F491591

General Info

Members Datasets Scaffolds Average Seq Length
1201 351 1201 173

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100209180|Ga0070707_1002091803
Length 191
Sequence MAVTRAEKEQELQDLTAAFGASDTAVLVDYKGLNVPQVTELRRQLRGAKANYKVVKNTLAKRASKGTKLASLEKHFEGTTAIAYTGGDAVALAKTLTTFMKNAPALKIKAAVLQGEAIQPAAVTDLASLPGKPELYAKLLFLLQAPMQQLVSVLAAAPRDLLSVLVQYEEKKKSEGAGAAEAAPTTAVGPA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
202 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
203 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
204 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
205 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
206 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
210 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
211 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
212 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
238 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
239 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
240 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
241 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
242 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
243 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
244 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
288 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
289 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
342 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
343 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
346 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
347 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
348 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
349 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.92
Metatranscriptomes 0.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.08
Nodule 0
Rhizoplane 3.25
Rhizosphere 96.5
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1405519 2162886007 Bacteria 2450
2 JGI24746J21847_1000233 3300001977 Bacteria 7648
3 JGI24750J21931_1061138 3300002070 Unclassified 603
4 JGI24745J21846_1004590 3300002073 Bacteria 1482
5 JGI24749J21850_1017645 3300002076 Bacteria 1005
6 JGI24751J29686_10002254 3300002459 Bacteria 3905
7 JGI25406J46586_10143235 3300003203 Bacteria 698
8 Ga0058859_11825990 3300004798 Bacteria 1339
9 Ga0065714_10095418 3300005288 Bacteria 1787
10 Ga0065704_10004364 3300005289 Bacteria 3418
11 Ga0065704_10419553 3300005289 Bacteria 733
12 Ga0065704_10616821 3300005289 Unclassified 599
13 Ga0065712_10075001 3300005290 Bacteria 3957
14 Ga0065712_10132359 3300005290 Bacteria 1534
15 Ga0065715_10001671 3300005293 Bacteria 6504
16 Ga0065715_10159327 3300005293 Bacteria 1635
17 Ga0065715_10383462 3300005293 Bacteria 904
18 Ga0065715_10618387 3300005293 Unclassified 694
19 Ga0065715_10804619 3300005293 Bacteria 608
20 Ga0065707_10002895 3300005295 Bacteria 5630
21 Ga0065707_10010077 3300005295 Bacteria 3167
22 Ga0065707_10029418 3300005295 Bacteria 922
23 Ga0065707_10231424 3300005295 Bacteria 1166
24 Ga0065707_10294973 3300005295 Bacteria 1004
25 Ga0070658_10542613 3300005327 Bacteria 1006
26 Ga0070676_10006877 3300005328 Bacteria 6091
27 Ga0070676_10015465 3300005328 Bacteria 4210
28 Ga0070676_10193432 3300005328 Bacteria 1329
29 Ga0070676_10598973 3300005328 Bacteria 795
30 Ga0070683_100197134 3300005329 Bacteria 1912
31 Ga0070683_100791651 3300005329 Bacteria 909
32 Ga0070690_100015535 3300005330 Bacteria 4545
33 Ga0070690_100085576 3300005330 Bacteria 2068
34 Ga0070690_100089907 3300005330 Bacteria 2020
35 Ga0070690_100146408 3300005330 Bacteria 1608
36 Ga0070690_100479799 3300005330 Bacteria 927
37 Ga0070690_100696579 3300005330 Unclassified 780
38 Ga0070670_100016953 3300005331 Bacteria 6253
39 Ga0070670_100028660 3300005331 Bacteria 4792
40 Ga0070670_100079968 3300005331 Bacteria 2809
41 Ga0070670_100315577 3300005331 Bacteria 1369
42 Ga0070670_100553054 3300005331 Bacteria 1027
43 Ga0070670_100998770 3300005331 Bacteria 761
44 Ga0070677_10003623 3300005333 Bacteria 4989
45 Ga0070677_10062602 3300005333 Bacteria 1539
46 Ga0070677_10117654 3300005333 Bacteria 1196
47 Ga0070677_10174643 3300005333 Bacteria 1019
48 Ga0070677_10201929 3300005333 Unclassified 960
49 Ga0068869_100011339 3300005334 Bacteria 5842
50 Ga0068869_100488052 3300005334 Unclassified 1027
51 Ga0068869_100937525 3300005334 Bacteria 751
52 Ga0070666_10006773 3300005335 Bacteria 7057
53 Ga0070666_10183699 3300005335 Bacteria 1467
54 Ga0070666_10193200 3300005335 Bacteria 1431
55 Ga0070680_101002920 3300005336 Unclassified 721
56 Ga0068868_100042747 3300005338 Bacteria 3538
57 Ga0068868_100132527 3300005338 Bacteria 2040
58 Ga0068868_100189330 3300005338 Bacteria 1711
59 Ga0068868_100275852 3300005338 Bacteria 1422
60 Ga0068868_100953395 3300005338 Unclassified 782
61 Ga0068868_100995453 3300005338 Bacteria 767
62 Ga0068868_100998284 3300005338 Bacteria 766
63 Ga0068868_101447236 3300005338 Bacteria 642
64 Ga0070660_100098453 3300005339 Bacteria 2315
65 Ga0070660_100752797 3300005339 Unclassified 818
66 Ga0070689_100041204 3300005340 Bacteria 3544
67 Ga0070689_100121980 3300005340 Bacteria 2082
68 Ga0070689_100178217 3300005340 Bacteria 1725
69 Ga0070689_100401803 3300005340 Bacteria 1158
70 Ga0070689_100726808 3300005340 Bacteria 869
71 Ga0070689_100818068 3300005340 Bacteria 820
72 Ga0070691_10093465 3300005341 Bacteria 1485
73 Ga0070687_100259548 3300005343 Bacteria 1083
74 Ga0070687_100377697 3300005343 Bacteria 922
75 Ga0070687_100568054 3300005343 Bacteria 774
76 Ga0070661_100368925 3300005344 Bacteria 1130
77 Ga0070661_100683959 3300005344 Bacteria 835
78 Ga0070692_10170042 3300005345 Bacteria 1256
79 Ga0070692_10311467 3300005345 Bacteria 965
80 Ga0070668_100060390 3300005347 Bacteria 2936
81 Ga0070668_100068984 3300005347 Bacteria 2749
82 Ga0070668_100141875 3300005347 Bacteria 1937
83 Ga0070668_100525744 3300005347 Bacteria 1027
84 Ga0070669_100014081 3300005353 Bacteria 5688
85 Ga0070669_100018135 3300005353 Bacteria 5028
86 Ga0070669_100084584 3300005353 Bacteria 2367
87 Ga0070669_100084879 3300005353 Bacteria 2364
88 Ga0070669_100156688 3300005353 Bacteria 1767
89 Ga0070669_100240981 3300005353 Bacteria 1437
90 Ga0070675_100029244 3300005354 Bacteria 4442
91 Ga0070675_100065146 3300005354 Bacteria 3012
92 Ga0070675_100073969 3300005354 Bacteria 2829
93 Ga0070675_100088869 3300005354 Bacteria 2586
94 Ga0070675_100118960 3300005354 Bacteria 2243
95 Ga0070675_100254613 3300005354 Bacteria 1537
96 Ga0070675_100290632 3300005354 Bacteria 1438
97 Ga0070675_100306811 3300005354 Bacteria 1399
98 Ga0070675_100636766 3300005354 Bacteria 968
99 Ga0070675_100755052 3300005354 Bacteria 888
100 Ga0070675_100785653 3300005354 Unclassified 870
101 Ga0070675_100850775 3300005354 Bacteria 835
102 Ga0070675_101017588 3300005354 Bacteria 761
103 Ga0070671_100013832 3300005355 Bacteria 6512
104 Ga0070671_100221070 3300005355 Bacteria 1607
105 Ga0070671_100234024 3300005355 Bacteria 1559
106 Ga0070671_100607051 3300005355 Bacteria 946
107 Ga0070671_100881926 3300005355 Bacteria 781
108 Ga0070671_101024521 3300005355 Bacteria 724
109 Ga0070674_100016181 3300005356 Bacteria 4675
110 Ga0070674_100062508 3300005356 Bacteria 2602
111 Ga0070674_100078028 3300005356 Bacteria 2359
112 Ga0070674_100245657 3300005356 Bacteria 1403
113 Ga0070674_100321880 3300005356 Bacteria 1240
114 Ga0070674_100545782 3300005356 Bacteria 972
115 Ga0070673_100085612 3300005364 Bacteria 2566
116 Ga0070673_100122237 3300005364 Bacteria 2174
117 Ga0070673_100135160 3300005364 Bacteria 2074
118 Ga0070673_100175915 3300005364 Bacteria 1829
119 Ga0070673_100321189 3300005364 Bacteria 1367
120 Ga0070673_100435250 3300005364 Bacteria 1178
121 Ga0070673_100597216 3300005364 Bacteria 1006
122 Ga0070673_100689047 3300005364 Bacteria 938
123 Ga0070673_100693254 3300005364 Unclassified 935
124 Ga0070673_100843865 3300005364 Unclassified 847
125 Ga0070673_101045179 3300005364 Archaea 762
126 Ga0070688_100048402 3300005365 Bacteria 2641
127 Ga0070688_100058832 3300005365 Bacteria 2421
128 Ga0070688_100452085 3300005365 Bacteria 961
129 Ga0070688_100486465 3300005365 Unclassified 928
130 Ga0070659_100341486 3300005366 Bacteria 1255
131 Ga0070667_100030091 3300005367 Bacteria 4528
132 Ga0070667_100227949 3300005367 Bacteria 1660
133 Ga0070667_100307873 3300005367 Bacteria 1427
134 Ga0070667_100352404 3300005367 Bacteria 1333
135 Ga0070667_101146719 3300005367 Bacteria 727
136 Ga0070703_10198559 3300005406 Unclassified 786
137 Ga0070701_10008026 3300005438 Bacteria 4540
138 Ga0070701_10059475 3300005438 Bacteria 2009
139 Ga0070701_10077997 3300005438 Bacteria 1786
140 Ga0070705_100008065 3300005440 Bacteria 5207
141 Ga0070705_100103582 3300005440 Bacteria 1802
142 Ga0070705_100235681 3300005440 Bacteria 1276
143 Ga0070705_100259048 3300005440 Bacteria 1225
144 Ga0070705_100481667 3300005440 Bacteria 938
145 Ga0070705_100492886 3300005440 Bacteria 928
146 Ga0070705_100495162 3300005440 Bacteria 927
147 Ga0070705_100554614 3300005440 Bacteria 882
148 Ga0070705_100960794 3300005440 Unclassified 691
149 Ga0070700_100054235 3300005441 Bacteria 2504
150 Ga0070700_100065653 3300005441 Bacteria 2301
151 Ga0070700_100071481 3300005441 Bacteria 2215
152 Ga0070700_100106333 3300005441 Bacteria 1857
153 Ga0070700_100189667 3300005441 Bacteria 1436
154 Ga0070700_100217821 3300005441 Bacteria 1351
155 Ga0070700_100304921 3300005441 Bacteria 1164
156 Ga0070700_100462836 3300005441 Bacteria 967
157 Ga0070700_100520406 3300005441 Bacteria 919
158 Ga0070694_100078396 3300005444 Bacteria 2291
159 Ga0070694_100154134 3300005444 Bacteria 1680
160 Ga0070694_100196914 3300005444 Bacteria 1500
161 Ga0070694_100342929 3300005444 Bacteria 1155
162 Ga0070663_100086667 3300005455 Bacteria 2313
163 Ga0070663_100096457 3300005455 Bacteria 2199
164 Ga0070663_100505775 3300005455 Bacteria 1004
165 Ga0070678_100021386 3300005456 Bacteria 4265
166 Ga0070678_100058558 3300005456 Bacteria 2828
167 Ga0070678_100149178 3300005456 Bacteria 1881
168 Ga0070678_100200741 3300005456 Bacteria 1646
169 Ga0070678_100215199 3300005456 Bacteria 1594
170 Ga0070678_100828156 3300005456 Bacteria 842
171 Ga0070662_100021077 3300005457 Bacteria 4446
172 Ga0070662_100032222 3300005457 Bacteria 3682
173 Ga0070662_100043294 3300005457 Bacteria 3220
174 Ga0070662_100102294 3300005457 Bacteria 2170
175 Ga0070662_100131259 3300005457 Bacteria 1932
176 Ga0070662_100620129 3300005457 Bacteria 911
177 Ga0070681_10165128 3300005458 Bacteria 2137
178 Ga0070681_10830312 3300005458 Bacteria 842
179 Ga0068867_100024756 3300005459 Bacteria 4302
180 Ga0068867_100033446 3300005459 Bacteria 3723
181 Ga0068867_100046871 3300005459 Bacteria 3176
182 Ga0068867_100057238 3300005459 Bacteria 2887
183 Ga0068867_100184810 3300005459 Bacteria 1659
184 Ga0068867_100492095 3300005459 Unclassified 1053
185 Ga0068867_100493275 3300005459 Bacteria 1051
186 Ga0068867_100847269 3300005459 Bacteria 819
187 Ga0068867_101302222 3300005459 Bacteria 671
188 Ga0070685_10020159 3300005466 Bacteria 3607
189 Ga0070685_10021547 3300005466 Bacteria 3503
190 Ga0070685_10048312 3300005466 Bacteria 2450
191 Ga0070685_10182320 3300005466 Bacteria 1353
192 Ga0070685_10326524 3300005466 Bacteria 1042
193 Ga0070685_10557527 3300005466 Bacteria 819
194 Ga0070685_10588926 3300005466 Unclassified 799
195 Ga0070706_100281275 3300005467 Bacteria 1553
196 Ga0070707_100078245 3300005468 Bacteria 3190
197 Ga0070707_100209180 3300005468 Bacteria 1901
198 Ga0070707_100767600 3300005468 Bacteria 927
199 Ga0070698_100031163 3300005471 Bacteria 5528
200 Ga0070698_100045728 3300005471 Bacteria 4479
201 Ga0070698_100061697 3300005471 Bacteria 3783
202 Ga0070698_100169372 3300005471 Bacteria 2125
203 Ga0070698_100618650 3300005471 Bacteria 1024
204 Ga0070699_100031970 3300005518 Bacteria 4544
205 Ga0070699_100039862 3300005518 Bacteria 4068
206 Ga0070699_100146585 3300005518 Bacteria 2086
207 Ga0070699_100166495 3300005518 Bacteria 1952
208 Ga0070699_100181003 3300005518 Bacteria 1870
209 Ga0070699_100251667 3300005518 Bacteria 1578
210 Ga0070699_100355707 3300005518 Bacteria 1320
211 Ga0070679_100186694 3300005530 Bacteria 2043
212 Ga0070684_100193474 3300005535 Bacteria 1851
213 Ga0070684_100949930 3300005535 Bacteria 806
214 Ga0070684_100985888 3300005535 Unclassified 791
215 Ga0070697_100064631 3300005536 Bacteria 2988
216 Ga0070697_100246218 3300005536 Bacteria 1528
217 Ga0070697_100333436 3300005536 Bacteria 1308
218 Ga0070697_100829331 3300005536 Bacteria 819
219 Ga0068853_101071691 3300005539 Unclassified 777
220 Ga0070672_100033331 3300005543 Bacteria 3899
221 Ga0070672_100068186 3300005543 Bacteria 2821
222 Ga0070672_100119072 3300005543 Bacteria 2159
223 Ga0070672_100139399 3300005543 Bacteria 1999
224 Ga0070672_100201644 3300005543 Bacteria 1664
225 Ga0070672_100204378 3300005543 Bacteria 1652
226 Ga0070672_100231232 3300005543 Bacteria 1553
227 Ga0070672_100493211 3300005543 Bacteria 1059
228 Ga0070686_100013157 3300005544 Bacteria 4727
229 Ga0070686_100054834 3300005544 Bacteria 2551
230 Ga0070686_100096258 3300005544 Bacteria 1990
231 Ga0070686_100274637 3300005544 Bacteria 1240
232 Ga0070686_100306960 3300005544 Bacteria 1179
233 Ga0070686_100316728 3300005544 Bacteria 1162
234 Ga0070686_100360571 3300005544 Bacteria 1095
235 Ga0070686_100406701 3300005544 Bacteria 1036
236 Ga0070686_101122869 3300005544 Bacteria 650
237 Ga0070695_100040059 3300005545 Bacteria 2964
238 Ga0070695_100334626 3300005545 Bacteria 1130
239 Ga0070695_100403820 3300005545 Bacteria 1037
240 Ga0070696_100091008 3300005546 Bacteria 2171
241 Ga0070696_100101101 3300005546 Bacteria 2066
242 Ga0070696_100109783 3300005546 Bacteria 1985
243 Ga0070696_100131283 3300005546 Bacteria 1823
244 Ga0070696_100188120 3300005546 Bacteria 1535
245 Ga0070696_100225264 3300005546 Bacteria 1408
246 Ga0070696_100280227 3300005546 Bacteria 1270
247 Ga0070696_100321519 3300005546 Bacteria 1191
248 Ga0070696_100502492 3300005546 Bacteria 965
249 Ga0070693_100316879 3300005547 Bacteria 1057
250 Ga0070693_100967339 3300005547 Bacteria 642
251 Ga0070665_100035708 3300005548 Bacteria 4999
252 Ga0070665_100043746 3300005548 Bacteria 4499
253 Ga0070665_100736223 3300005548 Bacteria 999
254 Ga0070665_100813998 3300005548 Unclassified 947
255 Ga0070704_100031727 3300005549 Bacteria 3557
256 Ga0070704_100032099 3300005549 Bacteria 3538
257 Ga0070704_100038836 3300005549 Bacteria 3264
258 Ga0070704_100085002 3300005549 Bacteria 2341
259 Ga0070704_100174582 3300005549 Bacteria 1713
260 Ga0070704_100593643 3300005549 Bacteria 972
261 Ga0068855_100566008 3300005563 Bacteria 1229
262 Ga0068855_101311308 3300005563 Bacteria 749
263 Ga0070664_100015545 3300005564 Bacteria 6227
264 Ga0070664_100048126 3300005564 Bacteria 3603
265 Ga0070664_100160735 3300005564 Bacteria 1987
266 Ga0070664_100245775 3300005564 Bacteria 1607
267 Ga0070664_100357995 3300005564 Bacteria 1329
268 Ga0070664_100615425 3300005564 Bacteria 1008
269 Ga0070664_100620706 3300005564 Unclassified 1003
270 Ga0070664_100622904 3300005564 Bacteria 1002
271 Ga0070664_100741094 3300005564 Bacteria 917
272 Ga0068857_100316136 3300005577 Bacteria 1441
273 Ga0068857_100462072 3300005577 Bacteria 1188
274 Ga0068857_100751845 3300005577 Unclassified 929
275 Ga0068854_100030421 3300005578 Bacteria 3745
276 Ga0068854_100517030 3300005578 Bacteria 1008
277 Ga0068854_100628444 3300005578 Bacteria 920
278 Ga0068856_100021502 3300005614 Bacteria 6269
279 Ga0068856_100553006 3300005614 Bacteria 1172
280 Ga0070702_100046299 3300005615 Bacteria 2465
281 Ga0070702_100076653 3300005615 Bacteria 1990
282 Ga0070702_100100416 3300005615 Bacteria 1774
283 Ga0068852_101273808 3300005616 Unclassified 757
284 Ga0068859_100028177 3300005617 Bacteria 5632
285 Ga0068859_100058170 3300005617 Bacteria 3894
286 Ga0068859_100081835 3300005617 Bacteria 3271
287 Ga0068859_100249479 3300005617 Bacteria 1865
288 Ga0068859_100257919 3300005617 Bacteria 1834
289 Ga0068859_100794714 3300005617 Unclassified 1034
290 Ga0068859_101324846 3300005617 Bacteria 794
291 Ga0068864_100021918 3300005618 Bacteria 5355
292 Ga0068864_100062599 3300005618 Bacteria 3224
293 Ga0068864_100064264 3300005618 Bacteria 3182
294 Ga0068864_100073731 3300005618 Bacteria 2976
295 Ga0068864_100122739 3300005618 Bacteria 2325
296 Ga0068864_100254709 3300005618 Bacteria 1631
297 Ga0068864_101062763 3300005618 Bacteria 805
298 Ga0068866_10036027 3300005718 Bacteria 2421
299 Ga0068866_10126863 3300005718 Bacteria 1445
300 Ga0068866_10162215 3300005718 Bacteria 1304
301 Ga0068866_10166314 3300005718 Bacteria 1291
302 Ga0068861_100018492 3300005719 Bacteria 4965
303 Ga0068861_100031215 3300005719 Bacteria 3912
304 Ga0068861_100037825 3300005719 Bacteria 3588
305 Ga0068861_100099899 3300005719 Bacteria 2305
306 Ga0068861_100248214 3300005719 Bacteria 1517
307 Ga0068861_100313089 3300005719 Bacteria 1364
