F491682
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1208 | 514 | 2416 | 457 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10000924|Ga0105238_1000092418 |
| Length | 513 |
| Sequence | MAKAKTAYVCTDCGAEHNKWQGQCIECNGWNTLSEFVVQPAKAAVAGAGARRGYAGEAAGAPKVTALTEVALTAESRTKTGIGELDRVLGGGLVDGSVVLIGGDPGIGKSTLLLQMLGTLGAVLPSVYVTGEESLAQVAGRAQRLDLPLAPLRALAETCIERILEQALATRPRVLVIDSIQTIWTETLTAAPGSVSQVRESAARLTRFAKETGTSVFLVGHVTKEGGIAGPRVLEHMVDAVLYFEGESGSRFRVLRAFKNRFGAVNELGVFAMSEKGLREVPNPSAIFLSTHTGPTSGSAVMVTREGTRPLLVEVQALVDQSSLGNPRRVALGMEQNRLAMLLAVLHRHGGLAVYDQDVFVNVVGGIRVQETAADLPVLLAVLSSFRDRPLPEKTVAFGEVGLSGEIRPVPNGEERLKEAATHGFRSHRAQGQCAEENAYRRDGSDRRGSSWRRHRAGDGLIDVGAWAERGSRSGCGSASVRIPLQQGVAQLCFLTPLPRFPPPSQPWRCSKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 134 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 135 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 233 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 234 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 235 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 236 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 237 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 238 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 239 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 240 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 242 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 249 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 250 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 257 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 258 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 260 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 263 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 264 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 265 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 266 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 267 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 268 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 269 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 270 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 271 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 272 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 273 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 274 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 275 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 281 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 282 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 283 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 284 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 285 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 286 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 287 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 288 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 292 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 293 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 294 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 295 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 296 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 297 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 298 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 299 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 300 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 360 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 361 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 362 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 363 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 364 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 365 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 366 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 367 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 401 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 404 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 405 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 414 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 416 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 417 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 420 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 421 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 425 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 426 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 427 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 428 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 429 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 430 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 431 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 432 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 433 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 434 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 435 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 436 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 437 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 438 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 439 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 440 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 441 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 442 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 443 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 444 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 445 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 446 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 447 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 448 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 449 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 450 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 451 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 452 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 453 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 454 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 455 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 456 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 457 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 458 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 459 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 460 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 461 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 462 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 463 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 464 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 465 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 466 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 467 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 468 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 469 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 470 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 471 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 472 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 473 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 474 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 475 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 476 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 477 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 478 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 479 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 480 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 481 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 482 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 483 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 484 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 485 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 486 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 487 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 488 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 489 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 490 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 491 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 492 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 493 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 494 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 495 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 496 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 497 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 498 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 499 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 500 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 501 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 502 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 503 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 504 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 505 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 506 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 507 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 508 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 509 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 510 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 511 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 512 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 513 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 514 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.56 |
| Metatranscriptomes | 0.99 |
| Isolates | 7.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.08 |
| Bulb | 0 |
| Endosphere | 15.89 |
| Nodule | 0.25 |
| Rhizoplane | 2.24 |
| Rhizosphere | 66.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105238_10000924 | 3300009551 | Bacteria | 30076 |
| 2 | SwRhRL2b_contig_3055844 | 2162886007 | Bacteria | 22848 |
| 3 | JGI24741J21665_1002156 | 3300001915 | Bacteria | 5235 |
| 4 | JGI24741J21665_1009817 | 3300001915 | Bacteria | 1740 |
| 5 | JGI24740J21852_10002197 | 3300001979 | Bacteria | 8920 |
| 6 | JGI24740J21852_10005668 | 3300001979 | Bacteria | 5257 |
| 7 | JGI24739J22299_10002332 | 3300001989 | Bacteria | 7312 |
| 8 | JGI24739J22299_10013417 | 3300001989 | Bacteria | 2993 |
| 9 | JGI24737J22298_10000899 | 3300001990 | Bacteria | 10568 |
| 10 | JGI24737J22298_10016466 | 3300001990 | Bacteria | 2386 |
| 11 | JGI25156J39149_1007693 | 3300002705 | Bacteria | 2796 |
| 12 | JGI25162J39368_1000226 | 3300002737 | Bacteria | 57732 |
| 13 | JGI25162J39368_1000686 | 3300002737 | Bacteria | 23602 |
| 14 | JGI25162J39368_1003175 | 3300002737 | Bacteria | 5127 |
| 15 | JGI25162J39368_1003182 | 3300002737 | Bacteria | 5116 |
| 16 | JGI25162J39368_1005076 | 3300002737 | Bacteria | 2744 |
| 17 | JGI25157J39369_1001011 | 3300002741 | Bacteria | 13050 |
| 18 | JGI25157J39369_1001369 | 3300002741 | Bacteria | 9520 |
| 19 | JGI25157J39369_1001673 | 3300002741 | Bacteria | 7535 |
| 20 | JGI25163J39215_1001647 | 3300002771 | Bacteria | 3305 |
| 21 | JGI25164J39214_1000045 | 3300002772 | Bacteria | 125909 |
| 22 | JGI25164J39214_1000435 | 3300002772 | Bacteria | 22777 |
| 23 | JGI25164J39214_1001511 | 3300002772 | Bacteria | 5227 |
| 24 | JGI25164J39214_1001528 | 3300002772 | Bacteria | 5131 |
| 25 | JGI25152J39213_1000231 | 3300002773 | Bacteria | 37495 |
| 26 | JGI25150J39212_1000095 | 3300002774 | Bacteria | 50881 |
| 27 | JGI25151J46595_10000183 | 3300003187 | Bacteria | 78518 |
| 28 | JGI25151J46595_10000195 | 3300003187 | Bacteria | 74795 |
| 29 | JGI25151J46595_10000477 | 3300003187 | Bacteria | 37879 |
| 30 | JGI25165J46597_1000072 | 3300003214 | Bacteria | 192184 |
| 31 | JGI25165J46597_1000260 | 3300003214 | Bacteria | 70453 |
| 32 | JGI25165J46597_1002761 | 3300003214 | Bacteria | 5131 |
| 33 | JGI25153J46596_10000291 | 3300003215 | Bacteria | 37879 |
| 34 | JGI26141J51220_1001122 | 3300003503 | Bacteria | 1601 |
| 35 | Ga0006562J51391_1014504 | 3300003578 | Bacteria | 8150 |
| 36 | Ga0006562J51391_1014508 | 3300003578 | Bacteria | 4580 |
| 37 | Ga0006562J51391_1103326 | 3300003578 | Bacteria | 3630 |
| 38 | Ga0055533_1000545 | 3300003756 | Bacteria | 13392 |
| 39 | Ga0055525_1000027 | 3300003759 | Bacteria | 340506 |
| 40 | Ga0055527_1000293 | 3300003760 | Bacteria | 28864 |
| 41 | Ga0055527_1000294 | 3300003760 | Bacteria | 28742 |
| 42 | Ga0055527_1000694 | 3300003760 | Bacteria | 9781 |
| 43 | Ga0055535_1000623 | 3300003761 | Bacteria | 28693 |
| 44 | Ga0055535_1001746 | 3300003761 | Bacteria | 9711 |
| 45 | Ga0055535_1001841 | 3300003761 | Bacteria | 9085 |
| 46 | Ga0055535_1002043 | 3300003761 | Bacteria | 8164 |
| 47 | Ga0055535_1002731 | 3300003761 | Bacteria | 5687 |
| 48 | Ga0055542_1000275 | 3300003762 | Bacteria | 57732 |
| 49 | Ga0055542_1000329 | 3300003762 | Bacteria | 50369 |
| 50 | Ga0055542_1000649 | 3300003762 | Bacteria | 28693 |
| 51 | Ga0055542_1000744 | 3300003762 | Bacteria | 25103 |
| 52 | Ga0055542_1001536 | 3300003762 | Bacteria | 11068 |
| 53 | Ga0055542_1001924 | 3300003762 | Bacteria | 8164 |
| 54 | Ga0055529_1000233 | 3300003763 | Bacteria | 70453 |
| 55 | Ga0055529_1000684 | 3300003763 | Bacteria | 23266 |
| 56 | Ga0055529_1001153 | 3300003763 | Bacteria | 11068 |
| 57 | Ga0055529_1001341 | 3300003763 | Bacteria | 8164 |
| 58 | Ga0055526_1000157 | 3300003771 | Bacteria | 60697 |
| 59 | Ga0055537_1000169 | 3300003773 | Bacteria | 48599 |
| 60 | Ga0055524_1000288 | 3300003775 | Bacteria | 48798 |
| 61 | Ga0055536_1005549 | 3300003781 | Bacteria | 6135 |
| 62 | Ga0055534_1000110 | 3300003784 | Bacteria | 60793 |
| 63 | Ga0055534_1000393 | 3300003784 | Bacteria | 27221 |
| 64 | Ga0055528_1000131 | 3300003790 | Bacteria | 60697 |
| 65 | Ga0055528_1000946 | 3300003790 | Bacteria | 19321 |
| 66 | Ga0055530_10002947 | 3300003791 | Bacteria | 10283 |
| 67 | Ga0055530_10005690 | 3300003791 | Bacteria | 5821 |
| 68 | Ga0055540_1016278 | 3300003792 | Bacteria | 2123 |
| 69 | Ga0055531_10001282 | 3300003794 | Bacteria | 18939 |
| 70 | Ga0055531_10011812 | 3300003794 | Bacteria | 4169 |
| 71 | Ga0055531_10017163 | 3300003794 | Bacteria | 3071 |
| 72 | Ga0058692_1000002 | 3300003856 | Bacteria | 508401 |
| 73 | Ga0058692_1000017 | 3300003856 | Bacteria | 274459 |
| 74 | Ga0065165_1000587 | 3300005262 | Bacteria | 53507 |
| 75 | Ga0065165_1005214 | 3300005262 | Bacteria | 7473 |
| 76 | Ga0065714_10014766 | 3300005288 | Bacteria | 2918 |
| 77 | Ga0065704_10000275 | 3300005289 | Bacteria | 50973 |
| 78 | Ga0065704_10002244 | 3300005289 | Bacteria | 9786 |
| 79 | Ga0065715_10008318 | 3300005293 | Bacteria | 3495 |
| 80 | Ga0070658_10004423 | 3300005327 | Bacteria | 11448 |
| 81 | Ga0070683_100009388 | 3300005329 | Bacteria | 8365 |
| 82 | Ga0070683_100030128 | 3300005329 | Bacteria | 4921 |
| 83 | Ga0070670_100005186 | 3300005331 | Bacteria | 10969 |
| 84 | Ga0070670_100015079 | 3300005331 | Bacteria | 6633 |
| 85 | Ga0070670_100057852 | 3300005331 | Bacteria | 3327 |
| 86 | Ga0068869_100011621 | 3300005334 | Bacteria | 5782 |
| 87 | Ga0068869_100056293 | 3300005334 | Bacteria | 2868 |
| 88 | Ga0070666_10000005 | 3300005335 | Bacteria | 343092 |
| 89 | Ga0070666_10000109 | 3300005335 | Bacteria | 56796 |
| 90 | Ga0070666_10091149 | 3300005335 | Bacteria | 2094 |
| 91 | Ga0070680_100000582 | 3300005336 | Bacteria | 25199 |
| 92 | Ga0070680_100011170 | 3300005336 | Bacteria | 6946 |
| 93 | Ga0070680_100019943 | 3300005336 | Bacteria | 5315 |
