F491815

General Info

Members Datasets Scaffolds Average Seq Length
1217 495 2434 412

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_95527_c1|nmdc:mga0rr50_95527_c1_893_2299
Length 468
Sequence LTAEGIVTCSEWRLTRMSRRRSHRFPTDMLQRKTEPECYAAPSRGSSGTEALRMADGREQNPERVDRVEVLIAGAGFAGLALAXXXRQALGHAFAVAVVDPVLGRPVADARASAIAAAARRMFEALGVWDAVAPRAEPILDMVITDSKLGDAVRPAFLTFAGEVEEGEPFAHMVENGDVLAALSAAAQREGVALIADAVTDFSADSRKVTARLKSGAAIEAKLLVAADGARSAIRERAGIATVGWPYGQSAIVTTVAHERPHHGRAEEHFLPAGPFAILPLPENRSSIVWTESAAEAERIMALPDADFHAELEQRFGLHLGEIAVAGPRRAFSLGFAVARSFVAERLALVGDAAHAIHPIAGQGLNMGLRDVAALAEAIVDAARLGLDPGGATVLNRYQRWRRFDTMAMGLATDGLNRLFSNRSDVLRLARDLGLGLVERMPGLKRLFIREAAGLTGEVPKLLRGEAL

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
136 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
157 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
158 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
237 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
238 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
239 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
240 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
241 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
242 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
243 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
244 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
245 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
246 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
247 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
248 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
251 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
256 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
257 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
258 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
259 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
260 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
261 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
262 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
263 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
264 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
265 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
266 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
267 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
269 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
271 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
272 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
273 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
274 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
275 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
276 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
277 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
278 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
279 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
280 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
281 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
282 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
283 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
284 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
285 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
286 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
287 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
288 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
289 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
292 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
293 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
294 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
295 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
296 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
297 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
298 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
299 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
300 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
301 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
302 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
303 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
304 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
305 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
306 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
307 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
308 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
311 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
312 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
313 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
318 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
319 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
320 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
321 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
322 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
323 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
324 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
325 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
326 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
327 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
328 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
329 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
330 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
331 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
332 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
333 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
334 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
335 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
336 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
337 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
338 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
339 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
340 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
341 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
342 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
343 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
346 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
347 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
348 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
349 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
350 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
351 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
352 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
353 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
354 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
355 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
356 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
357 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
358 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
359 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
360 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
361 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
362 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
363 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
364 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
365 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
366 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
367 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
368 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
369 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
370 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
376 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
381 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
382 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
383 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
384 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
385 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
386 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
387 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
388 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
389 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
390 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
391 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
392 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
393 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
394 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
398 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
401 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
402 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
403 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
419 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
420 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
421 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
422 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
423 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
424 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
425 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
426 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
427 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
428 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
429 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
430 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
431 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
432 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
433 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
434 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
437 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
438 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
439 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
440 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
441 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
442 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
443 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
444 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
445 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
446 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
447 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
448 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
449 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
450 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
451 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
452 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
453 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
454 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
455 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
456 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
457 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
458 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
459 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
460 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
461 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
462 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
463 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
464 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
465 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
466 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
467 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
468 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
469 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
470 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
471 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
472 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
473 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
474 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
475 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
476 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
477 2643221651 Afipia sp. Root123D2 Isolate Unclassified
478 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
479 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
480 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
481 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
482 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
483 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
484 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
485 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
486 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
487 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
488 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