308 Ga0068861_100428198 3300005719 Bacteria 1181
309 Ga0068861_100456738 3300005719 Bacteria 1146
310 Ga0068861_100566264 3300005719 Bacteria 1038
311 Ga0068861_101140504 3300005719 Unclassified 751
312 Ga0068870_10002825 3300005840 Bacteria 7306
313 Ga0068870_10019734 3300005840 Bacteria 3274
314 Ga0068870_10032447 3300005840 Bacteria 2655
315 Ga0068870_10056546 3300005840 Bacteria 2095
316 Ga0068870_10137441 3300005840 Bacteria 1426
317 Ga0068870_10195391 3300005840 Bacteria 1223
318 Ga0068863_100004974 3300005841 Bacteria 13101
319 Ga0068863_100099538 3300005841 Bacteria 2762
320 Ga0068863_100101783 3300005841 Bacteria 2731
321 Ga0068863_100206731 3300005841 Bacteria 1890
322 Ga0068863_100659973 3300005841 Bacteria 1038
323 Ga0068858_100055604 3300005842 Bacteria 3658
324 Ga0068858_100159964 3300005842 Bacteria 2120
325 Ga0068858_100181332 3300005842 Bacteria 1988
326 Ga0068858_100389209 3300005842 Bacteria 1338
327 Ga0068858_101016644 3300005842 Bacteria 812
328 Ga0068858_101357642 3300005842 Unclassified 700
329 Ga0068860_100110727 3300005843 Bacteria 2625
330 Ga0068860_100116036 3300005843 Bacteria 2561
331 Ga0068860_100465420 3300005843 Bacteria 1258
332 Ga0068860_100607193 3300005843 Bacteria 1100
333 Ga0068860_100676748 3300005843 Bacteria 1041
334 Ga0068862_100015325 3300005844 Bacteria 6366
335 Ga0068862_100019275 3300005844 Bacteria 5691
336 Ga0068862_100145087 3300005844 Bacteria 2109
337 Ga0068862_100158112 3300005844 Bacteria 2021
338 Ga0081539_10014366 3300005985 Bacteria 5863
339 Ga0081539_10014375 3300005985 Bacteria 5860
340 Ga0081539_10065894 3300005985 Bacteria 1965
341 Ga0075432_10044541 3300006058 Bacteria 1556
342 Ga0075432_10055895 3300006058 Bacteria 1399
343 Ga0070715_10101874 3300006163 Bacteria 1341
344 Ga0070715_10747122 3300006163 Bacteria 589
345 Ga0075367_10643360 3300006178 Bacteria 674
346 Ga0097621_100039048 3300006237 Bacteria 3811
347 Ga0097621_100099719 3300006237 Bacteria 2442
348 Ga0097621_100108636 3300006237 Bacteria 2342
349 Ga0097621_100151567 3300006237 Bacteria 1988
350 Ga0097621_100168154 3300006237 Bacteria 1888
351 Ga0097621_100263207 3300006237 Bacteria 1513
352 Ga0097621_100266755 3300006237 Bacteria 1503
353 Ga0097621_100281183 3300006237 Bacteria 1465
354 Ga0097621_100284461 3300006237 Bacteria 1456
355 Ga0097621_100472961 3300006237 Bacteria 1132
356 Ga0097621_100619227 3300006237 Bacteria 991
357 Ga0097621_100926191 3300006237 Unclassified 812
358 Ga0097621_101018777 3300006237 Bacteria 775
359 Ga0068871_100015630 3300006358 Bacteria 5688
360 Ga0068871_100033642 3300006358 Bacteria 4061
361 Ga0068871_100079899 3300006358 Bacteria 2707
362 Ga0068871_100104558 3300006358 Bacteria 2375
363 Ga0068871_100119842 3300006358 Bacteria 2222
364 Ga0068871_100239623 3300006358 Bacteria 1576
365 Ga0068871_100266459 3300006358 Bacteria 1496
366 Ga0068871_100375229 3300006358 Bacteria 1262
367 Ga0068871_100585057 3300006358 Bacteria 1014
368 Ga0068871_100699195 3300006358 Unclassified 929
369 Ga0075428_100062621 3300006844 Bacteria 4072
370 Ga0075428_100073818 3300006844 Bacteria 3726
371 Ga0075428_100125528 3300006844 Bacteria 2792
372 Ga0075428_100134234 3300006844 Bacteria 2691
373 Ga0075428_100237528 3300006844 Bacteria 1967
374 Ga0075428_101619160 3300006844 Bacteria 677
375 Ga0075430_100021035 3300006846 Bacteria 5546
376 Ga0075430_100037983 3300006846 Bacteria 4081
377 Ga0075430_100039958 3300006846 Bacteria 3971
378 Ga0075430_100165088 3300006846 Bacteria 1843
379 Ga0075430_100321973 3300006846 Bacteria 1278
380 Ga0075431_100038760 3300006847 Bacteria 4909
381 Ga0075431_100102783 3300006847 Bacteria 2949
382 Ga0075431_100202518 3300006847 Bacteria 2030
383 Ga0075431_100301296 3300006847 Bacteria 1619
384 Ga0075431_100442219 3300006847 Bacteria 1297
385 Ga0075431_100599455 3300006847 Bacteria 1086
386 Ga0075431_101119584 3300006847 Bacteria 752
387 Ga0075433_10042459 3300006852 Bacteria 3945
388 Ga0075433_10048382 3300006852 Bacteria 3697
389 Ga0075433_10137497 3300006852 Bacteria 2172
390 Ga0075433_10187506 3300006852 Bacteria 1840
391 Ga0075433_10233635 3300006852 Bacteria 1632
392 Ga0075433_10236050 3300006852 Bacteria 1623
393 Ga0075433_10494838 3300006852 Bacteria 1076
394 Ga0075434_100052306 3300006871 Bacteria 4058
395 Ga0075434_100075941 3300006871 Bacteria 3355
396 Ga0075434_100077985 3300006871 Bacteria 3308
397 Ga0075434_100129138 3300006871 Bacteria 2545
398 Ga0075434_100181407 3300006871 Bacteria 2125
399 Ga0075434_100249725 3300006871 Bacteria 1793
400 Ga0075434_100287006 3300006871 Bacteria 1665
401 Ga0075434_100428780 3300006871 Bacteria 1343
402 Ga0075434_101818066 3300006871 Bacteria 616
403 Ga0075429_100032192 3300006880 Bacteria 4557
404 Ga0075429_100039184 3300006880 Bacteria 4124
405 Ga0075429_100084571 3300006880 Bacteria 2765
406 Ga0075429_100196209 3300006880 Bacteria 1768
407 Ga0075429_100907933 3300006880 Unclassified 771
408 Ga0068865_100101972 3300006881 Bacteria 2102
409 Ga0068865_100125773 3300006881 Bacteria 1913
410 Ga0068865_100129198 3300006881 Bacteria 1891
411 Ga0068865_100167247 3300006881 Bacteria 1682
412 Ga0068865_100233430 3300006881 Bacteria 1444
413 Ga0068865_100535187 3300006881 Bacteria 982
414 Ga0075436_100069232 3300006914 Bacteria 2438
415 Ga0097620_100028177 3300006931 Bacteria 5632
416 Ga0097620_100058168 3300006931 Bacteria 3894
417 Ga0097620_100060741 3300006931 Bacteria 3808
418 Ga0097620_100081837 3300006931 Bacteria 3271
419 Ga0097620_100249481 3300006931 Bacteria 1865
420 Ga0097620_100257915 3300006931 Bacteria 1834
421 Ga0097620_100794916 3300006931 Unclassified 1034
422 Ga0097620_101324922 3300006931 Bacteria 794
423 Ga0075435_100048510 3300007076 Bacteria 3412
424 Ga0075435_100074231 3300007076 Bacteria 2781
425 Ga0075435_100153841 3300007076 Bacteria 1935
426 Ga0075435_100277488 3300007076 Bacteria 1430
427 Ga0075435_100292698 3300007076 Bacteria 1392
428 Ga0075435_100368059 3300007076 Bacteria 1234
429 Ga0075435_100537492 3300007076 Bacteria 1012
430 Ga0075435_100833909 3300007076 Bacteria 803
431 Ga0105240_10039744 3300009093 Bacteria 6021
432 Ga0105240_10836887 3300009093 Bacteria 994
433 Ga0105240_10960317 3300009093 Bacteria 916
434 Ga0111539_10006125 3300009094 Bacteria 15529
435 Ga0111539_10041243 3300009094 Bacteria 5550
436 Ga0111539_10070960 3300009094 Bacteria 4111
437 Ga0111539_10083713 3300009094 Bacteria 3751
438 Ga0111539_10086327 3300009094 Bacteria 3688
439 Ga0111539_10179168 3300009094 Bacteria 2476
440 Ga0111539_10491013 3300009094 Bacteria 1430
441 Ga0111539_10951130 3300009094 Bacteria 999
442 Ga0111539_10994790 3300009094 Bacteria 975
443 Ga0111539_11363322 3300009094 Bacteria 823
444 Ga0105245_10141649 3300009098 Bacteria 2265
445 Ga0105245_10168983 3300009098 Bacteria 2081
446 Ga0105245_10239696 3300009098 Bacteria 1757
447 Ga0105245_10449117 3300009098 Bacteria 1297
448 Ga0105245_10820342 3300009098 Unclassified 969
449 Ga0105245_10918213 3300009098 Bacteria 918
450 Ga0105247_10154422 3300009101 Bacteria 1515
451 Ga0114129_10057496 3300009147 Bacteria 5442
452 Ga0114129_10066608 3300009147 Bacteria 5023
453 Ga0114129_10076124 3300009147 Bacteria 4672
454 Ga0114129_10162762 3300009147 Bacteria 3046
455 Ga0114129_10244263 3300009147 Bacteria 2412
456 Ga0114129_10282496 3300009147 Bacteria 2217
457 Ga0114129_10349697 3300009147 Bacteria 1958
458 Ga0114129_10567454 3300009147 Bacteria 1474
459 Ga0114129_10582227 3300009147 Bacteria 1452
460 Ga0114129_10618614 3300009147 Bacteria 1401
461 Ga0114129_11763793 3300009147 Unclassified 754
462 Ga0105243_10043926 3300009148 Bacteria 3504
463 Ga0105243_10063738 3300009148 Bacteria 2954
464 Ga0105243_10074080 3300009148 Bacteria 2761
465 Ga0105243_10085132 3300009148 Bacteria 2590
466 Ga0105243_10168682 3300009148 Bacteria 1894
467 Ga0105243_10322453 3300009148 Bacteria 1408
468 Ga0105243_10487595 3300009148 Bacteria 1165
469 Ga0105243_11343580 3300009148 Bacteria 733
470 Ga0105243_11378700 3300009148 Bacteria 725
471 Ga0105241_11344686 3300009174 Bacteria 682
472 Ga0105242_10050864 3300009176 Bacteria 3375
473 Ga0105242_10080640 3300009176 Bacteria 2720
474 Ga0105242_10164471 3300009176 Bacteria 1945
475 Ga0105242_10193297 3300009176 Bacteria 1803
476 Ga0105242_10219200 3300009176 Bacteria 1699
477 Ga0105242_10428740 3300009176 Bacteria 1241
478 Ga0105242_10663574 3300009176 Bacteria 1016
479 Ga0105242_10899843 3300009176 Bacteria 885
480 Ga0105242_11278168 3300009176 Bacteria 756
481 Ga0105242_11367102 3300009176 Bacteria 734
482 Ga0105242_11450622 3300009176 Bacteria 715
483 Ga0105248_10061024 3300009177 Bacteria 4233
484 Ga0105248_10137242 3300009177 Bacteria 2759
485 Ga0105248_10241022 3300009177 Bacteria 2036
486 Ga0105248_10303600 3300009177 Bacteria 1797
487 Ga0105248_10378454 3300009177 Bacteria 1594
488 Ga0105248_10403957 3300009177 Bacteria 1538
489 Ga0105248_10580324 3300009177 Bacteria 1265
490 Ga0105248_10787181 3300009177 Bacteria 1073
491 Ga0105248_11572831 3300009177 Bacteria 745
492 Ga0105248_11575073 3300009177 Bacteria 744
493 Ga0105248_11660115 3300009177 Unclassified 724
494 Ga0105248_11961861 3300009177 Bacteria 665
495 Ga0105237_11133769 3300009545 Bacteria 789
496 Ga0105238_10408970 3300009551 Bacteria 1351
497 Ga0105249_10041597 3300009553 Bacteria 4178
498 Ga0105249_10045243 3300009553 Bacteria 4003
499 Ga0105249_10149458 3300009553 Bacteria 2247
500 Ga0105249_10219052 3300009553 Bacteria 1872
501 Ga0105249_10507076 3300009553 Bacteria 1252
502 Ga0105249_11138361 3300009553 Bacteria 851
503 Ga0105249_11159408 3300009553 Unclassified 843
504 Ga0105239_10518103 3300010375 Bacteria 1356
505 Ga0105246_10279635 3300011119 Bacteria 1338
506 Ga0157373_10583154 3300013100 Bacteria 813
507 Ga0157371_10552368 3300013102 Unclassified 854
508 Ga0157369_10199512 3300013105 Bacteria 2100
509 Ga0157374_10216423 3300013296 Bacteria 1879
510 Ga0157374_10699373 3300013296 Bacteria 1027
511 Ga0157374_11346949 3300013296 Bacteria 736
512 Ga0157374_11989689 3300013296 Bacteria 607
513 Ga0157378_10121184 3300013297 Bacteria 2411
514 Ga0157378_10427739 3300013297 Bacteria 1310
515 Ga0157378_10497666 3300013297 Bacteria 1217
516 Ga0163162_10050913 3300013306 Bacteria 4154
517 Ga0163162_10131850 3300013306 Bacteria 2608
518 Ga0163162_10692513 3300013306 Bacteria 1141
519 Ga0163162_10768392 3300013306 Bacteria 1082
520 Ga0163162_10854289 3300013306 Bacteria 1025
521 Ga0163162_11737494 3300013306 Bacteria 713
522 Ga0157375_10024596 3300013308 Bacteria 5577
523 Ga0157375_10156033 3300013308 Bacteria 2421
524 Ga0157375_10218957 3300013308 Bacteria 2062
525 Ga0157375_10272667 3300013308 Bacteria 1854
526 Ga0157375_10511424 3300013308 Bacteria 1365
527 Ga0157375_10544085 3300013308 Bacteria 1323
528 Ga0157375_12093949 3300013308 Unclassified 673
529 Ga0163163_10034316 3300014325 Bacteria 4912
530 Ga0163163_10106086 3300014325 Bacteria 2835
531 Ga0163163_10131576 3300014325 Bacteria 2542
532 Ga0163163_10245341 3300014325 Bacteria 1841
533 Ga0163163_11993622 3300014325 Unclassified 640
534 Ga0163163_12030560 3300014325 Bacteria 635
535 Ga0157380_10050583 3300014326 Bacteria 3283
536 Ga0157380_10090303 3300014326 Bacteria 2526
537 Ga0157380_10153614 3300014326 Bacteria 1993
538 Ga0157380_10223165 3300014326 Bacteria 1687
539 Ga0157380_10268081 3300014326 Bacteria 1555
540 Ga0157380_10283444 3300014326 Bacteria 1517
541 Ga0157380_10302550 3300014326 Bacteria 1474
542 Ga0157380_10515406 3300014326 Bacteria 1165
543 Ga0157380_10669123 3300014326 Bacteria 1038
544 Ga0157380_10760254 3300014326 Bacteria 982
545 Ga0157380_12099414 3300014326 Unclassified 628
546 Ga0157377_10039480 3300014745 Bacteria 2611
547 Ga0157377_10186071 3300014745 Bacteria 1309
548 Ga0157377_10523359 3300014745 Unclassified 833
549 Ga0157377_10820386 3300014745 Unclassified 688
550 Ga0157379_10127107 3300014968 Bacteria 2294
551 Ga0157379_10241009 3300014968 Bacteria 1640
552 Ga0157379_10249885 3300014968 Bacteria 1610
553 Ga0157379_10508177 3300014968 Bacteria 1117
554 Ga0157376_10159200 3300014969 Bacteria 2045
555 Ga0157376_10181165 3300014969 Bacteria 1926
556 Ga0157376_10191811 3300014969 Bacteria 1874
557 Ga0157376_10218237 3300014969 Bacteria 1765
558 Ga0157376_10388021 3300014969 Bacteria 1347
559 Ga0157376_10433824 3300014969 Bacteria 1278
560 Ga0163161_10021424 3300017792 Bacteria 4543
561 Ga0163161_10150890 3300017792 Bacteria 1766
562 Ga0207666_1016277 3300025271 Bacteria 1065
563 Ga0207673_1018101 3300025290 Bacteria 943
564 Ga0207697_10017447 3300025315 Bacteria 2950
565 Ga0207697_10047774 3300025315 Bacteria 1765
566 Ga0207653_10008996 3300025885 Bacteria 3117
567 Ga0207682_10003744 3300025893 Bacteria 6539
568 Ga0207682_10026915 3300025893 Bacteria 2288
569 Ga0207682_10048317 3300025893 Bacteria 1754
570 Ga0207682_10141295 3300025893 Bacteria 1080
571 Ga0207682_10196729 3300025893 Bacteria 926
572 Ga0207682_10213724 3300025893 Bacteria 890
573 Ga0207642_10036769 3300025899 Bacteria 2104
574 Ga0207642_10066780 3300025899 Bacteria 1695
575 Ga0207642_10171814 3300025899 Bacteria 1173
576 Ga0207642_10298597 3300025899 Bacteria 933
577 Ga0207642_10811831 3300025899 Bacteria 595
578 Ga0207688_10004034 3300025901 Bacteria 7996
579 Ga0207688_10098922 3300025901 Bacteria 1682
580 Ga0207688_10257291 3300025901 Bacteria 1059
581 Ga0207688_10324602 3300025901 Unclassified 945
582 Ga0207688_10458135 3300025901 Bacteria 796
583 Ga0207680_10030976 3300025903 Bacteria 3025
584 Ga0207680_10050441 3300025903 Bacteria 2483
585 Ga0207680_10378659 3300025903 Bacteria 997
586 Ga0207647_10256045 3300025904 Bacteria 1003
587 Ga0207645_10020173 3300025907 Bacteria 4364
588 Ga0207645_10024118 3300025907 Bacteria 3947
589 Ga0207645_10082868 3300025907 Bacteria 2056
590 Ga0207645_10103034 3300025907 Bacteria 1842
591 Ga0207645_10357207 3300025907 Bacteria 978
592 Ga0207645_10455144 3300025907 Bacteria 864
593 Ga0207643_10014738 3300025908 Bacteria 4251
594 Ga0207643_10017164 3300025908 Bacteria 3954
595 Ga0207643_10057380 3300025908 Bacteria 2216
596 Ga0207643_10075958 3300025908 Bacteria 1940
597 Ga0207643_10582824 3300025908 Bacteria 719
598 Ga0207654_10330709 3300025911 Bacteria 1044
599 Ga0207707_10973839 3300025912 Bacteria 697
600 Ga0207695_10235123 3300025913 Bacteria 1735
601 Ga0207695_10678960 3300025913 Bacteria 911
602 Ga0207660_10382723 3300025917 Bacteria 1131
603 Ga0207662_10012703 3300025918 Bacteria 4693
604 Ga0207662_10115019 3300025918 Bacteria 1681
605 Ga0207662_10178377 3300025918 Bacteria 1366
606 Ga0207662_10207618 3300025918 Bacteria 1270
607 Ga0207649_10060211 3300025920 Bacteria 2385
608 Ga0207649_10075290 3300025920 Bacteria 2169
609 Ga0207649_10689357 3300025920 Bacteria 792
610 Ga0207649_10796285 3300025920 Bacteria 737
611 Ga0207652_10119845 3300025921 Bacteria 2340
612 Ga0207646_10070333 3300025922 Bacteria 3125
613 Ga0207646_10096455 3300025922 Bacteria 2649
614 Ga0207646_10190999 3300025922 Bacteria 1850
615 Ga0207646_10348193 3300025922 Bacteria 1339
616 Ga0207646_10426919 3300025922 Bacteria 1196
617 Ga0207646_10506505 3300025922 Bacteria 1087
618 Ga0207681_10007716 3300025923 Bacteria 6588
619 Ga0207681_10050520 3300025923 Bacteria 2814
620 Ga0207681_10074974 3300025923 Bacteria 2371
621 Ga0207681_10079412 3300025923 Bacteria 2311
622 Ga0207681_10114511 3300025923 Bacteria 1967
623 Ga0207681_10433945 3300025923 Bacteria 1066
624 Ga0207681_11088163 3300025923 Unclassified 671
625 Ga0207694_10518352 3300025924 Bacteria 999
626 Ga0207650_10006980 3300025925 Bacteria 7701
627 Ga0207650_10024576 3300025925 Bacteria 4285
628 Ga0207650_10038113 3300025925 Bacteria 3507
629 Ga0207650_10143977 3300025925 Bacteria 1876
630 Ga0207650_10148309 3300025925 Bacteria 1849
631 Ga0207650_10369943 3300025925 Bacteria 1182
632 Ga0207650_10850472 3300025925 Bacteria 774
633 Ga0207650_11435229 3300025925 Bacteria 587
634 Ga0207659_10016029 3300025926 Bacteria 4869
635 Ga0207659_10030750 3300025926 Bacteria 3671
636 Ga0207659_10064457 3300025926 Bacteria 2652
637 Ga0207659_10089826 3300025926 Bacteria 2291
638 Ga0207659_10112531 3300025926 Bacteria 2072
639 Ga0207659_10177084 3300025926 Bacteria 1687
640 Ga0207659_10247199 3300025926 Bacteria 1446
641 Ga0207659_10369604 3300025926 Bacteria 1194
642 Ga0207659_10966621 3300025926 Unclassified 733
643 Ga0207659_10966717 3300025926 Unclassified 733
644 Ga0207687_10057682 3300025927 Bacteria 2729
645 Ga0207687_10119082 3300025927 Bacteria 1972
646 Ga0207687_10426226 3300025927 Bacteria 1096
647 Ga0207687_10635682 3300025927 Bacteria 902
648 Ga0207687_10696369 3300025927 Unclassified 862
649 Ga0207687_11214080 3300025927 Unclassified 648
650 Ga0207700_10285912 3300025928 Bacteria 1420
651 Ga0207644_10026058 3300025931 Bacteria 4025
652 Ga0207644_10074195 3300025931 Bacteria 2496
653 Ga0207644_10076123 3300025931 Bacteria 2468
654 Ga0207644_10102324 3300025931 Bacteria 2154
655 Ga0207644_10167225 3300025931 Bacteria 1714