| 94 | Ga0070682_100007842 | 3300005337 | Bacteria | 6009 |
| 95 | Ga0068868_100096767 | 3300005338 | Bacteria | 2385 |
| 96 | Ga0070660_100022544 | 3300005339 | Bacteria | 4658 |
| 97 | Ga0070660_100092497 | 3300005339 | Bacteria | 2387 |
| 98 | Ga0070660_100093919 | 3300005339 | Bacteria | 2369 |
| 99 | Ga0070691_10004017 | 3300005341 | Bacteria | 6661 |
| 100 | Ga0070661_100025439 | 3300005344 | Bacteria | 4254 |
| 101 | Ga0070661_100066014 | 3300005344 | Bacteria | 2659 |
| 102 | Ga0070661_100224930 | 3300005344 | Bacteria | 1440 |
| 103 | Ga0070692_10013541 | 3300005345 | Bacteria | 3806 |
| 104 | Ga0070668_100015112 | 3300005347 | Bacteria | 5768 |
| 105 | Ga0070668_100055546 | 3300005347 | Bacteria | 3057 |
| 106 | Ga0070671_100022064 | 3300005355 | Bacteria | 5201 |
| 107 | Ga0070673_100035809 | 3300005364 | Bacteria | 3767 |
| 108 | Ga0070659_100004293 | 3300005366 | Bacteria | 10174 |
| 109 | Ga0070659_100015194 | 3300005366 | Bacteria | 5761 |
| 110 | Ga0070659_100040216 | 3300005366 | Bacteria | 3653 |
| 111 | Ga0070659_100121716 | 3300005366 | Bacteria | 2114 |
| 112 | Ga0070667_100000005 | 3300005367 | Bacteria | 347268 |
| 113 | Ga0070667_100011088 | 3300005367 | Bacteria | 7456 |
| 114 | Ga0070714_100000030 | 3300005435 | Bacteria | 136610 |
| 115 | Ga0070714_100022547 | 3300005435 | Bacteria | 5164 |
| 116 | Ga0070663_100001614 | 3300005455 | Bacteria | 12448 |
| 117 | Ga0070663_100021593 | 3300005455 | Bacteria | 4285 |
| 118 | Ga0070663_100030288 | 3300005455 | Bacteria | 3706 |
| 119 | Ga0070663_100063269 | 3300005455 | Bacteria | 2671 |
| 120 | Ga0070678_100022542 | 3300005456 | Bacteria | 4176 |
| 121 | Ga0070662_100029847 | 3300005457 | Bacteria | 3809 |
| 122 | Ga0070662_100176421 | 3300005457 | Bacteria | 1682 |
| 123 | Ga0070681_10000012 | 3300005458 | Bacteria | 137191 |
| 124 | Ga0070681_10000151 | 3300005458 | Bacteria | 52829 |
| 125 | Ga0070681_10015872 | 3300005458 | Bacteria | 7509 |
| 126 | Ga0070681_10021334 | 3300005458 | Bacteria | 6494 |
| 127 | Ga0070681_10049132 | 3300005458 | Bacteria | 4214 |
| 128 | Ga0070681_10215218 | 3300005458 | Bacteria | 1838 |
| 129 | Ga0068867_100047162 | 3300005459 | Bacteria | 3167 |
| 130 | Ga0070685_10020643 | 3300005466 | Bacteria | 3566 |
| 131 | Ga0070706_100137400 | 3300005467 | Bacteria | 2281 |
| 132 | Ga0070707_100044426 | 3300005468 | Bacteria | 4254 |
| 133 | Ga0070698_100003276 | 3300005471 | Bacteria | 17787 |
| 134 | Ga0070698_100007458 | 3300005471 | Bacteria | 11830 |
| 135 | Ga0070699_100006355 | 3300005518 | Bacteria | 10302 |
| 136 | Ga0070699_100007511 | 3300005518 | Bacteria | 9480 |
| 137 | Ga0070679_100000250 | 3300005530 | Bacteria | 45069 |
| 138 | Ga0070679_100002170 | 3300005530 | Bacteria | 17707 |
| 139 | Ga0070679_100017294 | 3300005530 | Bacteria | 6978 |
| 140 | Ga0070679_100018115 | 3300005530 | Bacteria | 6827 |
| 141 | Ga0070679_100020190 | 3300005530 | Bacteria | 6494 |
| 142 | Ga0070679_100084666 | 3300005530 | Bacteria | 3159 |
| 143 | Ga0070679_100091324 | 3300005530 | Bacteria | 3033 |
| 144 | Ga0070679_100190477 | 3300005530 | Bacteria | 2020 |
| 145 | Ga0070684_100043290 | 3300005535 | Bacteria | 3887 |
| 146 | Ga0068853_100007278 | 3300005539 | Bacteria | 8861 |
| 147 | Ga0068853_100037423 | 3300005539 | Bacteria | 4128 |
| 148 | Ga0068853_100042692 | 3300005539 | Bacteria | 3878 |
| 149 | Ga0068853_100211371 | 3300005539 | Bacteria | 1768 |
| 150 | Ga0070672_100020456 | 3300005543 | Bacteria | 4827 |
| 151 | Ga0070672_100028699 | 3300005543 | Bacteria | 4164 |
| 152 | Ga0070672_100133477 | 3300005543 | Bacteria | 2043 |
| 153 | Ga0070696_100016563 | 3300005546 | Bacteria | 4968 |
| 154 | Ga0070696_100087642 | 3300005546 | Bacteria | 2211 |
| 155 | Ga0070693_100004804 | 3300005547 | Bacteria | 6436 |
| 156 | Ga0070693_100011978 | 3300005547 | Bacteria | 4379 |
| 157 | Ga0070693_100022508 | 3300005547 | Bacteria | 3353 |
| 158 | Ga0070665_100000057 | 3300005548 | Bacteria | 237271 |
| 159 | Ga0070665_100002080 | 3300005548 | Bacteria | 22457 |
| 160 | Ga0070665_100007314 | 3300005548 | Bacteria | 11232 |
| 161 | Ga0070665_100055961 | 3300005548 | Bacteria | 3955 |
| 162 | Ga0070665_100081154 | 3300005548 | Bacteria | 3249 |
| 163 | Ga0070665_100094147 | 3300005548 | Bacteria | 3001 |
| 164 | Ga0068855_100006636 | 3300005563 | Bacteria | 14054 |
| 165 | Ga0068855_100009999 | 3300005563 | Bacteria | 11430 |
| 166 | Ga0068855_100011362 | 3300005563 | Bacteria | 10749 |
| 167 | Ga0068855_100048818 | 3300005563 | Bacteria | 4994 |
| 168 | Ga0068855_100051540 | 3300005563 | Bacteria | 4848 |
| 169 | Ga0068855_100175469 | 3300005563 | Bacteria | 2425 |
| 170 | Ga0070664_100142482 | 3300005564 | Bacteria | 2111 |
| 171 | Ga0068857_100018935 | 3300005577 | Bacteria | 6040 |
| 172 | Ga0068857_100027344 | 3300005577 | Bacteria | 5032 |
| 173 | Ga0068854_100007062 | 3300005578 | Bacteria | 7168 |
| 174 | Ga0068854_100018464 | 3300005578 | Bacteria | 4682 |
| 175 | Ga0068856_100000562 | 3300005614 | Bacteria | 40765 |
| 176 | Ga0068856_100014061 | 3300005614 | Bacteria | 7740 |
| 177 | Ga0068856_100017954 | 3300005614 | Bacteria | 6859 |
| 178 | Ga0068856_100047688 | 3300005614 | Bacteria | 4221 |
| 179 | Ga0068856_100054557 | 3300005614 | Bacteria | 3942 |
| 180 | Ga0068856_100061782 | 3300005614 | Bacteria | 3701 |
| 181 | Ga0068852_100070903 | 3300005616 | Bacteria | 3058 |
| 182 | Ga0068852_100082345 | 3300005616 | Bacteria | 2859 |
| 183 | Ga0068852_100145566 | 3300005616 | Bacteria | 2197 |
| 184 | Ga0068859_100001188 | 3300005617 | Bacteria | 26597 |
| 185 | Ga0068859_100032636 | 3300005617 | Bacteria | 5230 |
| 186 | Ga0068859_100149907 | 3300005617 | Bacteria | 2408 |
| 187 | Ga0068864_100027618 | 3300005618 | Bacteria | 4795 |
| 188 | Ga0068864_100248184 | 3300005618 | Bacteria | 1651 |
| 189 | Ga0068861_100057351 | 3300005719 | Bacteria | 2975 |
| 190 | Ga0068851_10034009 | 3300005834 | Bacteria | 2543 |
| 191 | Ga0068863_100014237 | 3300005841 | Bacteria | 7664 |
| 192 | Ga0068858_100000756 | 3300005842 | Bacteria | 33914 |
| 193 | Ga0068860_100022592 | 3300005843 | Bacteria | 6081 |
| 194 | Ga0068860_100070622 | 3300005843 | Bacteria | 3320 |
| 195 | Ga0075365_10003207 | 3300006038 | Bacteria | 8363 |
| 196 | Ga0075363_100000300 | 3300006048 | Bacteria | 14500 |
| 197 | Ga0075364_10000282 | 3300006051 | Bacteria | 24892 |
| 198 | Ga0075364_10000611 | 3300006051 | Bacteria | 18426 |
| 199 | Ga0075364_10019278 | 3300006051 | Bacteria | 4280 |
| 200 | Ga0075364_10064642 | 3300006051 | Bacteria | 2401 |
| 201 | Ga0075364_10084553 | 3300006051 | Bacteria | 2101 |
| 202 | Ga0075367_10001307 | 3300006178 | Bacteria | 10548 |
| 203 | Ga0075369_10000096 | 3300006186 | Bacteria | 23766 |
| 204 | Ga0075427_10000040 | 3300006194 | Bacteria | 9268 |
| 205 | Ga0097621_100051852 | 3300006237 | Bacteria | 3340 |
| 206 | Ga0075370_10000080 | 3300006353 | Bacteria | 29469 |
| 207 | Ga0068871_100039443 | 3300006358 | Bacteria | 3779 |
| 208 | Ga0068871_100148287 | 3300006358 | Bacteria | 1999 |
| 209 | Ga0075428_100248666 | 3300006844 | Bacteria | 1917 |
| 210 | Ga0075428_100259391 | 3300006844 | Bacteria | 1872 |
| 211 | Ga0075430_100065380 | 3300006846 | Bacteria | 3055 |
| 212 | Ga0075431_100000523 | 3300006847 | Bacteria | 32218 |
| 213 | Ga0075433_10115062 | 3300006852 | Bacteria | 2386 |
| 214 | Ga0075434_100030354 | 3300006871 | Bacteria | 5322 |
| 215 | Ga0075434_100148119 | 3300006871 | Bacteria | 2367 |
| 216 | Ga0075429_100006840 | 3300006880 | Bacteria | 9897 |
| 217 | Ga0097620_100001188 | 3300006931 | Bacteria | 26597 |
| 218 | Ga0097620_100032636 | 3300006931 | Bacteria | 5230 |
| 219 | Ga0097620_100149909 | 3300006931 | Bacteria | 2408 |
| 220 | Ga0099794_10000547 | 3300007265 | Bacteria | 12624 |
| 221 | Ga0105251_10000219 | 3300009011 | Bacteria | 58096 |
| 222 | Ga0105240_10000898 | 3300009093 | Bacteria | 53055 |
| 223 | Ga0105240_10010308 | 3300009093 | Bacteria | 13156 |
| 224 | Ga0105240_10016744 | 3300009093 | Bacteria | 9914 |
| 225 | Ga0105240_10023437 | 3300009093 | Bacteria | 8161 |
| 226 | Ga0105240_10024511 | 3300009093 | Bacteria | 7950 |
| 227 | Ga0105240_10074438 | 3300009093 | Bacteria | 4192 |
| 228 | Ga0105240_10211204 | 3300009093 | Bacteria | 2268 |
| 229 | Ga0105240_10448027 | 3300009093 | Bacteria | 1445 |
| 230 | Ga0111539_10049286 | 3300009094 | Bacteria | 5024 |
| 231 | Ga0114129_10011620 | 3300009147 | Bacteria | 12534 |
| 232 | Ga0114129_10039875 | 3300009147 | Bacteria | 6625 |
| 233 | Ga0114129_10284607 | 3300009147 | Bacteria | 2208 |
| 234 | Ga0105243_10003262 | 3300009148 | Bacteria | 13207 |
| 235 | Ga0105241_10003742 | 3300009174 | Bacteria | 11283 |
| 236 | Ga0105241_10024704 | 3300009174 | Bacteria | 4463 |
| 237 | Ga0105241_10055513 | 3300009174 | Bacteria | 3035 |
| 238 | Ga0105242_10000940 | 3300009176 | Bacteria | 22701 |
| 239 | Ga0105248_10001462 | 3300009177 | Bacteria | 26311 |
| 240 | Ga0105248_10044939 | 3300009177 | Bacteria | 4953 |
| 241 | Ga0105237_10000064 | 3300009545 | Bacteria | 139463 |
| 242 | Ga0105237_10000183 | 3300009545 | Bacteria | 88412 |
| 243 | Ga0105237_10004545 | 3300009545 | Bacteria | 16029 |
| 244 | Ga0105237_10018769 | 3300009545 | Bacteria | 7151 |
| 245 | Ga0105237_10288567 | 3300009545 | Bacteria | 1643 |
| 246 | Ga0105237_10291157 | 3300009545 | Bacteria | 1636 |
| 247 | Ga0105238_10001307 | 3300009551 | Bacteria | 25025 |
| 248 | Ga0105238_10006865 | 3300009551 | Bacteria | 11367 |
| 249 | Ga0105238_10052297 | 3300009551 | Bacteria | 4106 |
| 250 | Ga0105249_10000763 | 3300009553 | Bacteria | 28922 |
| 251 | Ga0105249_10005381 | 3300009553 | Bacteria | 11047 |
| 252 | Ga0105032_100667 | 3300009979 | Bacteria | 3358 |
| 253 | Ga0105239_10000030 | 3300010375 | Bacteria | 233669 |
| 254 | Ga0105239_10008425 | 3300010375 | Bacteria | 11739 |
| 255 | Ga0105239_10009795 | 3300010375 | Bacteria | 10767 |
| 256 | Ga0105239_10011192 | 3300010375 | Bacteria | 10013 |
| 257 | Ga0105239_10016070 | 3300010375 | Bacteria | 8281 |
| 258 | Ga0105239_10039052 | 3300010375 | Bacteria | 5201 |
| 259 | Ga0105239_10066978 | 3300010375 | Bacteria | 3944 |
| 260 | Ga0105239_10098477 | 3300010375 | Bacteria | 3232 |
| 261 | Ga0105239_10113787 | 3300010375 | Bacteria | 3001 |
| 262 | Ga0157373_10028299 | 3300013100 | Bacteria | 4043 |
| 263 | Ga0157371_10012688 | 3300013102 | Bacteria | 6428 |
| 264 | Ga0157371_10025362 | 3300013102 | Bacteria | 4321 |
| 265 | Ga0157371_10063818 | 3300013102 | Bacteria | 2611 |
| 266 | Ga0157371_10103052 | 3300013102 | Bacteria | 2025 |
| 267 | Ga0157370_10000407 | 3300013104 | Bacteria | 54357 |
| 268 | Ga0157370_10002303 | 3300013104 | Bacteria | 23111 |
| 269 | Ga0157370_10007052 | 3300013104 | Bacteria | 12267 |
| 270 | Ga0157370_10012852 | 3300013104 | Bacteria | 8655 |
| 271 | Ga0157370_10018203 | 3300013104 | Bacteria | 7069 |
| 272 | Ga0157370_10030975 | 3300013104 | Bacteria | 5238 |
| 273 | Ga0157370_10085469 | 3300013104 | Bacteria | 2964 |
| 274 | Ga0157370_10214567 | 3300013104 | Bacteria | 1783 |
| 275 | Ga0157369_10000195 | 3300013105 | Bacteria | 84688 |
| 276 | Ga0157369_10000509 | 3300013105 | Bacteria | 51146 |
| 277 | Ga0157369_10003447 | 3300013105 | Bacteria | 18744 |
| 278 | Ga0157369_10004837 | 3300013105 | Bacteria | 15811 |
| 279 | Ga0157369_10028624 | 3300013105 | Bacteria | 6165 |
| 280 | Ga0157369_10045167 | 3300013105 | Bacteria | 4793 |
| 281 | Ga0157369_10046724 | 3300013105 | Bacteria | 4704 |
| 282 | Ga0157374_10011393 | 3300013296 | Bacteria | 7695 |
| 283 | Ga0157374_10042600 | 3300013296 | Bacteria | 4188 |
| 284 | Ga0157374_10054149 | 3300013296 | Bacteria | 3742 |
| 285 | Ga0157374_10144118 | 3300013296 | Bacteria | 2313 |
| 286 | Ga0157378_10000043 | 3300013297 | Bacteria | 107750 |
| 287 | Ga0163162_10000015 | 3300013306 | Bacteria | 261996 |
| 288 | Ga0163162_10008148 | 3300013306 | Bacteria | 10224 |
| 289 | Ga0163162_10009175 | 3300013306 | Bacteria | 9626 |
| 290 | Ga0163162_10045124 | 3300013306 | Bacteria | 4415 |
| 291 | Ga0157372_10001376 | 3300013307 | Bacteria | 26252 |
| 292 | Ga0157372_10005235 | 3300013307 | Bacteria | 13783 |
| 293 | Ga0157372_10005613 | 3300013307 | Bacteria | 13341 |
| 294 | Ga0157372_10037943 | 3300013307 | Bacteria | 5316 |
| 295 | Ga0157372_10039541 | 3300013307 | Bacteria | 5206 |
| 296 | Ga0157372_10047036 | 3300013307 | Bacteria | 4792 |
| 297 | Ga0157372_10125511 | 3300013307 | Bacteria | 2951 |
| 298 | Ga0157375_10000940 | 3300013308 | Bacteria | 25256 |
| 299 | Ga0157375_10001135 | 3300013308 | Bacteria | 23067 |
| 300 | Ga0157375_10019516 | 3300013308 | Bacteria | 6168 |
| 301 | Ga0157375_10062201 | 3300013308 | Bacteria | 3709 |
| 302 | Ga0157375_10073185 | 3300013308 | Bacteria | 3446 |
| 303 | Ga0163163_10000196 | 3300014325 | Bacteria | 62407 |
| 304 | Ga0163163_10039519 | 3300014325 | Bacteria | 4605 |
| 305 | Ga0157380_10001358 | 3300014326 | Bacteria | 15941 |
| 306 | Ga0182008_10002952 | 3300014497 | Bacteria | 10466 |
| 307 | Ga0182008_10005759 | 3300014497 | Bacteria | 7012 |
| 308 | Ga0182008_10009735 | 3300014497 | Bacteria | 5174 |
| 309 | Ga0182008_10013586 | 3300014497 | Bacteria | 4280 |
| 310 | Ga0157379_10040669 | 3300014968 | Bacteria | 4150 |
| 311 | Ga0157379_10067062 | 3300014968 | Bacteria | 3209 |
| 312 | Ga0157376_10002600 | 3300014969 | Bacteria | 12261 |
| 313 | Ga0157376_10117229 | 3300014969 | Bacteria | 2354 |
| 314 | Ga0157376_10152496 | 3300014969 | Bacteria | 2085 |
| 315 | Ga0182006_1000085 | 3300015261 | Bacteria | 117595 |
| 316 | Ga0182006_1001966 | 3300015261 | Bacteria | 11638 |
| 317 | Ga0182006_1007417 | 3300015261 | Bacteria | 5020 |
| 318 | Ga0182006_1029139 | 3300015261 | Bacteria | 2238 |
| 319 | Ga0182006_1033402 | 3300015261 | Bacteria | 2063 |
| 320 | Ga0182007_10001735 | 3300015262 | Bacteria | 11472 |
| 321 | Ga0182007_10003021 | 3300015262 | Bacteria | 8128 |
| 322 | Ga0182007_10003786 | 3300015262 | Bacteria | 7048 |
| 323 | Ga0182007_10006163 | 3300015262 | Bacteria | 5175 |
| 324 | Ga0182005_1000028 | 3300015265 | Bacteria | 221889 |
| 325 | Ga0182005_1001033 | 3300015265 | Bacteria | 11788 |
| 326 | Ga0183369_1007 | 3300015685 | Bacteria | 414878 |
| 327 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 328 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 329 | Ga0163161_10003975 | 3300017792 | Bacteria | 10353 |
| 330 | Ga0163161_10009726 | 3300017792 | Bacteria | 6661 |
| 331 | Ga0163161_10019639 | 3300017792 | Bacteria | 4740 |
| 332 | Ga0206356_10829538 | 3300020070 | Bacteria | 2824 |
| 333 | Ga0206356_11137636 | 3300020070 | Bacteria | 3095 |
| 334 | Ga0206354_11451415 | 3300020081 | Bacteria | 7136 |
| 335 | Ga0206353_10693000 | 3300020082 | Bacteria | 3463 |
| 336 | Ga0154015_1092133 | 3300020610 | Bacteria | 3070 |
| 337 | Ga0209435_103996 | 3300025206 | Bacteria | 1678 |
| 338 | Ga0209760_100625 | 3300025207 | Bacteria | 6019 |
| 339 | Ga0209784_100709 | 3300025224 | Bacteria | 8923 |
| 340 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 341 | Ga0209674_100119 | 3300025226 | Bacteria | 135468 |
| 342 | Ga0209674_100603 | 3300025226 | Bacteria | 13673 |
| 343 | Ga0209674_102640 | 3300025226 | Bacteria | 3722 |
| 344 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 345 | Ga0209672_100016 | 3300025228 | Bacteria | 522604 |
| 346 | Ga0209672_100312 | 3300025228 | Bacteria | 32535 |
| 347 | Ga0209672_101666 | 3300025228 | Bacteria | 7228 |
| 348 | Ga0209147_102563 | 3300025229 | Bacteria | 4370 |