489 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
490 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
491 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
492 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
493 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
494 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
495 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0.16
Isolates 2.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.78
Nodule 0.08
Rhizoplane 8.63
Rhizosphere 83.65
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_95527_c1 3300050513 Bacteria 2323
2 2214772987 2209111006 Bacteria 12126
3 ARSoilYngRDRAFT_c00005 3300000042 Bacteria 35497
4 ARcpr5yngRDRAFT_c000005 3300000043 Bacteria 45740
5 ARCol0oldRDRAFT_c00605 3300000045 Bacteria 3172
6 ARCol0yngRDRAFT_1000007 3300000652 Bacteria 46089
7 JGI24736J21556_1001465 3300001904 Bacteria 4327
8 JGI24741J21665_1000079 3300001915 Bacteria 24144
9 JGI24746J21847_1000626 3300001977 Bacteria 5404
10 JGI24740J21852_10003959 3300001979 Bacteria 6428
11 JGI24740J21852_10007775 3300001979 Bacteria 4329
12 JGI24739J22299_10000027 3300001989 Bacteria 42306
13 JGI24739J22299_10000379 3300001989 Bacteria 15355
14 JGI24737J22298_10000240 3300001990 Bacteria 18284
15 JGI24737J22298_10001802 3300001990 Bacteria 7672
16 JGI24735J21928_10000880 3300002067 Bacteria 10738
17 JGI24735J21928_10014573 3300002067 Bacteria 2461
18 JGI24750J21931_1000045 3300002070 Bacteria 16505
19 JGI24745J21846_1000029 3300002073 Bacteria 9373
20 JGI24738J21930_10001349 3300002075 Bacteria 6810
21 JGI24738J21930_10003527 3300002075 Bacteria 3937
22 JGI24749J21850_1000664 3300002076 Bacteria 4992
23 JGI24035J26624_1000187 3300002126 Bacteria 5724
24 JGI24034J26672_10000122 3300002239 Bacteria 11943
25 JGI24742J22300_10001443 3300002244 Bacteria 3743
26 JGI24751J29686_10005219 3300002459 Bacteria 2643
27 Ga0006562J51391_1067863 3300003578 Bacteria 10050
28 Ga0055536_1002707 3300003781 Bacteria 9833
29 Ga0065716_1000007 3300005277 Bacteria 8171
30 Ga0065704_10134305 3300005289 Bacteria 1583
31 Ga0065712_10001604 3300005290 Bacteria 8865
32 Ga0065712_10003002 3300005290 Bacteria 9868
33 Ga0065712_10078142 3300005290 Bacteria 3388
34 Ga0065715_10000898 3300005293 Bacteria 17267
35 Ga0065715_10088997 3300005293 Bacteria 17726
36 Ga0070658_10019947 3300005327 Bacteria 5370
37 Ga0070658_10045121 3300005327 Bacteria 3563
38 Ga0070676_10000146 3300005328 Bacteria 27770
39 Ga0070683_100000116 3300005329 Bacteria 51956
40 Ga0070683_100040594 3300005329 Bacteria 4280
41 Ga0070690_100015659 3300005330 Bacteria 4529
42 Ga0070690_100015826 3300005330 Bacteria 4506
43 Ga0070690_100017738 3300005330 Bacteria 4288
44 Ga0070690_100023017 3300005330 Bacteria 3816
45 Ga0070690_100146333 3300005330 Bacteria 1608
46 Ga0070670_100013395 3300005331 Bacteria 7024
47 Ga0070677_10000151 3300005333 Bacteria 23336
48 Ga0068869_100000013 3300005334 Bacteria 73970
49 Ga0070666_10023846 3300005335 Bacteria 3983
50 Ga0070666_10041339 3300005335 Bacteria 3080
51 Ga0070680_100005855 3300005336 Bacteria 9327
52 Ga0070680_100018386 3300005336 Bacteria 5521
53 Ga0070680_100021486 3300005336 Bacteria 5130
54 Ga0070680_100023840 3300005336 Bacteria 4884
55 Ga0070680_100084167 3300005336 Bacteria 2627
56 Ga0070682_100002742 3300005337 Bacteria 9757
57 Ga0070682_100022863 3300005337 Bacteria 3708
58 Ga0070682_100038543 3300005337 Bacteria 2931
59 Ga0068868_100002546 3300005338 Bacteria 12666
60 Ga0068868_100125794 3300005338 Bacteria 2094
61 Ga0070660_100005178 3300005339 Bacteria 9017
62 Ga0070660_100009730 3300005339 Bacteria 6776
63 Ga0070689_100001113 3300005340 Bacteria 16894
64 Ga0070689_100145685 3300005340 Bacteria 1907
65 Ga0070691_10059130 3300005341 Bacteria 1841
66 Ga0070687_100003954 3300005343 Bacteria 5839
67 Ga0070687_100004416 3300005343 Bacteria 5605
68 Ga0070687_100007702 3300005343 Bacteria 4511
69 Ga0070661_100000228 3300005344 Bacteria 46622
70 Ga0070661_100065128 3300005344 Bacteria 2678
71 Ga0070692_10001025 3300005345 Bacteria 9626
72 Ga0070692_10022160 3300005345 Bacteria 3101
73 Ga0070668_100077535 3300005347 Bacteria 2598
74 Ga0070668_100161410 3300005347 Bacteria 1819
75 Ga0070668_100218410 3300005347 Bacteria 1571
76 Ga0070669_100000368 3300005353 Bacteria 34899
77 Ga0070669_100059546 3300005353 Bacteria 2804
78 Ga0070669_100165881 3300005353 Bacteria 1719
79 Ga0070669_100190929 3300005353 Bacteria 1607
80 Ga0070675_100000752 3300005354 Bacteria 22581
81 Ga0070675_100018009 3300005354 Bacteria 5622
82 Ga0070675_100083141 3300005354 Bacteria 2672
83 Ga0070671_100000142 3300005355 Bacteria 46386
84 Ga0070671_100001856 3300005355 Bacteria 16117
85 Ga0070671_100007494 3300005355 Bacteria 8722
86 Ga0070671_100010831 3300005355 Bacteria 7316
87 Ga0070671_100050533 3300005355 Bacteria 3458
88 Ga0070674_100001056 3300005356 Bacteria 14403
89 Ga0070674_100026532 3300005356 Bacteria 3786
90 Ga0070673_100000045 3300005364 Bacteria 50756
91 Ga0070673_100038893 3300005364 Bacteria 3637
92 Ga0070673_100071329 3300005364 Bacteria 2791
93 Ga0070688_100005939 3300005365 Bacteria 6468
94 Ga0070688_100028550 3300005365 Bacteria 3332
95 Ga0070659_100000183 3300005366 Bacteria 47789
96 Ga0070667_100013162 3300005367 Bacteria 6838
97 Ga0070667_100029214 3300005367 Bacteria 4593
98 Ga0070667_100205749 3300005367 Bacteria 1748
99 Ga0070667_100309758 3300005367 Bacteria 1423
100 Ga0070703_10001614 3300005406 Bacteria 6702
101 Ga0070714_100003288 3300005435 Bacteria 12043
102 Ga0070714_100078156 3300005435 Bacteria 2875
103 Ga0070714_100092438 3300005435 Bacteria 2652
104 Ga0070713_100030794 3300005436 Bacteria 4266
105 Ga0070713_100105678 3300005436 Bacteria 2446
106 Ga0070713_100117010 3300005436 Bacteria 2332
107 Ga0070710_10009606 3300005437 Bacteria 4737
108 Ga0070710_10031023 3300005437 Bacteria 2880
109 Ga0070701_10009585 3300005438 Bacteria 4247
110 Ga0070711_100028231 3300005439 Bacteria 3691
111 Ga0070711_100166329 3300005439 Bacteria 1677
112 Ga0070705_100060076 3300005440 Bacteria 2253
113 Ga0070700_100041846 3300005441 Bacteria 2810
114 Ga0070694_100026598 3300005444 Bacteria 3751
115 Ga0070694_100114519 3300005444 Bacteria 1926
116 Ga0070708_100131067 3300005445 Bacteria 2320
117 Ga0070663_100001069 3300005455 Bacteria 14988
118 Ga0070663_100037221 3300005455 Bacteria 3386
119 Ga0070663_100086303 3300005455 Bacteria 2317
120 Ga0070678_100001753 3300005456 Bacteria 11676
121 Ga0070678_100031601 3300005456 Bacteria 3655
122 Ga0070662_100042252 3300005457 Bacteria 3256
123 Ga0070662_100063974 3300005457 Bacteria 2692
124 Ga0070681_10009946 3300005458 Bacteria 9373
125 Ga0070681_10014427 3300005458 Bacteria 7864
126 Ga0070681_10041751 3300005458 Bacteria 4598
127 Ga0070681_10043818 3300005458 Bacteria 4479
128 Ga0068867_100000160 3300005459 Bacteria 43656
129 Ga0068867_100019113 3300005459 Bacteria 4879
130 Ga0070685_10008870 3300005466 Bacteria 5185
131 Ga0070685_10114232 3300005466 Bacteria 1668
132 Ga0070706_100221789 3300005467 Bacteria 1765
133 Ga0070699_100123881 3300005518 Bacteria 2274
134 Ga0070679_100006152 3300005530 Bacteria 11169
135 Ga0070679_100020075 3300005530 Bacteria 6512
136 Ga0070679_100040234 3300005530 Bacteria 4650
137 Ga0070679_100045419 3300005530 Bacteria 4377
138 Ga0070679_100062201 3300005530 Bacteria 3721
139 Ga0070679_100076376 3300005530 Bacteria 3340
140 Ga0070679_100128935 3300005530 Bacteria 2511
141 Ga0070684_100000352 3300005535 Bacteria 31642
142 Ga0070684_100070008 3300005535 Bacteria 3086
143 Ga0070684_100079467 3300005535 Bacteria 2899
144 Ga0070697_100036459 3300005536 Bacteria 3973
145 Ga0068853_100003900 3300005539 Bacteria 11434
146 Ga0068853_100006249 3300005539 Bacteria 9441
147 Ga0068853_100044038 3300005539 Bacteria 3820
148 Ga0068853_100178455 3300005539 Bacteria 1925
149 Ga0070672_100000016 3300005543 Bacteria 71848
150 Ga0070672_100014289 3300005543 Bacteria 5624
151 Ga0070672_100078359 3300005543 Bacteria 2644
152 Ga0070672_100085665 3300005543 Bacteria 2533
153 Ga0070686_100001103 3300005544 Bacteria 15541
154 Ga0070695_100002919 3300005545 Bacteria 9946
155 Ga0070695_100003518 3300005545 Bacteria 9150
156 Ga0070695_100012328 3300005545 Bacteria 5125
157 Ga0070695_100068989 3300005545 Bacteria 2310
158 Ga0070696_100030786 3300005546 Bacteria 3675
159 Ga0070665_100077477 3300005548 Bacteria 3331
160 Ga0070665_100090650 3300005548 Bacteria 3063
161 Ga0070704_100001007 3300005549 Bacteria 14414
162 Ga0070704_100036603 3300005549 Bacteria 3346
163 Ga0068855_100010817 3300005563 Bacteria 11018
164 Ga0068855_100042726 3300005563 Bacteria 5371
165 Ga0068855_100055219 3300005563 Bacteria 4666
166 Ga0068855_100055244 3300005563 Bacteria 4665
167 Ga0068855_100384727 3300005563 Bacteria 1540
168 Ga0070664_100000067 3300005564 Bacteria 65201
169 Ga0068857_100003846 3300005577 Bacteria 12629
170 Ga0068857_100017914 3300005577 Bacteria 6211
171 Ga0068857_100037829 3300005577 Bacteria 4275
172 Ga0068854_100000131 3300005578 Bacteria 51521
173 Ga0068854_100016650 3300005578 Bacteria 4905
174 Ga0068854_100018065 3300005578 Bacteria 4728
175 Ga0068854_100022998 3300005578 Bacteria 4253
176 Ga0068854_100114930 3300005578 Bacteria 2035
177 Ga0068856_100015929 3300005614 Bacteria 7268
178 Ga0068856_100020679 3300005614 Bacteria 6394
179 Ga0068856_100024647 3300005614 Bacteria 5857
180 Ga0068856_100057977 3300005614 Bacteria 3824
181 Ga0070702_100000810 3300005615 Bacteria 11975
182 Ga0070702_100008194 3300005615 Bacteria 5047
183 Ga0068852_100082220 3300005616 Bacteria 2861
184 Ga0068852_100282240 3300005616 Bacteria 1601
185 Ga0068859_100015494 3300005617 Bacteria 7660
186 Ga0068859_100025009 3300005617 Bacteria 5993
187 Ga0068859_100327190 3300005617 Bacteria 1627
188 Ga0068864_100001095 3300005618 Bacteria 22704
189 Ga0068864_100047681 3300005618 Bacteria 3681
190 Ga0068864_100115096 3300005618 Bacteria 2398
191 Ga0068866_10002457 3300005718 Bacteria 7644
192 Ga0068861_100000241 3300005719 Bacteria 30096
193 Ga0068861_100024500 3300005719 Bacteria 4365
194 Ga0068861_100084806 3300005719 Bacteria 2487
195 Ga0068861_100204099 3300005719 Bacteria 1661
196 Ga0068851_10002682 3300005834 Bacteria 7840
197 Ga0068870_10000110 3300005840 Bacteria 27850
198 Ga0068870_10131406 3300005840 Bacteria 1455
199 Ga0068863_100004900 3300005841 Bacteria 13190
200 Ga0068863_100019233 3300005841 Bacteria 6535
201 Ga0068858_100022418 3300005842 Bacteria 5894
202 Ga0068858_100039621 3300005842 Bacteria 4369
203 Ga0068858_100042243 3300005842 Bacteria 4227
204 Ga0068858_100042547 3300005842 Bacteria 4212
205 Ga0068858_100079228 3300005842 Bacteria 3053
206 Ga0068858_100121676 3300005842 Bacteria 2441
207 Ga0068860_100001050 3300005843 Bacteria 30441
208 Ga0068860_100373840 3300005843 Bacteria 1406
209 Ga0068862_100023587 3300005844 Bacteria 5156
210 Ga0068862_100024602 3300005844 Bacteria 5054
211 Ga0068862_100037899 3300005844 Bacteria 4087
212 Ga0068862_100191564 3300005844 Bacteria 1840
213 Ga0081455_10000002 3300005937 Bacteria 460472
214 Ga0081540_1001046 3300005983 Bacteria 24692
215 Ga0081540_1014999 3300005983 Bacteria 4924
216 Ga0081540_1020079 3300005983 Bacteria 4032
217 Ga0081539_10012546 3300005985 Bacteria 6513
218 Ga0070717_10044309 3300006028 Bacteria 3632
219 Ga0070717_10145022 3300006028 Bacteria 2050
220 Ga0075365_10021515 3300006038 Bacteria 4025
221 Ga0075365_10100994 3300006038 Bacteria 1975
222 Ga0075365_10130557 3300006038 Bacteria 1738
223 Ga0075368_10000081 3300006042 Bacteria 23248
224 Ga0075368_10021543 3300006042 Bacteria 2449
225 Ga0075368_10041013 3300006042 Bacteria 1818
226 Ga0075363_100072497 3300006048 Bacteria 1873
227 Ga0075363_100108057 3300006048 Bacteria 1544
228 Ga0075364_10052321 3300006051 Bacteria 2668
229 Ga0070712_100004886 3300006175 Bacteria 8290
230 Ga0070712_100079757 3300006175 Bacteria 2367
231 Ga0075367_10001178 3300006178 Bacteria 10965
232 Ga0075367_10010807 3300006178 Bacteria 4809
233 Ga0075367_10018295 3300006178 Bacteria 3864
234 Ga0075369_10028880 3300006186 Bacteria 2327
235 Ga0097621_100012044 3300006237 Bacteria 6400
236 Ga0097621_100020748 3300006237 Bacteria 5068
237 Ga0097621_100022669 3300006237 Bacteria 4877
238 Ga0097621_100030501 3300006237 Bacteria 4269
239 Ga0075370_10038028 3300006353 Bacteria 2708
240 Ga0075370_10089375 3300006353 Bacteria 1776
241 Ga0068871_100016774 3300006358 Bacteria 5527
242 Ga0068871_100028631 3300006358 Bacteria 4369
243 Ga0068871_100039933 3300006358 Bacteria 3757
244 Ga0075430_100006643 3300006846 Bacteria 9750
245 Ga0075431_100125075 3300006847 Bacteria 2653
246 Ga0075433_10001079 3300006852 Bacteria 19637
247 Ga0075433_10351223 3300006852 Bacteria 1303
248 Ga0075434_100013980 3300006871 Bacteria 7660