656 Ga0207690_10287380 3300025932 Bacteria 1283
657 Ga0207690_10435987 3300025932 Bacteria 1051
658 Ga0207690_10650595 3300025932 Bacteria 864
659 Ga0207706_10010042 3300025933 Bacteria 8675
660 Ga0207706_10036777 3300025933 Bacteria 4348
661 Ga0207706_10036899 3300025933 Bacteria 4342
662 Ga0207706_10061580 3300025933 Bacteria 3305
663 Ga0207706_10062717 3300025933 Bacteria 3273
664 Ga0207706_10121543 3300025933 Bacteria 2296
665 Ga0207706_10228036 3300025933 Bacteria 1630
666 Ga0207706_10489910 3300025933 Bacteria 1062
667 Ga0207686_10026234 3300025934 Bacteria 3398
668 Ga0207686_10108841 3300025934 Bacteria 1865
669 Ga0207686_10264106 3300025934 Bacteria 1263
670 Ga0207686_10484917 3300025934 Bacteria 957
671 Ga0207686_10501873 3300025934 Unclassified 941
672 Ga0207686_10945471 3300025934 Unclassified 697
673 Ga0207686_10989106 3300025934 Bacteria 682
674 Ga0207709_10023935 3300025935 Bacteria 3481
675 Ga0207709_10039366 3300025935 Bacteria 2823
676 Ga0207709_10057765 3300025935 Bacteria 2408
677 Ga0207709_10130334 3300025935 Bacteria 1713
678 Ga0207709_10132471 3300025935 Bacteria 1701
679 Ga0207709_10148060 3300025935 Bacteria 1622
680 Ga0207709_10508548 3300025935 Bacteria 941
681 Ga0207709_10971649 3300025935 Bacteria 693
682 Ga0207670_10014679 3300025936 Bacteria 4657
683 Ga0207670_10161501 3300025936 Bacteria 1673
684 Ga0207670_10283384 3300025936 Bacteria 1292
685 Ga0207669_10058946 3300025937 Bacteria 2345
686 Ga0207669_10063702 3300025937 Bacteria 2277
687 Ga0207669_10097789 3300025937 Bacteria 1931
688 Ga0207669_10194758 3300025937 Bacteria 1465
689 Ga0207669_10289042 3300025937 Bacteria 1240
690 Ga0207669_10345826 3300025937 Bacteria 1147
691 Ga0207669_10567464 3300025937 Bacteria 918
692 Ga0207704_10003207 3300025938 Bacteria 7407
693 Ga0207704_10051287 3300025938 Bacteria 2494
694 Ga0207704_10052322 3300025938 Bacteria 2475
695 Ga0207704_10106614 3300025938 Bacteria 1883
696 Ga0207704_10170185 3300025938 Bacteria 1562
697 Ga0207704_10375689 3300025938 Bacteria 1114
698 Ga0207704_10433158 3300025938 Bacteria 1045
699 Ga0207704_10738776 3300025938 Bacteria 818
700 Ga0207691_10026550 3300025940 Bacteria 5433
701 Ga0207691_10055421 3300025940 Bacteria 3613
702 Ga0207691_10055497 3300025940 Bacteria 3610
703 Ga0207691_10097212 3300025940 Bacteria 2632
704 Ga0207691_10126513 3300025940 Bacteria 2261
705 Ga0207691_10154885 3300025940 Bacteria 2013
706 Ga0207691_10169112 3300025940 Bacteria 1915
707 Ga0207691_10222396 3300025940 Bacteria 1637
708 Ga0207691_10261739 3300025940 Bacteria 1491
709 Ga0207691_10310548 3300025940 Bacteria 1353
710 Ga0207711_10059356 3300025941 Bacteria 3294
711 Ga0207711_10075724 3300025941 Bacteria 2929
712 Ga0207711_10140160 3300025941 Bacteria 2175
713 Ga0207711_10159678 3300025941 Bacteria 2039
714 Ga0207711_10161010 3300025941 Bacteria 2031
715 Ga0207711_10513864 3300025941 Bacteria 1117
716 Ga0207711_10661297 3300025941 Bacteria 974
717 Ga0207711_10818466 3300025941 Unclassified 867
718 Ga0207711_10920943 3300025941 Bacteria 812
719 Ga0207711_11312748 3300025941 Bacteria 666
720 Ga0207689_10009264 3300025942 Bacteria 8513
721 Ga0207689_10047425 3300025942 Bacteria 3547
722 Ga0207689_10094969 3300025942 Bacteria 2449
723 Ga0207689_10146058 3300025942 Bacteria 1949
724 Ga0207689_10212101 3300025942 Bacteria 1600
725 Ga0207689_10260783 3300025942 Bacteria 1434
726 Ga0207689_10375736 3300025942 Bacteria 1183
727 Ga0207689_10519703 3300025942 Unclassified 998
728 Ga0207661_10489897 3300025944 Bacteria 1123
729 Ga0207661_10699776 3300025944 Bacteria 932
730 Ga0207679_10008656 3300025945 Bacteria 6488
731 Ga0207679_10036191 3300025945 Bacteria 3499
732 Ga0207679_10054268 3300025945 Bacteria 2949
733 Ga0207679_10152164 3300025945 Bacteria 1885
734 Ga0207679_10179978 3300025945 Bacteria 1748
735 Ga0207679_10521189 3300025945 Bacteria 1063
736 Ga0207679_10798854 3300025945 Bacteria 860
737 Ga0207667_10487744 3300025949 Bacteria 1251
738 Ga0207651_10133750 3300025960 Bacteria 1903
739 Ga0207651_10162838 3300025960 Bacteria 1750
740 Ga0207651_10258548 3300025960 Bacteria 1428
741 Ga0207651_10320096 3300025960 Bacteria 1296
742 Ga0207651_10340175 3300025960 Bacteria 1260
743 Ga0207651_10388416 3300025960 Bacteria 1184
744 Ga0207651_10609327 3300025960 Bacteria 955
745 Ga0207651_10678211 3300025960 Bacteria 906
746 Ga0207712_10009646 3300025961 Bacteria 6117
747 Ga0207712_10573842 3300025961 Unclassified 973
748 Ga0207668_10102148 3300025972 Bacteria 2133
749 Ga0207668_10143237 3300025972 Bacteria 1841
750 Ga0207668_10239079 3300025972 Bacteria 1468
751 Ga0207668_10606109 3300025972 Bacteria 954
752 Ga0207640_10021255 3300025981 Bacteria 3866
753 Ga0207640_10084796 3300025981 Bacteria 2176
754 Ga0207640_10369975 3300025981 Bacteria 1158
755 Ga0207640_10388618 3300025981 Bacteria 1133
756 Ga0207640_11544385 3300025981 Bacteria 597
757 Ga0207658_10047846 3300025986 Bacteria 3132
758 Ga0207658_10152996 3300025986 Bacteria 1882
759 Ga0207658_10159781 3300025986 Bacteria 1846
760 Ga0207658_10262525 3300025986 Bacteria 1472
761 Ga0207658_10884507 3300025986 Bacteria 813
762 Ga0207677_10040793 3300026023 Bacteria 3063
763 Ga0207677_10063437 3300026023 Bacteria 2569
764 Ga0207677_10075120 3300026023 Bacteria 2401
765 Ga0207677_10174657 3300026023 Bacteria 1684
766 Ga0207677_10191021 3300026023 Bacteria 1620
767 Ga0207677_10278414 3300026023 Bacteria 1372
768 Ga0207677_10340261 3300026023 Bacteria 1253
769 Ga0207677_10719785 3300026023 Unclassified 887
770 Ga0207703_10060003 3300026035 Bacteria 3108
771 Ga0207703_10118170 3300026035 Bacteria 2272
772 Ga0207703_10231248 3300026035 Bacteria 1657
773 Ga0207703_10476859 3300026035 Bacteria 1169
774 Ga0207703_10657915 3300026035 Bacteria 994
775 Ga0207703_11126634 3300026035 Bacteria 754
776 Ga0207639_10435676 3300026041 Bacteria 1187
777 Ga0207639_10461190 3300026041 Bacteria 1155
778 Ga0207678_10085630 3300026067 Bacteria 2694
779 Ga0207678_10097055 3300026067 Bacteria 2519
780 Ga0207678_10460392 3300026067 Bacteria 1106
781 Ga0207708_10035399 3300026075 Bacteria 3800
782 Ga0207708_10051640 3300026075 Bacteria 3131
783 Ga0207708_10088483 3300026075 Bacteria 2386
784 Ga0207708_10090858 3300026075 Bacteria 2354
785 Ga0207708_10105780 3300026075 Bacteria 2181
786 Ga0207708_10144850 3300026075 Bacteria 1866
787 Ga0207708_10150618 3300026075 Bacteria 1831
788 Ga0207708_10210731 3300026075 Bacteria 1553
789 Ga0207708_10246399 3300026075 Bacteria 1439
790 Ga0207708_10767264 3300026075 Bacteria 828
791 Ga0207708_10816388 3300026075 Bacteria 804
792 Ga0207702_11566291 3300026078 Unclassified 652
793 Ga0207641_10055300 3300026088 Bacteria 3369
794 Ga0207641_10201047 3300026088 Bacteria 1837
795 Ga0207641_10269221 3300026088 Bacteria 1598
796 Ga0207641_10281969 3300026088 Bacteria 1563
797 Ga0207641_10694817 3300026088 Bacteria 1001
798 Ga0207641_11325854 3300026088 Bacteria 720
799 Ga0207648_10035637 3300026089 Bacteria 4384
800 Ga0207648_10056796 3300026089 Bacteria 3415
801 Ga0207648_10108973 3300026089 Bacteria 2431
802 Ga0207648_10115354 3300026089 Bacteria 2360
803 Ga0207648_10305297 3300026089 Bacteria 1428
804 Ga0207648_10333949 3300026089 Bacteria 1364
805 Ga0207676_10008606 3300026095 Bacteria 7251
806 Ga0207676_10024598 3300026095 Bacteria 4458
807 Ga0207676_10090307 3300026095 Bacteria 2513
808 Ga0207676_10710741 3300026095 Bacteria 974
809 Ga0207676_11093644 3300026095 Bacteria 788
810 Ga0207674_10133598 3300026116 Bacteria 2444
811 Ga0207674_10140233 3300026116 Bacteria 2377
812 Ga0207674_10153948 3300026116 Bacteria 2255
813 Ga0207674_10217244 3300026116 Bacteria 1860
814 Ga0207674_10274896 3300026116 Bacteria 1632
815 Ga0207675_100031657 3300026118 Bacteria 4928
816 Ga0207675_100037707 3300026118 Bacteria 4509
817 Ga0207675_100040332 3300026118 Bacteria 4360
818 Ga0207675_100134337 3300026118 Bacteria 2346
819 Ga0207675_100209785 3300026118 Bacteria 1873
820 Ga0207675_100234171 3300026118 Bacteria 1773
821 Ga0207675_100839990 3300026118 Bacteria 933
822 Ga0207675_101470090 3300026118 Bacteria 702
823 Ga0207683_10041648 3300026121 Bacteria 4011
824 Ga0207683_10062914 3300026121 Bacteria 3269
825 Ga0207683_10065633 3300026121 Bacteria 3200
826 Ga0207683_10079749 3300026121 Bacteria 2903
827 Ga0207683_10370008 3300026121 Bacteria 1317
828 Ga0207683_10434710 3300026121 Bacteria 1209
829 Ga0207683_10634433 3300026121 Bacteria 989
830 Ga0207698_10705478 3300026142 Bacteria 1004
831 Ga0207698_11660369 3300026142 Bacteria 654
832 Ga0209984_1013870 3300027424 Bacteria 1060
833 Ga0209999_1033273 3300027543 Unclassified 959
834 Ga0209970_1047250 3300027614 Unclassified 774
835 Ga0209971_1007890 3300027682 Bacteria 2525
836 Ga0209971_1025261 3300027682 Bacteria 1419
837 Ga0207428_10002947 3300027907 Bacteria 16839
838 Ga0207428_10004000 3300027907 Bacteria 14150
839 Ga0207428_10006178 3300027907 Bacteria 11067
840 Ga0207428_10021152 3300027907 Bacteria 5510
841 Ga0207428_10032350 3300027907 Bacteria 4302
842 Ga0207428_10062710 3300027907 Bacteria 2939
843 Ga0268266_10055880 3300028379 Bacteria 3394
844 Ga0268266_10152149 3300028379 Bacteria 2086
845 Ga0268266_11366328 3300028379 Bacteria 684
846 Ga0268265_10000421 3300028380 Bacteria 45504
847 Ga0268265_10043970 3300028380 Bacteria 3323
848 Ga0268265_10104877 3300028380 Bacteria 2292
849 Ga0268265_10188525 3300028380 Bacteria 1779
850 Ga0268265_10375437 3300028380 Bacteria 1306
851 Ga0268264_10053362 3300028381 Bacteria 3372
852 Ga0268264_10213917 3300028381 Bacteria 1771
853 Ga0268264_10250663 3300028381 Bacteria 1645
854 Ga0268264_10736682 3300028381 Bacteria 981
855 Ga0268264_10743198 3300028381 Bacteria 977
856 Ga0268264_10895340 3300028381 Unclassified 890
857 Ga0268264_10951342 3300028381 Bacteria 864
858 Ga0307408_100160457 3300031548 Bacteria 1785
859 Ga0307408_101534403 3300031548 Bacteria 631
860 Ga0307405_10246686 3300031731 Bacteria 1326
861 Ga0307405_10944152 3300031731 Unclassified 732
862 Ga0307413_10035015 3300031824 Bacteria 2876
863 Ga0307410_10014184 3300031852 Bacteria 4679
864 Ga0307410_10501784 3300031852 Bacteria 998
865 Ga0307406_10213400 3300031901 Bacteria 1429
866 Ga0307407_10006748 3300031903 Bacteria 5136
867 Ga0307407_10452123 3300031903 Bacteria 932
868 Ga0307412_10561916 3300031911 Bacteria 960
869 Ga0307409_100008285 3300031995 Bacteria 6297
870 Ga0307409_100032545 3300031995 Bacteria 3782
871 Ga0307409_100342666 3300031995 Bacteria 1407
872 Ga0307409_100818607 3300031995 Bacteria 940
873 Ga0307409_101230032 3300031995 Bacteria 773
874 Ga0307416_100009329 3300032002 Bacteria 6416
875 Ga0307416_100071517 3300032002 Bacteria 2882
876 Ga0307416_100196288 3300032002 Bacteria 1910
877 Ga0307414_10031493 3300032004 Bacteria 3480
878 Ga0307414_10655971 3300032004 Bacteria 946
879 Ga0307414_10976457 3300032004 Bacteria 779
880 Ga0307414_11193821 3300032004 Bacteria 704
881 Ga0307411_10036028 3300032005 Bacteria 3096
882 Ga0307411_10060259 3300032005 Bacteria 2519
883 Ga0307411_10072865 3300032005 Bacteria 2334
884 Ga0307415_100017833 3300032126 Bacteria 4267
885 Ga0373930_0005072 3300034816 Bacteria 2172
886 Ga0373948_0001160 3300034817 Bacteria 3569
887 Ga0373950_0002587 3300034818 Bacteria 2504
888 Ga0373958_0012058 3300034819 Bacteria 1473
889 Ga0373958_0086321 3300034819 Unclassified 718
890 Ga0373959_0005588 3300034820 Bacteria 2064
891 Ga0373938_0000588 3300034957 Bacteria 5871
892 Ga0373938_0020269 3300034957 Bacteria 1338
893 Ga0373928_0007331 3300035084 Bacteria 2126
894 Ga0373929_0000498 3300035085 Bacteria 7492
895 Ga0373940_0001234 3300035088 Bacteria 4527
896 Ga0373940_0121073 3300035088 Unclassified 812
897 Ga0373944_0010372 3300035089 Bacteria 2539
898 Ga0373949_0001772 3300035090 Bacteria 5943
899 Ga0373951_0000520 3300035091 Bacteria 10956
900 Ga0373952_0010237 3300035092 Bacteria 1809
901 Ga0373932_0000492 3300035112 Bacteria 12172
902 Ga0373932_0004171 3300035112 Bacteria 3435
903 Ga0373939_0000428 3300035114 Bacteria 10567
904 Ga0373939_0028793 3300035114 Bacteria 1584
905 Ga0373941_0000851 3300035115 Bacteria 6291
906 Ga0373945_0372323 3300035116 Bacteria 622
907 Ga0373953_0101214 3300035117 Bacteria 1213
908 Ga0373954_0066995 3300035118 Bacteria 1701
909 Ga0373956_0278967 3300035119 Bacteria 795
910 Ga0373956_0415997 3300035119 Unclassified 641
911 Ga0373957_0254497 3300035120 Bacteria 739
912 Ga0373960_0000207 3300035121 Bacteria 10770
913 Ga0373943_0165157 3300035170 Bacteria 1208
914 Ga0373943_0347878 3300035170 Bacteria 849
915 Ga0373946_0279922 3300035171 Bacteria 820
916 Ga0373942_0001108 3300035207 Bacteria 7173
917 Ga0373961_0006147 3300035241 Bacteria 2885
918 Ga0373961_0037722 3300035241 Bacteria 1382
919 Ga0373962_0003292 3300035242 Bacteria 3884
920 Ga0373924_0519466 3300035410 Bacteria 535
921 Ga0373935_0295996 3300035692 Bacteria 1143
922 Ga0373935_0584524 3300035692 Bacteria 816
923 Ga0373927_0257328 3300035695 Bacteria 1148
924 Ga0373927_0328349 3300035695 Unclassified 1008
925 Ga0373933_0234889 3300035724 Bacteria 1178
926 Ga0373933_0366814 3300035724 Bacteria 937
927 Ga0373947_0056371 3300035725 Bacteria 2375
928 Ga0373947_0079670 3300035725 Bacteria 2025
929 Ga0373947_0511932 3300035725 Bacteria 816
930 Ga0373947_0580678 3300035725 Bacteria 763
931 Ga0373937_0054898 3300036401 Bacteria 3656
932 Ga0373937_0165129 3300036401 Bacteria 2076
933 Ga0373937_0588140 3300036401 Bacteria 1057
934 Ga0373937_0700547 3300036401 Bacteria 959
935 Ga0373937_1517793 3300036401 Bacteria 617
936 Ga0373925_0285032 3300037068 Bacteria 1331
937 Ga0373925_0292058 3300037068 Bacteria 1315
938 Ga0373925_0802719 3300037068 Viruses 776
939 Ga0451787_491067 3300041441 Bacteria 842
940 Ga0451853_3921483 3300041512 Unclassified 817
941 Ga0439450_017840 3300042008 Bacteria 1485
942 Ga0439450_157887 3300042008 Unclassified 597
943 Ga0439462_0026415 3300042015 Bacteria 1531
944 Ga0450917_006069 3300042120 Bacteria 906
945 Ga0450923_061185 3300042125 Bacteria 822
946 Ga0439458_0145211 3300042157 Bacteria 634
947 Ga0450908_023391 3300042184 Bacteria 1081
948 Ga0450908_063659 3300042184 Unclassified 650
949 Ga0439435_0123479 3300042436 Bacteria 813
950 Ga0439464_0037869 3300042439 Bacteria 1369
951 Ga0439464_0044240 3300042439 Bacteria 1275
952 Ga0439464_0084481 3300042439 Bacteria 951
953 Ga0451577_0043558 3300042876 Bacteria 4020
954 Ga0451577_0181234 3300042876 Bacteria 1899
955 Ga0451577_0616198 3300042876 Bacteria 985
956 Ga0439440_0012863 3300042993 Bacteria 1786
957 Ga0439440_0218575 3300042993 Unclassified 571
958 Ga0453683_0514083 3300044673 Unclassified 778
959 Ga0453684_0276901 3300044712 Bacteria 1915
960 Ga0453684_0906086 3300044712 Bacteria 944
961 Ga0451576_0009891 3300045051 Bacteria 11016
962 Ga0451576_0026098 3300045051 Bacteria 6285
963 Ga0451576_0150236 3300045051 Bacteria 2429
964 Ga0451576_0247364 3300045051 Bacteria 1863
965 Ga0451576_0566478 3300045051 Bacteria 1193
966 Ga0451576_0640522 3300045051 Bacteria 1117
967 Ga0451576_0725146 3300045051 Bacteria 1044
968 Ga0451576_0840338 3300045051 Bacteria 964
969 Ga0451576_1226148 3300045051 Unclassified 783
970 Ga0495603_0055590 3300046455 Bacteria 2345
971 Ga0495603_0058776 3300046455 Bacteria 2273
972 Ga0495603_0172406 3300046455 Bacteria 1253
973 Ga0495629_0004499 3300046459 Bacteria 10433
974 Ga0495629_0404886 3300046459 Bacteria 927
975 Ga0495629_0732471 3300046459 Bacteria 655
976 Ga0495639_0225703 3300046475 Unclassified 922
977 Ga0495639_0243038 3300046475 Bacteria 889
978 Ga0495584_0021886 3300046491 Bacteria 3246
979 Ga0495594_0005564 3300046499 Bacteria 6471
980 Ga0495594_0319657 3300046499 Bacteria 884
981 Ga0495608_0113728 3300046511 Bacteria 1739
982 Ga0495608_0249982 3300046511 Bacteria 1106
983 Ga0495618_0327546 3300046514 Unclassified 948
984 Ga0495628_0388572 3300046516 Bacteria 1021
985 Ga0495628_0935543 3300046516 Unclassified 600
986 Ga0495630_0414449 3300046517 Bacteria 1032
987 Ga0495630_0454208 3300046517 Bacteria 982
988 Ga0495643_0073682 3300046522 Bacteria 1789
989 Ga0495642_0008050 3300046528 Bacteria 4032
990 Ga0495642_0278405 3300046528 Unclassified 732
991 Ga0495665_0191119 3300046531 Bacteria 1062
992 Ga0495586_0297152 3300046535 Bacteria 925
993 Ga0495598_0013868 3300046537 Bacteria 2007
994 Ga0495609_0214396 3300046538 Unclassified 801
995 Ga0495609_0278334 3300046538 Bacteria 685
996 Ga0495621_0008884 3300046539 Bacteria 3029
997 Ga0495621_0017635 3300046539 Bacteria 2310
998 Ga0495621_0029709 3300046539 Bacteria 1864
999 Ga0495621_0043775 3300046539 Bacteria 1580
1000 Ga0495645_0511851 3300046543 Unclassified 749
1001 Ga0495622_0242888 3300046557 Bacteria 793
1002 Ga0495633_0040363 3300046558 Bacteria 2224
1003 Ga0495667_0216933 3300046559 Bacteria 1222
1004 Ga0495656_0137750 3300046615 Bacteria 1168
1005 Ga0495634_0190853 3300046642 Bacteria 1278
1006 Ga0495635_0381830 3300046663 Bacteria 937
1007 Ga0495659_0007506 3300046664 Bacteria 3460
1008 Ga0495659_0090054 3300046664 Bacteria 1176