| 349 | Ga0209563_100023 | 3300025230 | Bacteria | 636844 |
| 350 | Ga0207427_100055 | 3300025231 | Bacteria | 209093 |
| 351 | Ga0207427_100156 | 3300025231 | Bacteria | 77311 |
| 352 | Ga0207427_101364 | 3300025231 | Bacteria | 9003 |
| 353 | Ga0207427_101551 | 3300025231 | Bacteria | 7984 |
| 354 | Ga0207427_101571 | 3300025231 | Bacteria | 7888 |
| 355 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 356 | Ga0209437_100147 | 3300025233 | Bacteria | 161997 |
| 357 | Ga0209437_100161 | 3300025233 | Bacteria | 148264 |
| 358 | Ga0209437_100224 | 3300025233 | Bacteria | 101515 |
| 359 | Ga0209437_100231 | 3300025233 | Bacteria | 94387 |
| 360 | Ga0209437_100476 | 3300025233 | Bacteria | 30448 |
| 361 | Ga0209437_104309 | 3300025233 | Bacteria | 2519 |
| 362 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 363 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 364 | Ga0209258_100049 | 3300025242 | Bacteria | 358328 |
| 365 | Ga0209258_100064 | 3300025242 | Bacteria | 293837 |
| 366 | Ga0209258_100186 | 3300025242 | Bacteria | 132381 |
| 367 | Ga0209258_101060 | 3300025242 | Bacteria | 11992 |
| 368 | Ga0207425_1000028 | 3300025245 | Bacteria | 286333 |
| 369 | Ga0207425_1001541 | 3300025245 | Bacteria | 9450 |
| 370 | Ga0209646_1001220 | 3300025246 | Bacteria | 7345 |
| 371 | Ga0209646_1001618 | 3300025246 | Bacteria | 5805 |
| 372 | Ga0209026_1000037 | 3300025250 | Bacteria | 282562 |
| 373 | Ga0209026_1000099 | 3300025250 | Bacteria | 161750 |
| 374 | Ga0209026_1000122 | 3300025250 | Bacteria | 126140 |
| 375 | Ga0209026_1000541 | 3300025250 | Bacteria | 26051 |
| 376 | Ga0209677_101301 | 3300025253 | Bacteria | 11108 |
| 377 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 378 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 379 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 380 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 381 | Ga0209148_1000073 | 3300025254 | Bacteria | 320851 |
| 382 | Ga0209148_1000142 | 3300025254 | Bacteria | 163404 |
| 383 | Ga0209148_1001552 | 3300025254 | Bacteria | 11114 |
| 384 | Ga0209759_1000103 | 3300025256 | Bacteria | 153195 |
| 385 | Ga0209759_1000792 | 3300025256 | Bacteria | 25985 |
| 386 | Ga0209759_1001568 | 3300025256 | Bacteria | 12465 |
| 387 | Ga0209759_1005814 | 3300025256 | Bacteria | 4235 |
| 388 | Ga0209129_1000065 | 3300025258 | Bacteria | 232568 |
| 389 | Ga0209129_1000752 | 3300025258 | Bacteria | 20589 |
| 390 | Ga0209129_1006069 | 3300025258 | Bacteria | 4039 |
| 391 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 392 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 393 | Ga0209233_1000063 | 3300025261 | Bacteria | 395810 |
| 394 | Ga0209233_1000147 | 3300025261 | Bacteria | 186517 |
| 395 | Ga0209233_1000736 | 3300025261 | Bacteria | 14954 |
| 396 | Ga0209233_1014052 | 3300025261 | Bacteria | 2268 |
| 397 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 398 | Ga0209565_1000014 | 3300025263 | Bacteria | 530302 |
| 399 | Ga0209565_1000081 | 3300025263 | Bacteria | 155639 |
| 400 | Ga0209565_1003582 | 3300025263 | Bacteria | 4970 |
| 401 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 402 | Ga0209455_1000014 | 3300025272 | Bacteria | 806601 |
| 403 | Ga0209455_1000086 | 3300025272 | Bacteria | 244650 |
| 404 | Ga0209455_1000177 | 3300025272 | Bacteria | 106026 |
| 405 | Ga0209455_1000308 | 3300025272 | Bacteria | 49953 |
| 406 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 407 | Ga0209673_1001077 | 3300025273 | Bacteria | 30774 |
| 408 | Ga0209673_1004025 | 3300025273 | Bacteria | 8140 |
| 409 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 410 | Ga0209675_1000021 | 3300025291 | Bacteria | 334833 |
| 411 | Ga0209676_1000024 | 3300025292 | Bacteria | 578839 |
| 412 | Ga0209676_1000225 | 3300025292 | Bacteria | 124018 |
| 413 | Ga0209676_1001462 | 3300025292 | Bacteria | 22110 |
| 414 | Ga0209676_1003048 | 3300025292 | Bacteria | 10819 |
| 415 | Ga0209676_1003938 | 3300025292 | Bacteria | 8600 |
| 416 | Ga0209676_1004689 | 3300025292 | Bacteria | 7499 |
| 417 | Ga0209676_1008220 | 3300025292 | Bacteria | 4701 |
| 418 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 419 | Ga0209025_1000015 | 3300025294 | Bacteria | 808120 |
| 420 | Ga0209025_1000040 | 3300025294 | Bacteria | 376228 |
| 421 | Ga0209025_1003033 | 3300025294 | Bacteria | 16562 |
| 422 | Ga0209025_1006289 | 3300025294 | Bacteria | 9284 |
| 423 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 424 | Ga0209564_1000547 | 3300025295 | Bacteria | 60759 |
| 425 | Ga0209564_1013465 | 3300025295 | Bacteria | 3471 |
| 426 | Ga0209564_1023516 | 3300025295 | Bacteria | 2137 |
| 427 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 428 | Ga0209758_1001371 | 3300025297 | Bacteria | 29065 |
| 429 | Ga0209758_1004728 | 3300025297 | Bacteria | 11097 |
| 430 | Ga0209758_1010415 | 3300025297 | Bacteria | 5567 |
| 431 | Ga0209758_1012329 | 3300025297 | Bacteria | 4796 |
| 432 | Ga0209050_1000541 | 3300025298 | Bacteria | 62672 |
| 433 | Ga0209050_1002752 | 3300025298 | Bacteria | 14152 |
| 434 | Ga0209050_1003486 | 3300025298 | Bacteria | 11529 |
| 435 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 436 | Ga0209256_1004202 | 3300025299 | Bacteria | 9257 |
| 437 | Ga0209256_1007889 | 3300025299 | Bacteria | 5100 |
| 438 | Ga0209256_1009510 | 3300025299 | Bacteria | 4250 |
| 439 | Ga0209256_1010651 | 3300025299 | Bacteria | 3814 |
| 440 | Ga0209256_1011461 | 3300025299 | Bacteria | 3541 |
| 441 | Ga0209256_1021245 | 3300025299 | Bacteria | 2000 |
| 442 | Ga0209051_1003094 | 3300025303 | Bacteria | 11224 |
| 443 | Ga0209257_1000148 | 3300025304 | Bacteria | 193131 |
| 444 | Ga0209257_1000180 | 3300025304 | Bacteria | 158090 |
| 445 | Ga0209257_1000204 | 3300025304 | Bacteria | 143800 |
| 446 | Ga0209257_1001906 | 3300025304 | Bacteria | 22534 |
| 447 | Ga0209257_1002013 | 3300025304 | Bacteria | 21724 |
| 448 | Ga0209257_1002127 | 3300025304 | Bacteria | 20664 |
| 449 | Ga0209257_1004808 | 3300025304 | Bacteria | 10040 |
| 450 | Ga0209257_1009717 | 3300025304 | Bacteria | 5061 |
| 451 | Ga0209257_1010648 | 3300025304 | Bacteria | 4603 |
| 452 | Ga0209257_1029601 | 3300025304 | Bacteria | 1781 |
| 453 | Ga0207656_10001704 | 3300025321 | Bacteria | 7303 |
| 454 | Ga0207656_10004357 | 3300025321 | Bacteria | 4935 |
| 455 | Ga0207655_1000162 | 3300025728 | Bacteria | 122768 |
| 456 | Ga0207713_1000393 | 3300025735 | Bacteria | 47322 |
| 457 | Ga0207713_1039274 | 3300025735 | Bacteria | 1998 |
| 458 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 459 | Ga0207680_10000255 | 3300025903 | Bacteria | 25597 |
| 460 | Ga0207680_10000514 | 3300025903 | Bacteria | 18482 |
| 461 | Ga0207647_10000343 | 3300025904 | Bacteria | 37699 |
| 462 | Ga0207647_10000512 | 3300025904 | Bacteria | 30880 |
| 463 | Ga0207647_10000759 | 3300025904 | Bacteria | 25244 |
| 464 | Ga0207647_10001940 | 3300025904 | Bacteria | 15811 |
| 465 | Ga0207647_10007235 | 3300025904 | Bacteria | 8037 |
| 466 | Ga0207647_10011712 | 3300025904 | Bacteria | 6138 |
| 467 | Ga0207647_10011995 | 3300025904 | Bacteria | 6050 |
| 468 | Ga0207647_10038298 | 3300025904 | Bacteria | 3032 |
| 469 | Ga0207699_10133879 | 3300025906 | Bacteria | 1621 |
| 470 | Ga0207645_10050498 | 3300025907 | Bacteria | 2656 |
| 471 | Ga0207705_10000206 | 3300025909 | Bacteria | 59643 |
| 472 | Ga0207705_10002274 | 3300025909 | Bacteria | 14859 |
| 473 | Ga0207705_10002283 | 3300025909 | Bacteria | 14834 |
| 474 | Ga0207705_10005224 | 3300025909 | Bacteria | 9733 |
| 475 | Ga0207705_10028909 | 3300025909 | Bacteria | 3952 |
| 476 | Ga0207684_10129946 | 3300025910 | Bacteria | 2162 |
| 477 | Ga0207654_10029838 | 3300025911 | Bacteria | 2990 |
| 478 | Ga0207707_10000064 | 3300025912 | Bacteria | 107490 |
| 479 | Ga0207707_10000146 | 3300025912 | Bacteria | 73614 |
| 480 | Ga0207707_10000244 | 3300025912 | Bacteria | 59403 |
| 481 | Ga0207707_10000948 | 3300025912 | Bacteria | 27952 |
| 482 | Ga0207707_10003238 | 3300025912 | Bacteria | 14458 |
| 483 | Ga0207707_10005253 | 3300025912 | Bacteria | 11344 |
| 484 | Ga0207707_10008914 | 3300025912 | Bacteria | 8712 |
| 485 | Ga0207707_10014797 | 3300025912 | Bacteria | 6797 |
| 486 | Ga0207707_10016433 | 3300025912 | Bacteria | 6456 |
| 487 | Ga0207707_10018697 | 3300025912 | Bacteria | 6043 |
| 488 | Ga0207707_10036183 | 3300025912 | Bacteria | 4317 |
| 489 | Ga0207707_10192832 | 3300025912 | Bacteria | 1777 |
| 490 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 491 | Ga0207695_10000780 | 3300025913 | Bacteria | 60243 |
| 492 | Ga0207695_10001436 | 3300025913 | Bacteria | 40059 |
| 493 | Ga0207695_10001823 | 3300025913 | Bacteria | 33507 |
| 494 | Ga0207695_10008312 | 3300025913 | Bacteria | 13004 |
| 495 | Ga0207695_10008391 | 3300025913 | Bacteria | 12942 |
| 496 | Ga0207695_10011400 | 3300025913 | Bacteria | 10775 |
| 497 | Ga0207695_10016742 | 3300025913 | Bacteria | 8562 |
| 498 | Ga0207695_10026197 | 3300025913 | Bacteria | 6510 |
| 499 | Ga0207671_10000061 | 3300025914 | Bacteria | 175061 |
| 500 | Ga0207671_10000329 | 3300025914 | Bacteria | 69610 |
| 501 | Ga0207671_10001147 | 3300025914 | Bacteria | 31646 |
| 502 | Ga0207671_10003503 | 3300025914 | Bacteria | 15596 |
| 503 | Ga0207671_10003678 | 3300025914 | Bacteria | 15116 |
| 504 | Ga0207671_10023978 | 3300025914 | Bacteria | 4592 |
| 505 | Ga0207660_10000399 | 3300025917 | Bacteria | 28577 |
| 506 | Ga0207660_10000676 | 3300025917 | Bacteria | 22769 |
| 507 | Ga0207660_10002480 | 3300025917 | Bacteria | 12131 |
| 508 | Ga0207660_10004546 | 3300025917 | Bacteria | 9048 |
| 509 | Ga0207660_10008645 | 3300025917 | Bacteria | 6583 |
| 510 | Ga0207657_10014382 | 3300025919 | Bacteria | 7727 |
| 511 | Ga0207657_10018424 | 3300025919 | Bacteria | 6664 |
| 512 | Ga0207657_10021615 | 3300025919 | Bacteria | 6049 |
| 513 | Ga0207657_10023056 | 3300025919 | Bacteria | 5805 |
| 514 | Ga0207657_10035226 | 3300025919 | Bacteria | 4490 |
| 515 | Ga0207657_10059762 | 3300025919 | Bacteria | 3273 |
| 516 | Ga0207649_10000847 | 3300025920 | Bacteria | 19667 |
| 517 | Ga0207649_10010415 | 3300025920 | Bacteria | 5109 |
| 518 | Ga0207649_10027962 | 3300025920 | Bacteria | 3316 |
| 519 | Ga0207652_10000019 | 3300025921 | Bacteria | 164416 |
| 520 | Ga0207652_10000084 | 3300025921 | Bacteria | 101874 |
| 521 | Ga0207652_10000644 | 3300025921 | Bacteria | 34523 |
| 522 | Ga0207652_10002333 | 3300025921 | Bacteria | 16078 |
| 523 | Ga0207652_10070526 | 3300025921 | Bacteria | 3035 |
| 524 | Ga0207694_10000162 | 3300025924 | Bacteria | 68375 |
| 525 | Ga0207694_10002417 | 3300025924 | Bacteria | 15274 |
| 526 | Ga0207694_10003467 | 3300025924 | Bacteria | 12533 |
| 527 | Ga0207650_10021393 | 3300025925 | Bacteria | 4571 |
| 528 | Ga0207650_10115210 | 3300025925 | Bacteria | 2086 |
| 529 | Ga0207664_10000026 | 3300025929 | Bacteria | 194571 |
| 530 | Ga0207664_10001222 | 3300025929 | Bacteria | 17024 |
| 531 | Ga0207644_10032119 | 3300025931 | Bacteria | 3660 |
| 532 | Ga0207690_10000864 | 3300025932 | Bacteria | 19385 |
| 533 | Ga0207690_10000975 | 3300025932 | Bacteria | 18344 |
| 534 | Ga0207690_10004131 | 3300025932 | Bacteria | 8578 |
| 535 | Ga0207690_10032621 | 3300025932 | Bacteria | 3343 |
| 536 | Ga0207690_10069172 | 3300025932 | Bacteria | 2428 |
| 537 | Ga0207690_10075459 | 3300025932 | Bacteria | 2338 |
| 538 | Ga0207706_10011833 | 3300025933 | Bacteria | 7945 |
| 539 | Ga0207706_10022696 | 3300025933 | Bacteria | 5633 |
| 540 | Ga0207686_10046784 | 3300025934 | Bacteria | 2671 |
| 541 | Ga0207709_10008328 | 3300025935 | Bacteria | 5743 |
| 542 | Ga0207669_10045469 | 3300025937 | Bacteria | 2587 |
| 543 | Ga0207704_10005852 | 3300025938 | Bacteria | 5690 |
| 544 | Ga0207691_10043022 | 3300025940 | Bacteria | 4164 |
| 545 | Ga0207691_10057527 | 3300025940 | Bacteria | 3538 |
| 546 | Ga0207691_10100639 | 3300025940 | Bacteria | 2580 |
| 547 | Ga0207691_10152273 | 3300025940 | Bacteria | 2033 |
| 548 | Ga0207711_10001229 | 3300025941 | Bacteria | 24284 |
| 549 | Ga0207689_10019419 | 3300025942 | Bacteria | 5729 |
| 550 | Ga0207661_10006751 | 3300025944 | Bacteria | 8125 |
| 551 | Ga0207661_10010584 | 3300025944 | Bacteria | 6643 |
| 552 | Ga0207679_10041737 | 3300025945 | Bacteria | 3292 |
| 553 | Ga0207667_10000386 | 3300025949 | Bacteria | 59640 |
| 554 | Ga0207667_10001306 | 3300025949 | Bacteria | 31238 |
| 555 | Ga0207667_10005108 | 3300025949 | Bacteria | 16029 |
| 556 | Ga0207667_10005523 | 3300025949 | Bacteria | 15428 |
| 557 | Ga0207667_10007230 | 3300025949 | Bacteria | 13398 |
| 558 | Ga0207667_10011673 | 3300025949 | Bacteria | 10193 |
| 559 | Ga0207667_10014077 | 3300025949 | Bacteria | 9132 |
| 560 | Ga0207667_10015916 | 3300025949 | Bacteria | 8517 |
| 561 | Ga0207667_10033066 | 3300025949 | Bacteria | 5564 |
| 562 | Ga0207667_10064166 | 3300025949 | Bacteria | 3835 |
| 563 | Ga0207667_10160495 | 3300025949 | Bacteria | 2312 |
| 564 | Ga0207712_10001183 | 3300025961 | Bacteria | 18055 |
| 565 | Ga0207712_10001310 | 3300025961 | Bacteria | 17057 |
| 566 | Ga0207668_10124978 | 3300025972 | Bacteria | 1954 |
| 567 | Ga0207640_10000378 | 3300025981 | Bacteria | 28715 |
| 568 | Ga0207640_10002161 | 3300025981 | Bacteria | 10568 |
| 569 | Ga0207640_10004984 | 3300025981 | Bacteria | 7217 |
| 570 | Ga0207640_10006665 | 3300025981 | Bacteria | 6345 |
| 571 | Ga0207640_10007842 | 3300025981 | Bacteria | 5892 |
| 572 | Ga0207640_10009690 | 3300025981 | Bacteria | 5402 |
| 573 | Ga0207640_10046461 | 3300025981 | Bacteria | 2794 |
| 574 | Ga0207640_10183856 | 3300025981 | Bacteria | 1569 |
| 575 | Ga0207658_10000006 | 3300025986 | Bacteria | 392309 |
| 576 | Ga0207658_10054137 | 3300025986 | Bacteria | 2967 |
| 577 | Ga0207677_10170338 | 3300026023 | Bacteria | 1702 |
| 578 | Ga0207703_10000809 | 3300026035 | Bacteria | 30827 |
| 579 | Ga0207703_10190879 | 3300026035 | Bacteria | 1814 |
| 580 | Ga0207639_10000230 | 3300026041 | Bacteria | 41807 |
| 581 | Ga0207639_10000955 | 3300026041 | Bacteria | 19606 |
| 582 | Ga0207639_10002731 | 3300026041 | Bacteria | 11843 |
| 583 | Ga0207639_10003037 | 3300026041 | Bacteria | 11300 |
| 584 | Ga0207639_10009277 | 3300026041 | Bacteria | 6786 |
| 585 | Ga0207639_10009814 | 3300026041 | Bacteria | 6616 |
| 586 | Ga0207639_10174747 | 3300026041 | Bacteria | 1822 |
| 587 | Ga0207678_10003502 | 3300026067 | Bacteria | 14112 |
| 588 | Ga0207678_10004583 | 3300026067 | Bacteria | 12431 |
| 589 | Ga0207678_10010017 | 3300026067 | Bacteria | 8317 |
| 590 | Ga0207678_10019059 | 3300026067 | Bacteria | 6025 |
| 591 | Ga0207678_10023472 | 3300026067 | Bacteria | 5394 |
| 592 | Ga0207678_10034687 | 3300026067 | Bacteria | 4394 |
| 593 | Ga0207678_10068449 | 3300026067 | Bacteria | 3046 |
| 594 | Ga0207678_10185639 | 3300026067 | Bacteria | 1776 |
| 595 | Ga0207702_10000580 | 3300026078 | Bacteria | 40765 |
| 596 | Ga0207702_10001534 | 3300026078 | Bacteria | 22836 |
| 597 | Ga0207702_10002243 | 3300026078 | Bacteria | 18541 |
| 598 | Ga0207702_10011344 | 3300026078 | Bacteria | 7430 |
| 599 | Ga0207702_10013254 | 3300026078 | Bacteria | 6856 |
| 600 | Ga0207702_10013968 | 3300026078 | Bacteria | 6671 |
| 601 | Ga0207702_10037249 | 3300026078 | Bacteria | 4070 |
| 602 | Ga0207702_10083608 | 3300026078 | Bacteria | 2777 |
| 603 | Ga0207641_10015985 | 3300026088 | Bacteria | 6143 |
| 604 | Ga0207641_10035578 | 3300026088 | Bacteria | 4150 |
| 605 | Ga0207641_10057206 | 3300026088 | Bacteria | 3316 |
| 606 | Ga0207641_10147204 | 3300026088 | Bacteria | 2131 |