249 Ga0075434_100019228 3300006871 Bacteria 6608
250 Ga0075434_100038177 3300006871 Bacteria 4757
251 Ga0075434_100073207 3300006871 Bacteria 3419
252 Ga0075434_100167178 3300006871 Bacteria 2219
253 Ga0075434_100451529 3300006871 Bacteria 1307
254 Ga0075429_100121304 3300006880 Bacteria 2285
255 Ga0068865_100000209 3300006881 Bacteria 32559
256 Ga0068865_100025070 3300006881 Bacteria 3919
257 Ga0068865_100079228 3300006881 Bacteria 2352
258 Ga0075436_100004004 3300006914 Bacteria 10108
259 Ga0075436_100185210 3300006914 Bacteria 1472
260 Ga0097620_100015494 3300006931 Bacteria 7660
261 Ga0097620_100025009 3300006931 Bacteria 5993
262 Ga0097620_100327185 3300006931 Bacteria 1627
263 Ga0075435_100056907 3300007076 Bacteria 3162
264 Ga0105251_10025625 3300009011 Bacteria 3013
265 Ga0105240_10013995 3300009093 Bacteria 10978
266 Ga0105240_10036311 3300009093 Bacteria 6342
267 Ga0105240_10181196 3300009093 Bacteria 2486
268 Ga0105240_10430801 3300009093 Bacteria 1480
269 Ga0111539_10000941 3300009094 Bacteria 38137
270 Ga0111539_10001081 3300009094 Bacteria 36017
271 Ga0111539_10084487 3300009094 Bacteria 3732
272 Ga0111539_10089724 3300009094 Bacteria 3612
273 Ga0111539_10119085 3300009094 Bacteria 3094
274 Ga0105245_10000090 3300009098 Bacteria 90378
275 Ga0105245_10054168 3300009098 Bacteria 3602
276 Ga0105245_10240932 3300009098 Bacteria 1753
277 Ga0105247_10002972 3300009101 Bacteria 11243
278 Ga0105247_10008124 3300009101 Bacteria 6409
279 Ga0114129_10011617 3300009147 Bacteria 12537
280 Ga0114129_10075511 3300009147 Bacteria 4692
281 Ga0114129_10165358 3300009147 Bacteria 3020
282 Ga0105243_10017356 3300009148 Bacteria 5440
283 Ga0105243_10044255 3300009148 Bacteria 3492
284 Ga0105243_10140875 3300009148 Bacteria 2057
285 Ga0105241_10000053 3300009174 Bacteria 94578
286 Ga0105241_10009743 3300009174 Bacteria 7061
287 Ga0105242_10011145 3300009176 Bacteria 6909
288 Ga0105242_10028336 3300009176 Bacteria 4458
289 Ga0105242_10055680 3300009176 Bacteria 3235
290 Ga0105248_10000934 3300009177 Bacteria 32542
291 Ga0105248_10010774 3300009177 Bacteria 10093
292 Ga0105248_10037593 3300009177 Bacteria 5416
293 Ga0105248_10040996 3300009177 Bacteria 5191
294 Ga0105248_10179957 3300009177 Bacteria 2382
295 Ga0105248_10225181 3300009177 Bacteria 2111
296 Ga0105237_10028064 3300009545 Bacteria 5734
297 Ga0105237_10034377 3300009545 Bacteria 5133
298 Ga0105237_10184163 3300009545 Bacteria 2088
299 Ga0105237_10316943 3300009545 Bacteria 1563
300 Ga0105237_10341401 3300009545 Bacteria 1502
301 Ga0105238_10000905 3300009551 Bacteria 30512
302 Ga0105238_10011422 3300009551 Bacteria 8944
303 Ga0105238_10030815 3300009551 Bacteria 5458
304 Ga0105238_10037417 3300009551 Bacteria 4933
305 Ga0105238_10085309 3300009551 Bacteria 3146
306 Ga0105238_10099990 3300009551 Bacteria 2883
307 Ga0105249_10002035 3300009553 Bacteria 17539
308 Ga0105249_10002347 3300009553 Bacteria 16449
309 Ga0105249_10015086 3300009553 Bacteria 6835
310 Ga0105249_10093303 3300009553 Bacteria 2819
311 Ga0105249_10317834 3300009553 Bacteria 1567
312 Ga0105148_100011 3300009978 Bacteria 30290
313 Ga0099796_10010230 3300010159 Bacteria 2572
314 Ga0105239_10002502 3300010375 Bacteria 23393
315 Ga0105239_10025540 3300010375 Bacteria 6502
316 Ga0105239_10048612 3300010375 Bacteria 4651
317 Ga0105239_10179237 3300010375 Bacteria 2370
318 Ga0105239_10396815 3300010375 Bacteria 1561
319 Ga0105246_10000055 3300011119 Bacteria 45431
320 Ga0157373_10051024 3300013100 Bacteria 2946
321 Ga0157371_10001665 3300013102 Bacteria 22686
322 Ga0157371_10022274 3300013102 Bacteria 4646
323 Ga0157370_10038949 3300013104 Bacteria 4597
324 Ga0157370_10044244 3300013104 Bacteria 4281
325 Ga0157369_10044416 3300013105 Bacteria 4837
326 Ga0157369_10070663 3300013105 Bacteria 3750
327 Ga0157374_10000476 3300013296 Bacteria 36354
328 Ga0157378_10002229 3300013297 Bacteria 17200
329 Ga0157378_10120957 3300013297 Bacteria 2413
330 Ga0157378_10126805 3300013297 Bacteria 2358
331 Ga0163162_10004481 3300013306 Bacteria 13458
332 Ga0163162_10052202 3300013306 Bacteria 4105
333 Ga0157372_10004356 3300013307 Bacteria 15118
334 Ga0157372_10181124 3300013307 Bacteria 2439
335 Ga0157375_10004478 3300013308 Bacteria 12137
336 Ga0157375_10008267 3300013308 Bacteria 9111
337 Ga0157375_10035061 3300013308 Bacteria 4786
338 Ga0163163_10004723 3300014325 Bacteria 11673
339 Ga0163163_10007190 3300014325 Bacteria 9802
340 Ga0163163_10028878 3300014325 Bacteria 5331
341 Ga0163163_10054862 3300014325 Bacteria 3938
342 Ga0157380_10006672 3300014326 Bacteria 8147
343 Ga0157380_10278078 3300014326 Bacteria 1530
344 Ga0157377_10000987 3300014745 Bacteria 12004
345 Ga0157377_10004874 3300014745 Bacteria 6241
346 Ga0157379_10000805 3300014968 Bacteria 25414
347 Ga0157379_10027886 3300014968 Bacteria 5026
348 Ga0157379_10050365 3300014968 Bacteria 3718
349 Ga0157379_10086903 3300014968 Bacteria 2804
350 Ga0157376_10000283 3300014969 Bacteria 34227
351 Ga0157376_10295269 3300014969 Bacteria 1532
352 Ga0157376_10304377 3300014969 Bacteria 1510
353 Ga0163161_10000199 3300017792 Bacteria 55004
354 Ga0163161_10000897 3300017792 Bacteria 23133
355 Ga0206353_10275763 3300020082 Bacteria 3326
356 Ga0213875_10000053 3300021388 Bacteria 141791
357 Ga0213875_10003884 3300021388 Bacteria 8364
358 Ga0224572_1001790 3300024225 Bacteria 3295
359 Ga0228598_1000469 3300024227 Bacteria 8230
360 Ga0207666_1000469 3300025271 Bacteria 5162
361 Ga0207666_1000945 3300025271 Bacteria 3444
362 Ga0207673_1000045 3300025290 Bacteria 9922
363 Ga0209676_1000140 3300025292 Bacteria 176735
364 Ga0209676_1001860 3300025292 Bacteria 17366
365 Ga0209257_1000292 3300025304 Bacteria 110440
366 Ga0207697_10000245 3300025315 Bacteria 29793
367 Ga0207697_10006821 3300025315 Bacteria 5133
368 Ga0207653_10000923 3300025885 Bacteria 9730
369 Ga0207682_10000029 3300025893 Bacteria 57930
370 Ga0207642_10003101 3300025899 Bacteria 5210
371 Ga0207710_10006518 3300025900 Bacteria 4976
372 Ga0207710_10081259 3300025900 Bacteria 1504
373 Ga0207688_10000084 3300025901 Bacteria 35752
374 Ga0207688_10023584 3300025901 Bacteria 3370
375 Ga0207688_10048058 3300025901 Bacteria 2384
376 Ga0207680_10008657 3300025903 Bacteria 5010
377 Ga0207680_10018398 3300025903 Bacteria 3714
378 Ga0207680_10039933 3300025903 Bacteria 2727
379 Ga0207647_10000871 3300025904 Bacteria 23364
380 Ga0207647_10005096 3300025904 Bacteria 9685
381 Ga0207647_10006412 3300025904 Bacteria 8553
382 Ga0207647_10033960 3300025904 Bacteria 3260
383 Ga0207699_10038570 3300025906 Bacteria 2739
384 Ga0207645_10000090 3300025907 Bacteria 65569
385 Ga0207645_10033477 3300025907 Bacteria 3303
386 Ga0207643_10000044 3300025908 Bacteria 82217
387 Ga0207643_10005672 3300025908 Bacteria 6678
388 Ga0207643_10081668 3300025908 Bacteria 1873
389 Ga0207705_10026788 3300025909 Bacteria 4109
390 Ga0207684_10096437 3300025910 Bacteria 2524
391 Ga0207654_10000058 3300025911 Bacteria 75628
392 Ga0207654_10004275 3300025911 Bacteria 7208
393 Ga0207707_10017706 3300025912 Bacteria 6216
394 Ga0207707_10020258 3300025912 Bacteria 5806
395 Ga0207707_10097808 3300025912 Bacteria 2565
396 Ga0207695_10000453 3300025913 Bacteria 89314
397 Ga0207695_10002758 3300025913 Bacteria 25593
398 Ga0207695_10023280 3300025913 Bacteria 7004
399 Ga0207671_10125535 3300025914 Bacteria 1965
400 Ga0207671_10225179 3300025914 Bacteria 1470
401 Ga0207693_10000434 3300025915 Bacteria 38124
402 Ga0207693_10002841 3300025915 Bacteria 15002
403 Ga0207693_10013460 3300025915 Bacteria 6596
404 Ga0207693_10017239 3300025915 Bacteria 5760
405 Ga0207693_10047329 3300025915 Bacteria 3379
406 Ga0207693_10052546 3300025915 Bacteria 3196
407 Ga0207693_10060072 3300025915 Bacteria 2978
408 Ga0207693_10093857 3300025915 Bacteria 2352
409 Ga0207693_10131435 3300025915 Bacteria 1968
410 Ga0207693_10216281 3300025915 Bacteria 1506
411 Ga0207663_10170872 3300025916 Bacteria 1544
412 Ga0207660_10005635 3300025917 Bacteria 8131
413 Ga0207660_10016403 3300025917 Bacteria 4902
414 Ga0207660_10036154 3300025917 Bacteria 3433
415 Ga0207660_10085235 3300025917 Bacteria 2330
416 Ga0207660_10126476 3300025917 Bacteria 1941
417 Ga0207662_10000544 3300025918 Bacteria 16706
418 Ga0207662_10007517 3300025918 Bacteria 5932
419 Ga0207662_10010378 3300025918 Bacteria 5142
420 Ga0207657_10002170 3300025919 Bacteria 21251
421 Ga0207657_10005961 3300025919 Bacteria 12679
422 Ga0207657_10054105 3300025919 Bacteria 3473
423 Ga0207649_10000260 3300025920 Bacteria 41709
424 Ga0207652_10008473 3300025921 Bacteria 8274
425 Ga0207652_10011429 3300025921 Bacteria 7157
426 Ga0207652_10047793 3300025921 Bacteria 3656
427 Ga0207681_10000154 3300025923 Bacteria 57555
428 Ga0207681_10029640 3300025923 Bacteria 3558
429 Ga0207681_10057776 3300025923 Bacteria 2653
430 Ga0207681_10064101 3300025923 Bacteria 2536
431 Ga0207694_10033540 3300025924 Bacteria 3933
432 Ga0207694_10076501 3300025924 Bacteria 2621
433 Ga0207694_10082128 3300025924 Bacteria 2533
434 Ga0207650_10003395 3300025925 Bacteria 10954
435 Ga0207650_10013514 3300025925 Bacteria 5656
436 Ga0207650_10031312 3300025925 Bacteria 3840
437 Ga0207659_10000258 3300025926 Bacteria 32465
438 Ga0207659_10013822 3300025926 Bacteria 5187
439 Ga0207659_10176117 3300025926 Bacteria 1691
440 Ga0207687_10005296 3300025927 Bacteria 8548
441 Ga0207664_10025593 3300025929 Bacteria 4449
442 Ga0207664_10033479 3300025929 Bacteria 3948
443 Ga0207664_10040886 3300025929 Bacteria 3609
444 Ga0207644_10010275 3300025931 Bacteria 6168
445 Ga0207644_10011534 3300025931 Bacteria 5851
446 Ga0207644_10027515 3300025931 Bacteria 3928
447 Ga0207644_10038217 3300025931 Bacteria 3380
448 Ga0207644_10040569 3300025931 Bacteria 3290
449 Ga0207690_10002042 3300025932 Bacteria 12377
450 Ga0207690_10018700 3300025932 Bacteria 4251
451 Ga0207690_10178287 3300025932 Bacteria 1598
452 Ga0207706_10003023 3300025933 Bacteria 16211
453 Ga0207706_10018867 3300025933 Bacteria 6204
454 Ga0207706_10038206 3300025933 Bacteria 4258
455 Ga0207706_10060739 3300025933 Bacteria 3329
456 Ga0207706_10065103 3300025933 Bacteria 3210
457 Ga0207706_10110759 3300025933 Bacteria 2415
458 Ga0207706_10151650 3300025933 Bacteria 2038
459 Ga0207686_10148339 3300025934 Bacteria 1630
460 Ga0207709_10000372 3300025935 Bacteria 45219
461 Ga0207670_10004247 3300025936 Bacteria 7686
462 Ga0207670_10017680 3300025936 Bacteria 4313
463 Ga0207670_10026412 3300025936 Bacteria 3658
464 Ga0207669_10000019 3300025937 Bacteria 111630
465 Ga0207704_10000759 3300025938 Bacteria 14236
466 Ga0207665_10004784 3300025939 Bacteria 9011
467 Ga0207665_10161814 3300025939 Bacteria 1611
468 Ga0207691_10000882 3300025940 Bacteria 29793
469 Ga0207691_10001627 3300025940 Bacteria 22294
470 Ga0207691_10047049 3300025940 Bacteria 3962
471 Ga0207691_10082848 3300025940 Bacteria 2880
472 Ga0207691_10305640 3300025940 Bacteria 1366
473 Ga0207711_10001673 3300025941 Bacteria 20423
474 Ga0207711_10009158 3300025941 Bacteria 8271
475 Ga0207711_10013414 3300025941 Bacteria 6808
476 Ga0207711_10021680 3300025941 Bacteria 5367
477 Ga0207711_10101018 3300025941 Bacteria 2552
478 Ga0207689_10000228 3300025942 Bacteria 50020
479 Ga0207689_10007012 3300025942 Bacteria 9907
480 Ga0207661_10000107 3300025944 Bacteria 52429
481 Ga0207661_10076806 3300025944 Bacteria 2744
482 Ga0207661_10145070 3300025944 Bacteria 2047
483 Ga0207679_10000026 3300025945 Bacteria 200073
484 Ga0207679_10015638 3300025945 Bacteria 5020
485 Ga0207667_10007974 3300025949 Bacteria 12629
486 Ga0207667_10020988 3300025949 Bacteria 7244
487 Ga0207667_10045340 3300025949 Bacteria 4657
488 Ga0207667_10071293 3300025949 Bacteria 3613
489 Ga0207667_10194573 3300025949 Bacteria 2080
490 Ga0207651_10000069 3300025960 Bacteria 46408
491 Ga0207712_10000242 3300025961 Bacteria 53794
492 Ga0207712_10018876 3300025961 Bacteria 4497
493 Ga0207712_10035724 3300025961 Bacteria 3379
494 Ga0207712_10184011 3300025961 Bacteria 1644
495 Ga0207668_10000049 3300025972 Bacteria 99391
496 Ga0207668_10007545 3300025972 Bacteria 6475
497 Ga0207668_10052263 3300025972 Bacteria 2826
498 Ga0207640_10000234 3300025981 Bacteria 38057
499 Ga0207640_10019201 3300025981 Bacteria 4034
500 Ga0207658_10000804 3300025986 Bacteria 26394
501 Ga0207658_10036433 3300025986 Bacteria 3527
502 Ga0207658_10058728 3300025986 Bacteria 2864
503 Ga0207658_10169030 3300025986 Bacteria 1799
504 Ga0207658_10269219 3300025986 Bacteria 1455
505 Ga0207677_10017935 3300026023 Bacteria 4237
506 Ga0207677_10040031 3300026023 Bacteria 3086
507 Ga0207677_10049799 3300026023 Bacteria 2829
508 Ga0207703_10034429 3300026035 Bacteria 4019
509 Ga0207703_10054666 3300026035 Bacteria 3248
510 Ga0207703_10221093 3300026035 Bacteria 1693