1009 Ga0495659_0132472 3300046664 Bacteria 989
1010 Ga0495659_0182820 3300046664 Bacteria 854
1011 Ga0495588_0170164 3300046674 Bacteria 1152
1012 Ga0495647_0064387 3300046681 Bacteria 1454
1013 Ga0495658_0145503 3300046683 Bacteria 1452
1014 Ga0495658_0205762 3300046683 Bacteria 1228
1015 Ga0495658_0282072 3300046683 Bacteria 1048
1016 Ga0495658_0380160 3300046683 Bacteria 899
1017 Ga0495669_0089369 3300046684 Bacteria 1421
1018 Ga0495669_0498793 3300046684 Bacteria 592
1019 Ga0495613_0121783 3300046689 Bacteria 1873
1020 Ga0495624_0127686 3300046690 Bacteria 1560
1021 Ga0495670_0115442 3300046691 Bacteria 1392
1022 Ga0495600_0458756 3300046809 Bacteria 787
1023 Ga0495581_0288202 3300047315 Unclassified 960
1024 Ga0495581_0588628 3300047315 Unclassified 645
1025 Ga0495604_0171370 3300047317 Bacteria 1526
1026 Ga0495604_0481595 3300047317 Bacteria 807
1027 Ga0495636_0222412 3300047318 Bacteria 867
1028 Ga0495674_0649746 3300047319 Unclassified 832
1029 Ga0495676_0005608 3300047321 Bacteria 11508
1030 Ga0495676_0383087 3300047321 Bacteria 935
1031 Ga0495680_0390062 3300047322 Bacteria 963
1032 Ga0495675_0123218 3300047444 Bacteria 1614
1033 Ga0495685_067110 3300047447 Bacteria 1204
1034 Ga0495685_090389 3300047447 Bacteria 1015
1035 Ga0495684_0673273 3300047471 Bacteria 689
1036 Ga0496100_0361537 3300048903 Bacteria 1098
1037 Ga0496101_0005336 3300048904 Bacteria 8188
1038 Ga0496101_0111219 3300048904 Bacteria 2062
1039 Ga0496102_0374930 3300048905 Bacteria 1339
1040 Ga0496102_0489692 3300048905 Bacteria 1151
1041 Ga0496103_0184031 3300048906 Bacteria 1343
1042 Ga0496103_0337010 3300048906 Bacteria 970
1043 Ga0496103_0485797 3300048906 Unclassified 791
1044 Ga0496104_0051204 3300048907 Bacteria 3897
1045 Ga0496104_0116569 3300048907 Bacteria 2563
1046 Ga0496104_0237772 3300048907 Bacteria 1733
1047 Ga0496104_0387772 3300048907 Bacteria 1309
1048 Ga0496104_0729195 3300048907 Bacteria 898
1049 Ga0496105_0108637 3300048908 Bacteria 2290
1050 Ga0496105_0208594 3300048908 Bacteria 1593
1051 Ga0496105_0488986 3300048908 Bacteria 967
1052 Ga0496106_0227184 3300048909 Bacteria 1489
1053 Ga0496106_0310531 3300048909 Bacteria 1265
1054 Ga0496106_0433627 3300048909 Bacteria 1056
1055 Ga0496107_0163707 3300048910 Bacteria 1649
1056 Ga0496107_0167351 3300048910 Bacteria 1630
1057 Ga0496108_0007055 3300048911 Bacteria 9097
1058 Ga0496108_0132493 3300048911 Bacteria 2142
1059 Ga0496108_0265177 3300048911 Bacteria 1495
1060 Ga0496109_0040920 3300048912 Bacteria 4198
1061 Ga0496109_0069195 3300048912 Bacteria 3237
1062 Ga0496109_0141590 3300048912 Bacteria 2249
1063 Ga0496109_0686651 3300048912 Bacteria 961
1064 Ga0496110_0054227 3300048913 Bacteria 3526
1065 Ga0496110_0305351 3300048913 Bacteria 1449
1066 Ga0496110_0464145 3300048913 Bacteria 1154
1067 Ga0496111_0145684 3300048914 Bacteria 1756
1068 Ga0496112_1027148 3300048915 Bacteria 744
1069 Ga0496114_0000494 3300048917 Bacteria 28861
1070 Ga0496114_0618215 3300048917 Bacteria 954
1071 Ga0496114_0747775 3300048917 Bacteria 855
1072 Ga0496114_0812153 3300048917 Bacteria 814
1073 Ga0496114_0979156 3300048917 Unclassified 728
1074 Ga0501298_066353 3300049521 Bacteria 772
1075 Ga0501031_0231123 3300049568 Bacteria 1203
1076 Ga0501032_0126259 3300049569 Bacteria 1690
1077 Ga0501033_0483760 3300049570 Bacteria 857
1078 Ga0501036_0032096 3300049572 Bacteria 4437
1079 Ga0501036_0115191 3300049572 Bacteria 2271
1080 Ga0501037_0168931 3300049573 Bacteria 1556
1081 Ga0501038_0206105 3300049574 Bacteria 1576
1082 Ga0501038_0787862 3300049574 Unclassified 707
1083 Ga0501039_0035361 3300049575 Bacteria 3855
1084 Ga0501040_0013689 3300049576 Bacteria 5335
1085 Ga0501041_0021990 3300049577 Bacteria 3819
1086 Ga0501042_0026644 3300049578 Bacteria 4061
1087 Ga0501042_0077986 3300049578 Bacteria 2372
1088 Ga0501042_0171864 3300049578 Bacteria 1564
1089 Ga0501042_0460731 3300049578 Bacteria 922
1090 Ga0501042_0588885 3300049578 Bacteria 809
1091 Ga0501043_0128567 3300049579 Bacteria 1986
1092 Ga0501046_0002275 3300049580 Bacteria 18106
1093 Ga0501047_0664613 3300049581 Bacteria 861
1094 Ga0501067_0295415 3300049583 Bacteria 902
1095 Ga0501069_0159849 3300049585 Bacteria 1297
1096 Ga0501071_0018416 3300049587 Bacteria 4834
1097 Ga0501071_0764579 3300049587 Bacteria 744
1098 Ga0501072_0048999 3300049588 Bacteria 3325
1099 Ga0501072_0267096 3300049588 Bacteria 1361
1100 Ga0501072_0987689 3300049588 Bacteria 656
1101 Ga0501074_0267840 3300049590 Bacteria 1214
1102 Ga0501075_0001529 3300049591 Bacteria 15085
1103 Ga0501075_0195322 3300049591 Bacteria 1543
1104 Ga0501075_0219842 3300049591 Bacteria 1449
1105 Ga0501076_0002067 3300049592 Bacteria 13745
1106 Ga0501076_0036837 3300049592 Bacteria 3835
1107 Ga0501076_0263993 3300049592 Bacteria 1410
1108 Ga0501077_0050019 3300049593 Bacteria 2657
1109 Ga0501077_0050775 3300049593 Bacteria 2636
1110 Ga0501079_0086368 3300049741 Bacteria 2428
1111 Ga0501079_0458034 3300049741 Bacteria 1002
1112 Ga0501080_0442591 3300049742 Bacteria 1166
1113 Ga0501081_0061259 3300049743 Bacteria 2609
1114 Ga0501081_0102183 3300049743 Bacteria 2027
1115 Ga0501081_0366811 3300049743 Bacteria 1063
1116 Ga0501035_0401220 3300049822 Bacteria 1141
1117 Ga0501035_1236770 3300049822 Unclassified 578
1118 Ga0501045_0008126 3300049824 Bacteria 7308
1119 Ga0501045_0096171 3300049824 Bacteria 2191
1120 Ga0501045_0478866 3300049824 Bacteria 925
1121 nmdc:mga05p37_103285_c1 3300050507 Bacteria 3509
1122 nmdc:mga05p37_105964_c1 3300050507 Bacteria 3458
1123 nmdc:mga05p37_117437_c1 3300050507 Bacteria 3269
1124 nmdc:mga05p37_24767_c1 3300050507 Bacteria 7295
1125 nmdc:mga05p37_34071_c1 3300050507 Bacteria 6238
1126 nmdc:mga05p37_485900_c1 3300050507 Bacteria 1421
1127 nmdc:mga05p37_514956_c1 3300050507 Bacteria 1370
1128 nmdc:mga05p37_520289_c1 3300050507 Bacteria 1361
1129 nmdc:mga05p37_59927_c1 3300050507 Bacteria 4687
1130 nmdc:mga05p37_68961_c1 3300050507 Bacteria 4349
1131 nmdc:mga05p37_8028_c1 3300050507 Bacteria 12461
1132 nmdc:mga05p37_89187_c1 3300050507 Bacteria 3800
1133 nmdc:mga09592_216693_c1 3300050508 Bacteria 1659
1134 nmdc:mga09592_22043_c1 3300050508 Bacteria 5256
1135 nmdc:mga09592_424690_c1 3300050508 Bacteria 1148
1136 nmdc:mga09592_43595_c1 3300050508 Bacteria 3775
1137 nmdc:mga0qj67_1151_c1 3300050509 Bacteria 18319
1138 nmdc:mga0qj67_175518_c1 3300050509 Bacteria 1740
1139 nmdc:mga0qj67_28025_c1 3300050509 Bacteria 4371
1140 nmdc:mga0qj67_412167_c1 3300050509 Bacteria 1090
1141 nmdc:mga0qj67_57581_c1 3300050509 Bacteria 3081
1142 nmdc:mga0qj67_8359_c1 3300050509 Bacteria 7673
1143 nmdc:mga06r32_140362_c1 3300050510 Bacteria 2392
1144 nmdc:mga06r32_172732_c1 3300050510 Bacteria 2146
1145 nmdc:mga06r32_33135_c1 3300050510 Bacteria 4865
1146 nmdc:mga06r32_518466_c1 3300050510 Bacteria 1168
1147 nmdc:mga06r32_6659_c1 3300050510 Bacteria 10384
1148 nmdc:mga08y16_114159_c1 3300050511 Bacteria 2812
1149 nmdc:mga08y16_33537_c1 3300050511 Bacteria 5392
1150 nmdc:mga08y16_33677_c1 3300050511 Bacteria 5380
1151 nmdc:mga08y16_374734_c1 3300050511 Bacteria 1460
1152 nmdc:mga08y16_43775_c1 3300050511 Bacteria 4692
1153 nmdc:mga08y16_743750_c1 3300050511 Bacteria 977
1154 nmdc:mga08y16_822795_c1 3300050511 Bacteria 920
1155 nmdc:mga08y16_8354_c1 3300050511 Bacteria 10833
1156 nmdc:mga0n895_11385_c1 3300050512 Bacteria 7934
1157 nmdc:mga0n895_1582049_c1 3300050512 Unclassified 620
1158 nmdc:mga0n895_159377_c1 3300050512 Bacteria 2288
1159 nmdc:mga0n895_247113_c1 3300050512 Bacteria 1811
1160 nmdc:mga0n895_278704_c1 3300050512 Bacteria 1696
1161 nmdc:mga0n895_28020_c1 3300050512 Bacteria 5356
1162 nmdc:mga0n895_297667_c1 3300050512 Bacteria 1636
1163 nmdc:mga0n895_45910_c1 3300050512 Bacteria 4266
1164 nmdc:mga0n895_466074_c1 3300050512 Bacteria 1275
1165 nmdc:mga0n895_487206_c1 3300050512 Bacteria 1243
1166 nmdc:mga0rr50_175_c1 3300050513 Bacteria 34417
1167 nmdc:mga0rr50_448504_c1 3300050513 Bacteria 1094
1168 nmdc:mga0rr50_458783_c1 3300050513 Bacteria 1081
1169 nmdc:mga0rr50_57862_c1 3300050513 Bacteria 2902
1170 nmdc:mga0rr50_583938_c1 3300050513 Bacteria 952
1171 nmdc:mga0rr50_588813_c1 3300050513 Bacteria 948
1172 nmdc:mga08x19_85997_c1 3300050514 Bacteria 2070
1173 nmdc:mga0a205_13563_c1 3300050515 Bacteria 7592
1174 nmdc:mga0a205_13804_c1 3300050515 Bacteria 7529
1175 nmdc:mga0a205_199648_c1 3300050515 Bacteria 1891
1176 nmdc:mga0a205_341456_c1 3300050515 Bacteria 1366
1177 nmdc:mga0a205_389874_c1 3300050515 Bacteria 1257
1178 nmdc:mga0a205_5905_c2 3300050515 Bacteria 3456
1179 nmdc:mga0a205_681824_c1 3300050515 Bacteria 878
1180 nmdc:mga0a205_79703_c1 3300050515 Bacteria 3164
1181 Ga0495601_0021147 3300053077 Bacteria 3982
1182 Ga0495601_0661531 3300053077 Bacteria 668
1183 Ga0495612_0117816 3300053078 Bacteria 1141
1184 Ga0495595_0089139 3300053084 Bacteria 1478
1185 Ga0495595_0095477 3300053084 Bacteria 1430
1186 Ga0495619_0011545 3300053085 Bacteria 5569
1187 Ga0495619_0150202 3300053085 Bacteria 1607
1188 Ga0495619_0169987 3300053085 Bacteria 1507
1189 Ga0495619_0663666 3300053085 Bacteria 710
1190 Ga0501084_0013715 3300054114 Bacteria 6708
1191 Ga0501084_0246125 3300054114 Bacteria 1509
1192 Ga0590071_000358 3300059421 Bacteria 13472
1193 Ga0590074_010958 3300059423 Bacteria 1517
1194 Ga0590075_001993 3300059424 Bacteria 4928
1195 Ga0590075_090522 3300059424 Unclassified 794
1196 Ga0590077_000035 3300059426 Bacteria 30944
1197 Ga0501082_0001088 3300060353 Bacteria 24065
1198 Ga0501082_0248149 3300060353 Bacteria 1549
1199 Ga0501082_0950631 3300060353 Bacteria 751
1200 Ga0530510_0010884 3300061734 Bacteria 6382
1201 Ga0530510_0024932 3300061734 Bacteria 4274

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005546 Ga0070696_100502492 Ga0070696_1005024921 138
2 3300005295 Ga0065707_10029418 Ga0065707_100294181 139
3 3300006852 Ga0075433_10494838 Ga0075433_104948382 139
4 3300009147 Ga0114129_10244263 Ga0114129_102442634 139
5 3300009147 Ga0114129_10282496 Ga0114129_102824963 139
6 3300050507 nmdc:mga05p37_105964_c1 nmdc:mga05p37_105964_c1_1765_2298 139
7 3300050507 nmdc:mga05p37_8028_c1 nmdc:mga05p37_8028_c1_258_854 139
8 3300006178 Ga0075367_10643360 Ga0075367_106433602 146
9 3300035116 Ga0373945_0372323 Ga0373945_0372323_43_570 148
10 3300035695 Ga0373927_0328349 Ga0373927_0328349_232_759 150
11 3300046475 Ga0495639_0225703 Ga0495639_0225703_93_620 150
12 3300047319 Ga0495674_0649746 Ga0495674_0649746_68_595 150
13 3300047322 Ga0495680_0390062 Ga0495680_0390062_43_570 150
14 3300025986 Ga0207658_10884507 Ga0207658_108845071 151
15 3300005719 Ga0068861_101140504 Ga0068861_1011405042 153
16 3300005842 Ga0068858_100055604 Ga0068858_1000556049 153
17 3300026118 Ga0207675_100839990 Ga0207675_1008399902 153
18 3300028381 Ga0268264_10213917 Ga0268264_102139171 153
19 3300046684 Ga0495669_0498793 Ga0495669_0498793_19_504 153
20 3300005471 Ga0070698_100618650 Ga0070698_1006186501 154
21 3300006163 Ga0070715_10747122 Ga0070715_107471221 154
22 3300025922 Ga0207646_10506505 Ga0207646_105065052 154
23 3300046664 Ga0495659_0182820 Ga0495659_0182820_125_649 154
24 3300049578 Ga0501042_0588885 Ga0501042_0588885_19_555 154
25 3300005338 Ga0068868_100132527 Ga0068868_1001325272 155
26 3300005356 Ga0070674_100016181 Ga0070674_1000161813 155
27 3300005456 Ga0070678_100828156 Ga0070678_1008281562 155
28 3300005457 Ga0070662_100043294 Ga0070662_1000432943 155
29 3300005719 Ga0068861_100099899 Ga0068861_1000998992 155
30 3300005840 Ga0068870_10195391 Ga0068870_101953912 155
31 3300006358 Ga0068871_100104558 Ga0068871_1001045584 155
32 3300006881 Ga0068865_100125773 Ga0068865_1001257733 155
33 3300009176 Ga0105242_10164471 Ga0105242_101644713 155
34 3300009176 Ga0105242_11278168 Ga0105242_112781682 155
35 3300013306 Ga0163162_11737494 Ga0163162_117374942 155
36 3300014326 Ga0157380_10153614 Ga0157380_101536142 155
37 3300025893 Ga0207682_10048317 Ga0207682_100483173 155
38 3300025907 Ga0207645_10357207 Ga0207645_103572072 155
39 3300025927 Ga0207687_10635682 Ga0207687_106356822 155
40 3300025933 Ga0207706_10010042 Ga0207706_100100428 155
41 3300025934 Ga0207686_10264106 Ga0207686_102641062 155
42 3300025937 Ga0207669_10058946 Ga0207669_100589464 155
43 3300025938 Ga0207704_10003207 Ga0207704_100032073 155
44 3300025972 Ga0207668_10102148 Ga0207668_101021482 155
45 3300026023 Ga0207677_10340261 Ga0207677_103402612 155
46 3300026121 Ga0207683_10079749 Ga0207683_100797493 155
47 3300027424 Ga0209984_1013870 Ga0209984_10138702 155
48 3300027682 Ga0209971_1007890 Ga0209971_10078904 155
49 3300049741 Ga0501079_0458034 Ga0501079_0458034_322_849 155
50 3300050511 nmdc:mga08y16_822795_c1 nmdc:mga08y16_822795_c1_371_898 155
51 3300005345 Ga0070692_10311467 Ga0070692_103114671 156
52 3300005441 Ga0070700_100106333 Ga0070700_1001063332 156
53 3300005719 Ga0068861_100566264 Ga0068861_1005662642 156
54 3300006846 Ga0075430_100165088 Ga0075430_1001650882 156
55 3300025935 Ga0207709_10971649 Ga0207709_109716491 156
56 3300035725 Ga0373947_0511932 Ga0373947_0511932_197_730 156
57 3300037068 Ga0373925_0285032 Ga0373925_0285032_419_952 156
58 3300042436 Ga0439435_0123479 Ga0439435_0123479_15_542 156
59 3300046559 Ga0495667_0216933 Ga0495667_0216933_141_674 156
60 3300046683 Ga0495658_0145503 Ga0495658_0145503_484_1017 156
61 3300050509 nmdc:mga0qj67_175518_c1 nmdc:mga0qj67_175518_c1_268_795 156
62 3300053085 Ga0495619_0150202 Ga0495619_0150202_423_956 156
63 3300001977 JGI24746J21847_1000233 JGI24746J21847_10002333 157
64 3300002073 JGI24745J21846_1004590 JGI24745J21846_10045902 157
65 3300005293 Ga0065715_10001671 Ga0065715_100016718 157
66 3300005328 Ga0070676_10015465 Ga0070676_100154654 157
67 3300005330 Ga0070690_100015535 Ga0070690_1000155353 157
68 3300005333 Ga0070677_10003623 Ga0070677_100036233 157
69 3300005333 Ga0070677_10174643 Ga0070677_101746431 157
70 3300005334 Ga0068869_100011339 Ga0068869_1000113393 157
71 3300005335 Ga0070666_10006773 Ga0070666_100067732 157
72 3300005338 Ga0068868_100042747 Ga0068868_1000427473 157
73 3300005339 Ga0070660_100098453 Ga0070660_1000984532 157
74 3300005340 Ga0070689_100121980 Ga0070689_1001219801 157
75 3300005343 Ga0070687_100259548 Ga0070687_1002595482 157
76 3300005347 Ga0070668_100060390 Ga0070668_1000603903 157
77 3300005353 Ga0070669_100018135 Ga0070669_1000181353 157
78 3300005354 Ga0070675_100073969 Ga0070675_1000739693 157
79 3300005354 Ga0070675_100306811 Ga0070675_1003068111 157
80 3300005355 Ga0070671_100221070 Ga0070671_1002210702 157
81 3300005364 Ga0070673_100175915 Ga0070673_1001759151 157
82 3300005365 Ga0070688_100058832 Ga0070688_1000588323 157
83 3300005365 Ga0070688_100486465 Ga0070688_1004864651 157
84 3300005367 Ga0070667_100030091 Ga0070667_1000300913 157
85 3300005406 Ga0070703_10198559 Ga0070703_101985591 157
86 3300005444 Ga0070694_100196914 Ga0070694_1001969143 157
87 3300005455 Ga0070663_100086667 Ga0070663_1000866673 157
88 3300005456 Ga0070678_100149178 Ga0070678_1001491783 157
89 3300005457 Ga0070662_100021077 Ga0070662_1000210773 157
90 3300005466 Ga0070685_10020159 Ga0070685_100201595 157
91 3300005543 Ga0070672_100068186 Ga0070672_1000681861 157
92 3300005544 Ga0070686_100013157 Ga0070686_1000131573 157
93 3300005549 Ga0070704_100174582 Ga0070704_1001745821 157
94 3300005564 Ga0070664_100015545 Ga0070664_1000155454 157
95 3300005615 Ga0070702_100046299 Ga0070702_1000462992 157
96 3300005617 Ga0068859_100249479 Ga0068859_1002494792 157
97 3300005618 Ga0068864_100122739 Ga0068864_1001227393 157
98 3300005719 Ga0068861_100018492 Ga0068861_1000184922 157
99 3300005840 Ga0068870_10002825 Ga0068870_100028252 157
100 3300005841 Ga0068863_100004974 Ga0068863_1000049744 157
101 3300005842 Ga0068858_100159964 Ga0068858_1001599641 157
102 3300005843 Ga0068860_100465420 Ga0068860_1004654201 157
103 3300005844 Ga0068862_100015325 Ga0068862_1000153253 157
104 3300006237 Ga0097621_100284461 Ga0097621_1002844612 157
105 3300006358 Ga0068871_100079899 Ga0068871_1000798993 157
106 3300006847 Ga0075431_100038760 Ga0075431_1000387603 157
107 3300006852 Ga0075433_10137497 Ga0075433_101374973 157
108 3300006871 Ga0075434_100075941 Ga0075434_1000759413 157
109 3300006880 Ga0075429_100032192 Ga0075429_1000321923 157
110 3300006881 Ga0068865_100535187 Ga0068865_1005351872 157
111 3300006931 Ga0097620_100249481 Ga0097620_1002494812 157
112 3300009094 Ga0111539_10006125 Ga0111539_100061252 157
113 3300009098 Ga0105245_10918213 Ga0105245_109182132 157
114 3300009147 Ga0114129_10567454 Ga0114129_105674542 157
115 3300009176 Ga0105242_10080640 Ga0105242_100806402 157
116 3300009177 Ga0105248_10241022 Ga0105248_102410222 157
117 3300009553 Ga0105249_10045243 Ga0105249_100452438 157
118 3300013102 Ga0157371_10552368 Ga0157371_105523682 157
119 3300013296 Ga0157374_10216423 Ga0157374_102164233 157
120 3300013306 Ga0163162_10050913 Ga0163162_100509133 157
121 3300013308 Ga0157375_10024596 Ga0157375_100245963 157
122 3300014326 Ga0157380_10050583 Ga0157380_100505833 157