| 607 | Ga0207648_10035235 | 3300026089 | Bacteria | 4409 |
| 608 | Ga0207648_10139731 | 3300026089 | Bacteria | 2134 |
| 609 | Ga0207676_10031909 | 3300026095 | Bacteria | 3964 |
| 610 | Ga0207674_10000226 | 3300026116 | Bacteria | 70605 |
| 611 | Ga0207674_10003517 | 3300026116 | Bacteria | 19121 |
| 612 | Ga0207674_10011343 | 3300026116 | Bacteria | 10015 |
| 613 | Ga0207674_10019482 | 3300026116 | Bacteria | 7347 |
| 614 | Ga0207674_10021905 | 3300026116 | Bacteria | 6875 |
| 615 | Ga0207674_10077428 | 3300026116 | Bacteria | 3331 |
| 616 | Ga0207675_100171622 | 3300026118 | Bacteria | 2073 |
| 617 | Ga0207675_100198094 | 3300026118 | Bacteria | 1928 |
| 618 | Ga0207683_10030140 | 3300026121 | Bacteria | 4700 |
| 619 | Ga0207683_10181461 | 3300026121 | Bacteria | 1909 |
| 620 | Ga0207698_10002393 | 3300026142 | Bacteria | 11105 |
| 621 | Ga0207698_10039764 | 3300026142 | Bacteria | 3487 |
| 622 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 623 | Ga0209371_1000044 | 3300027312 | Bacteria | 327086 |
| 624 | Ga0209999_1003238 | 3300027543 | Bacteria | 2906 |
| 625 | Ga0209970_1003587 | 3300027614 | Bacteria | 2602 |
| 626 | Ga0209983_1002823 | 3300027665 | Bacteria | 3755 |
| 627 | Ga0209971_1004054 | 3300027682 | Bacteria | 3469 |
| 628 | Ga0209966_1003940 | 3300027695 | Bacteria | 2506 |
| 629 | Ga0209813_10001903 | 3300027866 | Bacteria | 4708 |
| 630 | Ga0207428_10051338 | 3300027907 | Bacteria | 3297 |
| 631 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 632 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 633 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 634 | Ga0268266_10036448 | 3300028379 | Bacteria | 4186 |
| 635 | Ga0268266_10096882 | 3300028379 | Bacteria | 2594 |
| 636 | Ga0268265_10002756 | 3300028380 | Bacteria | 12975 |
| 637 | Ga0268264_10016468 | 3300028381 | Bacteria | 6053 |
| 638 | Ga0268264_10032018 | 3300028381 | Bacteria | 4314 |
| 639 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 640 | Ga0268256_1000046 | 3300030500 | Bacteria | 327003 |
| 641 | Ga0316183_1029247 | 3300030742 | Bacteria | 7749 |
| 642 | Ga0307513_10004159 | 3300031456 | Bacteria | 19385 |
| 643 | Ga0307509_10000229 | 3300031507 | Bacteria | 90514 |
| 644 | Ga0316575_10027325 | 3300031665 | Bacteria | 2220 |
| 645 | Ga0316579_10002489 | 3300031691 | Bacteria | 6965 |
| 646 | Ga0316579_10004798 | 3300031691 | Bacteria | 5400 |
| 647 | Ga0316579_10012808 | 3300031691 | Bacteria | 3598 |
| 648 | Ga0316576_10012035 | 3300031727 | Bacteria | 5700 |
| 649 | Ga0316578_10003942 | 3300031728 | Bacteria | 6910 |
| 650 | Ga0316578_10022778 | 3300031728 | Bacteria | 3498 |
| 651 | Ga0307516_10016729 | 3300031730 | Bacteria | 7657 |
| 652 | Ga0316577_10022907 | 3300031733 | Bacteria | 3468 |
| 653 | Ga0307413_10000993 | 3300031824 | Bacteria | 10213 |
| 654 | Ga0307413_10091134 | 3300031824 | Bacteria | 1985 |
| 655 | Ga0307410_10027010 | 3300031852 | Bacteria | 3623 |
| 656 | Ga0307406_10000399 | 3300031901 | Bacteria | 25114 |
| 657 | Ga0307412_10002544 | 3300031911 | Bacteria | 10135 |
| 658 | Ga0307412_10003373 | 3300031911 | Bacteria | 8872 |
| 659 | Ga0307412_10080530 | 3300031911 | Bacteria | 2250 |
| 660 | Ga0307416_100212079 | 3300032002 | Bacteria | 1848 |
| 661 | Ga0307414_10001495 | 3300032004 | Bacteria | 12147 |
| 662 | Ga0307414_10040419 | 3300032004 | Bacteria | 3150 |
| 663 | Ga0307414_10044756 | 3300032004 | Bacteria | 3026 |
| 664 | Ga0307414_10062609 | 3300032004 | Bacteria | 2641 |
| 665 | Ga0307415_100180522 | 3300032126 | Bacteria | 1656 |
| 666 | Ga0316585_10000379 | 3300032137 | Bacteria | 10294 |
| 667 | Ga0316580_10000704 | 3300032139 | Bacteria | 8038 |
| 668 | Ga0316580_10025695 | 3300032139 | Bacteria | 1821 |
| 669 | Ga0316593_10000834 | 3300032168 | Bacteria | 6223 |
| 670 | Ga0316593_10006078 | 3300032168 | Bacteria | 3237 |
| 671 | Ga0316593_10013215 | 3300032168 | Bacteria | 2439 |
| 672 | Ga0307510_10002044 | 3300033180 | Bacteria | 22812 |
| 673 | Ga0307510_10025630 | 3300033180 | Bacteria | 6795 |
| 674 | Ga0316596_1000778 | 3300033541 | Bacteria | 5868 |
| 675 | Ga0373944_0003332 | 3300035089 | Bacteria | 4139 |
| 676 | Ga0316574_0003460 | 3300035398 | Bacteria | 8140 |
| 677 | Ga0316574_0006784 | 3300035398 | Bacteria | 6223 |
| 678 | Ga0316574_0008025 | 3300035398 | Bacteria | 5833 |
| 679 | Ga0373933_0064646 | 3300035724 | Bacteria | 2214 |
| 680 | Ga0316582_0000279 | 3300036647 | Bacteria | 17480 |
| 681 | Ga0316582_0003359 | 3300036647 | Bacteria | 7831 |
| 682 | Ga0316584_0011104 | 3300036712 | Bacteria | 6317 |
| 683 | Ga0316584_0014954 | 3300036712 | Bacteria | 5543 |
| 684 | Ga0316584_0203168 | 3300036712 | Bacteria | 1461 |
| 685 | Ga0373925_0021331 | 3300037068 | Bacteria | 4719 |
| 686 | Ga0395899_0000108 | 3300037312 | Bacteria | 142347 |
| 687 | Ga0395899_0020403 | 3300037312 | Bacteria | 5024 |
| 688 | Ga0395899_0065751 | 3300037312 | Bacteria | 2664 |
| 689 | Ga0395899_0082286 | 3300037312 | Bacteria | 2341 |
| 690 | Ga0395899_0112338 | 3300037312 | Bacteria | 1957 |
| 691 | Ga0395900_0000059 | 3300037418 | Bacteria | 205996 |
| 692 | Ga0395900_0000144 | 3300037418 | Bacteria | 119971 |
| 693 | Ga0395900_0001328 | 3300037418 | Bacteria | 29941 |
| 694 | Ga0395900_0011739 | 3300037418 | Bacteria | 8957 |
| 695 | Ga0395900_0047496 | 3300037418 | Bacteria | 4420 |
| 696 | Ga0395900_0050272 | 3300037418 | Bacteria | 4294 |
| 697 | Ga0395900_0068940 | 3300037418 | Bacteria | 3634 |
| 698 | Ga0395900_0096985 | 3300037418 | Bacteria | 3029 |
| 699 | Ga0395898_0000018 | 3300037466 | Bacteria | 418600 |
| 700 | Ga0395898_0000049 | 3300037466 | Bacteria | 284792 |
| 701 | Ga0395898_0286813 | 3300037466 | Bacteria | 1570 |
| 702 | Ga0395905_0000855 | 3300037471 | Bacteria | 39769 |
| 703 | Ga0395905_0044804 | 3300037471 | Bacteria | 4150 |
| 704 | Ga0316581_0013450 | 3300037588 | Bacteria | 2321 |
| 705 | Ga0395901_0000356 | 3300038443 | Bacteria | 55523 |
| 706 | Ga0395901_0043265 | 3300038443 | Bacteria | 4672 |
| 707 | Ga0395901_0146500 | 3300038443 | Bacteria | 2481 |
| 708 | Ga0237819_00006 | 3300038705 | Bacteria | 78253 |
| 709 | Ga0400490_03793 | 3300038726 | Bacteria | 3303 |
| 710 | Ga0400490_30897 | 3300038726 | Bacteria | 40161 |
| 711 | Ga0400490_38104 | 3300038726 | Bacteria | 20323 |
| 712 | Ga0400488_33615 | 3300038741 | Bacteria | 6652 |
| 713 | Ga0400486_17520 | 3300038742 | Bacteria | 2366 |
| 714 | Ga0400483_133713 | 3300039062 | Bacteria | 14771 |
| 715 | Ga0400483_226110 | 3300039062 | Bacteria | 3464 |
| 716 | Ga0400487_61177 | 3300039110 | Bacteria | 6666 |
| 717 | Ga0237816_00140 | 3300039145 | Bacteria | 5646 |
| 718 | Ga0439436_0000030 | 3300041404 | Bacteria | 48429 |
| 719 | Ga0439447_000680 | 3300041407 | Bacteria | 12629 |
| 720 | Ga0439465_0000405 | 3300041413 | Bacteria | 12512 |
| 721 | Ga0439465_0000621 | 3300041413 | Bacteria | 10781 |
| 722 | Ga0439465_0013770 | 3300041413 | Bacteria | 2517 |
| 723 | Ga0451797_1127267 | 3300041453 | Bacteria | 1562 |
| 724 | Ga0451800_0416601 | 3300041459 | Bacteria | 5257 |
| 725 | Ga0451806_541229 | 3300041462 | Bacteria | 7600 |
| 726 | Ga0451804_0746312 | 3300041463 | Bacteria | 2456 |
| 727 | Ga0451807_1917614 | 3300041486 | Bacteria | 3893 |
| 728 | Ga0451837_0375995 | 3300041494 | Bacteria | 6077 |
| 729 | Ga0451837_1201779 | 3300041494 | Bacteria | 3141 |
| 730 | Ga0439445_0005445 | 3300042004 | Bacteria | 2901 |
| 731 | Ga0439432_029987 | 3300042006 | Bacteria | 1765 |
| 732 | Ga0439449_0000048 | 3300042007 | Bacteria | 36681 |
| 733 | Ga0439449_0003482 | 3300042007 | Bacteria | 6115 |
| 734 | Ga0450911_000912 | 3300042115 | Bacteria | 7852 |
| 735 | Ga0450908_001001 | 3300042184 | Bacteria | 5468 |
| 736 | Ga0451577_0017292 | 3300042876 | Bacteria | 6664 |
| 737 | Ga0466969_0015288 | 3300044656 | Bacteria | 4023 |
| 738 | Ga0466982_0000003 | 3300044672 | Bacteria | 417243 |
| 739 | Ga0466966_0001324 | 3300044684 | Bacteria | 15870 |
| 740 | Ga0466966_0031675 | 3300044684 | Bacteria | 3428 |
| 741 | Ga0466961_0004875 | 3300044693 | Bacteria | 8442 |
| 742 | Ga0466961_0005216 | 3300044693 | Bacteria | 8177 |
| 743 | Ga0466961_0013157 | 3300044693 | Bacteria | 5293 |
| 744 | Ga0466961_0020100 | 3300044693 | Bacteria | 4297 |
| 745 | Ga0466963_0184095 | 3300044694 | Bacteria | 1459 |
| 746 | Ga0453684_0000298 | 3300044712 | Bacteria | 209777 |
| 747 | Ga0453684_0008337 | 3300044712 | Bacteria | 18633 |
| 748 | Ga0466971_0003757 | 3300044719 | Bacteria | 6500 |
| 749 | Ga0466971_0021286 | 3300044719 | Bacteria | 2886 |
| 750 | Ga0466968_0024535 | 3300044735 | Bacteria | 2464 |
| 751 | Ga0466968_0048671 | 3300044735 | Bacteria | 1804 |
| 752 | Ga0466970_0000202 | 3300044765 | Bacteria | 28937 |
| 753 | Ga0466970_0003852 | 3300044765 | Bacteria | 7344 |
| 754 | Ga0466957_0002054 | 3300044842 | Bacteria | 10762 |
| 755 | Ga0466957_0037073 | 3300044842 | Bacteria | 2934 |
| 756 | Ga0466959_0000194 | 3300045049 | Bacteria | 39999 |
| 757 | Ga0466959_0002267 | 3300045049 | Bacteria | 12261 |
| 758 | Ga0466959_0015572 | 3300045049 | Bacteria | 5543 |
| 759 | Ga0466959_0020295 | 3300045049 | Bacteria | 4894 |
| 760 | Ga0466959_0114102 | 3300045049 | Bacteria | 1926 |
| 761 | Ga0451576_0000033 | 3300045051 | Bacteria | 393131 |
| 762 | Ga0466958_0044743 | 3300045836 | Bacteria | 2668 |
| 763 | Ga0495617_000586 | 3300046452 | Bacteria | 18560 |
| 764 | Ga0495617_000939 | 3300046452 | Bacteria | 13544 |
| 765 | Ga0495627_005291 | 3300046453 | Bacteria | 5229 |
| 766 | Ga0495638_0000038 | 3300046460 | Bacteria | 249534 |
| 767 | Ga0495638_0000153 | 3300046460 | Bacteria | 109155 |
| 768 | Ga0495638_0002596 | 3300046460 | Bacteria | 14582 |
| 769 | Ga0495638_0003487 | 3300046460 | Bacteria | 12359 |
| 770 | Ga0495638_0012299 | 3300046460 | Bacteria | 5869 |
| 771 | Ga0495638_0072264 | 3300046460 | Bacteria | 2109 |
| 772 | Ga0495653_0002459 | 3300046463 | Bacteria | 14723 |
| 773 | Ga0495650_0000450 | 3300046471 | Bacteria | 65387 |
| 774 | Ga0495650_0001325 | 3300046471 | Bacteria | 24874 |
| 775 | Ga0495650_0005338 | 3300046471 | Bacteria | 8386 |
| 776 | Ga0495650_0030228 | 3300046471 | Bacteria | 2456 |
| 777 | Ga0495580_0134349 | 3300046472 | Bacteria | 1715 |
| 778 | Ga0495582_0026408 | 3300046473 | Bacteria | 3183 |
| 779 | Ga0495584_0002465 | 3300046491 | Bacteria | 10482 |
| 780 | Ga0495585_0000104 | 3300046492 | Bacteria | 90097 |
| 781 | Ga0495585_0008229 | 3300046492 | Bacteria | 6331 |
| 782 | Ga0495607_0000211 | 3300046501 | Bacteria | 62291 |
| 783 | Ga0495607_0002313 | 3300046501 | Bacteria | 15633 |
| 784 | Ga0495607_0010293 | 3300046501 | Bacteria | 6290 |
| 785 | Ga0495606_0000401 | 3300046507 | Bacteria | 73149 |
| 786 | Ga0495606_0004520 | 3300046507 | Bacteria | 13843 |
| 787 | Ga0495606_0006836 | 3300046507 | Bacteria | 10411 |
| 788 | Ga0495606_0009207 | 3300046507 | Bacteria | 8393 |
| 789 | Ga0495610_0000482 | 3300046512 | Bacteria | 41191 |
| 790 | Ga0495616_0000086 | 3300046513 | Bacteria | 78187 |
| 791 | Ga0495620_0001564 | 3300046515 | Bacteria | 13597 |
| 792 | Ga0495620_0006441 | 3300046515 | Bacteria | 6450 |
| 793 | Ga0495631_0001785 | 3300046518 | Bacteria | 12758 |
| 794 | Ga0495631_0001835 | 3300046518 | Bacteria | 12523 |
| 795 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 796 | Ga0495632_0011223 | 3300046519 | Bacteria | 5242 |
| 797 | Ga0495632_0022825 | 3300046519 | Bacteria | 3349 |
| 798 | Ga0495632_0085193 | 3300046519 | Bacteria | 1503 |
| 799 | Ga0495637_0010551 | 3300046520 | Bacteria | 4463 |
| 800 | Ga0495643_0003848 | 3300046522 | Bacteria | 10809 |
| 801 | Ga0495643_0007696 | 3300046522 | Bacteria | 6903 |
| 802 | Ga0495648_0002502 | 3300046524 | Bacteria | 16862 |
| 803 | Ga0495648_0004770 | 3300046524 | Bacteria | 11475 |
| 804 | Ga0495648_0006343 | 3300046524 | Bacteria | 9673 |
| 805 | Ga0495663_0000662 | 3300046525 | Bacteria | 11934 |
| 806 | Ga0495663_0006399 | 3300046525 | Bacteria | 3251 |
| 807 | Ga0495665_0036208 | 3300046531 | Bacteria | 2635 |
| 808 | Ga0495621_0004807 | 3300046539 | Bacteria | 3830 |
| 809 | Ga0495645_0080864 | 3300046543 | Bacteria | 2332 |
| 810 | Ga0495622_0013271 | 3300046557 | Bacteria | 3823 |
| 811 | Ga0495633_0008488 | 3300046558 | Bacteria | 5778 |
| 812 | Ga0495633_0013496 | 3300046558 | Bacteria | 4303 |
| 813 | Ga0495656_0005789 | 3300046615 | Bacteria | 4293 |
| 814 | Ga0495656_0007758 | 3300046615 | Bacteria | 3807 |
| 815 | Ga0495668_0003978 | 3300046616 | Bacteria | 10764 |
| 816 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 817 | Ga0495611_0000105 | 3300046648 | Bacteria | 58236 |
| 818 | Ga0495625_0000022 | 3300046660 | Bacteria | 278823 |
| 819 | Ga0495625_0010863 | 3300046660 | Bacteria | 7483 |
| 820 | Ga0495625_0017336 | 3300046660 | Bacteria | 5640 |
| 821 | Ga0495661_0000199 | 3300046665 | Bacteria | 69536 |
| 822 | Ga0495661_0000291 | 3300046665 | Archaea | 56833 |
| 823 | Ga0495658_0025436 | 3300046683 | Bacteria | 3163 |
| 824 | Ga0495613_0007234 | 3300046689 | Bacteria | 8264 |
| 825 | Ga0495613_0057452 | 3300046689 | Bacteria | 2857 |
| 826 | Ga0495670_0003523 | 3300046691 | Bacteria | 7684 |
| 827 | Ga0495670_0006841 | 3300046691 | Bacteria | 5613 |
| 828 | Ga0495670_0014938 | 3300046691 | Bacteria | 3822 |
| 829 | Ga0495671_0000372 | 3300046692 | Bacteria | 36874 |
| 830 | Ga0495649_0001571 | 3300046694 | Bacteria | 17089 |
| 831 | Ga0495589_0000059 | 3300046794 | Bacteria | 107171 |
| 832 | Ga0495589_0047146 | 3300046794 | Bacteria | 2136 |
| 833 | Ga0495660_0000745 | 3300046810 | Bacteria | 24604 |
| 834 | Ga0495660_0000747 | 3300046810 | Bacteria | 24561 |
| 835 | Ga0495660_0001860 | 3300046810 | Bacteria | 13852 |
| 836 | Ga0495636_0000912 | 3300047318 | Bacteria | 10978 |
| 837 | Ga0495636_0012167 | 3300047318 | Bacteria | 3408 |
| 838 | Ga0495636_0019322 | 3300047318 | Bacteria | 2738 |
| 839 | Ga0495672_0008952 | 3300047320 | Bacteria | 7309 |
| 840 | Ga0495683_0000001 | 3300047323 | Unclassified | 2230803 |
| 841 | Ga0495683_0007577 | 3300047323 | Bacteria | 5853 |
| 842 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 843 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 844 | Ga0495673_0000048 | 3300047469 | Bacteria | 265950 |
| 845 | Ga0495673_0002942 | 3300047469 | Bacteria | 11496 |
| 846 | Ga0495684_0070247 | 3300047471 | Bacteria | 2662 |
| 847 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 848 | Ga0495686_0001206 | 3300047472 | Bacteria | 29747 |
| 849 | Ga0495686_0005468 | 3300047472 | Bacteria | 10011 |
| 850 | Ga0495686_0006769 | 3300047472 | Bacteria | 8704 |
| 851 | Ga0495686_0008204 | 3300047472 | Bacteria | 7701 |
| 852 | Ga0495686_0047619 | 3300047472 | Bacteria | 2706 |
| 853 | Ga0495593_0034417 | 3300047673 | Bacteria | 2755 |
| 854 | Ga0496100_0006438 | 3300048903 | Bacteria | 6401 |
| 855 | Ga0496101_0011176 | 3300048904 | Bacteria | 5949 |
| 856 | Ga0496101_0038972 | 3300048904 | Bacteria | 3377 |
| 857 | Ga0496102_0127663 | 3300048905 | Bacteria | 2378 |
| 858 | Ga0496103_0030329 | 3300048906 | Bacteria | 3291 |
| 859 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 860 | Ga0496104_0034139 | 3300048907 | Bacteria | 4741 |
| 861 | Ga0496104_0078965 | 3300048907 | Bacteria | 3136 |
| 862 | Ga0496105_0000071 | 3300048908 | Bacteria | 79908 |
| 863 | Ga0496105_0001886 | 3300048908 | Bacteria | 15030 |
| 864 | Ga0496106_0001299 | 3300048909 | Bacteria | 18754 |
| 865 | Ga0496106_0091174 | 3300048909 | Bacteria | 2353 |
| 866 | Ga0496107_0153510 | 3300048910 | Bacteria | 1704 |