511 Ga0207639_10000323 3300026041 Bacteria 33257
512 Ga0207639_10000413 3300026041 Bacteria 29583
513 Ga0207639_10017058 3300026041 Bacteria 5145
514 Ga0207639_10021124 3300026041 Bacteria 4671
515 Ga0207639_10047997 3300026041 Bacteria 3229
516 Ga0207678_10000068 3300026067 Bacteria 81610
517 Ga0207678_10000920 3300026067 Bacteria 26941
518 Ga0207678_10020051 3300026067 Bacteria 5874
519 Ga0207678_10060722 3300026067 Bacteria 3251
520 Ga0207678_10081589 3300026067 Bacteria 2768
521 Ga0207708_10001502 3300026075 Bacteria 17383
522 Ga0207708_10014245 3300026075 Bacteria 5946
523 Ga0207708_10014309 3300026075 Bacteria 5934
524 Ga0207708_10074540 3300026075 Bacteria 2601
525 Ga0207708_10110697 3300026075 Bacteria 2131
526 Ga0207702_10000004 3300026078 Bacteria 422182
527 Ga0207702_10001343 3300026078 Bacteria 24595
528 Ga0207702_10081442 3300026078 Bacteria 2811
529 Ga0207641_10000669 3300026088 Bacteria 37271
530 Ga0207641_10202093 3300026088 Bacteria 1833
531 Ga0207648_10006668 3300026089 Bacteria 11454
532 Ga0207648_10009806 3300026089 Bacteria 9148
533 Ga0207648_10071352 3300026089 Bacteria 3027
534 Ga0207648_10073831 3300026089 Bacteria 2972
535 Ga0207676_10003679 3300026095 Bacteria 10839
536 Ga0207676_10018586 3300026095 Bacteria 5056
537 Ga0207676_10039043 3300026095 Bacteria 3628
538 Ga0207676_10052240 3300026095 Bacteria 3194
539 Ga0207674_10000882 3300026116 Bacteria 39274
540 Ga0207674_10013733 3300026116 Bacteria 8965
541 Ga0207674_10015731 3300026116 Bacteria 8300
542 Ga0207674_10032534 3300026116 Bacteria 5470
543 Ga0207674_10070999 3300026116 Bacteria 3500
544 Ga0207675_100014892 3300026118 Bacteria 7259
545 Ga0207675_100056431 3300026118 Bacteria 3663
546 Ga0207675_100248502 3300026118 Bacteria 1721
547 Ga0207675_100268177 3300026118 Bacteria 1656
548 Ga0207683_10000653 3300026121 Bacteria 31779
549 Ga0207683_10012333 3300026121 Bacteria 7294
550 Ga0207683_10028701 3300026121 Bacteria 4813
551 Ga0207698_10000977 3300026142 Bacteria 16625
552 Ga0207698_10057221 3300026142 Bacteria 3015
553 Ga0207698_10074967 3300026142 Bacteria 2701
554 Ga0207698_10194176 3300026142 Bacteria 1812
555 Ga0209999_1009022 3300027543 Bacteria 1803
556 Ga0210002_1001945 3300027617 Bacteria 2964
557 Ga0209983_1003607 3300027665 Bacteria 3283
558 Ga0209966_1000652 3300027695 Bacteria 7751
559 Ga0209813_10000087 3300027866 Bacteria 34252
560 Ga0207428_10000130 3300027907 Bacteria 104457
561 Ga0207428_10000286 3300027907 Bacteria 68250
562 Ga0207428_10049012 3300027907 Bacteria 3386
563 Ga0265357_1000262 3300028023 Bacteria 2700
564 Ga0268265_10002575 3300028380 Bacteria 13532
565 Ga0268265_10011597 3300028380 Bacteria 5959
566 Ga0268265_10167932 3300028380 Bacteria 1872
567 Ga0268265_10248948 3300028380 Bacteria 1573
568 Ga0268264_10046150 3300028381 Bacteria 3618
569 Ga0265337_1003660 3300028556 Bacteria 6589
570 Ga0265330_10008622 3300031235 Bacteria 4898
571 Ga0265332_10006574 3300031238 Bacteria 5271
572 Ga0265332_10074841 3300031238 Bacteria 1440
573 Ga0265325_10001319 3300031241 Bacteria 17563
574 Ga0265325_10023154 3300031241 Bacteria 3396
575 Ga0265340_10001848 3300031247 Bacteria 12085
576 Ga0265340_10015062 3300031247 Bacteria 4025
577 Ga0265340_10022161 3300031247 Bacteria 3250
578 Ga0265340_10042126 3300031247 Bacteria 2243
579 Ga0265339_10000033 3300031249 Bacteria 130595
580 Ga0265339_10009902 3300031249 Bacteria 5952
581 Ga0265339_10030179 3300031249 Bacteria 3071
582 Ga0265331_10056121 3300031250 Bacteria 1871
583 Ga0265331_10065198 3300031250 Bacteria 1713
584 Ga0307408_100130805 3300031548 Bacteria 1957
585 Ga0265313_10000049 3300031595 Bacteria 111617
586 Ga0265313_10005321 3300031595 Bacteria 9514
587 Ga0265313_10009363 3300031595 Bacteria 6366
588 Ga0265313_10023313 3300031595 Bacteria 3336
589 Ga0265313_10039878 3300031595 Bacteria 2326
590 Ga0265313_10044294 3300031595 Bacteria 2173
591 Ga0265313_10045754 3300031595 Bacteria 2129
592 Ga0265313_10072321 3300031595 Bacteria 1585
593 Ga0307508_10077726 3300031616 Bacteria 2898
594 Ga0265314_10019730 3300031711 Bacteria 5215
595 Ga0265314_10022239 3300031711 Bacteria 4859
596 Ga0265314_10031505 3300031711 Bacteria 3912
597 Ga0265342_10000149 3300031712 Bacteria 79177
598 Ga0265342_10001524 3300031712 Bacteria 21423
599 Ga0265342_10002635 3300031712 Bacteria 15340
600 Ga0265342_10038344 3300031712 Bacteria 2918
601 Ga0316576_10016776 3300031727 Bacteria 4960
602 Ga0307413_10043361 3300031824 Bacteria 2651
603 Ga0307413_10098092 3300031824 Bacteria 1928
604 Ga0307410_10030984 3300031852 Bacteria 3425
605 Ga0307410_10079395 3300031852 Bacteria 2299
606 Ga0307406_10004876 3300031901 Bacteria 7308
607 Ga0307406_10018783 3300031901 Bacteria 4046
608 Ga0307406_10024626 3300031901 Bacteria 3596
609 Ga0307412_10002217 3300031911 Bacteria 10785
610 Ga0307412_10016299 3300031911 Bacteria 4424
611 Ga0307409_100010670 3300031995 Bacteria 5732
612 Ga0307414_10000384 3300032004 Bacteria 24016
613 Ga0307414_10014276 3300032004 Bacteria 4756
614 Ga0307414_10016354 3300032004 Bacteria 4508
615 Ga0307414_10030847 3300032004 Bacteria 3507
616 Ga0307414_10053668 3300032004 Bacteria 2812
617 Ga0307411_10174874 3300032005 Bacteria 1623
618 Ga0307415_100079976 3300032126 Bacteria 2330
619 Ga0307510_10088528 3300033180 Bacteria 2955
620 Ga0373930_0000159 3300034816 Bacteria 7789
621 Ga0373950_0001078 3300034818 Bacteria 3484
622 Ga0373958_0000305 3300034819 Bacteria 5913
623 Ga0373959_0000743 3300034820 Bacteria 5561
624 Ga0373938_0000024 3300034957 Bacteria 19333
625 Ga0373938_0001010 3300034957 Bacteria 4532
626 Ga0373926_0004308 3300035083 Bacteria 4658
627 Ga0373926_0012322 3300035083 Bacteria 2889
628 Ga0373929_0000274 3300035085 Bacteria 9537
629 Ga0373929_0005708 3300035085 Bacteria 2245
630 Ga0373934_0013351 3300035086 Bacteria 3106
631 Ga0373940_0000029 3300035088 Bacteria 15347
632 Ga0373944_0011320 3300035089 Bacteria 2442
633 Ga0373951_0000391 3300035091 Bacteria 13023
634 Ga0373951_0000779 3300035091 Bacteria 8707
635 Ga0373923_0001398 3300035111 Bacteria 6876
636 Ga0373923_0034751 3300035111 Bacteria 2048
637 Ga0373932_0000515 3300035112 Bacteria 11900
638 Ga0373932_0002870 3300035112 Bacteria 4257
639 Ga0373932_0025991 3300035112 Bacteria 1590
640 Ga0373936_0003979 3300035113 Bacteria 5569
641 Ga0373936_0041141 3300035113 Bacteria 1853
642 Ga0373939_0001312 3300035114 Bacteria 6041
643 Ga0373939_0003941 3300035114 Bacteria 3491
644 Ga0373941_0001774 3300035115 Bacteria 4647
645 Ga0373941_0038096 3300035115 Bacteria 1470
646 Ga0373945_0000654 3300035116 Bacteria 10019
647 Ga0373945_0001064 3300035116 Bacteria 8252
648 Ga0373945_0003922 3300035116 Bacteria 4704
649 Ga0373953_0025607 3300035117 Bacteria 2255
650 Ga0373954_0000906 3300035118 Bacteria 11525
651 Ga0373956_0008585 3300035119 Bacteria 4139
652 Ga0373956_0015622 3300035119 Bacteria 3182
653 Ga0373956_0019147 3300035119 Bacteria 2902
654 Ga0373957_0006119 3300035120 Bacteria 3774
655 Ga0373957_0073568 3300035120 Bacteria 1340
656 Ga0373960_0000932 3300035121 Bacteria 6250
657 Ga0373960_0006664 3300035121 Bacteria 2716
658 Ga0373943_0001179 3300035170 Bacteria 11669
659 Ga0373943_0003827 3300035170 Bacteria 6840
660 Ga0373943_0061106 3300035170 Bacteria 1882
661 Ga0373946_0001814 3300035171 Bacteria 7457
662 Ga0373946_0009494 3300035171 Bacteria 3585
663 Ga0373946_0033652 3300035171 Bacteria 2064
664 Ga0373955_0000201 3300035172 Bacteria 24761
665 Ga0373942_0000286 3300035207 Bacteria 13700
666 Ga0373961_0000298 3300035241 Bacteria 22185
667 Ga0373961_0004205 3300035241 Bacteria 3494
668 Ga0373962_0000887 3300035242 Bacteria 6842
669 Ga0373962_0001502 3300035242 Bacteria 5520
670 Ga0373931_0001002 3300035691 Bacteria 11946
671 Ga0373931_0011412 3300035691 Bacteria 4293
672 Ga0373931_0027265 3300035691 Bacteria 2915
673 Ga0373931_0039871 3300035691 Bacteria 2461
674 Ga0373931_0122606 3300035691 Bacteria 1487
675 Ga0373935_0000068 3300035692 Bacteria 43997
676 Ga0373935_0023692 3300035692 Bacteria 3773
677 Ga0373935_0044129 3300035692 Bacteria 2808
678 Ga0373935_0044940 3300035692 Bacteria 2785
679 Ga0373927_0000863 3300035695 Bacteria 23082
680 Ga0373927_0005387 3300035695 Bacteria 8840
681 Ga0373927_0011948 3300035695 Bacteria 5778
682 Ga0373927_0026187 3300035695 Bacteria 3811
683 Ga0373927_0114486 3300035695 Bacteria 1758
684 Ga0373933_0037084 3300035724 Bacteria 2858
685 Ga0373933_0096591 3300035724 Bacteria 1829
686 Ga0373947_0002147 3300035725 Bacteria 11983
687 Ga0373947_0002537 3300035725 Bacteria 10978
688 Ga0373947_0006972 3300035725 Bacteria 6544
689 Ga0373947_0040717 3300035725 Bacteria 2768
690 Ga0373937_0000347 3300036401 Bacteria 43749
691 Ga0373937_0007729 3300036401 Bacteria 9319
692 Ga0373937_0048668 3300036401 Bacteria 3881
693 Ga0373925_0000081 3300037068 Bacteria 102407
694 Ga0373925_0005678 3300037068 Bacteria 9276
695 Ga0373925_0007759 3300037068 Bacteria 7811
696 Ga0373925_0008281 3300037068 Bacteria 7566
697 Ga0373925_0009149 3300037068 Bacteria 7208
698 Ga0373925_0053408 3300037068 Bacteria 3020
699 Ga0373925_0061285 3300037068 Bacteria 2826
700 Ga0373925_0068818 3300037068 Bacteria 2673
701 Ga0373925_0142309 3300037068 Bacteria 1878
702 Ga0395899_0014213 3300037312 Bacteria 6075
703 Ga0395900_0273709 3300037418 Bacteria 1682
704 Ga0395898_0001457 3300037466 Bacteria 33463
705 Ga0395898_0011440 3300037466 Bacteria 9216
706 Ga0436364_0094686 3300037853 Bacteria 72452
707 Ga0436364_0596981 3300037853 Bacteria 1423
708 Ga0436364_0951864 3300037853 Bacteria 9370
709 Ga0395901_0284451 3300038443 Bacteria 1717
710 Ga0400483_117325 3300039062 Bacteria 2450
711 Ga0436365_0160122 3300039437 Bacteria 1369
712 Ga0436365_0840419 3300039437 Bacteria 3388
713 Ga0436365_1336443 3300039437 Bacteria 3131
714 Ga0436365_1477994 3300039437 Bacteria 2193
715 Ga0436360_0873896 3300039438 Bacteria 2917
716 Ga0436361_0500089 3300039447 Bacteria 2831
717 Ga0436361_0722936 3300039447 Bacteria 24347
718 Ga0436361_0760231 3300039447 Bacteria 2204
719 Ga0436363_0138398 3300039450 Bacteria 1347
720 Ga0436363_0887763 3300039450 Bacteria 3617
721 Ga0450901_003385 3300042533 Bacteria 1668
722 Ga0453684_0043018 3300044712 Bacteria 6078
723 Ga0453684_0094777 3300044712 Bacteria 3671
724 Ga0466957_0058841 3300044842 Bacteria 2354
725 Ga0466959_0078594 3300045049 Bacteria 2379
726 Ga0451576_0013266 3300045051 Bacteria 9221
727 Ga0466958_0029784 3300045836 Bacteria 3239
728 Ga0495617_024736 3300046452 Bacteria 2026
729 Ga0495627_029130 3300046453 Bacteria 1758
730 Ga0495592_0000196 3300046454 Bacteria 51625
731 Ga0495592_0030502 3300046454 Bacteria 4078
732 Ga0495592_0044206 3300046454 Bacteria 3329
733 Ga0495603_0101032 3300046455 Bacteria 1683
734 Ga0495629_0001034 3300046459 Bacteria 22308
735 Ga0495629_0003904 3300046459 Bacteria 11215
736 Ga0495629_0010656 3300046459 Bacteria 6687
737 Ga0495629_0054088 3300046459 Bacteria 2808
738 Ga0495629_0056006 3300046459 Bacteria 2757
739 Ga0495638_0000068 3300046460 Bacteria 167596
740 Ga0495641_0066355 3300046461 Bacteria 1624
741 Ga0495651_0000977 3300046462 Bacteria 22167
742 Ga0495651_0062022 3300046462 Bacteria 2861
743 Ga0495651_0168341 3300046462 Bacteria 1563
744 Ga0495653_0000193 3300046463 Bacteria 49516
745 Ga0495653_0010589 3300046463 Bacteria 7551
746 Ga0495653_0044231 3300046463 Bacteria 3457
747 Ga0495582_0004213 3300046473 Bacteria 8090
748 Ga0495582_0005890 3300046473 Bacteria 6830
749 Ga0495582_0034182 3300046473 Bacteria 2795
750 Ga0495639_0009208 3300046475 Bacteria 4233
751 Ga0495639_0075596 3300046475 Bacteria 1562
752 Ga0495662_0001111 3300046476 Bacteria 13243
753 Ga0495662_0002749 3300046476 Bacteria 8890
754 Ga0495662_0006973 3300046476 Bacteria 5615
755 Ga0495664_0000016 3300046477 Bacteria 175933
756 Ga0495664_0000554 3300046477 Bacteria 18816
757 Ga0495664_0036496 3300046477 Bacteria 2897
758 Ga0495664_0082802 3300046477 Bacteria 1925
759 Ga0495584_0005586 3300046491 Bacteria 6648
760 Ga0495584_0006458 3300046491 Bacteria 6135
761 Ga0495584_0099823 3300046491 Bacteria 1467
762 Ga0495585_0000744 3300046492 Bacteria 28955
763 Ga0495594_0008772 3300046499 Bacteria 5213
764 Ga0495607_0027003 3300046501 Bacteria 3556
765 Ga0495583_0038328 3300046506 Bacteria 2265
766 Ga0495608_0000121 3300046511 Bacteria 56189
767 Ga0495608_0037362 3300046511 Bacteria 3266
768 Ga0495610_0000083 3300046512 Bacteria 112946
769 Ga0495610_0035906 3300046512 Bacteria 2539
770 Ga0495616_0110694 3300046513 Bacteria 1276
771 Ga0495618_0000124 3300046514 Bacteria 56215
772 Ga0495618_0003921 3300046514 Bacteria 9181
773 Ga0495618_0127837 3300046514 Bacteria 1626
774 Ga0495628_0000018 3300046516 Bacteria 169916
775 Ga0495628_0101785 3300046516 Bacteria 2216
776 Ga0495630_0002180 3300046517 Bacteria 13643