123 3300014326 Ga0157380_10302550 Ga0157380_103025502 157
124 3300014745 Ga0157377_10039480 Ga0157377_100394803 157
125 3300025893 Ga0207682_10003744 Ga0207682_100037448 157
126 3300025893 Ga0207682_10213724 Ga0207682_102137241 157
127 3300025901 Ga0207688_10004034 Ga0207688_100040345 157
128 3300025903 Ga0207680_10030976 Ga0207680_100309762 157
129 3300025907 Ga0207645_10020173 Ga0207645_100201733 157
130 3300025908 Ga0207643_10014738 Ga0207643_100147383 157
131 3300025908 Ga0207643_10075958 Ga0207643_100759581 157
132 3300025918 Ga0207662_10178377 Ga0207662_101783772 157
133 3300025920 Ga0207649_10060211 Ga0207649_100602112 157
134 3300025923 Ga0207681_10007716 Ga0207681_100077167 157
135 3300025926 Ga0207659_10016029 Ga0207659_100160297 157
136 3300025926 Ga0207659_10112531 Ga0207659_101125313 157
137 3300025927 Ga0207687_11214080 Ga0207687_112140801 157
138 3300025931 Ga0207644_10076123 Ga0207644_100761232 157
139 3300025933 Ga0207706_10036777 Ga0207706_100367773 157
140 3300025940 Ga0207691_10026550 Ga0207691_100265508 157
141 3300025942 Ga0207689_10009264 Ga0207689_100092644 157
142 3300025942 Ga0207689_10047425 Ga0207689_100474258 157
143 3300025945 Ga0207679_10008656 Ga0207679_100086568 157
144 3300025960 Ga0207651_10162838 Ga0207651_101628382 157
145 3300025961 Ga0207712_10009646 Ga0207712_100096463 157
146 3300025986 Ga0207658_10047846 Ga0207658_100478462 157
147 3300026023 Ga0207677_10075120 Ga0207677_100751203 157
148 3300026035 Ga0207703_10060003 Ga0207703_100600032 157
149 3300026067 Ga0207678_10097055 Ga0207678_100970552 157
150 3300026075 Ga0207708_10051640 Ga0207708_100516401 157
151 3300026088 Ga0207641_10055300 Ga0207641_100553001 157
152 3300026116 Ga0207674_10217244 Ga0207674_102172442 157
153 3300026118 Ga0207675_100134337 Ga0207675_1001343372 157
154 3300026121 Ga0207683_10434710 Ga0207683_104347102 157
155 3300027543 Ga0209999_1033273 Ga0209999_10332732 157
156 3300027907 Ga0207428_10004000 Ga0207428_100040005 157
157 3300028380 Ga0268265_10104877 Ga0268265_101048773 157
158 3300028381 Ga0268264_10951342 Ga0268264_109513422 157
159 3300035112 Ga0373932_0004171 Ga0373932_0004171_644_1174 157
160 3300035114 Ga0373939_0028793 Ga0373939_0028793_442_972 157
161 3300042008 Ga0439450_017840 Ga0439450_017840_111_641 157
162 3300042439 Ga0439464_0037869 Ga0439464_0037869_636_1166 157
163 3300042439 Ga0439464_0044240 Ga0439464_0044240_188_718 157
164 3300042876 Ga0451577_0043558 Ga0451577_0043558_772_1299 157
165 3300042876 Ga0451577_0181234 Ga0451577_0181234_542_1069 157
166 3300042993 Ga0439440_0012863 Ga0439440_0012863_824_1354 157
167 3300044712 Ga0453684_0276901 Ga0453684_0276901_866_1393 157
168 3300045051 Ga0451576_0150236 Ga0451576_0150236_1632_2162 157
169 3300045051 Ga0451576_0840338 Ga0451576_0840338_53_580 157
170 3300048912 Ga0496109_0686651 Ga0496109_0686651_276_806 157
171 3300049578 Ga0501042_0171864 Ga0501042_0171864_493_1023 157
172 3300050507 nmdc:mga05p37_103285_c1 nmdc:mga05p37_103285_c1_2845_3378 157
173 3300050507 nmdc:mga05p37_485900_c1 nmdc:mga05p37_485900_c1_659_1189 157
174 3300050507 nmdc:mga05p37_514956_c1 nmdc:mga05p37_514956_c1_209_736 157
175 3300050508 nmdc:mga09592_22043_c1 nmdc:mga09592_22043_c1_3130_3660 157
176 3300050509 nmdc:mga0qj67_1151_c1 nmdc:mga0qj67_1151_c1_14185_14715 157
177 3300050510 nmdc:mga06r32_6659_c1 nmdc:mga06r32_6659_c1_3076_3606 157
178 3300050511 nmdc:mga08y16_33537_c1 nmdc:mga08y16_33537_c1_3935_4465 157
179 3300050512 nmdc:mga0n895_11385_c1 nmdc:mga0n895_11385_c1_2180_2710 157
180 3300050515 nmdc:mga0a205_5905_c2 nmdc:mga0a205_5905_c2_2436_2966 157
181 3300005328 Ga0070676_10598973 Ga0070676_105989731 158
182 3300005364 Ga0070673_101045179 Ga0070673_1010451791 158
183 3300005456 Ga0070678_100215199 Ga0070678_1002151991 158
184 3300005457 Ga0070662_100620129 Ga0070662_1006201292 158
185 3300005459 Ga0068867_100184810 Ga0068867_1001848103 158
186 3300005616 Ga0068852_101273808 Ga0068852_1012738082 158
187 3300005843 Ga0068860_100116036 Ga0068860_1001160364 158
188 3300006358 Ga0068871_100239623 Ga0068871_1002396232 158
189 3300006844 Ga0075428_100237528 Ga0075428_1002375282 158
190 3300006847 Ga0075431_100599455 Ga0075431_1005994552 158
191 3300009147 Ga0114129_10349697 Ga0114129_103496972 158
192 3300042125 Ga0450923_061185 Ga0450923_061185_173_706 158
193 3300046455 Ga0495603_0172406 Ga0495603_0172406_29_556 158
194 3300046674 Ga0495588_0170164 Ga0495588_0170164_240_767 158
195 3300048907 Ga0496104_0387772 Ga0496104_0387772_299_826 158
196 3300049521 Ga0501298_066353 Ga0501298_066353_171_704 158
197 3300005343 Ga0070687_100377697 Ga0070687_1003776971 159
198 3300005354 Ga0070675_100636766 Ga0070675_1006367661 159
199 3300005440 Ga0070705_100960794 Ga0070705_1009607941 159
200 3300005535 Ga0070684_100985888 Ga0070684_1009858881 159
201 3300005564 Ga0070664_100048126 Ga0070664_1000481262 159
202 3300005618 Ga0068864_100064264 Ga0068864_1000642643 159
203 3300006844 Ga0075428_100134234 Ga0075428_1001342343 159
204 3300006846 Ga0075430_100021035 Ga0075430_1000210357 159
205 3300006847 Ga0075431_100301296 Ga0075431_1003012963 159
206 3300006852 Ga0075433_10042459 Ga0075433_100424598 159
207 3300006871 Ga0075434_100077985 Ga0075434_1000779852 159
208 3300006871 Ga0075434_100129138 Ga0075434_1001291383 159
209 3300006880 Ga0075429_100039184 Ga0075429_1000391846 159
210 3300007076 Ga0075435_100074231 Ga0075435_1000742313 159
211 3300009094 Ga0111539_10041243 Ga0111539_100412438 159
212 3300009101 Ga0105247_10154422 Ga0105247_101544222 159
213 3300009147 Ga0114129_10066608 Ga0114129_100666086 159
214 3300009551 Ga0105238_10408970 Ga0105238_104089702 159
215 3300011119 Ga0105246_10279635 Ga0105246_102796352 159
216 3300014325 Ga0163163_10106086 Ga0163163_101060864 159
217 3300025924 Ga0207694_10518352 Ga0207694_105183522 159
218 3300025925 Ga0207650_10024576 Ga0207650_100245763 159
219 3300025926 Ga0207659_10177084 Ga0207659_101770842 159
220 3300025926 Ga0207659_10966621 Ga0207659_109666211 159
221 3300025931 Ga0207644_10074195 Ga0207644_100741952 159
222 3300025933 Ga0207706_10121543 Ga0207706_101215431 159
223 3300025933 Ga0207706_10489910 Ga0207706_104899102 159
224 3300025936 Ga0207670_10161501 Ga0207670_101615012 159
225 3300025945 Ga0207679_10054268 Ga0207679_100542682 159
226 3300025960 Ga0207651_10388416 Ga0207651_103884162 159
227 3300026075 Ga0207708_10150618 Ga0207708_101506182 159
228 3300026088 Ga0207641_10269221 Ga0207641_102692212 159
229 3300026118 Ga0207675_100234171 Ga0207675_1002341712 159
230 3300026118 Ga0207675_101470090 Ga0207675_1014700901 159
231 3300027907 Ga0207428_10006178 Ga0207428_100061784 159
232 3300045051 Ga0451576_0640522 Ga0451576_0640522_364_891 159
233 3300049581 Ga0501047_0664613 Ga0501047_0664613_23_553 159
234 3300050507 nmdc:mga05p37_520289_c1 nmdc:mga05p37_520289_c1_741_1265 159
235 3300050508 nmdc:mga09592_43595_c1 nmdc:mga09592_43595_c1_870_1403 159
236 3300050509 nmdc:mga0qj67_28025_c1 nmdc:mga0qj67_28025_c1_2428_2961 159
237 3300050510 nmdc:mga06r32_172732_c1 nmdc:mga06r32_172732_c1_204_737 159
238 3300050511 nmdc:mga08y16_33677_c1 nmdc:mga08y16_33677_c1_2333_2866 159
239 3300050512 nmdc:mga0n895_297667_c1 nmdc:mga0n895_297667_c1_485_1021 159
240 3300050512 nmdc:mga0n895_45910_c1 nmdc:mga0n895_45910_c1_1154_1690 159
241 3300050513 nmdc:mga0rr50_57862_c1 nmdc:mga0rr50_57862_c1_1206_1742 159
242 3300050515 nmdc:mga0a205_13563_c1 nmdc:mga0a205_13563_c1_4180_4716 159
243 3300050515 nmdc:mga0a205_13804_c1 nmdc:mga0a205_13804_c1_2566_3102 159
244 3300050515 nmdc:mga0a205_341456_c1 nmdc:mga0a205_341456_c1_83_616 159
245 3300007076 Ga0075435_100833909 Ga0075435_1008339092 160
246 3300009177 Ga0105248_10378454 Ga0105248_103784542 160
247 3300025928 Ga0207700_10285912 Ga0207700_102859122 160
248 3300035170 Ga0373943_0165157 Ga0373943_0165157_480_1016 160
249 3300035692 Ga0373935_0295996 Ga0373935_0295996_87_623 160
250 3300035724 Ga0373933_0234889 Ga0373933_0234889_545_1081 160
251 3300036401 Ga0373937_0054898 Ga0373937_0054898_516_1052 160
252 3300037068 Ga0373925_0292058 Ga0373925_0292058_307_891 160
253 3300046531 Ga0495665_0191119 Ga0495665_0191119_37_573 160
254 3300047471 Ga0495684_0673273 Ga0495684_0673273_115_651 160
255 3300050513 nmdc:mga0rr50_588813_c1 nmdc:mga0rr50_588813_c1_177_719 160
256 3300035410 Ga0373924_0519466 Ga0373924_0519466_33_518 161
257 3300002459 JGI24751J29686_10002254 JGI24751J29686_100022543 162
258 3300005334 Ga0068869_100937525 Ga0068869_1009375251 162
259 3300005340 Ga0070689_100178217 Ga0070689_1001782172 162
260 3300005617 Ga0068859_100058170 Ga0068859_1000581706 162
261 3300005618 Ga0068864_100021918 Ga0068864_1000219183 162
262 3300006931 Ga0097620_100058168 Ga0097620_1000581686 162
263 3300014325 Ga0163163_10034316 Ga0163163_100343162 162
264 3300025936 Ga0207670_10283384 Ga0207670_102833842 162
265 3300025942 Ga0207689_10212101 Ga0207689_102121012 162
266 3300026095 Ga0207676_10090307 Ga0207676_100903072 162
267 3300005331 Ga0070670_100998770 Ga0070670_1009987701 163
268 3300005985 Ga0081539_10065894 Ga0081539_100658941 163
269 3300025908 Ga0207643_10582824 Ga0207643_105828242 163
270 3300034819 Ga0373958_0086321 Ga0373958_0086321_115_660 163
271 3300046538 Ga0495609_0214396 Ga0495609_0214396_225_767 163
272 3300050515 nmdc:mga0a205_681824_c1 nmdc:mga0a205_681824_c1_115_657 163
273 3300006163 Ga0070715_10101874 Ga0070715_101018742 164
274 3300006237 Ga0097621_100039048 Ga0097621_1000390484 164
275 3300006358 Ga0068871_100015630 Ga0068871_1000156308 164
276 3300009094 Ga0111539_10070960 Ga0111539_100709603 164
277 3300009098 Ga0105245_10239696 Ga0105245_102396963 164
278 3300009176 Ga0105242_10219200 Ga0105242_102192003 164
279 3300009177 Ga0105248_10787181 Ga0105248_107871812 164
280 3300014969 Ga0157376_10181165 Ga0157376_101811653 164
281 3300025315 Ga0207697_10047774 Ga0207697_100477743 164
282 3300025934 Ga0207686_10484917 Ga0207686_104849172 164
283 3300027907 Ga0207428_10021152 Ga0207428_100211528 164
284 3300035724 Ga0373933_0366814 Ga0373933_0366814_64_591 164
285 3300036401 Ga0373937_0165129 Ga0373937_0165129_1069_1596 164
286 3300046491 Ga0495584_0021886 Ga0495584_0021886_119_670 164
287 3300046528 Ga0495642_0008050 Ga0495642_0008050_3075_3626 164
288 3300046539 Ga0495621_0043775 Ga0495621_0043775_882_1433 164
289 3300047447 Ga0495685_067110 Ga0495685_067110_431_982 164
290 3300048903 Ga0496100_0361537 Ga0496100_0361537_18_545 164
291 3300048904 Ga0496101_0005336 Ga0496101_0005336_7433_7960 164
292 3300048905 Ga0496102_0374930 Ga0496102_0374930_452_979 164
293 3300048906 Ga0496103_0485797 Ga0496103_0485797_123_650 164
294 3300048907 Ga0496104_0237772 Ga0496104_0237772_202_729 164
295 3300048917 Ga0496114_0000494 Ga0496114_0000494_12925_13452 164
296 3300050511 nmdc:mga08y16_8354_c1 nmdc:mga08y16_8354_c1_2574_3104 164
297 3300025942 Ga0207689_10094969 Ga0207689_100949692 165
298 3300005339 Ga0070660_100752797 Ga0070660_1007527971 166
299 3300005536 Ga0070697_100829331 Ga0070697_1008293311 166
300 3300006237 Ga0097621_100926191 Ga0097621_1009261912 166
301 3300034957 Ga0373938_0020269 Ga0373938_0020269_132_671 166
302 3300035088 Ga0373940_0121073 Ga0373940_0121073_233_772 166
303 3300035241 Ga0373961_0037722 Ga0373961_0037722_778_1317 166
304 3300045051 Ga0451576_0566478 Ga0451576_0566478_244_783 166
305 3300048909 Ga0496106_0433627 Ga0496106_0433627_341_880 166
306 3300005340 Ga0070689_100726808 Ga0070689_1007268081 168
307 3300005471 Ga0070698_100169372 Ga0070698_1001693723 168
308 3300046664 Ga0495659_0007506 Ga0495659_0007506_134_670 168
309 3300049590 Ga0501074_0267840 Ga0501074_0267840_13_519 168
310 3300050507 nmdc:mga05p37_34071_c1 nmdc:mga05p37_34071_c1_3947_4483 168
311 3300005364 Ga0070673_100843865 Ga0070673_1008438651 169
312 3300005719 Ga0068861_100428198 Ga0068861_1004281982 169
313 3300005844 Ga0068862_100145087 Ga0068862_1001450872 169
314 3300009553 Ga0105249_10507076 Ga0105249_105070762 169
315 3300025960 Ga0207651_10609327 Ga0207651_106093272 169
316 3300026075 Ga0207708_10105780 Ga0207708_101057802 169
317 3300026118 Ga0207675_100209785 Ga0207675_1002097853 169
318 3300005549 Ga0070704_100031727 Ga0070704_1000317273 170
319 3300005331 Ga0070670_100016953 Ga0070670_10001695311 172
320 3300005336 Ga0070680_101002920 Ga0070680_1010029201 172
321 3300005548 Ga0070665_100813998 Ga0070665_1008139981 172
322 3300005564 Ga0070664_100245775 Ga0070664_1002457753 172
323 3300005617 Ga0068859_101324846 Ga0068859_1013248461 172
324 3300005719 Ga0068861_100456738 Ga0068861_1004567382 172
325 3300005840 Ga0068870_10032447 Ga0068870_100324472 172
326 3300006931 Ga0097620_101324922 Ga0097620_1013249221 172
327 3300025925 Ga0207650_10006980 Ga0207650_1000698013 172
328 3300025942 Ga0207689_10260783 Ga0207689_102607833 172
329 3300025945 Ga0207679_10179978 Ga0207679_101799782 172
330 3300026075 Ga0207708_10767264 Ga0207708_107672642 172
331 3300026116 Ga0207674_10133598 Ga0207674_101335982 172
332 3300005295 Ga0065707_10294973 Ga0065707_102949732 174
333 3300005347 Ga0070668_100525744 Ga0070668_1005257442 174
334 3300005353 Ga0070669_100240981 Ga0070669_1002409812 174
335 3300005441 Ga0070700_100304921 Ga0070700_1003049212 174
336 3300005467 Ga0070706_100281275 Ga0070706_1002812752 174
337 3300005468 Ga0070707_100078245 Ga0070707_1000782453 174
338 3300005543 Ga0070672_100493211 Ga0070672_1004932111 174
339 3300005546 Ga0070696_100225264 Ga0070696_1002252643 174
340 3300006881 Ga0068865_100129198 Ga0068865_1001291983 174
341 3300014326 Ga0157380_12099414 Ga0157380_120994141 174
342 3300025922 Ga0207646_10096455 Ga0207646_100964552 174
343 3300025923 Ga0207681_10433945 Ga0207681_104339452 174
344 3300025940 Ga0207691_10310548 Ga0207691_103105482 174
345 3300025972 Ga0207668_10606109 Ga0207668_106061092 174
346 3300026142 Ga0207698_11660369 Ga0207698_116603691 174
347 3300032002 Ga0307416_100196288 Ga0307416_1001962883 174
348 3300042876 Ga0451577_0616198 Ga0451577_0616198_127_651 174
349 3300042993 Ga0439440_0218575 Ga0439440_0218575_15_539 174
350 3300044712 Ga0453684_0906086 Ga0453684_0906086_137_664 174
351 3300048906 Ga0496103_0337010 Ga0496103_0337010_404_928 174
352 3300048914 Ga0496111_0145684 Ga0496111_0145684_14_538 174
353 3300005290 Ga0065712_10075001 Ga0065712_100750012 175
354 3300005293 Ga0065715_10383462 Ga0065715_103834621 175
355 3300005293 Ga0065715_10804619 Ga0065715_108046191 175
356 3300005295 Ga0065707_10231424 Ga0065707_102314242 175
357 3300005327 Ga0070658_10542613 Ga0070658_105426132 175
358 3300005328 Ga0070676_10006877 Ga0070676_1000687712 175
359 3300005328 Ga0070676_10193432 Ga0070676_101934322 175
360 3300005330 Ga0070690_100479799 Ga0070690_1004797991 175
361 3300005331 Ga0070670_100028660 Ga0070670_1000286608 175
362 3300005333 Ga0070677_10062602 Ga0070677_100626022 175
363 3300005338 Ga0068868_100189330 Ga0068868_1001893303 175
364 3300005344 Ga0070661_100368925 Ga0070661_1003689252 175
365 3300005347 Ga0070668_100068984 Ga0070668_1000689843 175
366 3300005353 Ga0070669_100084584 Ga0070669_1000845843 175
367 3300005353 Ga0070669_100084879 Ga0070669_1000848793 175
368 3300005354 Ga0070675_100088869 Ga0070675_1000888693 175
369 3300005354 Ga0070675_100118960 Ga0070675_1001189604 175
370 3300005354 Ga0070675_100755052 Ga0070675_1007550522 175
371 3300005354 Ga0070675_100785653 Ga0070675_1007856531 175
372 3300005354 Ga0070675_101017588 Ga0070675_1010175882 175
373 3300005356 Ga0070674_100062508 Ga0070674_1000625083 175
374 3300005356 Ga0070674_100078028 Ga0070674_1000780282 175
375 3300005356 Ga0070674_100245657 Ga0070674_1002456572 175
376 3300005364 Ga0070673_100135160 Ga0070673_1001351603 175
377 3300005364 Ga0070673_100597216 Ga0070673_1005972161 175
378 3300005364 Ga0070673_100689047 Ga0070673_1006890471 175
379 3300005438 Ga0070701_10008026 Ga0070701_100080263 175
380 3300005440 Ga0070705_100235681 Ga0070705_1002356812 175
381 3300005440 Ga0070705_100259048 Ga0070705_1002590482 175
382 3300005441 Ga0070700_100054235 Ga0070700_1000542353 175
383 3300005441 Ga0070700_100071481 Ga0070700_1000714814 175
384 3300005441 Ga0070700_100462836 Ga0070700_1004628362 175
385 3300005441 Ga0070700_100520406 Ga0070700_1005204062 175
386 3300005455 Ga0070663_100096457 Ga0070663_1000964572 175
387 3300005455 Ga0070663_100505775 Ga0070663_1005057752 175
388 3300005456 Ga0070678_100021386 Ga0070678_1000213863 175
389 3300005456 Ga0070678_100058558 Ga0070678_1000585583 175
390 3300005457 Ga0070662_100102294 Ga0070662_1001022944 175
391 3300005458 Ga0070681_10165128 Ga0070681_101651283 175
392 3300005459 Ga0068867_100024756 Ga0068867_1000247563 175
393 3300005459 Ga0068867_100046871 Ga0068867_1000468716 175
394 3300005459 Ga0068867_100493275 Ga0068867_1004932752 175
395 3300005471 Ga0070698_100045728 Ga0070698_1000457287 175
396 3300005518 Ga0070699_100251667 Ga0070699_1002516672 175
397 3300005518 Ga0070699_100355707 Ga0070699_1003557072 175