| 867 | Ga0496108_0027988 | 3300048911 | Bacteria | 4662 |
| 868 | Ga0496110_0046966 | 3300048913 | Bacteria | 3779 |
| 869 | Ga0496111_0059706 | 3300048914 | Bacteria | 2763 |
| 870 | Ga0496113_0002731 | 3300048916 | Bacteria | 10367 |
| 871 | Ga0496114_0050953 | 3300048917 | Bacteria | 3446 |
| 872 | Ga0496115_0000062 | 3300048918 | Bacteria | 100189 |
| 873 | Ga0496115_0000182 | 3300048918 | Bacteria | 58480 |
| 874 | Ga0496115_0000503 | 3300048918 | Bacteria | 30610 |
| 875 | Ga0496115_0016934 | 3300048918 | Bacteria | 5560 |
| 876 | Ga0496116_0006696 | 3300048919 | Bacteria | 10386 |
| 877 | Ga0496116_0009340 | 3300048919 | Bacteria | 8376 |
| 878 | Ga0496117_0001420 | 3300048920 | Bacteria | 34726 |
| 879 | Ga0496117_0002445 | 3300048920 | Bacteria | 23395 |
| 880 | Ga0496117_0004800 | 3300048920 | Bacteria | 14649 |
| 881 | Ga0496117_0018341 | 3300048920 | Bacteria | 5800 |
| 882 | Ga0496117_0019263 | 3300048920 | Bacteria | 5612 |
| 883 | Ga0496117_0022804 | 3300048920 | Bacteria | 5014 |
| 884 | Ga0496117_0037026 | 3300048920 | Bacteria | 3640 |
| 885 | Ga0496118_0001724 | 3300048921 | Bacteria | 31870 |
| 886 | Ga0496118_0002288 | 3300048921 | Bacteria | 26119 |
| 887 | Ga0496118_0003187 | 3300048921 | Bacteria | 20960 |
| 888 | Ga0496118_0007325 | 3300048921 | Bacteria | 11737 |
| 889 | Ga0496118_0008410 | 3300048921 | Bacteria | 10671 |
| 890 | Ga0496118_0008793 | 3300048921 | Bacteria | 10351 |
| 891 | Ga0496118_0009162 | 3300048921 | Bacteria | 10057 |
| 892 | Ga0496118_0009833 | 3300048921 | Bacteria | 9572 |
| 893 | Ga0496118_0011915 | 3300048921 | Bacteria | 8416 |
| 894 | Ga0496118_0018953 | 3300048921 | Bacteria | 6169 |
| 895 | Ga0496118_0019029 | 3300048921 | Bacteria | 6155 |
| 896 | Ga0496118_0073498 | 3300048921 | Bacteria | 2449 |
| 897 | Ga0496119_0000430 | 3300048922 | Bacteria | 57802 |
| 898 | Ga0496119_0001587 | 3300048922 | Bacteria | 27028 |
| 899 | Ga0496119_0002453 | 3300048922 | Bacteria | 20369 |
| 900 | Ga0496119_0004649 | 3300048922 | Bacteria | 13542 |
| 901 | Ga0496119_0041560 | 3300048922 | Bacteria | 2925 |
| 902 | Ga0496119_0078847 | 3300048922 | Bacteria | 1904 |
| 903 | Ga0496120_0000313 | 3300048923 | Bacteria | 80663 |
| 904 | Ga0496120_0001482 | 3300048923 | Bacteria | 27908 |
| 905 | Ga0496120_0002147 | 3300048923 | Bacteria | 21033 |
| 906 | Ga0496120_0007359 | 3300048923 | Bacteria | 8208 |
| 907 | Ga0496121_0000878 | 3300048924 | Bacteria | 54427 |
| 908 | Ga0496121_0005536 | 3300048924 | Bacteria | 16138 |
| 909 | Ga0496121_0006097 | 3300048924 | Bacteria | 15167 |
| 910 | Ga0496121_0007810 | 3300048924 | Bacteria | 12810 |
| 911 | Ga0496121_0008433 | 3300048924 | Bacteria | 12122 |
| 912 | Ga0496121_0012110 | 3300048924 | Bacteria | 9473 |
| 913 | Ga0496121_0019136 | 3300048924 | Bacteria | 6864 |
| 914 | Ga0496121_0022688 | 3300048924 | Bacteria | 6076 |
| 915 | Ga0496121_0089774 | 3300048924 | Bacteria | 2404 |
| 916 | Ga0496121_0091594 | 3300048924 | Bacteria | 2373 |
| 917 | Ga0496121_0105816 | 3300048924 | Bacteria | 2158 |
| 918 | Ga0496122_0001419 | 3300048925 | Bacteria | 38784 |
| 919 | Ga0496122_0001926 | 3300048925 | Bacteria | 31324 |
| 920 | Ga0496122_0002854 | 3300048925 | Bacteria | 23661 |
| 921 | Ga0496122_0003345 | 3300048925 | Bacteria | 21155 |
| 922 | Ga0496122_0006843 | 3300048925 | Bacteria | 12928 |
| 923 | Ga0496122_0009589 | 3300048925 | Bacteria | 10146 |
| 924 | Ga0496122_0022373 | 3300048925 | Bacteria | 5620 |
| 925 | Ga0496122_0024178 | 3300048925 | Bacteria | 5324 |
| 926 | Ga0496122_0026766 | 3300048925 | Bacteria | 4957 |
| 927 | Ga0496122_0042883 | 3300048925 | Bacteria | 3553 |
| 928 | Ga0496122_0044085 | 3300048925 | Bacteria | 3486 |
| 929 | Ga0496123_0001882 | 3300048926 | Bacteria | 27416 |
| 930 | Ga0496123_0002675 | 3300048926 | Bacteria | 21457 |
| 931 | Ga0496123_0002721 | 3300048926 | Bacteria | 21201 |
| 932 | Ga0496123_0007606 | 3300048926 | Bacteria | 10146 |
| 933 | Ga0496123_0018133 | 3300048926 | Bacteria | 5620 |
| 934 | Ga0496123_0027392 | 3300048926 | Bacteria | 4246 |
| 935 | Ga0496123_0030854 | 3300048926 | Bacteria | 3915 |
| 936 | Ga0496123_0055256 | 3300048926 | Bacteria | 2606 |
| 937 | Ga0496124_0000032 | 3300048927 | Bacteria | 332524 |
| 938 | Ga0496124_0003791 | 3300048927 | Bacteria | 18160 |
| 939 | Ga0496124_0012352 | 3300048927 | Bacteria | 8434 |
| 940 | Ga0496124_0020781 | 3300048927 | Bacteria | 6058 |
| 941 | Ga0496124_0021085 | 3300048927 | Bacteria | 6009 |
| 942 | Ga0496124_0021111 | 3300048927 | Bacteria | 6005 |
| 943 | Ga0496124_0023684 | 3300048927 | Bacteria | 5600 |
| 944 | Ga0496124_0034314 | 3300048927 | Bacteria | 4454 |
| 945 | Ga0496124_0051630 | 3300048927 | Bacteria | 3497 |
| 946 | Ga0496124_0064969 | 3300048927 | Bacteria | 3044 |
| 947 | Ga0496125_0000330 | 3300048928 | Bacteria | 91043 |
| 948 | Ga0496125_0007864 | 3300048928 | Bacteria | 11266 |
| 949 | Ga0496125_0015861 | 3300048928 | Bacteria | 7258 |
| 950 | Ga0496125_0018703 | 3300048928 | Bacteria | 6569 |
| 951 | Ga0496125_0028197 | 3300048928 | Bacteria | 5076 |
| 952 | Ga0496125_0041081 | 3300048928 | Bacteria | 3958 |
| 953 | Ga0496125_0042192 | 3300048928 | Bacteria | 3889 |
| 954 | Ga0496125_0103335 | 3300048928 | Bacteria | 2091 |
| 955 | Ga0496126_0000057 | 3300048929 | Bacteria | 276781 |
| 956 | Ga0496126_0007008 | 3300048929 | Bacteria | 12445 |
| 957 | Ga0496126_0011781 | 3300048929 | Bacteria | 9002 |
| 958 | Ga0496126_0011872 | 3300048929 | Bacteria | 8958 |
| 959 | Ga0496126_0016809 | 3300048929 | Bacteria | 7303 |
| 960 | Ga0496126_0058144 | 3300048929 | Bacteria | 3486 |
| 961 | Ga0496126_0067712 | 3300048929 | Bacteria | 3190 |
| 962 | Ga0496126_0109745 | 3300048929 | Bacteria | 2404 |
| 963 | Ga0495678_000237 | 3300049459 | Bacteria | 62286 |
| 964 | Ga0495682_0002463 | 3300049460 | Bacteria | 8743 |
| 965 | Ga0495682_0012905 | 3300049460 | Bacteria | 3189 |
| 966 | Ga0501031_0008301 | 3300049568 | Bacteria | 6754 |
| 967 | Ga0501031_0028021 | 3300049568 | Bacteria | 3671 |
| 968 | Ga0501032_0005884 | 3300049569 | Bacteria | 9068 |
| 969 | Ga0501032_0008355 | 3300049569 | Bacteria | 7544 |
| 970 | Ga0501032_0014147 | 3300049569 | Bacteria | 5656 |
| 971 | Ga0501033_0000329 | 3300049570 | Bacteria | 45324 |
| 972 | Ga0501033_0002339 | 3300049570 | Bacteria | 16164 |
| 973 | Ga0501033_0006466 | 3300049570 | Bacteria | 9168 |
| 974 | Ga0501033_0007203 | 3300049570 | Bacteria | 8681 |
| 975 | Ga0501034_0000122 | 3300049571 | Bacteria | 144085 |
| 976 | Ga0501034_0001357 | 3300049571 | Bacteria | 33066 |
| 977 | Ga0501034_0001661 | 3300049571 | Bacteria | 28667 |
| 978 | Ga0501034_0002041 | 3300049571 | Bacteria | 25359 |
| 979 | Ga0501034_0003703 | 3300049571 | Bacteria | 17262 |
| 980 | Ga0501034_0012439 | 3300049571 | Bacteria | 8790 |
| 981 | Ga0501034_0025578 | 3300049571 | Bacteria | 6010 |
| 982 | Ga0501034_0131845 | 3300049571 | Bacteria | 2482 |
| 983 | Ga0501034_0137324 | 3300049571 | Bacteria | 2425 |
| 984 | Ga0501034_0310492 | 3300049571 | Bacteria | 1511 |
| 985 | Ga0501036_0020553 | 3300049572 | Bacteria | 5545 |
| 986 | Ga0501036_0022920 | 3300049572 | Bacteria | 5257 |
| 987 | Ga0501036_0031284 | 3300049572 | Bacteria | 4497 |
| 988 | Ga0501036_0052114 | 3300049572 | Bacteria | 3465 |
| 989 | Ga0501037_0004358 | 3300049573 | Bacteria | 10275 |
| 990 | Ga0501037_0012058 | 3300049573 | Bacteria | 6364 |
| 991 | Ga0501037_0015531 | 3300049573 | Bacteria | 5603 |
| 992 | Ga0501037_0054749 | 3300049573 | Bacteria | 2917 |
| 993 | Ga0501037_0082153 | 3300049573 | Bacteria | 2335 |
| 994 | Ga0501037_0083968 | 3300049573 | Bacteria | 2307 |
| 995 | Ga0501038_0001377 | 3300049574 | Bacteria | 22209 |
| 996 | Ga0501038_0002332 | 3300049574 | Bacteria | 17683 |
| 997 | Ga0501038_0015142 | 3300049574 | Bacteria | 7016 |
| 998 | Ga0501038_0063967 | 3300049574 | Bacteria | 3138 |
| 999 | Ga0501039_0026295 | 3300049575 | Bacteria | 4472 |
| 1000 | Ga0501039_0046362 | 3300049575 | Bacteria | 3358 |
| 1001 | Ga0501039_0060274 | 3300049575 | Bacteria | 2939 |
| 1002 | Ga0501039_0072915 | 3300049575 | Bacteria | 2668 |
| 1003 | Ga0501040_0001361 | 3300049576 | Bacteria | 15433 |
| 1004 | Ga0501040_0040908 | 3300049576 | Bacteria | 3156 |
| 1005 | Ga0501042_0000268 | 3300049578 | Bacteria | 25376 |
| 1006 | Ga0501043_0004587 | 3300049579 | Bacteria | 11206 |
| 1007 | Ga0501043_0008045 | 3300049579 | Bacteria | 8325 |
| 1008 | Ga0501043_0022235 | 3300049579 | Bacteria | 4974 |
| 1009 | Ga0501043_0040904 | 3300049579 | Bacteria | 3643 |
| 1010 | Ga0501043_0086831 | 3300049579 | Bacteria | 2458 |
| 1011 | Ga0501046_0002951 | 3300049580 | Bacteria | 15738 |
| 1012 | Ga0501046_0053265 | 3300049580 | Bacteria | 3187 |
| 1013 | Ga0501046_0058487 | 3300049580 | Bacteria | 3021 |
| 1014 | Ga0501046_0109773 | 3300049580 | Bacteria | 2108 |
| 1015 | Ga0501047_0000477 | 3300049581 | Bacteria | 43621 |
| 1016 | Ga0501047_0000748 | 3300049581 | Bacteria | 33896 |
| 1017 | Ga0501047_0001953 | 3300049581 | Bacteria | 19818 |
| 1018 | Ga0501047_0002209 | 3300049581 | Bacteria | 18637 |
| 1019 | Ga0501047_0007329 | 3300049581 | Bacteria | 10376 |
| 1020 | Ga0501047_0037545 | 3300049581 | Bacteria | 4683 |
| 1021 | Ga0501047_0066774 | 3300049581 | Bacteria | 3467 |
| 1022 | Ga0501047_0076713 | 3300049581 | Bacteria | 3216 |
| 1023 | Ga0501047_0111666 | 3300049581 | Bacteria | 2616 |
| 1024 | Ga0501048_0142948 | 3300049582 | Bacteria | 1692 |
| 1025 | Ga0501067_0000969 | 3300049583 | Bacteria | 15401 |
| 1026 | Ga0501068_0005485 | 3300049584 | Bacteria | 6949 |
| 1027 | Ga0501069_0000532 | 3300049585 | Bacteria | 17429 |
| 1028 | Ga0501069_0007893 | 3300049585 | Bacteria | 5588 |
| 1029 | Ga0501069_0009522 | 3300049585 | Bacteria | 5127 |
| 1030 | Ga0501069_0090389 | 3300049585 | Bacteria | 1731 |
| 1031 | Ga0501070_0000511 | 3300049586 | Bacteria | 35493 |
| 1032 | Ga0501070_0002026 | 3300049586 | Bacteria | 17808 |
| 1033 | Ga0501070_0012868 | 3300049586 | Bacteria | 7050 |
| 1034 | Ga0501070_0016349 | 3300049586 | Bacteria | 6232 |
| 1035 | Ga0501070_0021521 | 3300049586 | Bacteria | 5410 |
| 1036 | Ga0501070_0024738 | 3300049586 | Bacteria | 5036 |
| 1037 | Ga0501070_0040547 | 3300049586 | Bacteria | 3882 |
| 1038 | Ga0501070_0043234 | 3300049586 | Bacteria | 3750 |
| 1039 | Ga0501071_0073858 | 3300049587 | Bacteria | 2488 |
| 1040 | Ga0501072_0002332 | 3300049588 | Bacteria | 14238 |
| 1041 | Ga0501073_0002861 | 3300049589 | Bacteria | 12925 |
| 1042 | Ga0501073_0003322 | 3300049589 | Bacteria | 12092 |
| 1043 | Ga0501073_0023664 | 3300049589 | Bacteria | 4408 |
| 1044 | Ga0501073_0031131 | 3300049589 | Bacteria | 3807 |
| 1045 | Ga0501073_0079942 | 3300049589 | Bacteria | 2275 |
| 1046 | Ga0501073_0098852 | 3300049589 | Bacteria | 2026 |
| 1047 | Ga0501074_0001728 | 3300049590 | Bacteria | 14921 |
| 1048 | Ga0501074_0004828 | 3300049590 | Bacteria | 9660 |
| 1049 | Ga0501074_0005047 | 3300049590 | Bacteria | 9468 |
| 1050 | Ga0501074_0013979 | 3300049590 | Bacteria | 5834 |
| 1051 | Ga0501074_0027291 | 3300049590 | Bacteria | 4140 |
| 1052 | Ga0501074_0027950 | 3300049590 | Bacteria | 4088 |
| 1053 | Ga0501074_0053095 | 3300049590 | Bacteria | 2925 |
| 1054 | Ga0501079_0046112 | 3300049741 | Bacteria | 3363 |
| 1055 | Ga0501079_0060209 | 3300049741 | Bacteria | 2929 |
| 1056 | Ga0501080_0001987 | 3300049742 | Bacteria | 17631 |
| 1057 | Ga0501080_0004316 | 3300049742 | Bacteria | 12625 |
| 1058 | Ga0501080_0031269 | 3300049742 | Bacteria | 4960 |
| 1059 | Ga0501080_0035546 | 3300049742 | Bacteria | 4649 |
| 1060 | Ga0501080_0035641 | 3300049742 | Bacteria | 4643 |
| 1061 | Ga0501080_0068947 | 3300049742 | Bacteria | 3289 |
| 1062 | Ga0501080_0074831 | 3300049742 | Bacteria | 3150 |
| 1063 | Ga0501081_0058272 | 3300049743 | Bacteria | 2672 |
| 1064 | Ga0501035_0003159 | 3300049822 | Bacteria | 15825 |
| 1065 | Ga0501035_0003545 | 3300049822 | Bacteria | 14903 |
| 1066 | Ga0501035_0004047 | 3300049822 | Bacteria | 13963 |
| 1067 | Ga0501035_0007349 | 3300049822 | Bacteria | 10297 |
| 1068 | Ga0501035_0021417 | 3300049822 | Bacteria | 5942 |
| 1069 | Ga0501035_0029276 | 3300049822 | Bacteria | 5022 |
| 1070 | Ga0501035_0035399 | 3300049822 | Bacteria | 4531 |
| 1071 | Ga0501035_0100174 | 3300049822 | Bacteria | 2543 |
| 1072 | Ga0501035_0167572 | 3300049822 | Bacteria | 1899 |
| 1073 | Ga0501035_0176765 | 3300049822 | Bacteria | 1841 |
| 1074 | Ga0501044_0000987 | 3300049823 | Bacteria | 34197 |
| 1075 | Ga0501044_0004695 | 3300049823 | Bacteria | 15274 |
| 1076 | Ga0501044_0014274 | 3300049823 | Bacteria | 8576 |
| 1077 | Ga0501044_0021149 | 3300049823 | Bacteria | 6946 |
| 1078 | Ga0501044_0040777 | 3300049823 | Bacteria | 4837 |
| 1079 | Ga0501044_0056198 | 3300049823 | Bacteria | 4040 |
| 1080 | Ga0501044_0096875 | 3300049823 | Bacteria | 2971 |
| 1081 | Ga0501044_0148263 | 3300049823 | Bacteria | 2329 |
| 1082 | Ga0501044_0157883 | 3300049823 | Bacteria | 2246 |
| 1083 | Ga0501045_0007173 | 3300049824 | Bacteria | 7732 |
| 1084 | nmdc:mga03n38_275_c1 | 3300050490 | Bacteria | 12239 |
| 1085 | nmdc:mga00v17_112_c1 | 3300050491 | Bacteria | 48527 |
| 1086 | nmdc:mga00v17_1548_c1 | 3300050491 | Bacteria | 12001 |
| 1087 | nmdc:mga00v17_458_c1 | 3300050491 | Bacteria | 22819 |
| 1088 | nmdc:mga00v17_9702_c1 | 3300050491 | Bacteria | 5223 |
| 1089 | nmdc:mga0yw44_153_c1 | 3300050492 | Bacteria | 23825 |
| 1090 | nmdc:mga06z11_1243_c1 | 3300050494 | Bacteria | 9404 |
| 1091 | nmdc:mga06z11_950_c1 | 3300050494 | Bacteria | 10551 |
| 1092 | nmdc:mga04h51_1512_c1 | 3300050495 | Bacteria | 5389 |
| 1093 | nmdc:mga07m45_132_c1 | 3300050496 | Bacteria | 29506 |
| 1094 | nmdc:mga05p37_48674_c1 | 3300050507 | Bacteria | 5213 |
| 1095 | nmdc:mga05p37_58838_c1 | 3300050507 | Bacteria | 4733 |
| 1096 | nmdc:mga09592_3405_c1 | 3300050508 | Bacteria | 12857 |
| 1097 | nmdc:mga0qj67_19462_c1 | 3300050509 | Bacteria | 5186 |
| 1098 | nmdc:mga06r32_1946_c1 | 3300050510 | Bacteria | 18400 |
| 1099 | nmdc:mga08y16_43276_c1 | 3300050511 | Bacteria | 4719 |
| 1100 | nmdc:mga0n895_144402_c1 | 3300050512 | Bacteria | 2409 |
| 1101 | nmdc:mga0n895_28377_c1 | 3300050512 | Bacteria | 5322 |
| 1102 | nmdc:mga0a205_61957_c1 | 3300050515 | Bacteria | 3614 |
| 1103 | nmdc:mga0sz30_24_c2 | 3300050516 | Bacteria | 23796 |
| 1104 | Ga0500610_0002481 | 3300053079 | Bacteria | 6818 |
| 1105 | Ga0500643_000020 | 3300053087 | Bacteria | 290328 |
| 1106 | Ga0500643_007001 | 3300053087 | Bacteria | 4625 |
| 1107 | Ga0500651_0000592 | 3300053093 | Bacteria | 18193 |
| 1108 | Ga0500651_0009373 | 3300053093 | Bacteria | 5811 |
| 1109 | Ga0500566_0052977 | 3300053094 | Bacteria | 2317 |
| 1110 | Ga0500555_000336 | 3300053103 | Bacteria | 20134 |
| 1111 | Ga0500568_0000145 | 3300053139 | Bacteria | 62300 |
| 1112 | Ga0500638_050268 | 3300053162 | Bacteria | 2016 |
| 1113 | Ga0500645_008678 | 3300053730 | Bacteria | 3449 |
| 1114 | Ga0501084_0112104 | 3300054114 | Bacteria | 2292 |
| 1115 | Ga0501082_0000082 | 3300060353 | Bacteria | 71065 |
| 1116 | Ga0466962_0001777 | 3300061719 | Bacteria | 10145 |
| 1117 | Ga0466962_0014644 | 3300061719 | Bacteria | 3779 |
| 1118 | Ga0466962_0074995 | 3300061719 | Bacteria | 1616 |
| 1119 | 2525555967 | 2524614729 | Bacteria | 3091755 |
| 1120 | 2538832264 | 2537561836 | Bacteria | 3910579 |
| 1121 | 2547500237 | 2547132130 | Bacteria | 4660562 |
| 1122 | 2572253472 | 2571042365 | Bacteria | 3289345 |
| 1123 | 2578459143 | 2576861471 | Bacteria | 4648976 |
| 1124 | 2595446813 | 2593339238 | Bacteria | 4182970 |