777 Ga0495630_0006717 3300046517 Bacteria 8198
778 Ga0495630_0018839 3300046517 Bacteria 5073
779 Ga0495630_0032184 3300046517 Bacteria 3906
780 Ga0495630_0100532 3300046517 Bacteria 2188
781 Ga0495632_0000023 3300046519 Bacteria 180933
782 Ga0495637_0000836 3300046520 Bacteria 20354
783 Ga0495637_0002707 3300046520 Bacteria 9657
784 Ga0495643_0000038 3300046522 Bacteria 236010
785 Ga0495644_0002708 3300046523 Bacteria 7027
786 Ga0495644_0015905 3300046523 Bacteria 2883
787 Ga0495648_0014476 3300046524 Bacteria 5773
788 Ga0495663_0000019 3300046525 Bacteria 129361
789 Ga0495663_0013219 3300046525 Bacteria 2308
790 Ga0495666_0006120 3300046526 Bacteria 6055
791 Ga0495652_0000005 3300046529 Bacteria 524368
792 Ga0495652_0019100 3300046529 Bacteria 6104
793 Ga0495652_0049806 3300046529 Bacteria 3584
794 Ga0495640_0000063 3300046533 Bacteria 60255
795 Ga0495640_0069336 3300046533 Bacteria 2371
796 Ga0495640_0143041 3300046533 Bacteria 1541
797 Ga0495640_0165006 3300046533 Unclassified 1417
798 Ga0495586_0019585 3300046535 Bacteria 3604
799 Ga0495586_0051648 3300046535 Bacteria 2225
800 Ga0495587_0000134 3300046536 Bacteria 56076
801 Ga0495587_0007597 3300046536 Bacteria 7015
802 Ga0495598_0000513 3300046537 Bacteria 7181
803 Ga0495598_0009308 3300046537 Bacteria 2319
804 Ga0495609_0043795 3300046538 Bacteria 2009
805 Ga0495645_0000070 3300046543 Bacteria 71823
806 Ga0495645_0003212 3300046543 Bacteria 11086
807 Ga0495645_0021402 3300046543 Bacteria 4674
808 Ga0495633_0000568 3300046558 Bacteria 35912
809 Ga0495633_0000772 3300046558 Bacteria 28691
810 Ga0495633_0002060 3300046558 Bacteria 14494
811 Ga0495667_0000023 3300046559 Bacteria 169343
812 Ga0495667_0005008 3300046559 Bacteria 8957
813 Ga0495634_0000241 3300046642 Bacteria 51268
814 Ga0495634_0014117 3300046642 Bacteria 5767
815 Ga0495635_0000045 3300046663 Bacteria 82266
816 Ga0495635_0035648 3300046663 Bacteria 3449
817 Ga0495659_0002311 3300046664 Bacteria 6167
818 Ga0495588_0034636 3300046674 Bacteria 2555
819 Ga0495657_0001484 3300046675 Bacteria 20216
820 Ga0495657_0007068 3300046675 Bacteria 8708
821 Ga0495657_0086915 3300046675 Bacteria 2013
822 Ga0495599_0000107 3300046678 Bacteria 56178
823 Ga0495623_0000180 3300046679 Bacteria 39869
824 Ga0495623_0002513 3300046679 Bacteria 12140
825 Ga0495623_0009474 3300046679 Bacteria 6323
826 Ga0495646_0000027 3300046680 Bacteria 97629
827 Ga0495646_0080435 3300046680 Bacteria 1900
828 Ga0495647_0004735 3300046681 Bacteria 4438
829 Ga0495658_0020639 3300046683 Bacteria 3461
830 Ga0495658_0032995 3300046683 Bacteria 2832
831 Ga0495613_0009605 3300046689 Bacteria 7187
832 Ga0495624_0015346 3300046690 Bacteria 5175
833 Ga0495624_0053973 3300046690 Bacteria 2535
834 Ga0495624_0095759 3300046690 Bacteria 1829
835 Ga0495670_0003165 3300046691 Bacteria 8106
836 Ga0495670_0004845 3300046691 Bacteria 6606
837 Ga0495671_0000027 3300046692 Bacteria 236011
838 Ga0495649_0000048 3300046694 Bacteria 118180
839 Ga0495600_0000062 3300046809 Bacteria 61420
840 Ga0495600_0006032 3300046809 Bacteria 7336
841 Ga0495600_0028982 3300046809 Bacteria 3583
842 Ga0495600_0196222 3300046809 Bacteria 1297
843 Ga0495581_0028604 3300047315 Bacteria 3231
844 Ga0495581_0034460 3300047315 Bacteria 2929
845 Ga0495581_0039498 3300047315 Bacteria 2732
846 Ga0495604_0000014 3300047317 Bacteria 205481
847 Ga0495604_0000613 3300047317 Bacteria 30609
848 Ga0495604_0017410 3300047317 Bacteria 5752
849 Ga0495674_0000014 3300047319 Bacteria 241211
850 Ga0495674_0020715 3300047319 Bacteria 6089
851 Ga0495674_0054449 3300047319 Bacteria 3513
852 Ga0495674_0108485 3300047319 Bacteria 2355
853 Ga0495674_0158694 3300047319 Bacteria 1893
854 Ga0495672_0008846 3300047320 Bacteria 7366
855 Ga0495676_0018139 3300047321 Bacteria 6208
856 Ga0495680_0000779 3300047322 Bacteria 35728
857 Ga0495680_0004120 3300047322 Bacteria 13973
858 Ga0495680_0005491 3300047322 Bacteria 11919
859 Ga0495680_0014092 3300047322 Bacteria 6946
860 Ga0495680_0106452 3300047322 Bacteria 2084
861 Ga0495680_0214928 3300047322 Bacteria 1375
862 Ga0495675_0000058 3300047444 Bacteria 77587
863 Ga0495675_0016655 3300047444 Bacteria 4646
864 Ga0495681_0000279 3300047470 Bacteria 40888
865 Ga0495681_0001314 3300047470 Bacteria 18798
866 Ga0495684_0000059 3300047471 Bacteria 77947
867 Ga0495684_0000136 3300047471 Bacteria 54014
868 Ga0495686_0043393 3300047472 Bacteria 2851
869 Ga0495686_0135686 3300047472 Bacteria 1455
870 Ga0495593_0005129 3300047673 Bacteria 7741
871 Ga0495593_0061722 3300047673 Bacteria 1960
872 Ga0495602_0000017 3300048088 Bacteria 184180
873 Ga0495614_0020420 3300048089 Bacteria 2865
874 Ga0495614_0024753 3300048089 Bacteria 2591
875 Ga0495615_0021522 3300048090 Bacteria 1456
876 Ga0496100_0000237 3300048903 Bacteria 28937
877 Ga0496100_0006029 3300048903 Bacteria 6579
878 Ga0496100_0025954 3300048903 Bacteria 3587
879 Ga0496100_0075119 3300048903 Bacteria 2266
880 Ga0496100_0114614 3300048903 Bacteria 1878
881 Ga0496100_0208748 3300048903 Bacteria 1427
882 Ga0496101_0000697 3300048904 Bacteria 20240
883 Ga0496101_0003104 3300048904 Bacteria 10272
884 Ga0496101_0011363 3300048904 Bacteria 5905
885 Ga0496101_0013493 3300048904 Bacteria 5475
886 Ga0496101_0087126 3300048904 Bacteria 2317
887 Ga0496101_0163654 3300048904 Bacteria 1707
888 Ga0496101_0175674 3300048904 Bacteria 1647
889 Ga0496102_0004386 3300048905 Bacteria 11921
890 Ga0496102_0008462 3300048905 Bacteria 8821
891 Ga0496102_0024214 3300048905 Bacteria 5396
892 Ga0496102_0064232 3300048905 Bacteria 3362
893 Ga0496102_0085685 3300048905 Bacteria 2909
894 Ga0496102_0100039 3300048905 Bacteria 2692
895 Ga0496102_0133343 3300048905 Bacteria 2326
896 Ga0496102_0133444 3300048905 Bacteria 2325
897 Ga0496102_0145942 3300048905 Bacteria 2221
898 Ga0496102_0214057 3300048905 Bacteria 1816
899 Ga0496103_0016536 3300048906 Bacteria 4402
900 Ga0496103_0080031 3300048906 Bacteria 2054
901 Ga0496104_0006107 3300048907 Bacteria 10574
902 Ga0496104_0014689 3300048907 Bacteria 7074
903 Ga0496104_0021017 3300048907 Bacteria 5989
904 Ga0496104_0031473 3300048907 Bacteria 4934
905 Ga0496104_0035169 3300048907 Bacteria 4677
906 Ga0496104_0065269 3300048907 Bacteria 3454
907 Ga0496104_0195705 3300048907 Bacteria 1934
908 Ga0496105_0001999 3300048908 Bacteria 14708
909 Ga0496105_0005181 3300048908 Bacteria 9880
910 Ga0496105_0006825 3300048908 Bacteria 8779
911 Ga0496105_0157161 3300048908 Bacteria 1867
912 Ga0496105_0185565 3300048908 Unclassified 1702
913 Ga0496106_0000236 3300048909 Bacteria 38678
914 Ga0496106_0002012 3300048909 Bacteria 15288
915 Ga0496106_0009101 3300048909 Bacteria 7338
916 Ga0496106_0011510 3300048909 Bacteria 6542
917 Ga0496106_0016650 3300048909 Bacteria 5438
918 Ga0496106_0076915 3300048909 Bacteria 2558
919 Ga0496107_0000327 3300048910 Bacteria 25714
920 Ga0496107_0014384 3300048910 Bacteria 5541
921 Ga0496107_0017289 3300048910 Bacteria 5071
922 Ga0496107_0028396 3300048910 Bacteria 3975
923 Ga0496107_0030947 3300048910 Bacteria 3816
924 Ga0496107_0053577 3300048910 Bacteria 2910
925 Ga0496107_0078701 3300048910 Bacteria 2402
926 Ga0496107_0091247 3300048910 Bacteria 2226
927 Ga0496107_0097708 3300048910 Bacteria 2150
928 Ga0496108_0000347 3300048911 Bacteria 39108
929 Ga0496108_0000902 3300048911 Bacteria 23152
930 Ga0496108_0001376 3300048911 Bacteria 19132
931 Ga0496108_0005173 3300048911 Bacteria 10547
932 Ga0496108_0013218 3300048911 Bacteria 6727
933 Ga0496108_0045907 3300048911 Bacteria 3649
934 Ga0496108_0098577 3300048911 Bacteria 2491
935 Ga0496108_0119819 3300048911 Bacteria 2256
936 Ga0496108_0161783 3300048911 Bacteria 1935
937 Ga0496109_0000224 3300048912 Bacteria 55854
938 Ga0496109_0000925 3300048912 Bacteria 24421
939 Ga0496109_0005863 3300048912 Bacteria 10300
940 Ga0496109_0008656 3300048912 Bacteria 8661
941 Ga0496109_0025751 3300048912 Bacteria 5243
942 Ga0496109_0031922 3300048912 Bacteria 4731
943 Ga0496109_0118634 3300048912 Bacteria 2463
944 Ga0496109_0346498 3300048912 Bacteria 1403
945 Ga0496110_0010097 3300048913 Bacteria 7666
946 Ga0496110_0029719 3300048913 Bacteria 4706
947 Ga0496110_0035608 3300048913 Bacteria 4319
948 Ga0496110_0055430 3300048913 Bacteria 3488
949 Ga0496110_0059966 3300048913 Bacteria 3355
950 Ga0496110_0074428 3300048913 Bacteria 3016
951 Ga0496110_0136555 3300048913 Bacteria 2216
952 Ga0496110_0250584 3300048913 Bacteria 1611
953 Ga0496111_0009006 3300048914 Bacteria 6640
954 Ga0496111_0021601 3300048914 Bacteria 4497
955 Ga0496111_0031448 3300048914 Bacteria 3781
956 Ga0496111_0069902 3300048914 Bacteria 2553
957 Ga0496111_0070351 3300048914 Bacteria 2545
958 Ga0496111_0179786 3300048914 Bacteria 1572
959 Ga0496112_0002281 3300048915 Bacteria 15339
960 Ga0496112_0002294 3300048915 Bacteria 15311
961 Ga0496112_0005249 3300048915 Bacteria 11155
962 Ga0496112_0006289 3300048915 Bacteria 10415
963 Ga0496112_0044183 3300048915 Bacteria 4365
964 Ga0496112_0133343 3300048915 Bacteria 2454
965 Ga0496112_0134740 3300048915 Bacteria 2440
966 Ga0496112_0188480 3300048915 Bacteria 2025
967 Ga0496112_0209861 3300048915 Bacteria 1905
968 Ga0496112_0266687 3300048915 Bacteria 1661
969 Ga0496113_0018979 3300048916 Bacteria 4801
970 Ga0496113_0022653 3300048916 Bacteria 4448
971 Ga0496113_0025192 3300048916 Bacteria 4237
972 Ga0496113_0038764 3300048916 Bacteria 3505
973 Ga0496113_0058625 3300048916 Bacteria 2897
974 Ga0496113_0083590 3300048916 Bacteria 2450
975 Ga0496114_0038158 3300048917 Bacteria 3974
976 Ga0496114_0054406 3300048917 Bacteria 3337
977 Ga0496115_0003837 3300048918 Bacteria 10833
978 Ga0496115_0011128 3300048918 Bacteria 6741
979 Ga0496115_0018524 3300048918 Bacteria 5348
980 Ga0496115_0022496 3300048918 Bacteria 4885
981 Ga0496116_0013402 3300048919 Bacteria 6612
982 Ga0496116_0036936 3300048919 Bacteria 3413
983 Ga0496117_0008437 3300048920 Bacteria 9781
984 Ga0496119_0000709 3300048922 Bacteria 44727
985 Ga0496121_0000997 3300048924 Bacteria 50601
986 Ga0496122_0002462 3300048925 Bacteria 26201
987 Ga0496122_0014017 3300048925 Bacteria 7787
988 Ga0496122_0073705 3300048925 Bacteria 2419
989 Ga0496123_0058162 3300048926 Bacteria 2510
990 Ga0496123_0167756 3300048926 Bacteria 1162
991 Ga0496124_0037793 3300048927 Bacteria 4196
992 Ga0496124_0046604 3300048927 Bacteria 3711
993 Ga0496125_0001108 3300048928 Bacteria 41389
994 Ga0496125_0012656 3300048928 Bacteria 8351
995 Ga0496125_0039327 3300048928 Bacteria 4075
996 Ga0496126_0023175 3300048929 Bacteria 6019
997 Ga0495678_041432 3300049459 Bacteria 1843
998 Ga0501031_0020670 3300049568 Bacteria 4293
999 Ga0501031_0058475 3300049568 Bacteria 2512
1000 Ga0501032_0000303 3300049569 Bacteria 41504
1001 Ga0501032_0087939 3300049569 Bacteria 2063
1002 Ga0501032_0123386 3300049569 Bacteria 1712
1003 Ga0501033_0000881 3300049570 Bacteria 27428
1004 Ga0501033_0005988 3300049570 Bacteria 9539
1005 Ga0501034_0000250 3300049571 Bacteria 99407
1006 Ga0501034_0111025 3300049571 Bacteria 2732
1007 Ga0501034_0118961 3300049571 Bacteria 2629
1008 Ga0501034_0222330 3300049571 Bacteria 1840
1009 Ga0501034_0394862 3300049571 Bacteria 1307
1010 Ga0501036_0000098 3300049572 Bacteria 54252
1011 Ga0501036_0133576 3300049572 Bacteria 2094
1012 Ga0501037_0000092 3300049573 Bacteria 83924
1013 Ga0501037_0063493 3300049573 Bacteria 2692
1014 Ga0501037_0069341 3300049573 Bacteria 2567
1015 Ga0501038_0002041 3300049574 Bacteria 18682
1016 Ga0501038_0050472 3300049574 Bacteria 3594
1017 Ga0501038_0052419 3300049574 Bacteria 3518
1018 Ga0501038_0151076 3300049574 Bacteria 1893
1019 Ga0501039_0000085 3300049575 Bacteria 70306
1020 Ga0501039_0058135 3300049575 Bacteria 2995
1021 Ga0501039_0154908 3300049575 Bacteria 1800
1022 Ga0501040_0010464 3300049576 Bacteria 6066
1023 Ga0501040_0188160 3300049576 Bacteria 1465
1024 Ga0501041_0016047 3300049577 Bacteria 4450
1025 Ga0501041_0016276 3300049577 Bacteria 4421
1026 Ga0501042_0020429 3300049578 Bacteria 4609
1027 Ga0501043_0000460 3300049579 Bacteria 36273
1028 Ga0501043_0077737 3300049579 Bacteria 2607
1029 Ga0501043_0192161 3300049579 Bacteria 1587
1030 Ga0501046_0000033 3300049580 Bacteria 174675
1031 Ga0501046_0000624 3300049580 Bacteria 34712
1032 Ga0501046_0045146 3300049580 Bacteria 3502
1033 Ga0501046_0052907 3300049580 Bacteria 3199
1034 Ga0501046_0084981 3300049580 Bacteria 2440
1035 Ga0501046_0143179 3300049580 Bacteria 1807
1036 Ga0501047_0000022 3300049581 Bacteria 249062
1037 Ga0501047_0061466 3300049581 Bacteria 3624
1038 Ga0501047_0066110 3300049581 Bacteria 3485
1039 Ga0501047_0082865 3300049581 Bacteria 3083
1040 Ga0501047_0085660 3300049581 Bacteria 3028
1041 Ga0501047_0176737 3300049581 Bacteria 2002
1042 Ga0501047_0268507 3300049581 Bacteria 1552
1043 Ga0501048_0000292 3300049582 Bacteria 34134