398 3300005530 Ga0070679_100186694 Ga0070679_1001866942 175
399 3300005535 Ga0070684_100949930 Ga0070684_1009499302 175
400 3300005536 Ga0070697_100064631 Ga0070697_1000646313 175
401 3300005539 Ga0068853_101071691 Ga0068853_1010716911 175
402 3300005543 Ga0070672_100119072 Ga0070672_1001190722 175
403 3300005543 Ga0070672_100204378 Ga0070672_1002043783 175
404 3300005544 Ga0070686_100096258 Ga0070686_1000962583 175
405 3300005544 Ga0070686_101122869 Ga0070686_1011228691 175
406 3300005546 Ga0070696_100109783 Ga0070696_1001097832 175
407 3300005546 Ga0070696_100188120 Ga0070696_1001881203 175
408 3300005546 Ga0070696_100321519 Ga0070696_1003215192 175
409 3300005547 Ga0070693_100316879 Ga0070693_1003168792 175
410 3300005547 Ga0070693_100967339 Ga0070693_1009673391 175
411 3300005548 Ga0070665_100035708 Ga0070665_1000357082 175
412 3300005548 Ga0070665_100043746 Ga0070665_1000437468 175
413 3300005548 Ga0070665_100736223 Ga0070665_1007362232 175
414 3300005549 Ga0070704_100038836 Ga0070704_1000388364 175
415 3300005549 Ga0070704_100593643 Ga0070704_1005936432 175
416 3300005563 Ga0068855_100566008 Ga0068855_1005660082 175
417 3300005564 Ga0070664_100160735 Ga0070664_1001607352 175
418 3300005564 Ga0070664_100615425 Ga0070664_1006154252 175
419 3300005614 Ga0068856_100021502 Ga0068856_1000215023 175
420 3300005615 Ga0070702_100076653 Ga0070702_1000766532 175
421 3300005618 Ga0068864_100062599 Ga0068864_1000625994 175
422 3300005618 Ga0068864_100254709 Ga0068864_1002547092 175
423 3300005618 Ga0068864_101062763 Ga0068864_1010627632 175
424 3300005718 Ga0068866_10036027 Ga0068866_100360273 175
425 3300005718 Ga0068866_10162215 Ga0068866_101622151 175
426 3300005719 Ga0068861_100037825 Ga0068861_1000378256 175
427 3300005719 Ga0068861_100248214 Ga0068861_1002482142 175
428 3300005840 Ga0068870_10137441 Ga0068870_101374413 175
429 3300005841 Ga0068863_100101783 Ga0068863_1001017833 175
430 3300005842 Ga0068858_100389209 Ga0068858_1003892092 175
431 3300005842 Ga0068858_101357642 Ga0068858_1013576421 175
432 3300005843 Ga0068860_100110727 Ga0068860_1001107274 175
433 3300005843 Ga0068860_100676748 Ga0068860_1006767482 175
434 3300005844 Ga0068862_100158112 Ga0068862_1001581123 175
435 3300006237 Ga0097621_100099719 Ga0097621_1000997193 175
436 3300006237 Ga0097621_100108636 Ga0097621_1001086363 175
437 3300006237 Ga0097621_100168154 Ga0097621_1001681542 175
438 3300006237 Ga0097621_100281183 Ga0097621_1002811833 175
439 3300006358 Ga0068871_100119842 Ga0068871_1001198423 175
440 3300006358 Ga0068871_100375229 Ga0068871_1003752293 175
441 3300006358 Ga0068871_100585057 Ga0068871_1005850572 175
442 3300006844 Ga0075428_100062621 Ga0075428_1000626213 175
443 3300006844 Ga0075428_100073818 Ga0075428_1000738183 175
444 3300006844 Ga0075428_101619160 Ga0075428_1016191601 175
445 3300006846 Ga0075430_100037983 Ga0075430_1000379833 175
446 3300006846 Ga0075430_100321973 Ga0075430_1003219732 175
447 3300006847 Ga0075431_100102783 Ga0075431_1001027833 175
448 3300006847 Ga0075431_100202518 Ga0075431_1002025184 175
449 3300006847 Ga0075431_100442219 Ga0075431_1004422193 175
450 3300006852 Ga0075433_10048382 Ga0075433_100483822 175
451 3300006852 Ga0075433_10187506 Ga0075433_101875063 175
452 3300006871 Ga0075434_101818066 Ga0075434_1018180661 175
453 3300006880 Ga0075429_100196209 Ga0075429_1001962091 175
454 3300006881 Ga0068865_100101972 Ga0068865_1001019722 175
455 3300006881 Ga0068865_100167247 Ga0068865_1001672472 175
456 3300006914 Ga0075436_100069232 Ga0075436_1000692322 175
457 3300006931 Ga0097620_100060741 Ga0097620_1000607413 175
458 3300009093 Ga0105240_10039744 Ga0105240_100397445 175
459 3300009093 Ga0105240_10836887 Ga0105240_108368872 175
460 3300009094 Ga0111539_10083713 Ga0111539_100837133 175
461 3300009094 Ga0111539_10491013 Ga0111539_104910131 175
462 3300009094 Ga0111539_10951130 Ga0111539_109511302 175
463 3300009098 Ga0105245_10141649 Ga0105245_101416492 175
464 3300009098 Ga0105245_10820342 Ga0105245_108203422 175
465 3300009147 Ga0114129_10057496 Ga0114129_100574963 175
466 3300009147 Ga0114129_10582227 Ga0114129_105822272 175
467 3300009148 Ga0105243_10043926 Ga0105243_100439266 175
468 3300009148 Ga0105243_10063738 Ga0105243_100637384 175
469 3300009148 Ga0105243_10168682 Ga0105243_101686823 175
470 3300009148 Ga0105243_11343580 Ga0105243_113435802 175
471 3300009174 Ga0105241_11344686 Ga0105241_113446862 175
472 3300009176 Ga0105242_10428740 Ga0105242_104287401 175
473 3300009176 Ga0105242_10899843 Ga0105242_108998431 175
474 3300009177 Ga0105248_10061024 Ga0105248_100610243 175
475 3300009177 Ga0105248_10137242 Ga0105248_101372423 175
476 3300009177 Ga0105248_10303600 Ga0105248_103036002 175
477 3300009177 Ga0105248_11961861 Ga0105248_119618611 175
478 3300009545 Ga0105237_11133769 Ga0105237_111337692 175
479 3300009553 Ga0105249_10149458 Ga0105249_101494584 175
480 3300009553 Ga0105249_11138361 Ga0105249_111383611 175
481 3300013105 Ga0157369_10199512 Ga0157369_101995123 175
482 3300013296 Ga0157374_11346949 Ga0157374_113469492 175
483 3300013296 Ga0157374_11989689 Ga0157374_119896891 175
484 3300013297 Ga0157378_10497666 Ga0157378_104976662 175
485 3300013306 Ga0163162_10768392 Ga0163162_107683922 175
486 3300013306 Ga0163162_10854289 Ga0163162_108542891 175
487 3300013308 Ga0157375_10218957 Ga0157375_102189573 175
488 3300014325 Ga0163163_10245341 Ga0163163_102453412 175
489 3300014325 Ga0163163_12030560 Ga0163163_120305601 175
490 3300014326 Ga0157380_10223165 Ga0157380_102231652 175
491 3300014326 Ga0157380_10669123 Ga0157380_106691232 175
492 3300014968 Ga0157379_10127107 Ga0157379_101271073 175
493 3300014968 Ga0157379_10508177 Ga0157379_105081772 175
494 3300014969 Ga0157376_10159200 Ga0157376_101592002 175
495 3300014969 Ga0157376_10191811 Ga0157376_101918112 175
496 3300014969 Ga0157376_10433824 Ga0157376_104338242 175
497 3300025893 Ga0207682_10196729 Ga0207682_101967292 175
498 3300025899 Ga0207642_10036769 Ga0207642_100367692 175
499 3300025899 Ga0207642_10171814 Ga0207642_101718141 175
500 3300025899 Ga0207642_10298597 Ga0207642_102985972 175
501 3300025901 Ga0207688_10098922 Ga0207688_100989222 175
502 3300025901 Ga0207688_10257291 Ga0207688_102572912 175
503 3300025901 Ga0207688_10324602 Ga0207688_103246021 175
504 3300025904 Ga0207647_10256045 Ga0207647_102560452 175
505 3300025907 Ga0207645_10024118 Ga0207645_100241183 175
506 3300025913 Ga0207695_10235123 Ga0207695_102351233 175
507 3300025913 Ga0207695_10678960 Ga0207695_106789602 175
508 3300025917 Ga0207660_10382723 Ga0207660_103827232 175
509 3300025918 Ga0207662_10115019 Ga0207662_101150192 175
510 3300025921 Ga0207652_10119845 Ga0207652_101198454 175
511 3300025922 Ga0207646_10190999 Ga0207646_101909992 175
512 3300025922 Ga0207646_10348193 Ga0207646_103481932 175
513 3300025923 Ga0207681_10050520 Ga0207681_100505202 175
514 3300025923 Ga0207681_10074974 Ga0207681_100749742 175
515 3300025925 Ga0207650_10850472 Ga0207650_108504722 175
516 3300025926 Ga0207659_10089826 Ga0207659_100898263 175
517 3300025926 Ga0207659_10966717 Ga0207659_109667172 175
518 3300025927 Ga0207687_10057682 Ga0207687_100576823 175
519 3300025927 Ga0207687_10696369 Ga0207687_106963692 175
520 3300025931 Ga0207644_10102324 Ga0207644_101023243 175
521 3300025932 Ga0207690_10650595 Ga0207690_106505952 175
522 3300025933 Ga0207706_10061580 Ga0207706_100615804 175
523 3300025934 Ga0207686_10026234 Ga0207686_100262343 175
524 3300025934 Ga0207686_10108841 Ga0207686_101088412 175
525 3300025934 Ga0207686_10945471 Ga0207686_109454711 175
526 3300025935 Ga0207709_10057765 Ga0207709_100577653 175
527 3300025935 Ga0207709_10130334 Ga0207709_101303343 175
528 3300025935 Ga0207709_10132471 Ga0207709_101324712 175
529 3300025935 Ga0207709_10508548 Ga0207709_105085481 175
530 3300025937 Ga0207669_10063702 Ga0207669_100637022 175
531 3300025937 Ga0207669_10097789 Ga0207669_100977893 175
532 3300025937 Ga0207669_10194758 Ga0207669_101947582 175
533 3300025937 Ga0207669_10567464 Ga0207669_105674642 175
534 3300025938 Ga0207704_10052322 Ga0207704_100523223 175
535 3300025938 Ga0207704_10170185 Ga0207704_101701852 175
536 3300025938 Ga0207704_10375689 Ga0207704_103756891 175
537 3300025938 Ga0207704_10433158 Ga0207704_104331581 175
538 3300025940 Ga0207691_10126513 Ga0207691_101265134 175
539 3300025940 Ga0207691_10154885 Ga0207691_101548853 175
540 3300025941 Ga0207711_10059356 Ga0207711_100593563 175
541 3300025941 Ga0207711_10075724 Ga0207711_100757241 175
542 3300025941 Ga0207711_10159678 Ga0207711_101596782 175
543 3300025941 Ga0207711_10161010 Ga0207711_101610102 175
544 3300025941 Ga0207711_10818466 Ga0207711_108184662 175
545 3300025941 Ga0207711_11312748 Ga0207711_113127481 175
546 3300025942 Ga0207689_10146058 Ga0207689_101460582 175
547 3300025945 Ga0207679_10798854 Ga0207679_107988541 175
548 3300025949 Ga0207667_10487744 Ga0207667_104877442 175
549 3300025960 Ga0207651_10133750 Ga0207651_101337502 175
550 3300025960 Ga0207651_10678211 Ga0207651_106782112 175
551 3300025961 Ga0207712_10573842 Ga0207712_105738422 175
552 3300025972 Ga0207668_10143237 Ga0207668_101432373 175
553 3300025981 Ga0207640_11544385 Ga0207640_115443851 175
554 3300025986 Ga0207658_10159781 Ga0207658_101597813 175
555 3300026023 Ga0207677_10040793 Ga0207677_100407933 175
556 3300026023 Ga0207677_10063437 Ga0207677_100634373 175
557 3300026023 Ga0207677_10719785 Ga0207677_107197851 175
558 3300026035 Ga0207703_11126634 Ga0207703_111266342 175
559 3300026067 Ga0207678_10085630 Ga0207678_100856302 175
560 3300026067 Ga0207678_10460392 Ga0207678_104603922 175
561 3300026075 Ga0207708_10035399 Ga0207708_100353998 175
562 3300026075 Ga0207708_10144850 Ga0207708_101448502 175
563 3300026075 Ga0207708_10816388 Ga0207708_108163882 175
564 3300026078 Ga0207702_11566291 Ga0207702_115662911 175
565 3300026088 Ga0207641_10694817 Ga0207641_106948172 175
566 3300026088 Ga0207641_11325854 Ga0207641_113258542 175
567 3300026089 Ga0207648_10108973 Ga0207648_101089733 175
568 3300026089 Ga0207648_10115354 Ga0207648_101153542 175
569 3300026095 Ga0207676_10008606 Ga0207676_1000860613 175
570 3300026095 Ga0207676_11093644 Ga0207676_110936442 175
571 3300026118 Ga0207675_100037707 Ga0207675_1000377073 175
572 3300026121 Ga0207683_10062914 Ga0207683_100629147 175
573 3300026121 Ga0207683_10065633 Ga0207683_100656332 175
574 3300027907 Ga0207428_10062710 Ga0207428_100627103 175
575 3300028379 Ga0268266_10055880 Ga0268266_100558807 175
576 3300028379 Ga0268266_10152149 Ga0268266_101521493 175
577 3300028379 Ga0268266_11366328 Ga0268266_113663282 175
578 3300028380 Ga0268265_10043970 Ga0268265_100439704 175
579 3300028381 Ga0268264_10736682 Ga0268264_107366822 175
580 3300028381 Ga0268264_10743198 Ga0268264_107431982 175
581 3300031548 Ga0307408_101534403 Ga0307408_1015344031 175
582 3300031731 Ga0307405_10246686 Ga0307405_102466862 175
583 3300031731 Ga0307405_10944152 Ga0307405_109441522 175
584 3300032002 Ga0307416_100071517 Ga0307416_1000715171 175
585 3300032004 Ga0307414_11193821 Ga0307414_111938211 175
586 3300035089 Ga0373944_0010372 Ga0373944_0010372_796_1323 175
587 3300035117 Ga0373953_0101214 Ga0373953_0101214_173_700 175
588 3300035118 Ga0373954_0066995 Ga0373954_0066995_44_571 175
589 3300035119 Ga0373956_0278967 Ga0373956_0278967_238_765 175
590 3300035119 Ga0373956_0415997 Ga0373956_0415997_89_616 175
591 3300035170 Ga0373943_0347878 Ga0373943_0347878_23_550 175
592 3300035171 Ga0373946_0279922 Ga0373946_0279922_117_644 175
593 3300035692 Ga0373935_0584524 Ga0373935_0584524_245_772 175
594 3300035695 Ga0373927_0257328 Ga0373927_0257328_407_934 175
595 3300035725 Ga0373947_0056371 Ga0373947_0056371_1552_2079 175
596 3300035725 Ga0373947_0580678 Ga0373947_0580678_113_640 175
597 3300036401 Ga0373937_0700547 Ga0373937_0700547_174_701 175
598 3300036401 Ga0373937_1517793 Ga0373937_1517793_37_564 175
599 3300037068 Ga0373925_0802719 Ga0373925_0802719_227_754 175
600 3300041441 Ga0451787_491067 Ga0451787_491067_91_618 175
601 3300041512 Ga0451853_3921483 Ga0451853_3921483_183_710 175
602 3300042015 Ga0439462_0026415 Ga0439462_0026415_494_1021 175
603 3300042157 Ga0439458_0145211 Ga0439458_0145211_79_606 175
604 3300042184 Ga0450908_063659 Ga0450908_063659_45_572 175
605 3300042439 Ga0439464_0084481 Ga0439464_0084481_369_896 175
606 3300046455 Ga0495603_0055590 Ga0495603_0055590_1494_2021 175
607 3300046455 Ga0495603_0058776 Ga0495603_0058776_503_1030 175
608 3300046459 Ga0495629_0004499 Ga0495629_0004499_8203_8730 175
609 3300046459 Ga0495629_0404886 Ga0495629_0404886_290_817 175
610 3300046459 Ga0495629_0732471 Ga0495629_0732471_26_553 175
611 3300046499 Ga0495594_0319657 Ga0495594_0319657_159_686 175
612 3300046511 Ga0495608_0113728 Ga0495608_0113728_306_833 175
613 3300046514 Ga0495618_0327546 Ga0495618_0327546_267_794 175
614 3300046516 Ga0495628_0935543 Ga0495628_0935543_44_571 175
615 3300046517 Ga0495630_0414449 Ga0495630_0414449_132_659 175
616 3300046539 Ga0495621_0017635 Ga0495621_0017635_1621_2148 175
617 3300046543 Ga0495645_0511851 Ga0495645_0511851_97_624 175
618 3300046557 Ga0495622_0242888 Ga0495622_0242888_144_671 175
619 3300046663 Ga0495635_0381830 Ga0495635_0381830_333_860 175
620 3300046683 Ga0495658_0282072 Ga0495658_0282072_403_930 175
621 3300046684 Ga0495669_0089369 Ga0495669_0089369_324_851 175
622 3300046690 Ga0495624_0127686 Ga0495624_0127686_977_1504 175
623 3300047315 Ga0495581_0288202 Ga0495581_0288202_167_694 175
624 3300047317 Ga0495604_0171370 Ga0495604_0171370_319_846 175
625 3300047321 Ga0495676_0005608 Ga0495676_0005608_9796_10323 175
626 3300047321 Ga0495676_0383087 Ga0495676_0383087_259_786 175
627 3300047444 Ga0495675_0123218 Ga0495675_0123218_793_1320 175
628 3300048907 Ga0496104_0051204 Ga0496104_0051204_941_1468 175
629 3300048907 Ga0496104_0729195 Ga0496104_0729195_303_830 175
630 3300048908 Ga0496105_0488986 Ga0496105_0488986_335_862 175
631 3300048911 Ga0496108_0265177 Ga0496108_0265177_260_787 175
632 3300048912 Ga0496109_0069195 Ga0496109_0069195_2199_2726 175
633 3300048915 Ga0496112_1027148 Ga0496112_1027148_182_709 175
634 3300048917 Ga0496114_0747775 Ga0496114_0747775_184_711 175
635 3300048917 Ga0496114_0812153 Ga0496114_0812153_262_789 175
636 3300049578 Ga0501042_0460731 Ga0501042_0460731_177_704 175
637 3300049591 Ga0501075_0219842 Ga0501075_0219842_128_655 175
638 3300049822 Ga0501035_1236770 Ga0501035_1236770_12_539 175
639 3300049824 Ga0501045_0478866 Ga0501045_0478866_332_859 175
640 3300050507 nmdc:mga05p37_24767_c1 nmdc:mga05p37_24767_c1_2367_2894 175
641 3300050507 nmdc:mga05p37_89187_c1 nmdc:mga05p37_89187_c1_1605_2132 175
642 3300050508 nmdc:mga09592_216693_c1 nmdc:mga09592_216693_c1_1051_1578 175
643 3300050509 nmdc:mga0qj67_412167_c1 nmdc:mga0qj67_412167_c1_336_863 175
644 3300050509 nmdc:mga0qj67_57581_c1 nmdc:mga0qj67_57581_c1_1506_2033 175
645 3300050510 nmdc:mga06r32_140362_c1 nmdc:mga06r32_140362_c1_1233_1760 175
646 3300050510 nmdc:mga06r32_33135_c1 nmdc:mga06r32_33135_c1_1936_2463 175
647 3300050510 nmdc:mga06r32_518466_c1 nmdc:mga06r32_518466_c1_585_1112 175
648 3300050511 nmdc:mga08y16_43775_c1 nmdc:mga08y16_43775_c1_2973_3500 175
649 3300050512 nmdc:mga0n895_1582049_c1 nmdc:mga0n895_1582049_c1_48_575 175
650 3300050514 nmdc:mga08x19_85997_c1 nmdc:mga08x19_85997_c1_361_888 175
651 3300050515 nmdc:mga0a205_79703_c1 nmdc:mga0a205_79703_c1_985_1512 175
652 3300053077 Ga0495601_0661531 Ga0495601_0661531_119_646 175
653 3300053078 Ga0495612_0117816 Ga0495612_0117816_62_589 175
654 3300053084 Ga0495595_0089139 Ga0495595_0089139_31_558 175
655 3300053085 Ga0495619_0169987 Ga0495619_0169987_922_1449 175
656 3300053085 Ga0495619_0663666 Ga0495619_0663666_171_698 175
657 3300059421 Ga0590071_000358 Ga0590071_000358_7016_7543 175
658 3300059423 Ga0590074_010958 Ga0590074_010958_583_1110 175
659 3300059424 Ga0590075_001993 Ga0590075_001993_809_1336 175
660 3300059424 Ga0590075_090522 Ga0590075_090522_102_629 175
661 3300059426 Ga0590077_000035 Ga0590077_000035_27608_28135 175
662 3300060353 Ga0501082_0950631 Ga0501082_0950631_173_700 175
663 3300003203 JGI25406J46586_10143235 JGI25406J46586_101432351 176
664 3300005289 Ga0065704_10419553 Ga0065704_104195531 176
665 3300005295 Ga0065707_10010077 Ga0065707_100100776 176
666 3300005330 Ga0070690_100085576 Ga0070690_1000855763 176
667 3300005340 Ga0070689_100401803 Ga0070689_1004018032 176
668 3300005343 Ga0070687_100568054 Ga0070687_1005680541 176
669 3300005364 Ga0070673_100321189 Ga0070673_1003211891 176
670 3300005518 Ga0070699_100146585 Ga0070699_1001465853 176
671 3300005544 Ga0070686_100054834 Ga0070686_1000548344 176
672 3300005544 Ga0070686_100316728 Ga0070686_1003167282 176
673 3300005577 Ga0068857_100751845 Ga0068857_1007518452 176
674 3300005578 Ga0068854_100030421 Ga0068854_1000304214 176
675 3300005985 Ga0081539_10014366 Ga0081539_1001436610 176