| 1125 | 2595449569 | 2593339239 | Bacteria | 4124669 |
| 1126 | 2630650981 | 2627854209 | Bacteria | 3093011 |
| 1127 | 2643815402 | 2643221559 | Bacteria | 4424915 |
| 1128 | 2643830274 | 2643221562 | Bacteria | 4048635 |
| 1129 | 2643879453 | 2643221573 | Bacteria | 4784121 |
| 1130 | 2643896791 | 2643221577 | Bacteria | 3710843 |
| 1131 | 2643905735 | 2643221579 | Bacteria | 4443405 |
| 1132 | 2643913132 | 2643221581 | Bacteria | 3893603 |
| 1133 | 2643940078 | 2643221586 | Bacteria | 4446529 |
| 1134 | 2643974355 | 2643221593 | Bacteria | 6296053 |
| 1135 | 2644077134 | 2643221612 | Bacteria | 4361984 |
| 1136 | 2644478996 | 2643221685 | Bacteria | 3673288 |
| 1137 | 2644528817 | 2643221695 | Bacteria | 3441323 |
| 1138 | 2644662936 | 2643221720 | Bacteria | 4694283 |
| 1139 | 2644695448 | 2643221727 | Bacteria | 4415595 |
| 1140 | 2644698110 | 2643221728 | Bacteria | 4797149 |
| 1141 | 2687583778 | 2687453130 | Bacteria | 4227172 |
| 1142 | 2721026520 | 2718218334 | Bacteria | 4765486 |
| 1143 | 2735833485 | 2734482264 | Unclassified | 5014763 |
| 1144 | 2739229486 | 2738543009 | Bacteria | 4944499 |
| 1145 | 2739730249 | 2739367700 | Bacteria | 4747630 |
| 1146 | 2747949905 | 2747842428 | Bacteria | 4689383 |
| 1147 | 2748017182 | 2747842501 | Bacteria | 5293829 |
| 1148 | 2765578198 | 2765235840 | Bacteria | 4663337 |
| 1149 | 2816516242 | 2816332141 | Bacteria | 4436036 |
| 1150 | 2819563963 | 2818991440 | Bacteria | 4774720 |
| 1151 | 2819660321 | 2818991457 | Bacteria | 5323295 |
| 1152 | 2842393573 | 2842391507 | Bacteria | 4486072 |
| 1153 | 2842759398 | 2842757796 | Bacteria | 3981385 |
| 1154 | 2842783526 | 2842780639 | Bacteria | 4337790 |
| 1155 | 2842918497 | 2842914999 | Bacteria | 4419378 |
| 1156 | 2842919881 | 2842918807 | Bacteria | 4289178 |
| 1157 | 2848700147 | 2848694841 | Bacteria | 9205737 |
| 1158 | 2852651500 | 2852649853 | Bacteria | 4036942 |
| 1159 | 2852689143 | 2852684882 | Bacteria | 5463342 |
| 1160 | 2855736366 | 2855730933 | Bacteria | 7047938 |
| 1161 | 2855773303 | 2855767633 | Bacteria | 7049357 |
| 1162 | 2857443025 | 2857442823 | Bacteria | 4562550 |
| 1163 | 2874220834 | 2874220319 | Bacteria | 4594709 |
| 1164 | 2884341479 | 2884338543 | Bacteria | 4610696 |
| 1165 | 2884412156 | 2884411467 | Bacteria | 5246714 |
| 1166 | 2887380371 | 2887375801 | Bacteria | 5334027 |
| 1167 | 2888375110 | 2888373701 | Bacteria | 5098052 |
| 1168 | 2894414674 | 2894414249 | Bacteria | 4405451 |
| 1169 | 2895397661 | 2895395659 | Bacteria | 3983269 |
| 1170 | 2895499169 | 2895498888 | Bacteria | 5283788 |
| 1171 | 2895512191 | 2895511927 | Bacteria | 6802080 |
| 1172 | 2895522202 | 2895522137 | Bacteria | 3284416 |
| 1173 | 2895527355 | 2895525241 | Bacteria | 3388457 |
| 1174 | 2904464599 | 2904463128 | Bacteria | 4775606 |
| 1175 | 2919088319 | 2919085039 | Bacteria | 4532964 |
| 1176 | 2919092651 | 2919089067 | Bacteria | 4560942 |
| 1177 | 2919130407 | 2919130084 | Bacteria | 5301837 |
| 1178 | 2919136950 | 2919134579 | Bacteria | 4480386 |
| 1179 | 2919406098 | 2919404418 | Bacteria | 4232372 |
| 1180 | 2919516508 | 2919513703 | Bacteria | 3844312 |
| 1181 | 2919678608 | 2919675420 | Bacteria | 3969095 |
| 1182 | 2923517833 | 2923516293 | Bacteria | 3716336 |
| 1183 | 2928496848 | 2928496128 | Bacteria | 4631123 |
| 1184 | 2928967685 | 2928963466 | Bacteria | 5165703 |
| 1185 | 2929198585 | 2929195423 | Bacteria | 5325372 |
| 1186 | 2931381542 | 2931380184 | Bacteria | 4455911 |
| 1187 | 2937611665 | 2937610967 | Bacteria | 4618818 |
| 1188 | 2939592243 | 2939589442 | Bacteria | 4214238 |
| 1189 | 2939612524 | 2939611941 | Bacteria | 3892017 |
| 1190 | 2939626400 | 2939622612 | Bacteria | 4698046 |
| 1191 | 2939627599 | 2939626828 | Bacteria | 4695272 |
| 1192 | 2941472929 | 2941471342 | Bacteria | 5018624 |
| 1193 | 2941476932 | 2941475908 | Bacteria | 4145589 |
| 1194 | 2941489558 | 2941489479 | Bacteria | 6313767 |
| 1195 | 2953995180 | 2953994433 | Bacteria | 4303959 |
| 1196 | 2961047599 | 2961047084 | Bacteria | 4594415 |
| 1197 | 2961068430 | 2961064222 | Bacteria | 4749990 |
| 1198 | 2974309578 | 2974307012 | Bacteria | 4172388 |
| 1199 | 2977250316 | 2977247770 | Bacteria | 4160543 |
| 1200 | 2984515209 | 2984514374 | Bacteria | 4172479 |
| 1201 | 2987608349 | 2987605356 | Bacteria | 4187822 |
| 1202 | 2995950906 | 2995948881 | Bacteria | 6358104 |
| 1203 | 8002393463 | 8002392321 | Bacteria | 4159911 |
| 1204 | 8002871702 | 8002869464 | Bacteria | 3588529 |
| 1205 | 8003014691 | 8003014200 | Bacteria | 4059994 |
| 1206 | 8021624868 | 8021622325 | Bacteria | 4844743 |
| 1207 | 8021627849 | 8021626552 | Bacteria | 4665214 |
| 1208 | 8021651918 | 8021648035 | Bacteria | 4772378 |
| 1209 | Ga0105238_10000924 | |||
| 1210 | SwRhRL2b_contig_3055844 | |||
| 1211 | JGI24741J21665_1002156 | |||
| 1212 | JGI24741J21665_1009817 | |||
| 1213 | JGI24740J21852_10002197 | |||
| 1214 | JGI24740J21852_10005668 | |||
| 1215 | JGI24739J22299_10002332 | |||
| 1216 | JGI24739J22299_10013417 | |||
| 1217 | JGI24737J22298_10000899 | |||
| 1218 | JGI24737J22298_10016466 | |||
| 1219 | JGI25156J39149_1007693 | |||
| 1220 | JGI25162J39368_1000226 | |||
| 1221 | JGI25162J39368_1000686 | |||
| 1222 | JGI25162J39368_1003175 | |||
| 1223 | JGI25162J39368_1003182 | |||
| 1224 | JGI25162J39368_1005076 | |||
| 1225 | JGI25157J39369_1001011 | |||
| 1226 | JGI25157J39369_1001369 | |||
| 1227 | JGI25157J39369_1001673 | |||
| 1228 | JGI25163J39215_1001647 | |||
| 1229 | JGI25164J39214_1000045 | |||
| 1230 | JGI25164J39214_1000435 | |||
| 1231 | JGI25164J39214_1001511 | |||
| 1232 | JGI25164J39214_1001528 | |||
| 1233 | JGI25152J39213_1000231 | |||
| 1234 | JGI25150J39212_1000095 | |||
| 1235 | JGI25151J46595_10000183 | |||
| 1236 | JGI25151J46595_10000195 | |||
| 1237 | JGI25151J46595_10000477 | |||
| 1238 | JGI25165J46597_1000072 | |||
| 1239 | JGI25165J46597_1000260 | |||
| 1240 | JGI25165J46597_1002761 | |||
| 1241 | JGI25153J46596_10000291 | |||
| 1242 | JGI26141J51220_1001122 | |||
| 1243 | Ga0006562J51391_1014504 | |||
| 1244 | Ga0006562J51391_1014508 | |||
| 1245 | Ga0006562J51391_1103326 | |||
| 1246 | Ga0055533_1000545 | |||
| 1247 | Ga0055525_1000027 | |||
| 1248 | Ga0055527_1000293 | |||
| 1249 | Ga0055527_1000294 | |||
| 1250 | Ga0055527_1000694 | |||
| 1251 | Ga0055535_1000623 | |||
| 1252 | Ga0055535_1001746 | |||
| 1253 | Ga0055535_1001841 | |||
| 1254 | Ga0055535_1002043 | |||
| 1255 | Ga0055535_1002731 | |||
| 1256 | Ga0055542_1000275 | |||
| 1257 | Ga0055542_1000329 | |||
| 1258 | Ga0055542_1000649 | |||
| 1259 | Ga0055542_1000744 | |||
| 1260 | Ga0055542_1001536 | |||
| 1261 | Ga0055542_1001924 | |||
| 1262 | Ga0055529_1000233 | |||
| 1263 | Ga0055529_1000684 | |||
| 1264 | Ga0055529_1001153 | |||
| 1265 | Ga0055529_1001341 | |||
| 1266 | Ga0055526_1000157 | |||
| 1267 | Ga0055537_1000169 | |||
| 1268 | Ga0055524_1000288 | |||
| 1269 | Ga0055536_1005549 | |||
| 1270 | Ga0055534_1000110 | |||
| 1271 | Ga0055534_1000393 | |||
| 1272 | Ga0055528_1000131 | |||
| 1273 | Ga0055528_1000946 | |||
| 1274 | Ga0055530_10002947 | |||
| 1275 | Ga0055530_10005690 | |||
| 1276 | Ga0055540_1016278 | |||
| 1277 | Ga0055531_10001282 | |||
| 1278 | Ga0055531_10011812 | |||
| 1279 | Ga0055531_10017163 | |||
| 1280 | Ga0058692_1000002 | |||
| 1281 | Ga0058692_1000017 | |||
| 1282 | Ga0065165_1000587 | |||
| 1283 | Ga0065165_1005214 | |||
| 1284 | Ga0065714_10014766 | |||
| 1285 | Ga0065704_10000275 | |||
| 1286 | Ga0065704_10002244 | |||
| 1287 | Ga0065715_10008318 | |||
| 1288 | Ga0070658_10004423 | |||
| 1289 | Ga0070683_100009388 | |||
| 1290 | Ga0070683_100030128 | |||
| 1291 | Ga0070670_100005186 | |||
| 1292 | Ga0070670_100015079 | |||
| 1293 | Ga0070670_100057852 | |||
| 1294 | Ga0068869_100011621 | |||
| 1295 | Ga0068869_100056293 | |||
| 1296 | Ga0070666_10000005 | |||
| 1297 | Ga0070666_10000109 | |||
| 1298 | Ga0070666_10091149 | |||
| 1299 | Ga0070680_100000582 | |||
| 1300 | Ga0070680_100011170 | |||
| 1301 | Ga0070680_100019943 | |||
| 1302 | Ga0070682_100007842 | |||
| 1303 | Ga0068868_100096767 | |||
| 1304 | Ga0070660_100022544 | |||
| 1305 | Ga0070660_100092497 | |||
| 1306 | Ga0070660_100093919 | |||
| 1307 | Ga0070691_10004017 | |||
| 1308 | Ga0070661_100025439 | |||
| 1309 | Ga0070661_100066014 | |||
| 1310 | Ga0070661_100224930 | |||
| 1311 | Ga0070692_10013541 | |||
| 1312 | Ga0070668_100015112 | |||
| 1313 | Ga0070668_100055546 | |||
| 1314 | Ga0070671_100022064 | |||
| 1315 | Ga0070673_100035809 | |||
| 1316 | Ga0070659_100004293 | |||
| 1317 | Ga0070659_100015194 | |||
| 1318 | Ga0070659_100040216 | |||
| 1319 | Ga0070659_100121716 | |||
| 1320 | Ga0070667_100000005 | |||
| 1321 | Ga0070667_100011088 | |||
| 1322 | Ga0070714_100000030 | |||
| 1323 | Ga0070714_100022547 | |||
| 1324 | Ga0070663_100001614 | |||
| 1325 | Ga0070663_100021593 | |||
| 1326 | Ga0070663_100030288 | |||
| 1327 | Ga0070663_100063269 | |||
| 1328 | Ga0070678_100022542 | |||
| 1329 | Ga0070662_100029847 | |||
| 1330 | Ga0070662_100176421 | |||
| 1331 | Ga0070681_10000012 | |||
| 1332 | Ga0070681_10000151 | |||
| 1333 | Ga0070681_10015872 | |||
| 1334 | Ga0070681_10021334 | |||
| 1335 | Ga0070681_10049132 | |||
| 1336 | Ga0070681_10215218 | |||
| 1337 | Ga0068867_100047162 | |||
| 1338 | Ga0070685_10020643 | |||
| 1339 | Ga0070706_100137400 | |||
| 1340 | Ga0070707_100044426 | |||
| 1341 | Ga0070698_100003276 | |||
| 1342 | Ga0070698_100007458 | |||
| 1343 | Ga0070699_100006355 | |||
| 1344 | Ga0070699_100007511 | |||
| 1345 | Ga0070679_100000250 | |||
| 1346 | Ga0070679_100002170 | |||
| 1347 | Ga0070679_100017294 | |||
| 1348 | Ga0070679_100018115 | |||
| 1349 | Ga0070679_100020190 | |||
| 1350 | Ga0070679_100084666 | |||
| 1351 | Ga0070679_100091324 | |||
| 1352 | Ga0070679_100190477 | |||
| 1353 | Ga0070684_100043290 | |||
| 1354 | Ga0068853_100007278 | |||
| 1355 | Ga0068853_100037423 | |||
| 1356 | Ga0068853_100042692 | |||
| 1357 | Ga0068853_100211371 | |||
| 1358 | Ga0070672_100020456 | |||
| 1359 | Ga0070672_100028699 | |||
| 1360 | Ga0070672_100133477 | |||
| 1361 | Ga0070696_100016563 | |||
| 1362 | Ga0070696_100087642 | |||
| 1363 | Ga0070693_100004804 | |||
| 1364 | Ga0070693_100011978 | |||
| 1365 | Ga0070693_100022508 | |||
| 1366 | Ga0070665_100000057 | |||
| 1367 | Ga0070665_100002080 | |||
| 1368 | Ga0070665_100007314 | |||
| 1369 | Ga0070665_100055961 | |||
| 1370 | Ga0070665_100081154 | |||
| 1371 | Ga0070665_100094147 | |||
| 1372 | Ga0068855_100006636 | |||
| 1373 | Ga0068855_100009999 | |||
| 1374 | Ga0068855_100011362 | |||
| 1375 | Ga0068855_100048818 | |||
| 1376 | Ga0068855_100051540 | |||
| 1377 | Ga0068855_100175469 | |||
| 1378 | Ga0070664_100142482 | |||
| 1379 | Ga0068857_100018935 | |||
| 1380 | Ga0068857_100027344 | |||
| 1381 | Ga0068854_100007062 | |||
| 1382 | Ga0068854_100018464 | |||
| 1383 | Ga0068856_100000562 | |||
| 1384 | Ga0068856_100014061 | |||
| 1385 | Ga0068856_100017954 | |||
| 1386 | Ga0068856_100047688 | |||
| 1387 | Ga0068856_100054557 | |||
| 1388 | Ga0068856_100061782 | |||
| 1389 | Ga0068852_100070903 | |||
| 1390 | Ga0068852_100082345 | |||
| 1391 | Ga0068852_100145566 | |||
| 1392 | Ga0068859_100001188 | |||
| 1393 | Ga0068859_100032636 | |||
| 1394 | Ga0068859_100149907 | |||
| 1395 | Ga0068864_100027618 | |||
| 1396 | Ga0068864_100248184 | |||
| 1397 | Ga0068861_100057351 | |||
| 1398 | Ga0068851_10034009 | |||
| 1399 | Ga0068863_100014237 | |||
| 1400 | Ga0068858_100000756 | |||
| 1401 | Ga0068860_100022592 | |||
| 1402 | Ga0068860_100070622 | |||
| 1403 | Ga0075365_10003207 | |||
| 1404 | Ga0075363_100000300 | |||
| 1405 | Ga0075364_10000282 | |||
| 1406 | Ga0075364_10000611 | |||
| 1407 | Ga0075364_10019278 | |||
| 1408 | Ga0075364_10064642 | |||
| 1409 | Ga0075364_10084553 | |||
| 1410 | Ga0075367_10001307 | |||
| 1411 | Ga0075369_10000096 | |||
| 1412 | Ga0075427_10000040 | |||
| 1413 | Ga0097621_100051852 | |||
| 1414 | Ga0075370_10000080 | |||
| 1415 | Ga0068871_100039443 | |||
| 1416 | Ga0068871_100148287 | |||
| 1417 | Ga0075428_100248666 | |||
| 1418 | Ga0075428_100259391 | |||
| 1419 | Ga0075430_100065380 | |||
| 1420 | Ga0075431_100000523 | |||
| 1421 | Ga0075433_10115062 | |||
| 1422 | Ga0075434_100030354 | |||
| 1423 | Ga0075434_100148119 | |||
| 1424 | Ga0075429_100006840 | |||
| 1425 | Ga0097620_100001188 | |||
| 1426 | Ga0097620_100032636 | |||
| 1427 | Ga0097620_100149909 | |||
| 1428 | Ga0099794_10000547 | |||
| 1429 | Ga0105251_10000219 | |||
| 1430 | Ga0105240_10000898 | |||
| 1431 | Ga0105240_10010308 | |||
| 1432 | Ga0105240_10016744 | |||
| 1433 | Ga0105240_10023437 | |||
| 1434 | Ga0105240_10024511 | |||
| 1435 | Ga0105240_10074438 | |||
| 1436 | Ga0105240_10211204 | |||
| 1437 | Ga0105240_10448027 | |||
| 1438 | Ga0111539_10049286 | |||
| 1439 | Ga0114129_10011620 | |||
| 1440 | Ga0114129_10039875 | |||
| 1441 | Ga0114129_10284607 | |||
| 1442 | Ga0105243_10003262 | |||
| 1443 | Ga0105241_10003742 | |||
| 1444 | Ga0105241_10024704 | |||
| 1445 | Ga0105241_10055513 | |||
| 1446 | Ga0105242_10000940 | |||
| 1447 | Ga0105248_10001462 | |||
| 1448 | Ga0105248_10044939 | |||
| 1449 | Ga0105237_10000064 | |||
| 1450 | Ga0105237_10000183 | |||
| 1451 | Ga0105237_10004545 | |||
| 1452 | Ga0105237_10018769 | |||
| 1453 | Ga0105237_10288567 | |||
| 1454 | Ga0105237_10291157 | |||
| 1455 | Ga0105238_10001307 | |||
| 1456 | Ga0105238_10006865 | |||
| 1457 | Ga0105238_10052297 | |||
| 1458 | Ga0105249_10000763 | |||
| 1459 | Ga0105249_10005381 | |||
| 1460 | Ga0105032_100667 | |||
| 1461 | Ga0105239_10000030 | |||
| 1462 | Ga0105239_10008425 | |||
| 1463 | Ga0105239_10009795 | |||
| 1464 | Ga0105239_10011192 | |||
| 1465 | Ga0105239_10016070 | |||
| 1466 | Ga0105239_10039052 | |||
| 1467 | Ga0105239_10066978 | |||
| 1468 | Ga0105239_10098477 | |||
| 1469 | Ga0105239_10113787 | |||
| 1470 | Ga0157373_10028299 | |||
| 1471 | Ga0157371_10012688 | |||
| 1472 | Ga0157371_10025362 | |||
| 1473 | Ga0157371_10063818 | |||
| 1474 | Ga0157371_10103052 | |||
| 1475 | Ga0157370_10000407 | |||
| 1476 | Ga0157370_10002303 | |||
| 1477 | Ga0157370_10007052 | |||
| 1478 | Ga0157370_10012852 | |||
| 1479 | Ga0157370_10018203 | |||
| 1480 | Ga0157370_10030975 | |||
| 1481 | Ga0157370_10085469 | |||
| 1482 | Ga0157370_10214567 | |||
| 1483 | Ga0157369_10000195 | |||
| 1484 | Ga0157369_10000509 | |||
| 1485 | Ga0157369_10003447 | |||
| 1486 | Ga0157369_10004837 | |||
| 1487 | Ga0157369_10028624 | |||
| 1488 | Ga0157369_10045167 | |||
| 1489 | Ga0157369_10046724 | |||
| 1490 | Ga0157374_10011393 | |||
| 1491 | Ga0157374_10042600 | |||
| 1492 | Ga0157374_10054149 | |||
| 1493 | Ga0157374_10144118 | |||
| 1494 | Ga0157378_10000043 | |||
| 1495 | Ga0163162_10000015 | |||
| 1496 | Ga0163162_10008148 | |||
| 1497 | Ga0163162_10009175 | |||
| 1498 | Ga0163162_10045124 | |||
| 1499 | Ga0157372_10001376 | |||
| 1500 | Ga0157372_10005235 | |||
| 1501 | Ga0157372_10005613 | |||
| 1502 | Ga0157372_10037943 | |||
| 1503 | Ga0157372_10039541 | |||
| 1504 | Ga0157372_10047036 | |||
| 1505 | Ga0157372_10125511 | |||
| 1506 | Ga0157375_10000940 | |||
| 1507 | Ga0157375_10001135 | |||
| 1508 | Ga0157375_10019516 | |||
| 1509 | Ga0157375_10062201 | |||
| 1510 | Ga0157375_10073185 | |||
| 1511 | Ga0163163_10000196 | |||
| 1512 | Ga0163163_10039519 | |||
| 1513 | Ga0157380_10001358 | |||
| 1514 | Ga0182008_10002952 | |||
| 1515 | Ga0182008_10005759 | |||
| 1516 | Ga0182008_10009735 | |||
| 1517 | Ga0182008_10013586 | |||