1044 Ga0501048_0173710 3300049582 Bacteria 1527
1045 Ga0501048_0178656 3300049582 Bacteria 1504
1046 Ga0501067_0003139 3300049583 Bacteria 9123
1047 Ga0501067_0029418 3300049583 Bacteria 3044
1048 Ga0501067_0084919 3300049583 Bacteria 1756
1049 Ga0501068_0003364 3300049584 Bacteria 8588
1050 Ga0501068_0054371 3300049584 Bacteria 2425
1051 Ga0501068_0151515 3300049584 Bacteria 1457
1052 Ga0501070_0014140 3300049586 Bacteria 6717
1053 Ga0501070_0020252 3300049586 Bacteria 5579
1054 Ga0501070_0049761 3300049586 Bacteria 3480
1055 Ga0501070_0055000 3300049586 Bacteria 3299
1056 Ga0501070_0173269 3300049586 Bacteria 1777
1057 Ga0501071_0045980 3300049587 Bacteria 3135
1058 Ga0501071_0086331 3300049587 Bacteria 2301
1059 Ga0501071_0099093 3300049587 Bacteria 2147
1060 Ga0501072_0027316 3300049588 Bacteria 4453
1061 Ga0501072_0054742 3300049588 Bacteria 3144
1062 Ga0501072_0111234 3300049588 Bacteria 2180
1063 Ga0501073_0000109 3300049589 Bacteria 53094
1064 Ga0501073_0023706 3300049589 Bacteria 4405
1065 Ga0501073_0044455 3300049589 Bacteria 3130
1066 Ga0501073_0046982 3300049589 Bacteria 3035
1067 Ga0501073_0062686 3300049589 Bacteria 2593
1068 Ga0501074_0000250 3300049590 Bacteria 30239
1069 Ga0501074_0013873 3300049590 Bacteria 5857
1070 Ga0501074_0049283 3300049590 Bacteria 3041
1071 Ga0501074_0053274 3300049590 Bacteria 2919
1072 Ga0501074_0080618 3300049590 Bacteria 2335
1073 Ga0501075_0039262 3300049591 Bacteria 3543
1074 Ga0501076_0091458 3300049592 Bacteria 2447
1075 Ga0501076_0175704 3300049592 Bacteria 1745
1076 Ga0501077_0056525 3300049593 Bacteria 2491
1077 Ga0501077_0197258 3300049593 Bacteria 1279
1078 Ga0501223_000086 3300049663 Bacteria 27446
1079 Ga0501225_0000034 3300049705 Bacteria 46629
1080 Ga0501225_0004061 3300049705 Bacteria 4381
1081 Ga0501079_0005234 3300049741 Bacteria 9642
1082 Ga0501080_0006971 3300049742 Bacteria 10198
1083 Ga0501080_0011399 3300049742 Bacteria 8142
1084 Ga0501080_0025088 3300049742 Bacteria 5532
1085 Ga0501080_0113678 3300049742 Bacteria 2510
1086 Ga0501080_0133642 3300049742 Bacteria 2296
1087 Ga0501080_0261239 3300049742 Bacteria 1578
1088 Ga0501080_0317699 3300049742 Bacteria 1410
1089 Ga0501081_0008911 3300049743 Bacteria 6518
1090 Ga0501081_0055428 3300049743 Bacteria 2739
1091 Ga0501081_0100093 3300049743 Bacteria 2048
1092 Ga0501081_0103323 3300049743 Bacteria 2016
1093 Ga0501083_0000618 3300049744 Bacteria 22913
1094 Ga0501083_0003365 3300049744 Bacteria 11191
1095 Ga0501083_0021302 3300049744 Bacteria 4504
1096 Ga0501083_0063674 3300049744 Bacteria 2459
1097 Ga0501083_0143314 3300049744 Bacteria 1564
1098 Ga0501035_0001489 3300049822 Bacteria 23988
1099 Ga0501035_0021051 3300049822 Bacteria 5995
1100 Ga0501035_0054468 3300049822 Bacteria 3574
1101 Ga0501044_0000072 3300049823 Bacteria 124143
1102 Ga0501044_0024914 3300049823 Bacteria 6345
1103 Ga0501044_0043948 3300049823 Bacteria 4640
1104 Ga0501044_0064936 3300049823 Bacteria 3723
1105 Ga0501044_0257729 3300049823 Bacteria 1683
1106 Ga0501045_0041254 3300049824 Bacteria 3358
1107 Ga0501045_0081425 3300049824 Bacteria 2387
1108 nmdc:mga03n38_55789_c1 3300050490 Bacteria 1781
1109 nmdc:mga03n38_74979_c1 3300050490 Bacteria 1575
1110 nmdc:mga00v17_268007_c1 3300050491 Bacteria 1108
1111 nmdc:mga0yw44_127155_c1 3300050492 Bacteria 1647
1112 nmdc:mga0yw44_58568_c1 3300050492 Bacteria 2354
1113 nmdc:mga0yw44_86222_c1 3300050492 Bacteria 1977
1114 nmdc:mga06z11_191_c1 3300050494 Bacteria 24617
1115 nmdc:mga04h51_1507_c1 3300050495 Bacteria 5395
1116 nmdc:mga04h51_22073_c1 3300050495 Bacteria 1922
1117 nmdc:mga05p37_193198_c1 3300050507 Bacteria 2470
1118 nmdc:mga05p37_27999_c1 3300050507 Bacteria 6865
1119 nmdc:mga09592_14616_c1 3300050508 Bacteria 6407
1120 nmdc:mga0qj67_350211_c1 3300050509 Bacteria 1194
1121 nmdc:mga0qj67_392_c1 3300050509 Bacteria 30232
1122 nmdc:mga06r32_51949_c1 3300050510 Bacteria 3924
1123 nmdc:mga06r32_64244_c1 3300050510 Bacteria 3539
1124 nmdc:mga08y16_14375_c1 3300050511 Bacteria 8333
1125 nmdc:mga08y16_64084_c1 3300050511 Bacteria 3838
1126 nmdc:mga08y16_66523_c1 3300050511 Bacteria 3761
1127 nmdc:mga0n895_111546_c1 3300050512 Bacteria 2751
1128 nmdc:mga0n895_15793_c1 3300050512 Bacteria 6903
1129 nmdc:mga0n895_311322_c1 3300050512 Bacteria 1596
1130 nmdc:mga0n895_552_c1 3300050512 Bacteria 25634
1131 nmdc:mga0n895_84596_c1 3300050512 Bacteria 3165
1132 nmdc:mga0rr50_157675_c1 3300050513 Bacteria 1840
1133 nmdc:mga0rr50_33063_c1 3300050513 Bacteria 3692
1134 nmdc:mga08x19_40687_c1 3300050514 Bacteria 2959
1135 nmdc:mga0a205_2568_c1 3300050515 Bacteria 16009
1136 nmdc:mga0sz30_21157_c1 3300050516 Bacteria 2630
1137 Ga0495601_0000016 3300053077 Bacteria 207486
1138 Ga0495601_0002664 3300053077 Bacteria 10122
1139 Ga0495601_0007172 3300053077 Bacteria 6538
1140 Ga0495601_0011070 3300053077 Bacteria 5390
1141 Ga0495601_0053768 3300053077 Bacteria 2546
1142 Ga0495601_0054340 3300053077 Bacteria 2533
1143 Ga0495601_0057524 3300053077 Bacteria 2463
1144 Ga0495612_0000041 3300053078 Bacteria 62752
1145 Ga0495612_0003354 3300053078 Bacteria 6637
1146 Ga0495612_0010956 3300053078 Bacteria 3661
1147 Ga0495612_0015875 3300053078 Bacteria 3018
1148 Ga0495612_0019036 3300053078 Bacteria 2748
1149 Ga0495612_0036858 3300053078 Bacteria 1985
1150 Ga0495595_0000048 3300053084 Bacteria 60581
1151 Ga0495595_0001522 3300053084 Bacteria 9051
1152 Ga0495595_0008969 3300053084 Bacteria 4125
1153 Ga0495595_0010099 3300053084 Bacteria 3918
1154 Ga0495619_0000050 3300053085 Bacteria 101361
1155 Ga0495619_0000518 3300053085 Bacteria 25614
1156 Ga0495619_0001220 3300053085 Bacteria 16844
1157 Ga0495619_0001244 3300053085 Bacteria 16678
1158 Ga0495619_0008836 3300053085 Bacteria 6369
1159 Ga0495619_0025575 3300053085 Bacteria 3792
1160 Ga0495619_0029292 3300053085 Bacteria 3556
1161 Ga0495619_0093107 3300053085 Bacteria 2042
1162 Ga0500647_0002985 3300053091 Bacteria 6478
1163 Ga0500651_0039297 3300053093 Bacteria 2979
1164 Ga0500651_0059817 3300053093 Bacteria 2382
1165 Ga0500566_0007133 3300053094 Bacteria 6620
1166 Ga0500641_0024126 3300053096 Bacteria 2343
1167 Ga0500556_0001106 3300053104 Bacteria 13430
1168 Ga0500593_043998 3300053117 Bacteria 1992
1169 Ga0500618_004828 3300053125 Bacteria 4214
1170 Ga0500618_010582 3300053125 Bacteria 2472
1171 Ga0500559_0000398 3300053136 Bacteria 31511
1172 Ga0500559_0000465 3300053136 Bacteria 28853
1173 Ga0500568_0005085 3300053139 Bacteria 6878
1174 Ga0500622_0009386 3300053156 Bacteria 5414
1175 Ga0500624_004059 3300053157 Bacteria 1920
1176 Ga0500637_0037235 3300053178 Bacteria 2734
1177 Ga0500645_001143 3300053730 Bacteria 14378
1178 Ga0501084_0001321 3300054114 Bacteria 19525
1179 Ga0501084_0012745 3300054114 Bacteria 6964
1180 Ga0501084_0013172 3300054114 Bacteria 6841
1181 Ga0501084_0014344 3300054114 Bacteria 6565
1182 Ga0501082_0007370 3300060353 Bacteria 9492
1183 Ga0501082_0010751 3300060353 Bacteria 7878
1184 Ga0501082_0033077 3300060353 Bacteria 4459
1185 Ga0501082_0042143 3300060353 Bacteria 3935
1186 Ga0501082_0056526 3300060353 Bacteria 3380
1187 Ga0501082_0081619 3300060353 Bacteria 2790
1188 Ga0501082_0094166 3300060353 Bacteria 2588
1189 Ga0501082_0110314 3300060353 Bacteria 2382
1190 Ga0501082_0168915 3300060353 Bacteria 1901
1191 2512038276 2511231221 Bacteria 6846400
1192 2512642554 2512564014 Bacteria 4639632
1193 2523103374 2522572158 Bacteria 6514390
1194 2523468637 2523231067 Bacteria 5230452
1195 2599102682 2597490356 Bacteria 7030811
1196 2643757928 2643221547 Bacteria 4740017
1197 2643884552 2643221574 Bacteria 2789653
1198 2644290964 2643221651 Bacteria 4798932
1199 2644351387 2643221663 Bacteria 3425771
1200 2644549064 2643221699 Bacteria 5731501
1201 2644553206 2643221699 Bacteria 5731501
1202 2739349867 2738543031 Bacteria 5769731
1203 2778125464 2775507255 Bacteria 3945731
1204 2809063335 2808606401 Bacteria 4586670
1205 2809079229 2808606404 Bacteria 4652788
1206 2809083397 2808606405 Bacteria 4586632
1207 2846955403 2846952575 Bacteria 6587527
1208 2848861046 2848858292 Bacteria 7391279
1209 2880520605 2880518877 Bacteria 5012590
1210 2897808820 2897803580 Bacteria 7000062
1211 2919073820 2919073203 Bacteria 6531949
1212 2919452663 2919450847 Bacteria 5631160
1213 2928974528 2928972540 Bacteria 3058286
1214 2941488062 2941485952 Bacteria 3591484
1215 2977243451 2977240413 Bacteria 3191065
1216 8016557647 8016557553 Bacteria 8154380
1217 8054002866 8054002106 Bacteria 7987183
1218 nmdc:mga0rr50_95527_c1
1219 2214772987
1220 ARSoilYngRDRAFT_c00005
1221 ARcpr5yngRDRAFT_c000005
1222 ARCol0oldRDRAFT_c00605
1223 ARCol0yngRDRAFT_1000007
1224 JGI24736J21556_1001465
1225 JGI24741J21665_1000079
1226 JGI24746J21847_1000626
1227 JGI24740J21852_10003959
1228 JGI24740J21852_10007775
1229 JGI24739J22299_10000027
1230 JGI24739J22299_10000379
1231 JGI24737J22298_10000240
1232 JGI24737J22298_10001802
1233 JGI24735J21928_10000880
1234 JGI24735J21928_10014573
1235 JGI24750J21931_1000045
1236 JGI24745J21846_1000029
1237 JGI24738J21930_10001349
1238 JGI24738J21930_10003527
1239 JGI24749J21850_1000664
1240 JGI24035J26624_1000187
1241 JGI24034J26672_10000122
1242 JGI24742J22300_10001443
1243 JGI24751J29686_10005219
1244 Ga0006562J51391_1067863
1245 Ga0055536_1002707
1246 Ga0065716_1000007
1247 Ga0065704_10134305
1248 Ga0065712_10001604
1249 Ga0065712_10003002
1250 Ga0065712_10078142
1251 Ga0065715_10000898
1252 Ga0065715_10088997
1253 Ga0070658_10019947
1254 Ga0070658_10045121
1255 Ga0070676_10000146
1256 Ga0070683_100000116
1257 Ga0070683_100040594
1258 Ga0070690_100015659
1259 Ga0070690_100015826
1260 Ga0070690_100017738
1261 Ga0070690_100023017
1262 Ga0070690_100146333
1263 Ga0070670_100013395
1264 Ga0070677_10000151
1265 Ga0068869_100000013
1266 Ga0070666_10023846
1267 Ga0070666_10041339
1268 Ga0070680_100005855
1269 Ga0070680_100018386
1270 Ga0070680_100021486
1271 Ga0070680_100023840
1272 Ga0070680_100084167
1273 Ga0070682_100002742
1274 Ga0070682_100022863
1275 Ga0070682_100038543
1276 Ga0068868_100002546
1277 Ga0068868_100125794
1278 Ga0070660_100005178
1279 Ga0070660_100009730
1280 Ga0070689_100001113
1281 Ga0070689_100145685
1282 Ga0070691_10059130
1283 Ga0070687_100003954
1284 Ga0070687_100004416
1285 Ga0070687_100007702
1286 Ga0070661_100000228
1287 Ga0070661_100065128
1288 Ga0070692_10001025
1289 Ga0070692_10022160
1290 Ga0070668_100077535
1291 Ga0070668_100161410
1292 Ga0070668_100218410
1293 Ga0070669_100000368
1294 Ga0070669_100059546
1295 Ga0070669_100165881
1296 Ga0070669_100190929
1297 Ga0070675_100000752
1298 Ga0070675_100018009
1299 Ga0070675_100083141
1300 Ga0070671_100000142
1301 Ga0070671_100001856
1302 Ga0070671_100007494
1303 Ga0070671_100010831
1304 Ga0070671_100050533
1305 Ga0070674_100001056
1306 Ga0070674_100026532
1307 Ga0070673_100000045
1308 Ga0070673_100038893
1309 Ga0070673_100071329
1310 Ga0070688_100005939
1311 Ga0070688_100028550
1312 Ga0070659_100000183
1313 Ga0070667_100013162
1314 Ga0070667_100029214
1315 Ga0070667_100205749
1316 Ga0070667_100309758
1317 Ga0070703_10001614
1318 Ga0070714_100003288
1319 Ga0070714_100078156
1320 Ga0070714_100092438
1321 Ga0070713_100030794
1322 Ga0070713_100105678
1323 Ga0070713_100117010
1324 Ga0070710_10009606
1325 Ga0070710_10031023
1326 Ga0070701_10009585
1327 Ga0070711_100028231
1328 Ga0070711_100166329
1329 Ga0070705_100060076
1330 Ga0070700_100041846
1331 Ga0070694_100026598
1332 Ga0070694_100114519
1333 Ga0070708_100131067
1334 Ga0070663_100001069
1335 Ga0070663_100037221
1336 Ga0070663_100086303
1337 Ga0070678_100001753
1338 Ga0070678_100031601
1339 Ga0070662_100042252
1340 Ga0070662_100063974
1341 Ga0070681_10009946
1342 Ga0070681_10014427
1343 Ga0070681_10041751
1344 Ga0070681_10043818
1345 Ga0068867_100000160
1346 Ga0068867_100019113
1347 Ga0070685_10008870
1348 Ga0070685_10114232
1349 Ga0070706_100221789
1350 Ga0070699_100123881
1351 Ga0070679_100006152
1352 Ga0070679_100020075
1353 Ga0070679_100040234
1354 Ga0070679_100045419
1355 Ga0070679_100062201
1356 Ga0070679_100076376
1357 Ga0070679_100128935
1358 Ga0070684_100000352
1359 Ga0070684_100070008
1360 Ga0070684_100079467
1361 Ga0070697_100036459
1362 Ga0068853_100003900
1363 Ga0068853_100006249
1364 Ga0068853_100044038
1365 Ga0068853_100178455
1366 Ga0070672_100000016
1367 Ga0070672_100014289
1368 Ga0070672_100078359
1369 Ga0070672_100085665
1370 Ga0070686_100001103
1371 Ga0070695_100002919
1372 Ga0070695_100003518
1373 Ga0070695_100012328
1374 Ga0070695_100068989
1375 Ga0070696_100030786
1376 Ga0070665_100077477
1377 Ga0070665_100090650
1378 Ga0070704_100001007
1379 Ga0070704_100036603
1380 Ga0068855_100010817
1381 Ga0068855_100042726
1382 Ga0068855_100055219
1383 Ga0068855_100055244
1384 Ga0068855_100384727
1385 Ga0070664_100000067
1386 Ga0068857_100003846