676 3300007076 Ga0075435_100292698 Ga0075435_1002926983 176
677 3300009094 Ga0111539_11363322 Ga0111539_113633222 176
678 3300009553 Ga0105249_11159408 Ga0105249_111594082 176
679 3300010375 Ga0105239_10518103 Ga0105239_105181032 176
680 3300014968 Ga0157379_10249885 Ga0157379_102498852 176
681 3300025926 Ga0207659_10369604 Ga0207659_103696042 176
682 3300025941 Ga0207711_10661297 Ga0207711_106612972 176
683 3300025981 Ga0207640_10021255 Ga0207640_100212558 176
684 3300026035 Ga0207703_10657915 Ga0207703_106579152 176
685 3300026116 Ga0207674_10153948 Ga0207674_101539483 176
686 3300026121 Ga0207683_10370008 Ga0207683_103700082 176
687 3300027614 Ga0209970_1047250 Ga0209970_10472501 176
688 3300027682 Ga0209971_1025261 Ga0209971_10252612 176
689 3300028380 Ga0268265_10375437 Ga0268265_103754372 176
690 3300034816 Ga0373930_0005072 Ga0373930_0005072_227_757 176
691 3300034817 Ga0373948_0001160 Ga0373948_0001160_2692_3222 176
692 3300034818 Ga0373950_0002587 Ga0373950_0002587_630_1160 176
693 3300034819 Ga0373958_0012058 Ga0373958_0012058_260_790 176
694 3300034820 Ga0373959_0005588 Ga0373959_0005588_1096_1626 176
695 3300034957 Ga0373938_0000588 Ga0373938_0000588_2661_3191 176
696 3300035084 Ga0373928_0007331 Ga0373928_0007331_1103_1633 176
697 3300035085 Ga0373929_0000498 Ga0373929_0000498_2210_2740 176
698 3300035088 Ga0373940_0001234 Ga0373940_0001234_2843_3373 176
699 3300035090 Ga0373949_0001772 Ga0373949_0001772_1377_1907 176
700 3300035091 Ga0373951_0000520 Ga0373951_0000520_7412_7942 176
701 3300035092 Ga0373952_0010237 Ga0373952_0010237_309_839 176
702 3300035112 Ga0373932_0000492 Ga0373932_0000492_8391_8921 176
703 3300035114 Ga0373939_0000428 Ga0373939_0000428_9375_9905 176
704 3300035115 Ga0373941_0000851 Ga0373941_0000851_584_1114 176
705 3300035121 Ga0373960_0000207 Ga0373960_0000207_1303_1833 176
706 3300035207 Ga0373942_0001108 Ga0373942_0001108_1005_1535 176
707 3300035241 Ga0373961_0006147 Ga0373961_0006147_1423_1953 176
708 3300035242 Ga0373962_0003292 Ga0373962_0003292_835_1365 176
709 3300042008 Ga0439450_157887 Ga0439450_157887_31_561 176
710 3300042120 Ga0450917_006069 Ga0450917_006069_199_729 176
711 3300045051 Ga0451576_0009891 Ga0451576_0009891_3916_4446 176
712 3300046517 Ga0495630_0454208 Ga0495630_0454208_302_832 176
713 3300046522 Ga0495643_0073682 Ga0495643_0073682_1140_1673 176
714 3300046558 Ga0495633_0040363 Ga0495633_0040363_1076_1630 176
715 3300046683 Ga0495658_0380160 Ga0495658_0380160_326_856 176
716 3300046809 Ga0495600_0458756 Ga0495600_0458756_49_579 176
717 3300047317 Ga0495604_0481595 Ga0495604_0481595_144_674 176
718 3300048906 Ga0496103_0184031 Ga0496103_0184031_72_602 176
719 3300048910 Ga0496107_0163707 Ga0496107_0163707_848_1378 176
720 3300049583 Ga0501067_0295415 Ga0501067_0295415_240_770 176
721 3300005338 Ga0068868_100953395 Ga0068868_1009533951 177
722 3300005338 Ga0068868_100995453 Ga0068868_1009954531 177
723 3300005459 Ga0068867_100492095 Ga0068867_1004920952 177
724 3300005471 Ga0070698_100031163 Ga0070698_1000311633 177
725 3300005518 Ga0070699_100039862 Ga0070699_1000398623 177
726 3300005544 Ga0070686_100406701 Ga0070686_1004067012 177
727 3300005549 Ga0070704_100085002 Ga0070704_1000850023 177
728 3300005617 Ga0068859_100794714 Ga0068859_1007947142 177
729 3300006237 Ga0097621_100263207 Ga0097621_1002632072 177
730 3300006931 Ga0097620_100794916 Ga0097620_1007949162 177
731 3300009147 Ga0114129_10162762 Ga0114129_101627622 177
732 3300009177 Ga0105248_11575073 Ga0105248_115750731 177
733 3300014326 Ga0157380_10090303 Ga0157380_100903034 177
734 3300014969 Ga0157376_10388021 Ga0157376_103880212 177
735 3300025925 Ga0207650_11435229 Ga0207650_114352291 177
736 3300025934 Ga0207686_10989106 Ga0207686_109891062 177
737 3300026023 Ga0207677_10174657 Ga0207677_101746573 177
738 3300026023 Ga0207677_10191021 Ga0207677_101910212 177
739 3300042184 Ga0450908_023391 Ga0450908_023391_165_701 177
740 3300046535 Ga0495586_0297152 Ga0495586_0297152_341_874 177
741 3300046664 Ga0495659_0132472 Ga0495659_0132472_334_897 177
742 3300046691 Ga0495670_0115442 Ga0495670_0115442_19_582 177
743 3300049588 Ga0501072_0987689 Ga0501072_0987689_68_601 177
744 3300049592 Ga0501076_0263993 Ga0501076_0263993_415_948 177
745 3300049743 Ga0501081_0366811 Ga0501081_0366811_228_761 177
746 3300050507 nmdc:mga05p37_59927_c1 nmdc:mga05p37_59927_c1_2120_2683 177
747 2162886007 SwRhRL2b_contig_1405519 SwRhRL2b_0801.00006230 178
748 3300002070 JGI24750J21931_1061138 JGI24750J21931_10611381 178
749 3300002076 JGI24749J21850_1017645 JGI24749J21850_10176451 178
750 3300004798 Ga0058859_11825990 Ga0058859_118259901 178
751 3300005288 Ga0065714_10095418 Ga0065714_100954181 178
752 3300005289 Ga0065704_10004364 Ga0065704_100043642 178
753 3300005289 Ga0065704_10616821 Ga0065704_106168211 178
754 3300005290 Ga0065712_10132359 Ga0065712_101323593 178
755 3300005293 Ga0065715_10159327 Ga0065715_101593272 178
756 3300005293 Ga0065715_10618387 Ga0065715_106183872 178
757 3300005295 Ga0065707_10002895 Ga0065707_100028953 178
758 3300005329 Ga0070683_100197134 Ga0070683_1001971342 178
759 3300005329 Ga0070683_100791651 Ga0070683_1007916512 178
760 3300005330 Ga0070690_100089907 Ga0070690_1000899073 178
761 3300005330 Ga0070690_100146408 Ga0070690_1001464082 178
762 3300005330 Ga0070690_100696579 Ga0070690_1006965792 178
763 3300005331 Ga0070670_100079968 Ga0070670_1000799684 178
764 3300005331 Ga0070670_100315577 Ga0070670_1003155772 178
765 3300005331 Ga0070670_100553054 Ga0070670_1005530542 178
766 3300005333 Ga0070677_10117654 Ga0070677_101176542 178
767 3300005333 Ga0070677_10201929 Ga0070677_102019291 178
768 3300005334 Ga0068869_100488052 Ga0068869_1004880522 178
769 3300005335 Ga0070666_10183699 Ga0070666_101836992 178
770 3300005335 Ga0070666_10193200 Ga0070666_101932003 178
771 3300005338 Ga0068868_100275852 Ga0068868_1002758521 178
772 3300005338 Ga0068868_100998284 Ga0068868_1009982842 178
773 3300005338 Ga0068868_101447236 Ga0068868_1014472361 178
774 3300005340 Ga0070689_100041204 Ga0070689_1000412047 178
775 3300005340 Ga0070689_100818068 Ga0070689_1008180681 178
776 3300005341 Ga0070691_10093465 Ga0070691_100934652 178
777 3300005344 Ga0070661_100683959 Ga0070661_1006839591 178
778 3300005345 Ga0070692_10170042 Ga0070692_101700422 178
779 3300005347 Ga0070668_100141875 Ga0070668_1001418753 178
780 3300005353 Ga0070669_100014081 Ga0070669_1000140818 178
781 3300005353 Ga0070669_100156688 Ga0070669_1001566881 178
782 3300005354 Ga0070675_100029244 Ga0070675_1000292443 178
783 3300005354 Ga0070675_100065146 Ga0070675_1000651465 178
784 3300005354 Ga0070675_100254613 Ga0070675_1002546132 178
785 3300005354 Ga0070675_100290632 Ga0070675_1002906322 178
786 3300005354 Ga0070675_100850775 Ga0070675_1008507751 178
787 3300005355 Ga0070671_100013832 Ga0070671_1000138328 178
788 3300005355 Ga0070671_100234024 Ga0070671_1002340242 178
789 3300005355 Ga0070671_100607051 Ga0070671_1006070511 178
790 3300005355 Ga0070671_100881926 Ga0070671_1008819261 178
791 3300005355 Ga0070671_101024521 Ga0070671_1010245211 178
792 3300005356 Ga0070674_100321880 Ga0070674_1003218802 178
793 3300005356 Ga0070674_100545782 Ga0070674_1005457822 178
794 3300005364 Ga0070673_100085612 Ga0070673_1000856123 178
795 3300005364 Ga0070673_100122237 Ga0070673_1001222374 178
796 3300005364 Ga0070673_100435250 Ga0070673_1004352502 178
797 3300005364 Ga0070673_100693254 Ga0070673_1006932541 178
798 3300005365 Ga0070688_100048402 Ga0070688_1000484023 178
799 3300005365 Ga0070688_100452085 Ga0070688_1004520852 178
800 3300005366 Ga0070659_100341486 Ga0070659_1003414862 178
801 3300005367 Ga0070667_100227949 Ga0070667_1002279493 178
802 3300005367 Ga0070667_100307873 Ga0070667_1003078731 178
803 3300005367 Ga0070667_100352404 Ga0070667_1003524041 178
804 3300005367 Ga0070667_101146719 Ga0070667_1011467191 178
805 3300005438 Ga0070701_10059475 Ga0070701_100594752 178
806 3300005438 Ga0070701_10077997 Ga0070701_100779972 178
807 3300005440 Ga0070705_100008065 Ga0070705_1000080653 178
808 3300005440 Ga0070705_100103582 Ga0070705_1001035822 178
809 3300005440 Ga0070705_100481667 Ga0070705_1004816671 178
810 3300005440 Ga0070705_100492886 Ga0070705_1004928861 178
811 3300005440 Ga0070705_100495162 Ga0070705_1004951621 178
812 3300005440 Ga0070705_100554614 Ga0070705_1005546142 178
813 3300005441 Ga0070700_100065653 Ga0070700_1000656532 178
814 3300005441 Ga0070700_100189667 Ga0070700_1001896673 178
815 3300005441 Ga0070700_100217821 Ga0070700_1002178212 178
816 3300005444 Ga0070694_100078396 Ga0070694_1000783963 178
817 3300005444 Ga0070694_100154134 Ga0070694_1001541342 178
818 3300005444 Ga0070694_100342929 Ga0070694_1003429292 178
819 3300005456 Ga0070678_100200741 Ga0070678_1002007412 178
820 3300005457 Ga0070662_100032222 Ga0070662_1000322223 178
821 3300005457 Ga0070662_100131259 Ga0070662_1001312593 178
822 3300005458 Ga0070681_10830312 Ga0070681_108303122 178
823 3300005459 Ga0068867_100033446 Ga0068867_1000334468 178
824 3300005459 Ga0068867_100057238 Ga0068867_1000572385 178
825 3300005459 Ga0068867_100847269 Ga0068867_1008472691 178
826 3300005459 Ga0068867_101302222 Ga0068867_1013022221 178
827 3300005466 Ga0070685_10021547 Ga0070685_100215471 178
828 3300005466 Ga0070685_10048312 Ga0070685_100483124 178
829 3300005466 Ga0070685_10182320 Ga0070685_101823202 178
830 3300005466 Ga0070685_10326524 Ga0070685_103265241 178
831 3300005466 Ga0070685_10557527 Ga0070685_105575271 178
832 3300005466 Ga0070685_10588926 Ga0070685_105889262 178
833 3300005468 Ga0070707_100209180 Ga0070707_1002091803 178
834 3300005468 Ga0070707_100767600 Ga0070707_1007676002 178
835 3300005471 Ga0070698_100061697 Ga0070698_1000616973 178
836 3300005518 Ga0070699_100031970 Ga0070699_1000319703 178
837 3300005518 Ga0070699_100166495 Ga0070699_1001664953 178
838 3300005518 Ga0070699_100181003 Ga0070699_1001810033 178
839 3300005535 Ga0070684_100193474 Ga0070684_1001934742 178
840 3300005536 Ga0070697_100246218 Ga0070697_1002462182 178
841 3300005536 Ga0070697_100333436 Ga0070697_1003334362 178
842 3300005543 Ga0070672_100033331 Ga0070672_1000333315 178
843 3300005543 Ga0070672_100139399 Ga0070672_1001393991 178
844 3300005543 Ga0070672_100201644 Ga0070672_1002016443 178
845 3300005543 Ga0070672_100231232 Ga0070672_1002312323 178
846 3300005544 Ga0070686_100274637 Ga0070686_1002746372 178
847 3300005544 Ga0070686_100306960 Ga0070686_1003069601 178
848 3300005544 Ga0070686_100360571 Ga0070686_1003605712 178
849 3300005545 Ga0070695_100040059 Ga0070695_1000400593 178
850 3300005545 Ga0070695_100334626 Ga0070695_1003346262 178
851 3300005545 Ga0070695_100403820 Ga0070695_1004038201 178
852 3300005546 Ga0070696_100091008 Ga0070696_1000910082 178
853 3300005546 Ga0070696_100101101 Ga0070696_1001011012 178
854 3300005546 Ga0070696_100131283 Ga0070696_1001312833 178
855 3300005546 Ga0070696_100280227 Ga0070696_1002802272 178
856 3300005549 Ga0070704_100032099 Ga0070704_1000320995 178
857 3300005563 Ga0068855_101311308 Ga0068855_1013113082 178
858 3300005564 Ga0070664_100357995 Ga0070664_1003579952 178
859 3300005564 Ga0070664_100620706 Ga0070664_1006207062 178
860 3300005564 Ga0070664_100622904 Ga0070664_1006229041 178
861 3300005564 Ga0070664_100741094 Ga0070664_1007410942 178
862 3300005577 Ga0068857_100316136 Ga0068857_1003161362 178
863 3300005577 Ga0068857_100462072 Ga0068857_1004620722 178
864 3300005578 Ga0068854_100517030 Ga0068854_1005170302 178
865 3300005578 Ga0068854_100628444 Ga0068854_1006284442 178
866 3300005614 Ga0068856_100553006 Ga0068856_1005530062 178
867 3300005615 Ga0070702_100100416 Ga0070702_1001004162 178
868 3300005617 Ga0068859_100028177 Ga0068859_10002817711 178
869 3300005617 Ga0068859_100081835 Ga0068859_1000818355 178
870 3300005617 Ga0068859_100257919 Ga0068859_1002579194 178
871 3300005618 Ga0068864_100073731 Ga0068864_1000737313 178
872 3300005718 Ga0068866_10126863 Ga0068866_101268631 178
873 3300005718 Ga0068866_10166314 Ga0068866_101663142 178
874 3300005719 Ga0068861_100031215 Ga0068861_1000312156 178
875 3300005719 Ga0068861_100313089 Ga0068861_1003130892 178
876 3300005840 Ga0068870_10019734 Ga0068870_100197345 178
877 3300005840 Ga0068870_10056546 Ga0068870_100565462 178
878 3300005841 Ga0068863_100099538 Ga0068863_1000995382 178
879 3300005841 Ga0068863_100206731 Ga0068863_1002067313 178
880 3300005841 Ga0068863_100659973 Ga0068863_1006599732 178
881 3300005842 Ga0068858_100181332 Ga0068858_1001813323 178
882 3300005842 Ga0068858_101016644 Ga0068858_1010166441 178
883 3300005843 Ga0068860_100607193 Ga0068860_1006071931 178
884 3300005844 Ga0068862_100019275 Ga0068862_1000192758 178
885 3300005985 Ga0081539_10014375 Ga0081539_100143758 178
886 3300006058 Ga0075432_10044541 Ga0075432_100445412 178
887 3300006058 Ga0075432_10055895 Ga0075432_100558952 178
888 3300006237 Ga0097621_100151567 Ga0097621_1001515673 178
889 3300006237 Ga0097621_100266755 Ga0097621_1002667552 178
890 3300006237 Ga0097621_100472961 Ga0097621_1004729611 178
891 3300006237 Ga0097621_100619227 Ga0097621_1006192272 178
892 3300006237 Ga0097621_101018777 Ga0097621_1010187772 178
893 3300006358 Ga0068871_100033642 Ga0068871_1000336423 178
894 3300006358 Ga0068871_100266459 Ga0068871_1002664593 178
895 3300006358 Ga0068871_100699195 Ga0068871_1006991952 178
896 3300006844 Ga0075428_100125528 Ga0075428_1001255284 178
897 3300006846 Ga0075430_100039958 Ga0075430_1000399583 178
898 3300006847 Ga0075431_101119584 Ga0075431_1011195842 178
899 3300006852 Ga0075433_10233635 Ga0075433_102336352 178
900 3300006852 Ga0075433_10236050 Ga0075433_102360502 178
901 3300006871 Ga0075434_100052306 Ga0075434_1000523063 178
902 3300006871 Ga0075434_100181407 Ga0075434_1001814072 178
903 3300006871 Ga0075434_100249725 Ga0075434_1002497253 178
904 3300006871 Ga0075434_100287006 Ga0075434_1002870062 178
905 3300006871 Ga0075434_100428780 Ga0075434_1004287801 178
906 3300006880 Ga0075429_100084571 Ga0075429_1000845713 178
907 3300006880 Ga0075429_100907933 Ga0075429_1009079331 178
908 3300006881 Ga0068865_100233430 Ga0068865_1002334302 178
909 3300006931 Ga0097620_100028177 Ga0097620_1000281773 178
910 3300006931 Ga0097620_100081837 Ga0097620_1000818373 178
911 3300006931 Ga0097620_100257915 Ga0097620_1002579154 178
912 3300007076 Ga0075435_100048510 Ga0075435_1000485102 178
913 3300007076 Ga0075435_100153841 Ga0075435_1001538412 178
914 3300007076 Ga0075435_100277488 Ga0075435_1002774882 178
915 3300007076 Ga0075435_100368059 Ga0075435_1003680592 178
916 3300007076 Ga0075435_100537492 Ga0075435_1005374922 178
917 3300009093 Ga0105240_10960317 Ga0105240_109603172 178
918 3300009094 Ga0111539_10086327 Ga0111539_100863273 178
919 3300009094 Ga0111539_10179168 Ga0111539_101791683 178
920 3300009094 Ga0111539_10994790 Ga0111539_109947902 178
921 3300009098 Ga0105245_10168983 Ga0105245_101689832 178
922 3300009098 Ga0105245_10449117 Ga0105245_104491172 178
923 3300009147 Ga0114129_10076124 Ga0114129_100761243 178
924 3300009147 Ga0114129_10618614 Ga0114129_106186142 178
925 3300009147 Ga0114129_11763793 Ga0114129_117637931 178
926 3300009148 Ga0105243_10074080 Ga0105243_100740804 178
927 3300009148 Ga0105243_10085132 Ga0105243_100851324 178
928 3300009148 Ga0105243_10322453 Ga0105243_103224532 178
929 3300009148 Ga0105243_10487595 Ga0105243_104875952 178
930 3300009148 Ga0105243_11378700 Ga0105243_113787002 178
931 3300009176 Ga0105242_10050864 Ga0105242_100508642 178
932 3300009176 Ga0105242_10193297 Ga0105242_101932972 178
933 3300009176 Ga0105242_10663574 Ga0105242_106635742 178
934 3300009176 Ga0105242_11367102 Ga0105242_113671021 178
935 3300009176 Ga0105242_11450622 Ga0105242_114506222 178
936 3300009177 Ga0105248_10403957 Ga0105248_104039572 178
937 3300009177 Ga0105248_10580324 Ga0105248_105803242 178
938 3300009177 Ga0105248_11572831 Ga0105248_115728312 178
939 3300009177 Ga0105248_11660115 Ga0105248_116601151 178
940 3300009553 Ga0105249_10041597 Ga0105249_100415976 178
941 3300009553 Ga0105249_10219052 Ga0105249_102190523 178
942 3300013100 Ga0157373_10583154 Ga0157373_105831542 178
943 3300013296 Ga0157374_10699373 Ga0157374_106993732 178
944 3300013297 Ga0157378_10121184 Ga0157378_101211843 178
945 3300013297 Ga0157378_10427739 Ga0157378_104277391 178
946 3300013306 Ga0163162_10131850 Ga0163162_101318504 178
947 3300013306 Ga0163162_10692513 Ga0163162_106925132 178
948 3300013308 Ga0157375_10156033 Ga0157375_101560333 178
949 3300013308 Ga0157375_10272667 Ga0157375_102726672 178
950 3300013308 Ga0157375_10511424 Ga0157375_105114243 178
951 3300013308 Ga0157375_10544085 Ga0157375_105440852 178
952 3300013308 Ga0157375_12093949 Ga0157375_120939491 178
953 3300014325 Ga0163163_10131576 Ga0163163_101315763 178
954 3300014325 Ga0163163_11993622 Ga0163163_119936221 178
955 3300014326 Ga0157380_10268081 Ga0157380_102680812 178
956 3300014326 Ga0157380_10283444 Ga0157380_102834442 178