| 1518 | Ga0157379_10040669 | |||
| 1519 | Ga0157379_10067062 | |||
| 1520 | Ga0157376_10002600 | |||
| 1521 | Ga0157376_10117229 | |||
| 1522 | Ga0157376_10152496 | |||
| 1523 | Ga0182006_1000085 | |||
| 1524 | Ga0182006_1001966 | |||
| 1525 | Ga0182006_1007417 | |||
| 1526 | Ga0182006_1029139 | |||
| 1527 | Ga0182006_1033402 | |||
| 1528 | Ga0182007_10001735 | |||
| 1529 | Ga0182007_10003021 | |||
| 1530 | Ga0182007_10003786 | |||
| 1531 | Ga0182007_10006163 | |||
| 1532 | Ga0182005_1000028 | |||
| 1533 | Ga0182005_1001033 | |||
| 1534 | Ga0183369_1007 | |||
| 1535 | Ga0183368_1003 | |||
| 1536 | Ga0183360_10001 | |||
| 1537 | Ga0163161_10003975 | |||
| 1538 | Ga0163161_10009726 | |||
| 1539 | Ga0163161_10019639 | |||
| 1540 | Ga0206356_10829538 | |||
| 1541 | Ga0206356_11137636 | |||
| 1542 | Ga0206354_11451415 | |||
| 1543 | Ga0206353_10693000 | |||
| 1544 | Ga0154015_1092133 | |||
| 1545 | Ga0209435_103996 | |||
| 1546 | Ga0209760_100625 | |||
| 1547 | Ga0209784_100709 | |||
| 1548 | Ga0209674_100012 | |||
| 1549 | Ga0209674_100119 | |||
| 1550 | Ga0209674_100603 | |||
| 1551 | Ga0209674_102640 | |||
| 1552 | Ga0209672_100005 | |||
| 1553 | Ga0209672_100016 | |||
| 1554 | Ga0209672_100312 | |||
| 1555 | Ga0209672_101666 | |||
| 1556 | Ga0209147_102563 | |||
| 1557 | Ga0209563_100023 | |||
| 1558 | Ga0207427_100055 | |||
| 1559 | Ga0207427_100156 | |||
| 1560 | Ga0207427_101364 | |||
| 1561 | Ga0207427_101551 | |||
| 1562 | Ga0207427_101571 | |||
| 1563 | Ga0209437_100020 | |||
| 1564 | Ga0209437_100147 | |||
| 1565 | Ga0209437_100161 | |||
| 1566 | Ga0209437_100224 | |||
| 1567 | Ga0209437_100231 | |||
| 1568 | Ga0209437_100476 | |||
| 1569 | Ga0209437_104309 | |||
| 1570 | Ga0209258_100006 | |||
| 1571 | Ga0209258_100012 | |||
| 1572 | Ga0209258_100049 | |||
| 1573 | Ga0209258_100064 | |||
| 1574 | Ga0209258_100186 | |||
| 1575 | Ga0209258_101060 | |||
| 1576 | Ga0207425_1000028 | |||
| 1577 | Ga0207425_1001541 | |||
| 1578 | Ga0209646_1001220 | |||
| 1579 | Ga0209646_1001618 | |||
| 1580 | Ga0209026_1000037 | |||
| 1581 | Ga0209026_1000099 | |||
| 1582 | Ga0209026_1000122 | |||
| 1583 | Ga0209026_1000541 | |||
| 1584 | Ga0209677_101301 | |||
| 1585 | Ga0209148_1000005 | |||
| 1586 | Ga0209148_1000010 | |||
| 1587 | Ga0209148_1000012 | |||
| 1588 | Ga0209148_1000014 | |||
| 1589 | Ga0209148_1000073 | |||
| 1590 | Ga0209148_1000142 | |||
| 1591 | Ga0209148_1001552 | |||
| 1592 | Ga0209759_1000103 | |||
| 1593 | Ga0209759_1000792 | |||
| 1594 | Ga0209759_1001568 | |||
| 1595 | Ga0209759_1005814 | |||
| 1596 | Ga0209129_1000065 | |||
| 1597 | Ga0209129_1000752 | |||
| 1598 | Ga0209129_1006069 | |||
| 1599 | Ga0209233_1000009 | |||
| 1600 | Ga0209233_1000020 | |||
| 1601 | Ga0209233_1000063 | |||
| 1602 | Ga0209233_1000147 | |||
| 1603 | Ga0209233_1000736 | |||
| 1604 | Ga0209233_1014052 | |||
| 1605 | Ga0209565_1000001 | |||
| 1606 | Ga0209565_1000014 | |||
| 1607 | Ga0209565_1000081 | |||
| 1608 | Ga0209565_1003582 | |||
| 1609 | Ga0209455_1000008 | |||
| 1610 | Ga0209455_1000014 | |||
| 1611 | Ga0209455_1000086 | |||
| 1612 | Ga0209455_1000177 | |||
| 1613 | Ga0209455_1000308 | |||
| 1614 | Ga0209673_1000001 | |||
| 1615 | Ga0209673_1001077 | |||
| 1616 | Ga0209673_1004025 | |||
| 1617 | Ga0209675_1000001 | |||
| 1618 | Ga0209675_1000021 | |||
| 1619 | Ga0209676_1000024 | |||
| 1620 | Ga0209676_1000225 | |||
| 1621 | Ga0209676_1001462 | |||
| 1622 | Ga0209676_1003048 | |||
| 1623 | Ga0209676_1003938 | |||
| 1624 | Ga0209676_1004689 | |||
| 1625 | Ga0209676_1008220 | |||
| 1626 | Ga0209025_1000002 | |||
| 1627 | Ga0209025_1000015 | |||
| 1628 | Ga0209025_1000040 | |||
| 1629 | Ga0209025_1003033 | |||
| 1630 | Ga0209025_1006289 | |||
| 1631 | Ga0209564_1000001 | |||
| 1632 | Ga0209564_1000547 | |||
| 1633 | Ga0209564_1013465 | |||
| 1634 | Ga0209564_1023516 | |||
| 1635 | Ga0209758_1000003 | |||
| 1636 | Ga0209758_1001371 | |||
| 1637 | Ga0209758_1004728 | |||
| 1638 | Ga0209758_1010415 | |||
| 1639 | Ga0209758_1012329 | |||
| 1640 | Ga0209050_1000541 | |||
| 1641 | Ga0209050_1002752 | |||
| 1642 | Ga0209050_1003486 | |||
| 1643 | Ga0209256_1000002 | |||
| 1644 | Ga0209256_1004202 | |||
| 1645 | Ga0209256_1007889 | |||
| 1646 | Ga0209256_1009510 | |||
| 1647 | Ga0209256_1010651 | |||
| 1648 | Ga0209256_1011461 | |||
| 1649 | Ga0209256_1021245 | |||
| 1650 | Ga0209051_1003094 | |||
| 1651 | Ga0209257_1000148 | |||
| 1652 | Ga0209257_1000180 | |||
| 1653 | Ga0209257_1000204 | |||
| 1654 | Ga0209257_1001906 | |||
| 1655 | Ga0209257_1002013 | |||
| 1656 | Ga0209257_1002127 | |||
| 1657 | Ga0209257_1004808 | |||
| 1658 | Ga0209257_1009717 | |||
| 1659 | Ga0209257_1010648 | |||
| 1660 | Ga0209257_1029601 | |||
| 1661 | Ga0207656_10001704 | |||
| 1662 | Ga0207656_10004357 | |||
| 1663 | Ga0207655_1000162 | |||
| 1664 | Ga0207713_1000393 | |||
| 1665 | Ga0207713_1039274 | |||
| 1666 | Ga0207680_10000005 | |||
| 1667 | Ga0207680_10000255 | |||
| 1668 | Ga0207680_10000514 | |||
| 1669 | Ga0207647_10000343 | |||
| 1670 | Ga0207647_10000512 | |||
| 1671 | Ga0207647_10000759 | |||
| 1672 | Ga0207647_10001940 | |||
| 1673 | Ga0207647_10007235 | |||
| 1674 | Ga0207647_10011712 | |||
| 1675 | Ga0207647_10011995 | |||
| 1676 | Ga0207647_10038298 | |||
| 1677 | Ga0207699_10133879 | |||
| 1678 | Ga0207645_10050498 | |||
| 1679 | Ga0207705_10000206 | |||
| 1680 | Ga0207705_10002274 | |||
| 1681 | Ga0207705_10002283 | |||
| 1682 | Ga0207705_10005224 | |||
| 1683 | Ga0207705_10028909 | |||
| 1684 | Ga0207684_10129946 | |||
| 1685 | Ga0207654_10029838 | |||
| 1686 | Ga0207707_10000064 | |||
| 1687 | Ga0207707_10000146 | |||
| 1688 | Ga0207707_10000244 | |||
| 1689 | Ga0207707_10000948 | |||
| 1690 | Ga0207707_10003238 | |||
| 1691 | Ga0207707_10005253 | |||
| 1692 | Ga0207707_10008914 | |||
| 1693 | Ga0207707_10014797 | |||
| 1694 | Ga0207707_10016433 | |||
| 1695 | Ga0207707_10018697 | |||
| 1696 | Ga0207707_10036183 | |||
| 1697 | Ga0207707_10192832 | |||
| 1698 | Ga0207695_10000007 | |||
| 1699 | Ga0207695_10000780 | |||
| 1700 | Ga0207695_10001436 | |||
| 1701 | Ga0207695_10001823 | |||
| 1702 | Ga0207695_10008312 | |||
| 1703 | Ga0207695_10008391 | |||
| 1704 | Ga0207695_10011400 | |||
| 1705 | Ga0207695_10016742 | |||
| 1706 | Ga0207695_10026197 | |||
| 1707 | Ga0207671_10000061 | |||
| 1708 | Ga0207671_10000329 | |||
| 1709 | Ga0207671_10001147 | |||
| 1710 | Ga0207671_10003503 | |||
| 1711 | Ga0207671_10003678 | |||
| 1712 | Ga0207671_10023978 | |||
| 1713 | Ga0207660_10000399 | |||
| 1714 | Ga0207660_10000676 | |||
| 1715 | Ga0207660_10002480 | |||
| 1716 | Ga0207660_10004546 | |||
| 1717 | Ga0207660_10008645 | |||
| 1718 | Ga0207657_10014382 | |||
| 1719 | Ga0207657_10018424 | |||
| 1720 | Ga0207657_10021615 | |||
| 1721 | Ga0207657_10023056 | |||
| 1722 | Ga0207657_10035226 | |||
| 1723 | Ga0207657_10059762 | |||
| 1724 | Ga0207649_10000847 | |||
| 1725 | Ga0207649_10010415 | |||
| 1726 | Ga0207649_10027962 | |||
| 1727 | Ga0207652_10000019 | |||
| 1728 | Ga0207652_10000084 | |||
| 1729 | Ga0207652_10000644 | |||
| 1730 | Ga0207652_10002333 | |||
| 1731 | Ga0207652_10070526 | |||
| 1732 | Ga0207694_10000162 | |||
| 1733 | Ga0207694_10002417 | |||
| 1734 | Ga0207694_10003467 | |||
| 1735 | Ga0207650_10021393 | |||
| 1736 | Ga0207650_10115210 | |||
| 1737 | Ga0207664_10000026 | |||
| 1738 | Ga0207664_10001222 | |||
| 1739 | Ga0207644_10032119 | |||
| 1740 | Ga0207690_10000864 | |||
| 1741 | Ga0207690_10000975 | |||
| 1742 | Ga0207690_10004131 | |||
| 1743 | Ga0207690_10032621 | |||
| 1744 | Ga0207690_10069172 | |||
| 1745 | Ga0207690_10075459 | |||
| 1746 | Ga0207706_10011833 | |||
| 1747 | Ga0207706_10022696 | |||
| 1748 | Ga0207686_10046784 | |||
| 1749 | Ga0207709_10008328 | |||
| 1750 | Ga0207669_10045469 | |||
| 1751 | Ga0207704_10005852 | |||
| 1752 | Ga0207691_10043022 | |||
| 1753 | Ga0207691_10057527 | |||
| 1754 | Ga0207691_10100639 | |||
| 1755 | Ga0207691_10152273 | |||
| 1756 | Ga0207711_10001229 | |||
| 1757 | Ga0207689_10019419 | |||
| 1758 | Ga0207661_10006751 | |||
| 1759 | Ga0207661_10010584 | |||
| 1760 | Ga0207679_10041737 | |||
| 1761 | Ga0207667_10000386 | |||
| 1762 | Ga0207667_10001306 | |||
| 1763 | Ga0207667_10005108 | |||
| 1764 | Ga0207667_10005523 | |||
| 1765 | Ga0207667_10007230 | |||
| 1766 | Ga0207667_10011673 | |||
| 1767 | Ga0207667_10014077 | |||
| 1768 | Ga0207667_10015916 | |||
| 1769 | Ga0207667_10033066 | |||
| 1770 | Ga0207667_10064166 | |||
| 1771 | Ga0207667_10160495 | |||
| 1772 | Ga0207712_10001183 | |||
| 1773 | Ga0207712_10001310 | |||
| 1774 | Ga0207668_10124978 | |||
| 1775 | Ga0207640_10000378 | |||
| 1776 | Ga0207640_10002161 | |||
| 1777 | Ga0207640_10004984 | |||
| 1778 | Ga0207640_10006665 | |||
| 1779 | Ga0207640_10007842 | |||
| 1780 | Ga0207640_10009690 | |||
| 1781 | Ga0207640_10046461 | |||
| 1782 | Ga0207640_10183856 | |||
| 1783 | Ga0207658_10000006 | |||
| 1784 | Ga0207658_10054137 | |||
| 1785 | Ga0207677_10170338 | |||
| 1786 | Ga0207703_10000809 | |||
| 1787 | Ga0207703_10190879 | |||
| 1788 | Ga0207639_10000230 | |||
| 1789 | Ga0207639_10000955 | |||
| 1790 | Ga0207639_10002731 | |||
| 1791 | Ga0207639_10003037 | |||
| 1792 | Ga0207639_10009277 | |||
| 1793 | Ga0207639_10009814 | |||
| 1794 | Ga0207639_10174747 | |||
| 1795 | Ga0207678_10003502 | |||
| 1796 | Ga0207678_10004583 | |||
| 1797 | Ga0207678_10010017 | |||
| 1798 | Ga0207678_10019059 | |||
| 1799 | Ga0207678_10023472 | |||
| 1800 | Ga0207678_10034687 | |||
| 1801 | Ga0207678_10068449 | |||
| 1802 | Ga0207678_10185639 | |||
| 1803 | Ga0207702_10000580 | |||
| 1804 | Ga0207702_10001534 | |||
| 1805 | Ga0207702_10002243 | |||
| 1806 | Ga0207702_10011344 | |||
| 1807 | Ga0207702_10013254 | |||
| 1808 | Ga0207702_10013968 | |||
| 1809 | Ga0207702_10037249 | |||
| 1810 | Ga0207702_10083608 | |||
| 1811 | Ga0207641_10015985 | |||
| 1812 | Ga0207641_10035578 | |||
| 1813 | Ga0207641_10057206 | |||
| 1814 | Ga0207641_10147204 | |||
| 1815 | Ga0207648_10035235 | |||
| 1816 | Ga0207648_10139731 | |||
| 1817 | Ga0207676_10031909 | |||
| 1818 | Ga0207674_10000226 | |||
| 1819 | Ga0207674_10003517 | |||
| 1820 | Ga0207674_10011343 | |||
| 1821 | Ga0207674_10019482 | |||
| 1822 | Ga0207674_10021905 | |||
| 1823 | Ga0207674_10077428 | |||
| 1824 | Ga0207675_100171622 | |||
| 1825 | Ga0207675_100198094 | |||
| 1826 | Ga0207683_10030140 | |||
| 1827 | Ga0207683_10181461 | |||
| 1828 | Ga0207698_10002393 | |||
| 1829 | Ga0207698_10039764 | |||
| 1830 | Ga0209371_1000004 | |||
| 1831 | Ga0209371_1000044 | |||
| 1832 | Ga0209999_1003238 | |||
| 1833 | Ga0209970_1003587 | |||
| 1834 | Ga0209983_1002823 | |||
| 1835 | Ga0209971_1004054 | |||
| 1836 | Ga0209966_1003940 | |||
| 1837 | Ga0209813_10001903 | |||
| 1838 | Ga0207428_10051338 | |||
| 1839 | Ga0268266_10000001 | |||
| 1840 | Ga0268266_10000004 | |||
| 1841 | Ga0268266_10000006 | |||
| 1842 | Ga0268266_10036448 | |||
| 1843 | Ga0268266_10096882 | |||
| 1844 | Ga0268265_10002756 | |||
| 1845 | Ga0268264_10016468 | |||
| 1846 | Ga0268264_10032018 | |||
| 1847 | Ga0268256_1000005 | |||
| 1848 | Ga0268256_1000046 | |||
| 1849 | Ga0316183_1029247 | |||
| 1850 | Ga0307513_10004159 | |||
| 1851 | Ga0307509_10000229 | |||
| 1852 | Ga0316575_10027325 | |||
| 1853 | Ga0316579_10002489 | |||
| 1854 | Ga0316579_10004798 | |||
| 1855 | Ga0316579_10012808 | |||
| 1856 | Ga0316576_10012035 | |||
| 1857 | Ga0316578_10003942 | |||
| 1858 | Ga0316578_10022778 | |||
| 1859 | Ga0307516_10016729 | |||
| 1860 | Ga0316577_10022907 | |||
| 1861 | Ga0307413_10000993 | |||
| 1862 | Ga0307413_10091134 | |||
| 1863 | Ga0307410_10027010 | |||
| 1864 | Ga0307406_10000399 | |||
| 1865 | Ga0307412_10002544 | |||
| 1866 | Ga0307412_10003373 | |||
| 1867 | Ga0307412_10080530 | |||
| 1868 | Ga0307416_100212079 | |||
| 1869 | Ga0307414_10001495 | |||
| 1870 | Ga0307414_10040419 | |||
| 1871 | Ga0307414_10044756 | |||
| 1872 | Ga0307414_10062609 | |||
| 1873 | Ga0307415_100180522 | |||
| 1874 | Ga0316585_10000379 | |||
| 1875 | Ga0316580_10000704 | |||
| 1876 | Ga0316580_10025695 | |||
| 1877 | Ga0316593_10000834 | |||
| 1878 | Ga0316593_10006078 | |||
| 1879 | Ga0316593_10013215 | |||
| 1880 | Ga0307510_10002044 | |||
| 1881 | Ga0307510_10025630 | |||
| 1882 | Ga0316596_1000778 | |||
| 1883 | Ga0373944_0003332 | |||
| 1884 | Ga0316574_0003460 | |||
| 1885 | Ga0316574_0006784 | |||
| 1886 | Ga0316574_0008025 | |||
| 1887 | Ga0373933_0064646 | |||
| 1888 | Ga0316582_0000279 | |||
| 1889 | Ga0316582_0003359 | |||
| 1890 | Ga0316584_0011104 | |||
| 1891 | Ga0316584_0014954 | |||
| 1892 | Ga0316584_0203168 | |||
| 1893 | Ga0373925_0021331 | |||
| 1894 | Ga0395899_0000108 | |||
| 1895 | Ga0395899_0020403 | |||
| 1896 | Ga0395899_0065751 | |||
| 1897 | Ga0395899_0082286 | |||
| 1898 | Ga0395899_0112338 | |||
| 1899 | Ga0395900_0000059 | |||
| 1900 | Ga0395900_0000144 | |||
| 1901 | Ga0395900_0001328 | |||
| 1902 | Ga0395900_0011739 | |||
| 1903 | Ga0395900_0047496 | |||
| 1904 | Ga0395900_0050272 | |||
| 1905 | Ga0395900_0068940 | |||
| 1906 | Ga0395900_0096985 | |||
| 1907 | Ga0395898_0000018 | |||
| 1908 | Ga0395898_0000049 | |||
| 1909 | Ga0395898_0286813 | |||
| 1910 | Ga0395905_0000855 | |||
| 1911 | Ga0395905_0044804 | |||
| 1912 | Ga0316581_0013450 | |||
| 1913 | Ga0395901_0000356 | |||
| 1914 | Ga0395901_0043265 | |||
| 1915 | Ga0395901_0146500 | |||
| 1916 | Ga0237819_00006 | |||
| 1917 | Ga0400490_03793 | |||
| 1918 | Ga0400490_30897 | |||
| 1919 | Ga0400490_38104 | |||
| 1920 | Ga0400488_33615 | |||
| 1921 | Ga0400486_17520 | |||
| 1922 | Ga0400483_133713 | |||
| 1923 | Ga0400483_226110 | |||
| 1924 | Ga0400487_61177 | |||
| 1925 | Ga0237816_00140 | |||
| 1926 | Ga0439436_0000030 | |||
| 1927 | Ga0439447_000680 | |||
| 1928 | Ga0439465_0000405 | |||
| 1929 | Ga0439465_0000621 | |||
| 1930 | Ga0439465_0013770 | |||
| 1931 | Ga0451797_1127267 | |||
| 1932 | Ga0451800_0416601 | |||
| 1933 | Ga0451806_541229 | |||
| 1934 | Ga0451804_0746312 | |||
| 1935 | Ga0451807_1917614 | |||
| 1936 | Ga0451837_0375995 | |||
| 1937 | Ga0451837_1201779 | |||
| 1938 | Ga0439445_0005445 | |||
| 1939 | Ga0439432_029987 | |||
| 1940 | Ga0439449_0000048 | |||
| 1941 | Ga0439449_0003482 | |||
| 1942 | Ga0450911_000912 | |||
| 1943 | Ga0450908_001001 | |||
| 1944 | Ga0451577_0017292 | |||
| 1945 | Ga0466969_0015288 | |||
| 1946 | Ga0466982_0000003 | |||
| 1947 | Ga0466966_0001324 | |||
| 1948 | Ga0466966_0031675 | |||
| 1949 | Ga0466961_0004875 | |||
| 1950 | Ga0466961_0005216 | |||
| 1951 | Ga0466961_0013157 | |||
| 1952 | Ga0466961_0020100 | |||
| 1953 | Ga0466963_0184095 | |||
| 1954 | Ga0453684_0000298 | |||
| 1955 | Ga0453684_0008337 | |||
| 1956 | Ga0466971_0003757 | |||
| 1957 | Ga0466971_0021286 | |||
| 1958 | Ga0466968_0024535 | |||
| 1959 | Ga0466968_0048671 | |||
| 1960 | Ga0466970_0000202 | |||
| 1961 | Ga0466970_0003852 | |||
| 1962 | Ga0466957_0002054 | |||
| 1963 | Ga0466957_0037073 | |||
| 1964 | Ga0466959_0000194 | |||
| 1965 | Ga0466959_0002267 | |||
| 1966 | Ga0466959_0015572 | |||
| 1967 | Ga0466959_0020295 | |||
| 1968 | Ga0466959_0114102 | |||
| 1969 | Ga0451576_0000033 | |||
| 1970 | Ga0466958_0044743 | |||
| 1971 | Ga0495617_000586 | |||
| 1972 | Ga0495617_000939 | |||
| 1973 | Ga0495627_005291 | |||
| 1974 | Ga0495638_0000038 | |||
| 1975 | Ga0495638_0000153 | |||
| 1976 | Ga0495638_0002596 | |||
| 1977 | Ga0495638_0003487 | |||
| 1978 | Ga0495638_0012299 | |||
| 1979 | Ga0495638_0072264 | |||
| 1980 | Ga0495653_0002459 | |||
| 1981 | Ga0495650_0000450 | |||
| 1982 | Ga0495650_0001325 | |||