1387 Ga0068857_100017914
1388 Ga0068857_100037829
1389 Ga0068854_100000131
1390 Ga0068854_100016650
1391 Ga0068854_100018065
1392 Ga0068854_100022998
1393 Ga0068854_100114930
1394 Ga0068856_100015929
1395 Ga0068856_100020679
1396 Ga0068856_100024647
1397 Ga0068856_100057977
1398 Ga0070702_100000810
1399 Ga0070702_100008194
1400 Ga0068852_100082220
1401 Ga0068852_100282240
1402 Ga0068859_100015494
1403 Ga0068859_100025009
1404 Ga0068859_100327190
1405 Ga0068864_100001095
1406 Ga0068864_100047681
1407 Ga0068864_100115096
1408 Ga0068866_10002457
1409 Ga0068861_100000241
1410 Ga0068861_100024500
1411 Ga0068861_100084806
1412 Ga0068861_100204099
1413 Ga0068851_10002682
1414 Ga0068870_10000110
1415 Ga0068870_10131406
1416 Ga0068863_100004900
1417 Ga0068863_100019233
1418 Ga0068858_100022418
1419 Ga0068858_100039621
1420 Ga0068858_100042243
1421 Ga0068858_100042547
1422 Ga0068858_100079228
1423 Ga0068858_100121676
1424 Ga0068860_100001050
1425 Ga0068860_100373840
1426 Ga0068862_100023587
1427 Ga0068862_100024602
1428 Ga0068862_100037899
1429 Ga0068862_100191564
1430 Ga0081455_10000002
1431 Ga0081540_1001046
1432 Ga0081540_1014999
1433 Ga0081540_1020079
1434 Ga0081539_10012546
1435 Ga0070717_10044309
1436 Ga0070717_10145022
1437 Ga0075365_10021515
1438 Ga0075365_10100994
1439 Ga0075365_10130557
1440 Ga0075368_10000081
1441 Ga0075368_10021543
1442 Ga0075368_10041013
1443 Ga0075363_100072497
1444 Ga0075363_100108057
1445 Ga0075364_10052321
1446 Ga0070712_100004886
1447 Ga0070712_100079757
1448 Ga0075367_10001178
1449 Ga0075367_10010807
1450 Ga0075367_10018295
1451 Ga0075369_10028880
1452 Ga0097621_100012044
1453 Ga0097621_100020748
1454 Ga0097621_100022669
1455 Ga0097621_100030501
1456 Ga0075370_10038028
1457 Ga0075370_10089375
1458 Ga0068871_100016774
1459 Ga0068871_100028631
1460 Ga0068871_100039933
1461 Ga0075430_100006643
1462 Ga0075431_100125075
1463 Ga0075433_10001079
1464 Ga0075433_10351223
1465 Ga0075434_100013980
1466 Ga0075434_100019228
1467 Ga0075434_100038177
1468 Ga0075434_100073207
1469 Ga0075434_100167178
1470 Ga0075434_100451529
1471 Ga0075429_100121304
1472 Ga0068865_100000209
1473 Ga0068865_100025070
1474 Ga0068865_100079228
1475 Ga0075436_100004004
1476 Ga0075436_100185210
1477 Ga0097620_100015494
1478 Ga0097620_100025009
1479 Ga0097620_100327185
1480 Ga0075435_100056907
1481 Ga0105251_10025625
1482 Ga0105240_10013995
1483 Ga0105240_10036311
1484 Ga0105240_10181196
1485 Ga0105240_10430801
1486 Ga0111539_10000941
1487 Ga0111539_10001081
1488 Ga0111539_10084487
1489 Ga0111539_10089724
1490 Ga0111539_10119085
1491 Ga0105245_10000090
1492 Ga0105245_10054168
1493 Ga0105245_10240932
1494 Ga0105247_10002972
1495 Ga0105247_10008124
1496 Ga0114129_10011617
1497 Ga0114129_10075511
1498 Ga0114129_10165358
1499 Ga0105243_10017356
1500 Ga0105243_10044255
1501 Ga0105243_10140875
1502 Ga0105241_10000053
1503 Ga0105241_10009743
1504 Ga0105242_10011145
1505 Ga0105242_10028336
1506 Ga0105242_10055680
1507 Ga0105248_10000934
1508 Ga0105248_10010774
1509 Ga0105248_10037593
1510 Ga0105248_10040996
1511 Ga0105248_10179957
1512 Ga0105248_10225181
1513 Ga0105237_10028064
1514 Ga0105237_10034377
1515 Ga0105237_10184163
1516 Ga0105237_10316943
1517 Ga0105237_10341401
1518 Ga0105238_10000905
1519 Ga0105238_10011422
1520 Ga0105238_10030815
1521 Ga0105238_10037417
1522 Ga0105238_10085309
1523 Ga0105238_10099990
1524 Ga0105249_10002035
1525 Ga0105249_10002347
1526 Ga0105249_10015086
1527 Ga0105249_10093303
1528 Ga0105249_10317834
1529 Ga0105148_100011
1530 Ga0099796_10010230
1531 Ga0105239_10002502
1532 Ga0105239_10025540
1533 Ga0105239_10048612
1534 Ga0105239_10179237
1535 Ga0105239_10396815
1536 Ga0105246_10000055
1537 Ga0157373_10051024
1538 Ga0157371_10001665
1539 Ga0157371_10022274
1540 Ga0157370_10038949
1541 Ga0157370_10044244
1542 Ga0157369_10044416
1543 Ga0157369_10070663
1544 Ga0157374_10000476
1545 Ga0157378_10002229
1546 Ga0157378_10120957
1547 Ga0157378_10126805
1548 Ga0163162_10004481
1549 Ga0163162_10052202
1550 Ga0157372_10004356
1551 Ga0157372_10181124
1552 Ga0157375_10004478
1553 Ga0157375_10008267
1554 Ga0157375_10035061
1555 Ga0163163_10004723
1556 Ga0163163_10007190
1557 Ga0163163_10028878
1558 Ga0163163_10054862
1559 Ga0157380_10006672
1560 Ga0157380_10278078
1561 Ga0157377_10000987
1562 Ga0157377_10004874
1563 Ga0157379_10000805
1564 Ga0157379_10027886
1565 Ga0157379_10050365
1566 Ga0157379_10086903
1567 Ga0157376_10000283
1568 Ga0157376_10295269
1569 Ga0157376_10304377
1570 Ga0163161_10000199
1571 Ga0163161_10000897
1572 Ga0206353_10275763
1573 Ga0213875_10000053
1574 Ga0213875_10003884
1575 Ga0224572_1001790
1576 Ga0228598_1000469
1577 Ga0207666_1000469
1578 Ga0207666_1000945
1579 Ga0207673_1000045
1580 Ga0209676_1000140
1581 Ga0209676_1001860
1582 Ga0209257_1000292
1583 Ga0207697_10000245
1584 Ga0207697_10006821
1585 Ga0207653_10000923
1586 Ga0207682_10000029
1587 Ga0207642_10003101
1588 Ga0207710_10006518
1589 Ga0207710_10081259
1590 Ga0207688_10000084
1591 Ga0207688_10023584
1592 Ga0207688_10048058
1593 Ga0207680_10008657
1594 Ga0207680_10018398
1595 Ga0207680_10039933
1596 Ga0207647_10000871
1597 Ga0207647_10005096
1598 Ga0207647_10006412
1599 Ga0207647_10033960
1600 Ga0207699_10038570
1601 Ga0207645_10000090
1602 Ga0207645_10033477
1603 Ga0207643_10000044
1604 Ga0207643_10005672
1605 Ga0207643_10081668
1606 Ga0207705_10026788
1607 Ga0207684_10096437
1608 Ga0207654_10000058
1609 Ga0207654_10004275
1610 Ga0207707_10017706
1611 Ga0207707_10020258
1612 Ga0207707_10097808
1613 Ga0207695_10000453
1614 Ga0207695_10002758
1615 Ga0207695_10023280
1616 Ga0207671_10125535
1617 Ga0207671_10225179
1618 Ga0207693_10000434
1619 Ga0207693_10002841
1620 Ga0207693_10013460
1621 Ga0207693_10017239
1622 Ga0207693_10047329
1623 Ga0207693_10052546
1624 Ga0207693_10060072
1625 Ga0207693_10093857
1626 Ga0207693_10131435
1627 Ga0207693_10216281
1628 Ga0207663_10170872
1629 Ga0207660_10005635
1630 Ga0207660_10016403
1631 Ga0207660_10036154
1632 Ga0207660_10085235
1633 Ga0207660_10126476
1634 Ga0207662_10000544
1635 Ga0207662_10007517
1636 Ga0207662_10010378
1637 Ga0207657_10002170
1638 Ga0207657_10005961
1639 Ga0207657_10054105
1640 Ga0207649_10000260
1641 Ga0207652_10008473
1642 Ga0207652_10011429
1643 Ga0207652_10047793
1644 Ga0207681_10000154
1645 Ga0207681_10029640
1646 Ga0207681_10057776
1647 Ga0207681_10064101
1648 Ga0207694_10033540
1649 Ga0207694_10076501
1650 Ga0207694_10082128
1651 Ga0207650_10003395
1652 Ga0207650_10013514
1653 Ga0207650_10031312
1654 Ga0207659_10000258
1655 Ga0207659_10013822
1656 Ga0207659_10176117
1657 Ga0207687_10005296
1658 Ga0207664_10025593
1659 Ga0207664_10033479
1660 Ga0207664_10040886
1661 Ga0207644_10010275
1662 Ga0207644_10011534
1663 Ga0207644_10027515
1664 Ga0207644_10038217
1665 Ga0207644_10040569
1666 Ga0207690_10002042
1667 Ga0207690_10018700
1668 Ga0207690_10178287
1669 Ga0207706_10003023
1670 Ga0207706_10018867
1671 Ga0207706_10038206
1672 Ga0207706_10060739
1673 Ga0207706_10065103
1674 Ga0207706_10110759
1675 Ga0207706_10151650
1676 Ga0207686_10148339
1677 Ga0207709_10000372
1678 Ga0207670_10004247
1679 Ga0207670_10017680
1680 Ga0207670_10026412
1681 Ga0207669_10000019
1682 Ga0207704_10000759
1683 Ga0207665_10004784
1684 Ga0207665_10161814
1685 Ga0207691_10000882
1686 Ga0207691_10001627
1687 Ga0207691_10047049
1688 Ga0207691_10082848
1689 Ga0207691_10305640
1690 Ga0207711_10001673
1691 Ga0207711_10009158
1692 Ga0207711_10013414
1693 Ga0207711_10021680
1694 Ga0207711_10101018
1695 Ga0207689_10000228
1696 Ga0207689_10007012
1697 Ga0207661_10000107
1698 Ga0207661_10076806
1699 Ga0207661_10145070
1700 Ga0207679_10000026
1701 Ga0207679_10015638
1702 Ga0207667_10007974
1703 Ga0207667_10020988
1704 Ga0207667_10045340
1705 Ga0207667_10071293
1706 Ga0207667_10194573
1707 Ga0207651_10000069
1708 Ga0207712_10000242
1709 Ga0207712_10018876
1710 Ga0207712_10035724
1711 Ga0207712_10184011
1712 Ga0207668_10000049
1713 Ga0207668_10007545
1714 Ga0207668_10052263
1715 Ga0207640_10000234
1716 Ga0207640_10019201
1717 Ga0207658_10000804
1718 Ga0207658_10036433
1719 Ga0207658_10058728
1720 Ga0207658_10169030
1721 Ga0207658_10269219
1722 Ga0207677_10017935
1723 Ga0207677_10040031
1724 Ga0207677_10049799
1725 Ga0207703_10034429
1726 Ga0207703_10054666
1727 Ga0207703_10221093
1728 Ga0207639_10000323
1729 Ga0207639_10000413
1730 Ga0207639_10017058
1731 Ga0207639_10021124
1732 Ga0207639_10047997
1733 Ga0207678_10000068
1734 Ga0207678_10000920
1735 Ga0207678_10020051
1736 Ga0207678_10060722
1737 Ga0207678_10081589
1738 Ga0207708_10001502
1739 Ga0207708_10014245
1740 Ga0207708_10014309
1741 Ga0207708_10074540
1742 Ga0207708_10110697
1743 Ga0207702_10000004
1744 Ga0207702_10001343
1745 Ga0207702_10081442
1746 Ga0207641_10000669
1747 Ga0207641_10202093
1748 Ga0207648_10006668
1749 Ga0207648_10009806
1750 Ga0207648_10071352
1751 Ga0207648_10073831
1752 Ga0207676_10003679
1753 Ga0207676_10018586
1754 Ga0207676_10039043
1755 Ga0207676_10052240
1756 Ga0207674_10000882
1757 Ga0207674_10013733
1758 Ga0207674_10015731
1759 Ga0207674_10032534
1760 Ga0207674_10070999
1761 Ga0207675_100014892
1762 Ga0207675_100056431
1763 Ga0207675_100248502
1764 Ga0207675_100268177
1765 Ga0207683_10000653
1766 Ga0207683_10012333
1767 Ga0207683_10028701
1768 Ga0207698_10000977
1769 Ga0207698_10057221
1770 Ga0207698_10074967
1771 Ga0207698_10194176
1772 Ga0209999_1009022
1773 Ga0210002_1001945
1774 Ga0209983_1003607
1775 Ga0209966_1000652
1776 Ga0209813_10000087
1777 Ga0207428_10000130
1778 Ga0207428_10000286
1779 Ga0207428_10049012
1780 Ga0265357_1000262
1781 Ga0268265_10002575
1782 Ga0268265_10011597
1783 Ga0268265_10167932
1784 Ga0268265_10248948
1785 Ga0268264_10046150
1786 Ga0265337_1003660
1787 Ga0265330_10008622
1788 Ga0265332_10006574
1789 Ga0265332_10074841
1790 Ga0265325_10001319
1791 Ga0265325_10023154
1792 Ga0265340_10001848
1793 Ga0265340_10015062
1794 Ga0265340_10022161
1795 Ga0265340_10042126
1796 Ga0265339_10000033
1797 Ga0265339_10009902
1798 Ga0265339_10030179
1799 Ga0265331_10056121
1800 Ga0265331_10065198
1801 Ga0307408_100130805
1802 Ga0265313_10000049
1803 Ga0265313_10005321
1804 Ga0265313_10009363
1805 Ga0265313_10023313
1806 Ga0265313_10039878
1807 Ga0265313_10044294
1808 Ga0265313_10045754
1809 Ga0265313_10072321
1810 Ga0307508_10077726
1811 Ga0265314_10019730
1812 Ga0265314_10022239
1813 Ga0265314_10031505
1814 Ga0265342_10000149
1815 Ga0265342_10001524
1816 Ga0265342_10002635
1817 Ga0265342_10038344
1818 Ga0316576_10016776
1819 Ga0307413_10043361
1820 Ga0307413_10098092
1821 Ga0307410_10030984
1822 Ga0307410_10079395
1823 Ga0307406_10004876
1824 Ga0307406_10018783
1825 Ga0307406_10024626
1826 Ga0307412_10002217
1827 Ga0307412_10016299
1828 Ga0307409_100010670
1829 Ga0307414_10000384
1830 Ga0307414_10014276
1831 Ga0307414_10016354
1832 Ga0307414_10030847
1833 Ga0307414_10053668
1834 Ga0307411_10174874
1835 Ga0307415_100079976
1836 Ga0307510_10088528
1837 Ga0373930_0000159
1838 Ga0373950_0001078
1839 Ga0373958_0000305
1840 Ga0373959_0000743
1841 Ga0373938_0000024
1842 Ga0373938_0001010
1843 Ga0373926_0004308
1844 Ga0373926_0012322
1845 Ga0373929_0000274
1846 Ga0373929_0005708
1847 Ga0373934_0013351
1848 Ga0373940_0000029
1849 Ga0373944_0011320
1850 Ga0373951_0000391
1851 Ga0373951_0000779
1852 Ga0373923_0001398
1853 Ga0373923_0034751
1854 Ga0373932_0000515
1855 Ga0373932_0002870
1856 Ga0373932_0025991
1857 Ga0373936_0003979
1858 Ga0373936_0041141
1859 Ga0373939_0001312
1860 Ga0373939_0003941
1861 Ga0373941_0001774
1862 Ga0373941_0038096
1863 Ga0373945_0000654
1864 Ga0373945_0001064
1865 Ga0373945_0003922
1866 Ga0373953_0025607
1867 Ga0373954_0000906
1868 Ga0373956_0008585
1869 Ga0373956_0015622
1870 Ga0373956_0019147
1871 Ga0373957_0006119
1872 Ga0373957_0073568
1873 Ga0373960_0000932
1874 Ga0373960_0006664
1875 Ga0373943_0001179
1876 Ga0373943_0003827
1877 Ga0373943_0061106
1878 Ga0373946_0001814
1879 Ga0373946_0009494
1880 Ga0373946_0033652
1881 Ga0373955_0000201
1882 Ga0373942_0000286
1883 Ga0373961_0000298
1884 Ga0373961_0004205
1885 Ga0373962_0000887
1886 Ga0373962_0001502
1887 Ga0373931_0001002
1888 Ga0373931_0011412
1889 Ga0373931_0027265
1890 Ga0373931_0039871
1891 Ga0373931_0122606
1892 Ga0373935_0000068
1893 Ga0373935_0023692
1894 Ga0373935_0044129
1895 Ga0373935_0044940
1896 Ga0373927_0000863
1897 Ga0373927_0005387
1898 Ga0373927_0011948
1899 Ga0373927_0026187
1900 Ga0373927_0114486
1901 Ga0373933_0037084
1902 Ga0373933_0096591
1903 Ga0373947_0002147
1904 Ga0373947_0002537
1905 Ga0373947_0006972
1906 Ga0373947_0040717
1907 Ga0373937_0000347
1908 Ga0373937_0007729
1909 Ga0373937_0048668
1910 Ga0373925_0000081
1911 Ga0373925_0005678
1912 Ga0373925_0007759
1913 Ga0373925_0008281
1914 Ga0373925_0009149
1915 Ga0373925_0053408