957 3300014326 Ga0157380_10515406 Ga0157380_105154062 178
958 3300014326 Ga0157380_10760254 Ga0157380_107602541 178
959 3300014745 Ga0157377_10186071 Ga0157377_101860712 178
960 3300014745 Ga0157377_10523359 Ga0157377_105233592 178
961 3300014745 Ga0157377_10820386 Ga0157377_108203862 178
962 3300014968 Ga0157379_10241009 Ga0157379_102410093 178
963 3300014969 Ga0157376_10218237 Ga0157376_102182373 178
964 3300017792 Ga0163161_10021424 Ga0163161_100214243 178
965 3300017792 Ga0163161_10150890 Ga0163161_101508903 178
966 3300025271 Ga0207666_1016277 Ga0207666_10162772 178
967 3300025290 Ga0207673_1018101 Ga0207673_10181011 178
968 3300025315 Ga0207697_10017447 Ga0207697_100174473 178
969 3300025885 Ga0207653_10008996 Ga0207653_100089964 178
970 3300025893 Ga0207682_10026915 Ga0207682_100269154 178
971 3300025893 Ga0207682_10141295 Ga0207682_101412952 178
972 3300025899 Ga0207642_10066780 Ga0207642_100667802 178
973 3300025899 Ga0207642_10811831 Ga0207642_108118311 178
974 3300025901 Ga0207688_10458135 Ga0207688_104581352 178
975 3300025903 Ga0207680_10050441 Ga0207680_100504413 178
976 3300025903 Ga0207680_10378659 Ga0207680_103786592 178
977 3300025907 Ga0207645_10082868 Ga0207645_100828682 178
978 3300025907 Ga0207645_10103034 Ga0207645_101030342 178
979 3300025907 Ga0207645_10455144 Ga0207645_104551441 178
980 3300025908 Ga0207643_10017164 Ga0207643_100171642 178
981 3300025908 Ga0207643_10057380 Ga0207643_100573803 178
982 3300025911 Ga0207654_10330709 Ga0207654_103307092 178
983 3300025912 Ga0207707_10973839 Ga0207707_109738391 178
984 3300025918 Ga0207662_10012703 Ga0207662_100127033 178
985 3300025918 Ga0207662_10207618 Ga0207662_102076182 178
986 3300025920 Ga0207649_10075290 Ga0207649_100752903 178
987 3300025920 Ga0207649_10689357 Ga0207649_106893571 178
988 3300025920 Ga0207649_10796285 Ga0207649_107962852 178
989 3300025922 Ga0207646_10070333 Ga0207646_100703332 178
990 3300025922 Ga0207646_10426919 Ga0207646_104269192 178
991 3300025923 Ga0207681_10079412 Ga0207681_100794123 178
992 3300025923 Ga0207681_10114511 Ga0207681_101145112 178
993 3300025923 Ga0207681_11088163 Ga0207681_110881631 178
994 3300025925 Ga0207650_10038113 Ga0207650_100381131 178
995 3300025925 Ga0207650_10143977 Ga0207650_101439772 178
996 3300025925 Ga0207650_10148309 Ga0207650_101483091 178
997 3300025925 Ga0207650_10369943 Ga0207650_103699432 178
998 3300025926 Ga0207659_10030750 Ga0207659_100307508 178
999 3300025926 Ga0207659_10064457 Ga0207659_100644575 178
1000 3300025926 Ga0207659_10247199 Ga0207659_102471993 178
1001 3300025927 Ga0207687_10119082 Ga0207687_101190823 178
1002 3300025927 Ga0207687_10426226 Ga0207687_104262262 178
1003 3300025931 Ga0207644_10026058 Ga0207644_100260587 178
1004 3300025931 Ga0207644_10167225 Ga0207644_101672253 178
1005 3300025932 Ga0207690_10287380 Ga0207690_102873802 178
1006 3300025932 Ga0207690_10435987 Ga0207690_104359872 178
1007 3300025933 Ga0207706_10036899 Ga0207706_100368998 178
1008 3300025933 Ga0207706_10062717 Ga0207706_100627173 178
1009 3300025933 Ga0207706_10228036 Ga0207706_102280363 178
1010 3300025934 Ga0207686_10501873 Ga0207686_105018732 178
1011 3300025935 Ga0207709_10023935 Ga0207709_100239353 178
1012 3300025935 Ga0207709_10039366 Ga0207709_100393663 178
1013 3300025935 Ga0207709_10148060 Ga0207709_101480602 178
1014 3300025936 Ga0207670_10014679 Ga0207670_100146798 178
1015 3300025937 Ga0207669_10289042 Ga0207669_102890422 178
1016 3300025937 Ga0207669_10345826 Ga0207669_103458262 178
1017 3300025938 Ga0207704_10051287 Ga0207704_100512873 178
1018 3300025938 Ga0207704_10106614 Ga0207704_101066142 178
1019 3300025938 Ga0207704_10738776 Ga0207704_107387762 178
1020 3300025940 Ga0207691_10055421 Ga0207691_100554213 178
1021 3300025940 Ga0207691_10055497 Ga0207691_100554972 178
1022 3300025940 Ga0207691_10097212 Ga0207691_100972122 178
1023 3300025940 Ga0207691_10169112 Ga0207691_101691123 178
1024 3300025940 Ga0207691_10222396 Ga0207691_102223962 178
1025 3300025940 Ga0207691_10261739 Ga0207691_102617391 178
1026 3300025941 Ga0207711_10140160 Ga0207711_101401602 178
1027 3300025941 Ga0207711_10513864 Ga0207711_105138642 178
1028 3300025941 Ga0207711_10920943 Ga0207711_109209432 178
1029 3300025942 Ga0207689_10375736 Ga0207689_103757362 178
1030 3300025942 Ga0207689_10519703 Ga0207689_105197032 178
1031 3300025944 Ga0207661_10489897 Ga0207661_104898972 178
1032 3300025944 Ga0207661_10699776 Ga0207661_106997762 178
1033 3300025945 Ga0207679_10036191 Ga0207679_100361912 178
1034 3300025945 Ga0207679_10152164 Ga0207679_101521642 178
1035 3300025945 Ga0207679_10521189 Ga0207679_105211892 178
1036 3300025960 Ga0207651_10258548 Ga0207651_102585482 178
1037 3300025960 Ga0207651_10320096 Ga0207651_103200962 178
1038 3300025960 Ga0207651_10340175 Ga0207651_103401752 178
1039 3300025972 Ga0207668_10239079 Ga0207668_102390792 178
1040 3300025981 Ga0207640_10084796 Ga0207640_100847962 178
1041 3300025981 Ga0207640_10369975 Ga0207640_103699752 178
1042 3300025981 Ga0207640_10388618 Ga0207640_103886182 178
1043 3300025986 Ga0207658_10152996 Ga0207658_101529961 178
1044 3300025986 Ga0207658_10262525 Ga0207658_102625252 178
1045 3300026023 Ga0207677_10278414 Ga0207677_102784142 178
1046 3300026035 Ga0207703_10118170 Ga0207703_101181703 178
1047 3300026035 Ga0207703_10231248 Ga0207703_102312482 178
1048 3300026035 Ga0207703_10476859 Ga0207703_104768592 178
1049 3300026041 Ga0207639_10435676 Ga0207639_104356761 178
1050 3300026041 Ga0207639_10461190 Ga0207639_104611901 178
1051 3300026075 Ga0207708_10088483 Ga0207708_100884834 178
1052 3300026075 Ga0207708_10090858 Ga0207708_100908582 178
1053 3300026075 Ga0207708_10210731 Ga0207708_102107312 178
1054 3300026075 Ga0207708_10246399 Ga0207708_102463993 178
1055 3300026088 Ga0207641_10201047 Ga0207641_102010473 178
1056 3300026088 Ga0207641_10281969 Ga0207641_102819692 178
1057 3300026089 Ga0207648_10035637 Ga0207648_100356378 178
1058 3300026089 Ga0207648_10056796 Ga0207648_100567961 178
1059 3300026089 Ga0207648_10305297 Ga0207648_103052972 178
1060 3300026089 Ga0207648_10333949 Ga0207648_103339491 178
1061 3300026095 Ga0207676_10024598 Ga0207676_100245988 178
1062 3300026095 Ga0207676_10710741 Ga0207676_107107412 178
1063 3300026116 Ga0207674_10140233 Ga0207674_101402333 178
1064 3300026116 Ga0207674_10274896 Ga0207674_102748962 178
1065 3300026118 Ga0207675_100031657 Ga0207675_1000316578 178
1066 3300026118 Ga0207675_100040332 Ga0207675_1000403328 178
1067 3300026121 Ga0207683_10041648 Ga0207683_100416488 178
1068 3300026121 Ga0207683_10634433 Ga0207683_106344331 178
1069 3300026142 Ga0207698_10705478 Ga0207698_107054782 178
1070 3300027907 Ga0207428_10002947 Ga0207428_1000294721 178
1071 3300027907 Ga0207428_10032350 Ga0207428_100323503 178
1072 3300028380 Ga0268265_10000421 Ga0268265_100004218 178
1073 3300028380 Ga0268265_10188525 Ga0268265_101885252 178
1074 3300028381 Ga0268264_10053362 Ga0268264_100533622 178
1075 3300028381 Ga0268264_10250663 Ga0268264_102506632 178
1076 3300028381 Ga0268264_10895340 Ga0268264_108953401 178
1077 3300031548 Ga0307408_100160457 Ga0307408_1001604572 178
1078 3300031824 Ga0307413_10035015 Ga0307413_100350155 178
1079 3300031852 Ga0307410_10014184 Ga0307410_100141844 178
1080 3300031852 Ga0307410_10501784 Ga0307410_105017842 178
1081 3300031901 Ga0307406_10213400 Ga0307406_102134002 178
1082 3300031903 Ga0307407_10006748 Ga0307407_100067483 178
1083 3300031903 Ga0307407_10452123 Ga0307407_104521231 178
1084 3300031911 Ga0307412_10561916 Ga0307412_105619161 178
1085 3300031995 Ga0307409_100008285 Ga0307409_1000082853 178
1086 3300031995 Ga0307409_100032545 Ga0307409_1000325456 178
1087 3300031995 Ga0307409_100342666 Ga0307409_1003426661 178
1088 3300031995 Ga0307409_100818607 Ga0307409_1008186072 178
1089 3300031995 Ga0307409_101230032 Ga0307409_1012300321 178
1090 3300032002 Ga0307416_100009329 Ga0307416_1000093298 178
1091 3300032004 Ga0307414_10031493 Ga0307414_100314934 178
1092 3300032004 Ga0307414_10655971 Ga0307414_106559712 178
1093 3300032004 Ga0307414_10976457 Ga0307414_109764571 178
1094 3300032005 Ga0307411_10036028 Ga0307411_100360284 178
1095 3300032005 Ga0307411_10060259 Ga0307411_100602594 178
1096 3300032005 Ga0307411_10072865 Ga0307411_100728653 178
1097 3300032126 Ga0307415_100017833 Ga0307415_1000178334 178
1098 3300035120 Ga0373957_0254497 Ga0373957_0254497_166_702 178
1099 3300035725 Ga0373947_0079670 Ga0373947_0079670_820_1359 178
1100 3300036401 Ga0373937_0588140 Ga0373937_0588140_77_613 178
1101 3300044673 Ga0453683_0514083 Ga0453683_0514083_205_744 178
1102 3300045051 Ga0451576_0026098 Ga0451576_0026098_2550_3101 178
1103 3300045051 Ga0451576_0247364 Ga0451576_0247364_79_618 178
1104 3300045051 Ga0451576_0725146 Ga0451576_0725146_468_1007 178
1105 3300045051 Ga0451576_1226148 Ga0451576_1226148_177_716 178
1106 3300046475 Ga0495639_0243038 Ga0495639_0243038_311_847 178
1107 3300046499 Ga0495594_0005564 Ga0495594_0005564_5225_5764 178
1108 3300046511 Ga0495608_0249982 Ga0495608_0249982_80_616 178
1109 3300046516 Ga0495628_0388572 Ga0495628_0388572_124_660 178
1110 3300046528 Ga0495642_0278405 Ga0495642_0278405_100_639 178
1111 3300046537 Ga0495598_0013868 Ga0495598_0013868_103_654 178
1112 3300046538 Ga0495609_0278334 Ga0495609_0278334_112_663 178
1113 3300046539 Ga0495621_0008884 Ga0495621_0008884_1633_2193 178
1114 3300046539 Ga0495621_0029709 Ga0495621_0029709_535_1086 178
1115 3300046615 Ga0495656_0137750 Ga0495656_0137750_375_926 178
1116 3300046642 Ga0495634_0190853 Ga0495634_0190853_539_1075 178
1117 3300046664 Ga0495659_0090054 Ga0495659_0090054_484_1023 178
1118 3300046681 Ga0495647_0064387 Ga0495647_0064387_616_1152 178
1119 3300046683 Ga0495658_0205762 Ga0495658_0205762_21_557 178
1120 3300046689 Ga0495613_0121783 Ga0495613_0121783_593_1129 178
1121 3300047315 Ga0495581_0588628 Ga0495581_0588628_56_595 178
1122 3300047318 Ga0495636_0222412 Ga0495636_0222412_11_550 178
1123 3300047447 Ga0495685_090389 Ga0495685_090389_221_760 178
1124 3300048904 Ga0496101_0111219 Ga0496101_0111219_440_976 178
1125 3300048905 Ga0496102_0489692 Ga0496102_0489692_159_695 178
1126 3300048907 Ga0496104_0116569 Ga0496104_0116569_1375_1917 178
1127 3300048908 Ga0496105_0108637 Ga0496105_0108637_520_1065 178
1128 3300048908 Ga0496105_0208594 Ga0496105_0208594_635_1177 178
1129 3300048909 Ga0496106_0227184 Ga0496106_0227184_530_1066 178
1130 3300048909 Ga0496106_0310531 Ga0496106_0310531_210_746 178
1131 3300048910 Ga0496107_0167351 Ga0496107_0167351_997_1533 178
1132 3300048911 Ga0496108_0007055 Ga0496108_0007055_8000_8545 178
1133 3300048911 Ga0496108_0132493 Ga0496108_0132493_1335_1871 178
1134 3300048912 Ga0496109_0040920 Ga0496109_0040920_765_1310 178
1135 3300048912 Ga0496109_0141590 Ga0496109_0141590_738_1274 178
1136 3300048913 Ga0496110_0054227 Ga0496110_0054227_2313_2849 178
1137 3300048913 Ga0496110_0305351 Ga0496110_0305351_221_766 178
1138 3300048913 Ga0496110_0464145 Ga0496110_0464145_47_598 178
1139 3300048917 Ga0496114_0618215 Ga0496114_0618215_313_849 178
1140 3300048917 Ga0496114_0979156 Ga0496114_0979156_135_677 178
1141 3300049568 Ga0501031_0231123 Ga0501031_0231123_233_769 178
1142 3300049569 Ga0501032_0126259 Ga0501032_0126259_829_1365 178
1143 3300049570 Ga0501033_0483760 Ga0501033_0483760_134_670 178
1144 3300049572 Ga0501036_0032096 Ga0501036_0032096_2471_3007 178
1145 3300049572 Ga0501036_0115191 Ga0501036_0115191_500_1036 178
1146 3300049573 Ga0501037_0168931 Ga0501037_0168931_485_1021 178
1147 3300049574 Ga0501038_0206105 Ga0501038_0206105_580_1116 178
1148 3300049574 Ga0501038_0787862 Ga0501038_0787862_38_574 178
1149 3300049575 Ga0501039_0035361 Ga0501039_0035361_2493_3029 178
1150 3300049576 Ga0501040_0013689 Ga0501040_0013689_798_1334 178
1151 3300049577 Ga0501041_0021990 Ga0501041_0021990_2332_2868 178
1152 3300049578 Ga0501042_0026644 Ga0501042_0026644_3006_3542 178
1153 3300049578 Ga0501042_0077986 Ga0501042_0077986_511_1047 178
1154 3300049579 Ga0501043_0128567 Ga0501043_0128567_423_959 178
1155 3300049580 Ga0501046_0002275 Ga0501046_0002275_39_575 178
1156 3300049585 Ga0501069_0159849 Ga0501069_0159849_677_1216 178
1157 3300049587 Ga0501071_0018416 Ga0501071_0018416_3339_3875 178
1158 3300049587 Ga0501071_0764579 Ga0501071_0764579_179_715 178
1159 3300049588 Ga0501072_0048999 Ga0501072_0048999_635_1171 178
1160 3300049588 Ga0501072_0267096 Ga0501072_0267096_386_922 178
1161 3300049591 Ga0501075_0001529 Ga0501075_0001529_2649_3185 178
1162 3300049591 Ga0501075_0195322 Ga0501075_0195322_566_1102 178
1163 3300049592 Ga0501076_0002067 Ga0501076_0002067_1315_1851 178
1164 3300049592 Ga0501076_0036837 Ga0501076_0036837_411_947 178
1165 3300049593 Ga0501077_0050019 Ga0501077_0050019_854_1390 178
1166 3300049593 Ga0501077_0050775 Ga0501077_0050775_1889_2425 178
1167 3300049741 Ga0501079_0086368 Ga0501079_0086368_739_1275 178
1168 3300049742 Ga0501080_0442591 Ga0501080_0442591_268_804 178
1169 3300049743 Ga0501081_0061259 Ga0501081_0061259_914_1450 178
1170 3300049743 Ga0501081_0102183 Ga0501081_0102183_843_1379 178
1171 3300049822 Ga0501035_0401220 Ga0501035_0401220_134_670 178
1172 3300049824 Ga0501045_0008126 Ga0501045_0008126_4925_5461 178
1173 3300049824 Ga0501045_0096171 Ga0501045_0096171_908_1444 178
1174 3300050507 nmdc:mga05p37_117437_c1 nmdc:mga05p37_117437_c1_30_569 178
1175 3300050507 nmdc:mga05p37_68961_c1 nmdc:mga05p37_68961_c1_1507_2082 178
1176 3300050508 nmdc:mga09592_424690_c1 nmdc:mga09592_424690_c1_120_659 178
1177 3300050509 nmdc:mga0qj67_8359_c1 nmdc:mga0qj67_8359_c1_2087_2623 178
1178 3300050511 nmdc:mga08y16_114159_c1 nmdc:mga08y16_114159_c1_2088_2624 178
1179 3300050511 nmdc:mga08y16_374734_c1 nmdc:mga08y16_374734_c1_615_1151 178
1180 3300050511 nmdc:mga08y16_743750_c1 nmdc:mga08y16_743750_c1_299_835 178
1181 3300050512 nmdc:mga0n895_159377_c1 nmdc:mga0n895_159377_c1_182_733 178
1182 3300050512 nmdc:mga0n895_247113_c1 nmdc:mga0n895_247113_c1_902_1453 178
1183 3300050512 nmdc:mga0n895_278704_c1 nmdc:mga0n895_278704_c1_123_698 178
1184 3300050512 nmdc:mga0n895_28020_c1 nmdc:mga0n895_28020_c1_1945_2487 178
1185 3300050512 nmdc:mga0n895_466074_c1 nmdc:mga0n895_466074_c1_700_1236 178
1186 3300050512 nmdc:mga0n895_487206_c1 nmdc:mga0n895_487206_c1_692_1228 178
1187 3300050513 nmdc:mga0rr50_175_c1 nmdc:mga0rr50_175_c1_31563_32099 178
1188 3300050513 nmdc:mga0rr50_448504_c1 nmdc:mga0rr50_448504_c1_164_739 178
1189 3300050513 nmdc:mga0rr50_458783_c1 nmdc:mga0rr50_458783_c1_244_780 178
1190 3300050513 nmdc:mga0rr50_583938_c1 nmdc:mga0rr50_583938_c1_12_548 178
1191 3300050515 nmdc:mga0a205_199648_c1 nmdc:mga0a205_199648_c1_611_1162 178
1192 3300050515 nmdc:mga0a205_389874_c1 nmdc:mga0a205_389874_c1_649_1185 178
1193 3300053077 Ga0495601_0021147 Ga0495601_0021147_2727_3263 178
1194 3300053084 Ga0495595_0095477 Ga0495595_0095477_848_1384 178
1195 3300053085 Ga0495619_0011545 Ga0495619_0011545_1953_2489 178
1196 3300054114 Ga0501084_0013715 Ga0501084_0013715_2155_2691 178
1197 3300054114 Ga0501084_0246125 Ga0501084_0246125_814_1350 178
1198 3300060353 Ga0501082_0001088 Ga0501082_0001088_15084_15620 178
1199 3300060353 Ga0501082_0248149 Ga0501082_0248149_283_819 178
1200 3300061734 Ga0530510_0010884 Ga0530510_0010884_2248_2784 178
1201 3300061734 Ga0530510_0024932 Ga0530510_0024932_654_1190 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

3

101

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ug7-assembly1.cif.gz_LJ 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b 0.9551 1 129
7ug7-assembly1.cif.gz_LJ 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b 0.948 1 129
5gad-assembly1.cif.gz_I rnc-srp-sr complex early state 0.9352 2 125
7unu-assembly1.cif.gz_I pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9345 2 118
7unu-assembly1.cif.gz_I pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.927 2 118
ID Description Score Start End Superfamily
af_Q8I1U9_104_236_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.9152 4 129 3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.9064 3 132 3.30.70.1730
1zaxA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.9016 5 129 3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8872 3 132 3.30.70.1730
6dzpI00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8739 3 129 3.30.70.1730
ID Description Score Start End GO Terms
AF-A0A7V5X184-F1-model_v4 50S ribosomal protein L10 0.9639 3 112 GO:0003735
GO:0006412
GO:0015934
AF-A0A378BFA1-F1-model_v4 Large ribosomal subunit protein uL10 0.9609 1 132 GO:0003735
GO:0006412
GO:0015934
GO:0070180
AF-A0A4Q6BZD9-F1-model_v4 50S ribosomal protein L10 0.9582 1 118 GO:0003735
GO:0006412
GO:0015934
AF-A0A7Z9WDZ0-F1-model_v4 50S ribosomal protein L10 0.9567 3 127 GO:0003735
GO:0006412
GO:0015934
AF-A0A7V5X184-F1-model_v4 50S ribosomal protein L10 0.9555 3 112 GO:0003735
GO:0006412
GO:0015934

Feature Viewer

pLDDT pTM Quality
75.89 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map