| 1983 | Ga0495650_0005338 | |||
| 1984 | Ga0495650_0030228 | |||
| 1985 | Ga0495580_0134349 | |||
| 1986 | Ga0495582_0026408 | |||
| 1987 | Ga0495584_0002465 | |||
| 1988 | Ga0495585_0000104 | |||
| 1989 | Ga0495585_0008229 | |||
| 1990 | Ga0495607_0000211 | |||
| 1991 | Ga0495607_0002313 | |||
| 1992 | Ga0495607_0010293 | |||
| 1993 | Ga0495606_0000401 | |||
| 1994 | Ga0495606_0004520 | |||
| 1995 | Ga0495606_0006836 | |||
| 1996 | Ga0495606_0009207 | |||
| 1997 | Ga0495610_0000482 | |||
| 1998 | Ga0495616_0000086 | |||
| 1999 | Ga0495620_0001564 | |||
| 2000 | Ga0495620_0006441 | |||
| 2001 | Ga0495631_0001785 | |||
| 2002 | Ga0495631_0001835 | |||
| 2003 | Ga0495632_0000004 | |||
| 2004 | Ga0495632_0011223 | |||
| 2005 | Ga0495632_0022825 | |||
| 2006 | Ga0495632_0085193 | |||
| 2007 | Ga0495637_0010551 | |||
| 2008 | Ga0495643_0003848 | |||
| 2009 | Ga0495643_0007696 | |||
| 2010 | Ga0495648_0002502 | |||
| 2011 | Ga0495648_0004770 | |||
| 2012 | Ga0495648_0006343 | |||
| 2013 | Ga0495663_0000662 | |||
| 2014 | Ga0495663_0006399 | |||
| 2015 | Ga0495665_0036208 | |||
| 2016 | Ga0495621_0004807 | |||
| 2017 | Ga0495645_0080864 | |||
| 2018 | Ga0495622_0013271 | |||
| 2019 | Ga0495633_0008488 | |||
| 2020 | Ga0495633_0013496 | |||
| 2021 | Ga0495656_0005789 | |||
| 2022 | Ga0495656_0007758 | |||
| 2023 | Ga0495668_0003978 | |||
| 2024 | Ga0495611_0000001 | |||
| 2025 | Ga0495611_0000105 | |||
| 2026 | Ga0495625_0000022 | |||
| 2027 | Ga0495625_0010863 | |||
| 2028 | Ga0495625_0017336 | |||
| 2029 | Ga0495661_0000199 | |||
| 2030 | Ga0495661_0000291 | |||
| 2031 | Ga0495658_0025436 | |||
| 2032 | Ga0495613_0007234 | |||
| 2033 | Ga0495613_0057452 | |||
| 2034 | Ga0495670_0003523 | |||
| 2035 | Ga0495670_0006841 | |||
| 2036 | Ga0495670_0014938 | |||
| 2037 | Ga0495671_0000372 | |||
| 2038 | Ga0495649_0001571 | |||
| 2039 | Ga0495589_0000059 | |||
| 2040 | Ga0495589_0047146 | |||
| 2041 | Ga0495660_0000745 | |||
| 2042 | Ga0495660_0000747 | |||
| 2043 | Ga0495660_0001860 | |||
| 2044 | Ga0495636_0000912 | |||
| 2045 | Ga0495636_0012167 | |||
| 2046 | Ga0495636_0019322 | |||
| 2047 | Ga0495672_0008952 | |||
| 2048 | Ga0495683_0000001 | |||
| 2049 | Ga0495683_0007577 | |||
| 2050 | Ga0495679_000004 | |||
| 2051 | Ga0495673_0000004 | |||
| 2052 | Ga0495673_0000048 | |||
| 2053 | Ga0495673_0002942 | |||
| 2054 | Ga0495684_0070247 | |||
| 2055 | Ga0495686_0000017 | |||
| 2056 | Ga0495686_0001206 | |||
| 2057 | Ga0495686_0005468 | |||
| 2058 | Ga0495686_0006769 | |||
| 2059 | Ga0495686_0008204 | |||
| 2060 | Ga0495686_0047619 | |||
| 2061 | Ga0495593_0034417 | |||
| 2062 | Ga0496100_0006438 | |||
| 2063 | Ga0496101_0011176 | |||
| 2064 | Ga0496101_0038972 | |||
| 2065 | Ga0496102_0127663 | |||
| 2066 | Ga0496103_0030329 | |||
| 2067 | Ga0496104_0000011 | |||
| 2068 | Ga0496104_0034139 | |||
| 2069 | Ga0496104_0078965 | |||
| 2070 | Ga0496105_0000071 | |||
| 2071 | Ga0496105_0001886 | |||
| 2072 | Ga0496106_0001299 | |||
| 2073 | Ga0496106_0091174 | |||
| 2074 | Ga0496107_0153510 | |||
| 2075 | Ga0496108_0027988 | |||
| 2076 | Ga0496110_0046966 | |||
| 2077 | Ga0496111_0059706 | |||
| 2078 | Ga0496113_0002731 | |||
| 2079 | Ga0496114_0050953 | |||
| 2080 | Ga0496115_0000062 | |||
| 2081 | Ga0496115_0000182 | |||
| 2082 | Ga0496115_0000503 | |||
| 2083 | Ga0496115_0016934 | |||
| 2084 | Ga0496116_0006696 | |||
| 2085 | Ga0496116_0009340 | |||
| 2086 | Ga0496117_0001420 | |||
| 2087 | Ga0496117_0002445 | |||
| 2088 | Ga0496117_0004800 | |||
| 2089 | Ga0496117_0018341 | |||
| 2090 | Ga0496117_0019263 | |||
| 2091 | Ga0496117_0022804 | |||
| 2092 | Ga0496117_0037026 | |||
| 2093 | Ga0496118_0001724 | |||
| 2094 | Ga0496118_0002288 | |||
| 2095 | Ga0496118_0003187 | |||
| 2096 | Ga0496118_0007325 | |||
| 2097 | Ga0496118_0008410 | |||
| 2098 | Ga0496118_0008793 | |||
| 2099 | Ga0496118_0009162 | |||
| 2100 | Ga0496118_0009833 | |||
| 2101 | Ga0496118_0011915 | |||
| 2102 | Ga0496118_0018953 | |||
| 2103 | Ga0496118_0019029 | |||
| 2104 | Ga0496118_0073498 | |||
| 2105 | Ga0496119_0000430 | |||
| 2106 | Ga0496119_0001587 | |||
| 2107 | Ga0496119_0002453 | |||
| 2108 | Ga0496119_0004649 | |||
| 2109 | Ga0496119_0041560 | |||
| 2110 | Ga0496119_0078847 | |||
| 2111 | Ga0496120_0000313 | |||
| 2112 | Ga0496120_0001482 | |||
| 2113 | Ga0496120_0002147 | |||
| 2114 | Ga0496120_0007359 | |||
| 2115 | Ga0496121_0000878 | |||
| 2116 | Ga0496121_0005536 | |||
| 2117 | Ga0496121_0006097 | |||
| 2118 | Ga0496121_0007810 | |||
| 2119 | Ga0496121_0008433 | |||
| 2120 | Ga0496121_0012110 | |||
| 2121 | Ga0496121_0019136 | |||
| 2122 | Ga0496121_0022688 | |||
| 2123 | Ga0496121_0089774 | |||
| 2124 | Ga0496121_0091594 | |||
| 2125 | Ga0496121_0105816 | |||
| 2126 | Ga0496122_0001419 | |||
| 2127 | Ga0496122_0001926 | |||
| 2128 | Ga0496122_0002854 | |||
| 2129 | Ga0496122_0003345 | |||
| 2130 | Ga0496122_0006843 | |||
| 2131 | Ga0496122_0009589 | |||
| 2132 | Ga0496122_0022373 | |||
| 2133 | Ga0496122_0024178 | |||
| 2134 | Ga0496122_0026766 | |||
| 2135 | Ga0496122_0042883 | |||
| 2136 | Ga0496122_0044085 | |||
| 2137 | Ga0496123_0001882 | |||
| 2138 | Ga0496123_0002675 | |||
| 2139 | Ga0496123_0002721 | |||
| 2140 | Ga0496123_0007606 | |||
| 2141 | Ga0496123_0018133 | |||
| 2142 | Ga0496123_0027392 | |||
| 2143 | Ga0496123_0030854 | |||
| 2144 | Ga0496123_0055256 | |||
| 2145 | Ga0496124_0000032 | |||
| 2146 | Ga0496124_0003791 | |||
| 2147 | Ga0496124_0012352 | |||
| 2148 | Ga0496124_0020781 | |||
| 2149 | Ga0496124_0021085 | |||
| 2150 | Ga0496124_0021111 | |||
| 2151 | Ga0496124_0023684 | |||
| 2152 | Ga0496124_0034314 | |||
| 2153 | Ga0496124_0051630 | |||
| 2154 | Ga0496124_0064969 | |||
| 2155 | Ga0496125_0000330 | |||
| 2156 | Ga0496125_0007864 | |||
| 2157 | Ga0496125_0015861 | |||
| 2158 | Ga0496125_0018703 | |||
| 2159 | Ga0496125_0028197 | |||
| 2160 | Ga0496125_0041081 | |||
| 2161 | Ga0496125_0042192 | |||
| 2162 | Ga0496125_0103335 | |||
| 2163 | Ga0496126_0000057 | |||
| 2164 | Ga0496126_0007008 | |||
| 2165 | Ga0496126_0011781 | |||
| 2166 | Ga0496126_0011872 | |||
| 2167 | Ga0496126_0016809 | |||
| 2168 | Ga0496126_0058144 | |||
| 2169 | Ga0496126_0067712 | |||
| 2170 | Ga0496126_0109745 | |||
| 2171 | Ga0495678_000237 | |||
| 2172 | Ga0495682_0002463 | |||
| 2173 | Ga0495682_0012905 | |||
| 2174 | Ga0501031_0008301 | |||
| 2175 | Ga0501031_0028021 | |||
| 2176 | Ga0501032_0005884 | |||
| 2177 | Ga0501032_0008355 | |||
| 2178 | Ga0501032_0014147 | |||
| 2179 | Ga0501033_0000329 | |||
| 2180 | Ga0501033_0002339 | |||
| 2181 | Ga0501033_0006466 | |||
| 2182 | Ga0501033_0007203 | |||
| 2183 | Ga0501034_0000122 | |||
| 2184 | Ga0501034_0001357 | |||
| 2185 | Ga0501034_0001661 | |||
| 2186 | Ga0501034_0002041 | |||
| 2187 | Ga0501034_0003703 | |||
| 2188 | Ga0501034_0012439 | |||
| 2189 | Ga0501034_0025578 | |||
| 2190 | Ga0501034_0131845 | |||
| 2191 | Ga0501034_0137324 | |||
| 2192 | Ga0501034_0310492 | |||
| 2193 | Ga0501036_0020553 | |||
| 2194 | Ga0501036_0022920 | |||
| 2195 | Ga0501036_0031284 | |||
| 2196 | Ga0501036_0052114 | |||
| 2197 | Ga0501037_0004358 | |||
| 2198 | Ga0501037_0012058 | |||
| 2199 | Ga0501037_0015531 | |||
| 2200 | Ga0501037_0054749 | |||
| 2201 | Ga0501037_0082153 | |||
| 2202 | Ga0501037_0083968 | |||
| 2203 | Ga0501038_0001377 | |||
| 2204 | Ga0501038_0002332 | |||
| 2205 | Ga0501038_0015142 | |||
| 2206 | Ga0501038_0063967 | |||
| 2207 | Ga0501039_0026295 | |||
| 2208 | Ga0501039_0046362 | |||
| 2209 | Ga0501039_0060274 | |||
| 2210 | Ga0501039_0072915 | |||
| 2211 | Ga0501040_0001361 | |||
| 2212 | Ga0501040_0040908 | |||
| 2213 | Ga0501042_0000268 | |||
| 2214 | Ga0501043_0004587 | |||
| 2215 | Ga0501043_0008045 | |||
| 2216 | Ga0501043_0022235 | |||
| 2217 | Ga0501043_0040904 | |||
| 2218 | Ga0501043_0086831 | |||
| 2219 | Ga0501046_0002951 | |||
| 2220 | Ga0501046_0053265 | |||
| 2221 | Ga0501046_0058487 | |||
| 2222 | Ga0501046_0109773 | |||
| 2223 | Ga0501047_0000477 | |||
| 2224 | Ga0501047_0000748 | |||
| 2225 | Ga0501047_0001953 | |||
| 2226 | Ga0501047_0002209 | |||
| 2227 | Ga0501047_0007329 | |||
| 2228 | Ga0501047_0037545 | |||
| 2229 | Ga0501047_0066774 | |||
| 2230 | Ga0501047_0076713 | |||
| 2231 | Ga0501047_0111666 | |||
| 2232 | Ga0501048_0142948 | |||
| 2233 | Ga0501067_0000969 | |||
| 2234 | Ga0501068_0005485 | |||
| 2235 | Ga0501069_0000532 | |||
| 2236 | Ga0501069_0007893 | |||
| 2237 | Ga0501069_0009522 | |||
| 2238 | Ga0501069_0090389 | |||
| 2239 | Ga0501070_0000511 | |||
| 2240 | Ga0501070_0002026 | |||
| 2241 | Ga0501070_0012868 | |||
| 2242 | Ga0501070_0016349 | |||
| 2243 | Ga0501070_0021521 | |||
| 2244 | Ga0501070_0024738 | |||
| 2245 | Ga0501070_0040547 | |||
| 2246 | Ga0501070_0043234 | |||
| 2247 | Ga0501071_0073858 | |||
| 2248 | Ga0501072_0002332 | |||
| 2249 | Ga0501073_0002861 | |||
| 2250 | Ga0501073_0003322 | |||
| 2251 | Ga0501073_0023664 | |||
| 2252 | Ga0501073_0031131 | |||
| 2253 | Ga0501073_0079942 | |||
| 2254 | Ga0501073_0098852 | |||
| 2255 | Ga0501074_0001728 | |||
| 2256 | Ga0501074_0004828 | |||
| 2257 | Ga0501074_0005047 | |||
| 2258 | Ga0501074_0013979 | |||
| 2259 | Ga0501074_0027291 | |||
| 2260 | Ga0501074_0027950 | |||
| 2261 | Ga0501074_0053095 | |||
| 2262 | Ga0501079_0046112 | |||
| 2263 | Ga0501079_0060209 | |||
| 2264 | Ga0501080_0001987 | |||
| 2265 | Ga0501080_0004316 | |||
| 2266 | Ga0501080_0031269 | |||
| 2267 | Ga0501080_0035546 | |||
| 2268 | Ga0501080_0035641 | |||
| 2269 | Ga0501080_0068947 | |||
| 2270 | Ga0501080_0074831 | |||
| 2271 | Ga0501081_0058272 | |||
| 2272 | Ga0501035_0003159 | |||
| 2273 | Ga0501035_0003545 | |||
| 2274 | Ga0501035_0004047 | |||
| 2275 | Ga0501035_0007349 | |||
| 2276 | Ga0501035_0021417 | |||
| 2277 | Ga0501035_0029276 | |||
| 2278 | Ga0501035_0035399 | |||
| 2279 | Ga0501035_0100174 | |||
| 2280 | Ga0501035_0167572 | |||
| 2281 | Ga0501035_0176765 | |||
| 2282 | Ga0501044_0000987 | |||
| 2283 | Ga0501044_0004695 | |||
| 2284 | Ga0501044_0014274 | |||
| 2285 | Ga0501044_0021149 | |||
| 2286 | Ga0501044_0040777 | |||
| 2287 | Ga0501044_0056198 | |||
| 2288 | Ga0501044_0096875 | |||
| 2289 | Ga0501044_0148263 | |||
| 2290 | Ga0501044_0157883 | |||
| 2291 | Ga0501045_0007173 | |||
| 2292 | nmdc:mga03n38_275_c1 | |||
| 2293 | nmdc:mga00v17_112_c1 | |||
| 2294 | nmdc:mga00v17_1548_c1 | |||
| 2295 | nmdc:mga00v17_458_c1 | |||
| 2296 | nmdc:mga00v17_9702_c1 | |||
| 2297 | nmdc:mga0yw44_153_c1 | |||
| 2298 | nmdc:mga06z11_1243_c1 | |||
| 2299 | nmdc:mga06z11_950_c1 | |||
| 2300 | nmdc:mga04h51_1512_c1 | |||
| 2301 | nmdc:mga07m45_132_c1 | |||
| 2302 | nmdc:mga05p37_48674_c1 | |||
| 2303 | nmdc:mga05p37_58838_c1 | |||
| 2304 | nmdc:mga09592_3405_c1 | |||
| 2305 | nmdc:mga0qj67_19462_c1 | |||
| 2306 | nmdc:mga06r32_1946_c1 | |||
| 2307 | nmdc:mga08y16_43276_c1 | |||
| 2308 | nmdc:mga0n895_144402_c1 | |||
| 2309 | nmdc:mga0n895_28377_c1 | |||
| 2310 | nmdc:mga0a205_61957_c1 | |||
| 2311 | nmdc:mga0sz30_24_c2 | |||
| 2312 | Ga0500610_0002481 | |||
| 2313 | Ga0500643_000020 | |||
| 2314 | Ga0500643_007001 | |||
| 2315 | Ga0500651_0000592 | |||
| 2316 | Ga0500651_0009373 | |||
| 2317 | Ga0500566_0052977 | |||
| 2318 | Ga0500555_000336 | |||
| 2319 | Ga0500568_0000145 | |||
| 2320 | Ga0500638_050268 | |||
| 2321 | Ga0500645_008678 | |||
| 2322 | Ga0501084_0112104 | |||
| 2323 | Ga0501082_0000082 | |||
| 2324 | Ga0466962_0001777 | |||
| 2325 | Ga0466962_0014644 | |||
| 2326 | Ga0466962_0074995 | |||
| 2327 | 2525555967 | |||
| 2328 | 2538832264 | |||
| 2329 | 2547500237 | |||
| 2330 | 2572253472 | |||
| 2331 | 2578459143 | |||
| 2332 | 2595446813 | |||
| 2333 | 2595449569 | |||
| 2334 | 2630650981 | |||
| 2335 | 2643815402 | |||
| 2336 | 2643830274 | |||
| 2337 | 2643879453 | |||
| 2338 | 2643896791 | |||
| 2339 | 2643905735 | |||
| 2340 | 2643913132 | |||
| 2341 | 2643940078 | |||
| 2342 | 2643974355 | |||
| 2343 | 2644077134 | |||
| 2344 | 2644478996 | |||
| 2345 | 2644528817 | |||
| 2346 | 2644662936 | |||
| 2347 | 2644695448 | |||
| 2348 | 2644698110 | |||
| 2349 | 2687583778 | |||
| 2350 | 2721026520 | |||
| 2351 | 2735833485 | |||
| 2352 | 2739229486 | |||
| 2353 | 2739730249 | |||
| 2354 | 2747949905 | |||
| 2355 | 2748017182 | |||
| 2356 | 2765578198 | |||
| 2357 | 2816516242 | |||
| 2358 | 2819563963 | |||
| 2359 | 2819660321 | |||
| 2360 | 2842393573 | |||
| 2361 | 2842759398 | |||
| 2362 | 2842783526 | |||
| 2363 | 2842918497 | |||
| 2364 | 2842919881 | |||
| 2365 | 2848700147 | |||
| 2366 | 2852651500 | |||
| 2367 | 2852689143 | |||
| 2368 | 2855736366 | |||
| 2369 | 2855773303 | |||
| 2370 | 2857443025 | |||
| 2371 | 2874220834 | |||
| 2372 | 2884341479 | |||
| 2373 | 2884412156 | |||
| 2374 | 2887380371 | |||
| 2375 | 2888375110 | |||
| 2376 | 2894414674 | |||
| 2377 | 2895397661 | |||
| 2378 | 2895499169 | |||
| 2379 | 2895512191 | |||
| 2380 | 2895522202 | |||
| 2381 | 2895527355 | |||
| 2382 | 2904464599 | |||
| 2383 | 2919088319 | |||
| 2384 | 2919092651 | |||
| 2385 | 2919130407 | |||
| 2386 | 2919136950 | |||
| 2387 | 2919406098 | |||
| 2388 | 2919516508 | |||
| 2389 | 2919678608 | |||
| 2390 | 2923517833 | |||
| 2391 | 2928496848 | |||
| 2392 | 2928967685 | |||
| 2393 | 2929198585 | |||
| 2394 | 2931381542 | |||
| 2395 | 2937611665 | |||
| 2396 | 2939592243 | |||
| 2397 | 2939612524 | |||
| 2398 | 2939626400 | |||
| 2399 | 2939627599 | |||
| 2400 | 2941472929 | |||
| 2401 | 2941476932 | |||
| 2402 | 2941489558 | |||
| 2403 | 2953995180 | |||
| 2404 | 2961047599 | |||
| 2405 | 2961068430 | |||
| 2406 | 2974309578 | |||
| 2407 | 2977250316 | |||
| 2408 | 2984515209 | |||
| 2409 | 2987608349 | |||
| 2410 | 2995950906 | |||
| 2411 | 8002393463 | |||
| 2412 | 8002871702 | |||
| 2413 | 8003014691 | |||
| 2414 | 8021624868 | |||
| 2415 | 8021627849 | |||
| 2416 | 8021651918 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h45-assembly1.cif.gz_B | crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms | 0.945 | 295 | 461 |
| 5h45-assembly1.cif.gz_B | crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms | 0.9102 | 295 | 461 |
| 8dvh-assembly1.cif.gz_B | crystal structure of atp-dependent lon protease from bacillus subtillis (bslonba) | 0.8873 | 295 | 457 |
| 5lkq-assembly1.cif.gz_B | protease domain of rada | 0.8855 | 285 | 457 |
| 5lkq-assembly1.cif.gz_B | protease domain of rada | 0.8613 | 285 | 457 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P24554_314_459_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9892 | 316 | 457 | 3.30.230.10 |
| af_P24554_64_278_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9815 | 65 | 279 | 3.40.50.300 |
| af_F4K8X8_240_443_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9773 | 85 | 281 | 3.40.50.300 |
| af_P24554_64_278_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.977 | 65 | 279 | 3.40.50.300 |
| af_P9WHJ9_288_461_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9698 | 295 | 457 | 3.30.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A482F3K9-F1-model_v4 | DNA repair protein RadA | 1.003 | 315 | 461 |
GO:0000725
GO:0005829 |
| AF-T1A795-F1-model_v4 | DNA repair protein RadA | 0.9967 | 311 | 402 |
GO:0000725
GO:0005829 |
| AF-W1XIA3-F1-model_v4 | DNA repair protein RadA | 0.9966 | 301 | 409 |
GO:0000725
GO:0005829 |
| AF-G5N717-F1-model_v4 | DNA repair protein RadA | 0.9899 | 302 | 460 |
GO:0000725
GO:0005829 |
| AF-A0A2H9RGE8-F1-model_v4 | DNA repair protein RadA | 0.9861 | 83 | 457 |
GO:0000725
GO:0003684 GO:0005524 GO:0005829 GO:0016887 GO:0046872 GO:0140664 |