1916 Ga0373925_0061285
1917 Ga0373925_0068818
1918 Ga0373925_0142309
1919 Ga0395899_0014213
1920 Ga0395900_0273709
1921 Ga0395898_0001457
1922 Ga0395898_0011440
1923 Ga0436364_0094686
1924 Ga0436364_0596981
1925 Ga0436364_0951864
1926 Ga0395901_0284451
1927 Ga0400483_117325
1928 Ga0436365_0160122
1929 Ga0436365_0840419
1930 Ga0436365_1336443
1931 Ga0436365_1477994
1932 Ga0436360_0873896
1933 Ga0436361_0500089
1934 Ga0436361_0722936
1935 Ga0436361_0760231
1936 Ga0436363_0138398
1937 Ga0436363_0887763
1938 Ga0450901_003385
1939 Ga0453684_0043018
1940 Ga0453684_0094777
1941 Ga0466957_0058841
1942 Ga0466959_0078594
1943 Ga0451576_0013266
1944 Ga0466958_0029784
1945 Ga0495617_024736
1946 Ga0495627_029130
1947 Ga0495592_0000196
1948 Ga0495592_0030502
1949 Ga0495592_0044206
1950 Ga0495603_0101032
1951 Ga0495629_0001034
1952 Ga0495629_0003904
1953 Ga0495629_0010656
1954 Ga0495629_0054088
1955 Ga0495629_0056006
1956 Ga0495638_0000068
1957 Ga0495641_0066355
1958 Ga0495651_0000977
1959 Ga0495651_0062022
1960 Ga0495651_0168341
1961 Ga0495653_0000193
1962 Ga0495653_0010589
1963 Ga0495653_0044231
1964 Ga0495582_0004213
1965 Ga0495582_0005890
1966 Ga0495582_0034182
1967 Ga0495639_0009208
1968 Ga0495639_0075596
1969 Ga0495662_0001111
1970 Ga0495662_0002749
1971 Ga0495662_0006973
1972 Ga0495664_0000016
1973 Ga0495664_0000554
1974 Ga0495664_0036496
1975 Ga0495664_0082802
1976 Ga0495584_0005586
1977 Ga0495584_0006458
1978 Ga0495584_0099823
1979 Ga0495585_0000744
1980 Ga0495594_0008772
1981 Ga0495607_0027003
1982 Ga0495583_0038328
1983 Ga0495608_0000121
1984 Ga0495608_0037362
1985 Ga0495610_0000083
1986 Ga0495610_0035906
1987 Ga0495616_0110694
1988 Ga0495618_0000124
1989 Ga0495618_0003921
1990 Ga0495618_0127837
1991 Ga0495628_0000018
1992 Ga0495628_0101785
1993 Ga0495630_0002180
1994 Ga0495630_0006717
1995 Ga0495630_0018839
1996 Ga0495630_0032184
1997 Ga0495630_0100532
1998 Ga0495632_0000023
1999 Ga0495637_0000836
2000 Ga0495637_0002707
2001 Ga0495643_0000038
2002 Ga0495644_0002708
2003 Ga0495644_0015905
2004 Ga0495648_0014476
2005 Ga0495663_0000019
2006 Ga0495663_0013219
2007 Ga0495666_0006120
2008 Ga0495652_0000005
2009 Ga0495652_0019100
2010 Ga0495652_0049806
2011 Ga0495640_0000063
2012 Ga0495640_0069336
2013 Ga0495640_0143041
2014 Ga0495640_0165006
2015 Ga0495586_0019585
2016 Ga0495586_0051648
2017 Ga0495587_0000134
2018 Ga0495587_0007597
2019 Ga0495598_0000513
2020 Ga0495598_0009308
2021 Ga0495609_0043795
2022 Ga0495645_0000070
2023 Ga0495645_0003212
2024 Ga0495645_0021402
2025 Ga0495633_0000568
2026 Ga0495633_0000772
2027 Ga0495633_0002060
2028 Ga0495667_0000023
2029 Ga0495667_0005008
2030 Ga0495634_0000241
2031 Ga0495634_0014117
2032 Ga0495635_0000045
2033 Ga0495635_0035648
2034 Ga0495659_0002311
2035 Ga0495588_0034636
2036 Ga0495657_0001484
2037 Ga0495657_0007068
2038 Ga0495657_0086915
2039 Ga0495599_0000107
2040 Ga0495623_0000180
2041 Ga0495623_0002513
2042 Ga0495623_0009474
2043 Ga0495646_0000027
2044 Ga0495646_0080435
2045 Ga0495647_0004735
2046 Ga0495658_0020639
2047 Ga0495658_0032995
2048 Ga0495613_0009605
2049 Ga0495624_0015346
2050 Ga0495624_0053973
2051 Ga0495624_0095759
2052 Ga0495670_0003165
2053 Ga0495670_0004845
2054 Ga0495671_0000027
2055 Ga0495649_0000048
2056 Ga0495600_0000062
2057 Ga0495600_0006032
2058 Ga0495600_0028982
2059 Ga0495600_0196222
2060 Ga0495581_0028604
2061 Ga0495581_0034460
2062 Ga0495581_0039498
2063 Ga0495604_0000014
2064 Ga0495604_0000613
2065 Ga0495604_0017410
2066 Ga0495674_0000014
2067 Ga0495674_0020715
2068 Ga0495674_0054449
2069 Ga0495674_0108485
2070 Ga0495674_0158694
2071 Ga0495672_0008846
2072 Ga0495676_0018139
2073 Ga0495680_0000779
2074 Ga0495680_0004120
2075 Ga0495680_0005491
2076 Ga0495680_0014092
2077 Ga0495680_0106452
2078 Ga0495680_0214928
2079 Ga0495675_0000058
2080 Ga0495675_0016655
2081 Ga0495681_0000279
2082 Ga0495681_0001314
2083 Ga0495684_0000059
2084 Ga0495684_0000136
2085 Ga0495686_0043393
2086 Ga0495686_0135686
2087 Ga0495593_0005129
2088 Ga0495593_0061722
2089 Ga0495602_0000017
2090 Ga0495614_0020420
2091 Ga0495614_0024753
2092 Ga0495615_0021522
2093 Ga0496100_0000237
2094 Ga0496100_0006029
2095 Ga0496100_0025954
2096 Ga0496100_0075119
2097 Ga0496100_0114614
2098 Ga0496100_0208748
2099 Ga0496101_0000697
2100 Ga0496101_0003104
2101 Ga0496101_0011363
2102 Ga0496101_0013493
2103 Ga0496101_0087126
2104 Ga0496101_0163654
2105 Ga0496101_0175674
2106 Ga0496102_0004386
2107 Ga0496102_0008462
2108 Ga0496102_0024214
2109 Ga0496102_0064232
2110 Ga0496102_0085685
2111 Ga0496102_0100039
2112 Ga0496102_0133343
2113 Ga0496102_0133444
2114 Ga0496102_0145942
2115 Ga0496102_0214057
2116 Ga0496103_0016536
2117 Ga0496103_0080031
2118 Ga0496104_0006107
2119 Ga0496104_0014689
2120 Ga0496104_0021017
2121 Ga0496104_0031473
2122 Ga0496104_0035169
2123 Ga0496104_0065269
2124 Ga0496104_0195705
2125 Ga0496105_0001999
2126 Ga0496105_0005181
2127 Ga0496105_0006825
2128 Ga0496105_0157161
2129 Ga0496105_0185565
2130 Ga0496106_0000236
2131 Ga0496106_0002012
2132 Ga0496106_0009101
2133 Ga0496106_0011510
2134 Ga0496106_0016650
2135 Ga0496106_0076915
2136 Ga0496107_0000327
2137 Ga0496107_0014384
2138 Ga0496107_0017289
2139 Ga0496107_0028396
2140 Ga0496107_0030947
2141 Ga0496107_0053577
2142 Ga0496107_0078701
2143 Ga0496107_0091247
2144 Ga0496107_0097708
2145 Ga0496108_0000347
2146 Ga0496108_0000902
2147 Ga0496108_0001376
2148 Ga0496108_0005173
2149 Ga0496108_0013218
2150 Ga0496108_0045907
2151 Ga0496108_0098577
2152 Ga0496108_0119819
2153 Ga0496108_0161783
2154 Ga0496109_0000224
2155 Ga0496109_0000925
2156 Ga0496109_0005863
2157 Ga0496109_0008656
2158 Ga0496109_0025751
2159 Ga0496109_0031922
2160 Ga0496109_0118634
2161 Ga0496109_0346498
2162 Ga0496110_0010097
2163 Ga0496110_0029719
2164 Ga0496110_0035608
2165 Ga0496110_0055430
2166 Ga0496110_0059966
2167 Ga0496110_0074428
2168 Ga0496110_0136555
2169 Ga0496110_0250584
2170 Ga0496111_0009006
2171 Ga0496111_0021601
2172 Ga0496111_0031448
2173 Ga0496111_0069902
2174 Ga0496111_0070351
2175 Ga0496111_0179786
2176 Ga0496112_0002281
2177 Ga0496112_0002294
2178 Ga0496112_0005249
2179 Ga0496112_0006289
2180 Ga0496112_0044183
2181 Ga0496112_0133343
2182 Ga0496112_0134740
2183 Ga0496112_0188480
2184 Ga0496112_0209861
2185 Ga0496112_0266687
2186 Ga0496113_0018979
2187 Ga0496113_0022653
2188 Ga0496113_0025192
2189 Ga0496113_0038764
2190 Ga0496113_0058625
2191 Ga0496113_0083590
2192 Ga0496114_0038158
2193 Ga0496114_0054406
2194 Ga0496115_0003837
2195 Ga0496115_0011128
2196 Ga0496115_0018524
2197 Ga0496115_0022496
2198 Ga0496116_0013402
2199 Ga0496116_0036936
2200 Ga0496117_0008437
2201 Ga0496119_0000709
2202 Ga0496121_0000997
2203 Ga0496122_0002462
2204 Ga0496122_0014017
2205 Ga0496122_0073705
2206 Ga0496123_0058162
2207 Ga0496123_0167756
2208 Ga0496124_0037793
2209 Ga0496124_0046604
2210 Ga0496125_0001108
2211 Ga0496125_0012656
2212 Ga0496125_0039327
2213 Ga0496126_0023175
2214 Ga0495678_041432
2215 Ga0501031_0020670
2216 Ga0501031_0058475
2217 Ga0501032_0000303
2218 Ga0501032_0087939
2219 Ga0501032_0123386
2220 Ga0501033_0000881
2221 Ga0501033_0005988
2222 Ga0501034_0000250
2223 Ga0501034_0111025
2224 Ga0501034_0118961
2225 Ga0501034_0222330
2226 Ga0501034_0394862
2227 Ga0501036_0000098
2228 Ga0501036_0133576
2229 Ga0501037_0000092
2230 Ga0501037_0063493
2231 Ga0501037_0069341
2232 Ga0501038_0002041
2233 Ga0501038_0050472
2234 Ga0501038_0052419
2235 Ga0501038_0151076
2236 Ga0501039_0000085
2237 Ga0501039_0058135
2238 Ga0501039_0154908
2239 Ga0501040_0010464
2240 Ga0501040_0188160
2241 Ga0501041_0016047
2242 Ga0501041_0016276
2243 Ga0501042_0020429
2244 Ga0501043_0000460
2245 Ga0501043_0077737
2246 Ga0501043_0192161
2247 Ga0501046_0000033
2248 Ga0501046_0000624
2249 Ga0501046_0045146
2250 Ga0501046_0052907
2251 Ga0501046_0084981
2252 Ga0501046_0143179
2253 Ga0501047_0000022
2254 Ga0501047_0061466
2255 Ga0501047_0066110
2256 Ga0501047_0082865
2257 Ga0501047_0085660
2258 Ga0501047_0176737
2259 Ga0501047_0268507
2260 Ga0501048_0000292
2261 Ga0501048_0173710
2262 Ga0501048_0178656
2263 Ga0501067_0003139
2264 Ga0501067_0029418
2265 Ga0501067_0084919
2266 Ga0501068_0003364
2267 Ga0501068_0054371
2268 Ga0501068_0151515
2269 Ga0501070_0014140
2270 Ga0501070_0020252
2271 Ga0501070_0049761
2272 Ga0501070_0055000
2273 Ga0501070_0173269
2274 Ga0501071_0045980
2275 Ga0501071_0086331
2276 Ga0501071_0099093
2277 Ga0501072_0027316
2278 Ga0501072_0054742
2279 Ga0501072_0111234
2280 Ga0501073_0000109
2281 Ga0501073_0023706
2282 Ga0501073_0044455
2283 Ga0501073_0046982
2284 Ga0501073_0062686
2285 Ga0501074_0000250
2286 Ga0501074_0013873
2287 Ga0501074_0049283
2288 Ga0501074_0053274
2289 Ga0501074_0080618
2290 Ga0501075_0039262
2291 Ga0501076_0091458
2292 Ga0501076_0175704
2293 Ga0501077_0056525
2294 Ga0501077_0197258
2295 Ga0501223_000086
2296 Ga0501225_0000034
2297 Ga0501225_0004061
2298 Ga0501079_0005234
2299 Ga0501080_0006971
2300 Ga0501080_0011399
2301 Ga0501080_0025088
2302 Ga0501080_0113678
2303 Ga0501080_0133642
2304 Ga0501080_0261239
2305 Ga0501080_0317699
2306 Ga0501081_0008911
2307 Ga0501081_0055428
2308 Ga0501081_0100093
2309 Ga0501081_0103323
2310 Ga0501083_0000618
2311 Ga0501083_0003365
2312 Ga0501083_0021302
2313 Ga0501083_0063674
2314 Ga0501083_0143314
2315 Ga0501035_0001489
2316 Ga0501035_0021051
2317 Ga0501035_0054468
2318 Ga0501044_0000072
2319 Ga0501044_0024914
2320 Ga0501044_0043948
2321 Ga0501044_0064936
2322 Ga0501044_0257729
2323 Ga0501045_0041254
2324 Ga0501045_0081425
2325 nmdc:mga03n38_55789_c1
2326 nmdc:mga03n38_74979_c1
2327 nmdc:mga00v17_268007_c1
2328 nmdc:mga0yw44_127155_c1
2329 nmdc:mga0yw44_58568_c1
2330 nmdc:mga0yw44_86222_c1
2331 nmdc:mga06z11_191_c1
2332 nmdc:mga04h51_1507_c1
2333 nmdc:mga04h51_22073_c1
2334 nmdc:mga05p37_193198_c1
2335 nmdc:mga05p37_27999_c1
2336 nmdc:mga09592_14616_c1
2337 nmdc:mga0qj67_350211_c1
2338 nmdc:mga0qj67_392_c1
2339 nmdc:mga06r32_51949_c1
2340 nmdc:mga06r32_64244_c1
2341 nmdc:mga08y16_14375_c1
2342 nmdc:mga08y16_64084_c1
2343 nmdc:mga08y16_66523_c1
2344 nmdc:mga0n895_111546_c1
2345 nmdc:mga0n895_15793_c1
2346 nmdc:mga0n895_311322_c1
2347 nmdc:mga0n895_552_c1
2348 nmdc:mga0n895_84596_c1
2349 nmdc:mga0rr50_157675_c1
2350 nmdc:mga0rr50_33063_c1
2351 nmdc:mga08x19_40687_c1
2352 nmdc:mga0a205_2568_c1
2353 nmdc:mga0sz30_21157_c1
2354 Ga0495601_0000016
2355 Ga0495601_0002664
2356 Ga0495601_0007172
2357 Ga0495601_0011070
2358 Ga0495601_0053768
2359 Ga0495601_0054340
2360 Ga0495601_0057524
2361 Ga0495612_0000041
2362 Ga0495612_0003354
2363 Ga0495612_0010956
2364 Ga0495612_0015875
2365 Ga0495612_0019036
2366 Ga0495612_0036858
2367 Ga0495595_0000048
2368 Ga0495595_0001522
2369 Ga0495595_0008969
2370 Ga0495595_0010099
2371 Ga0495619_0000050
2372 Ga0495619_0000518
2373 Ga0495619_0001220
2374 Ga0495619_0001244
2375 Ga0495619_0008836
2376 Ga0495619_0025575
2377 Ga0495619_0029292
2378 Ga0495619_0093107
2379 Ga0500647_0002985
2380 Ga0500651_0039297
2381 Ga0500651_0059817
2382 Ga0500566_0007133
2383 Ga0500641_0024126
2384 Ga0500556_0001106
2385 Ga0500593_043998
2386 Ga0500618_004828
2387 Ga0500618_010582
2388 Ga0500559_0000398
2389 Ga0500559_0000465
2390 Ga0500568_0005085
2391 Ga0500622_0009386
2392 Ga0500624_004059
2393 Ga0500637_0037235
2394 Ga0500645_001143
2395 Ga0501084_0001321
2396 Ga0501084_0012745
2397 Ga0501084_0013172
2398 Ga0501084_0014344
2399 Ga0501082_0007370
2400 Ga0501082_0010751
2401 Ga0501082_0033077
2402 Ga0501082_0042143
2403 Ga0501082_0056526
2404 Ga0501082_0081619
2405 Ga0501082_0094166
2406 Ga0501082_0110314
2407 Ga0501082_0168915
2408 2512038276
2409 2512642554
2410 2523103374
2411 2523468637
2412 2599102682
2413 2643757928
2414 2643884552
2415 2644290964
2416 2644351387
2417 2644549064
2418 2644553206
2419 2739349867
2420 2778125464
2421 2809063335
2422 2809079229
2423 2809083397
2424 2846955403
2425 2848861046
2426 2880520605
2427 2897808820
2428 2919073820
2429 2919452663
2430 2928974528
2431 2941488062
2432 2977243451
2433 8016557647
2434 8054002866

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01494

FAD_binding_3

FAD binding domain

67

409

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k22-assembly1.cif.gz_B-2 structure of the c-terminal truncated form of e.coli c5-hydroxylase ubii involved in ubiquinone (q8) biosynthesis 0.8817 8 364
7mwa-assembly1.cif.gz_A crystal structure of 2-octaprenyl-6-methoxyphenol hydroxylase ubih from acinetobacter baumannii, apoenzyme 0.8744 10 377
4k22-assembly1.cif.gz_B-2 structure of the c-terminal truncated form of e.coli c5-hydroxylase ubii involved in ubiquinone (q8) biosynthesis 0.8699 8 364
4k22-assembly1.cif.gz_A-2 structure of the c-terminal truncated form of e.coli c5-hydroxylase ubii involved in ubiquinone (q8) biosynthesis 0.8697 8 367
7mwa-assembly1.cif.gz_B-2 crystal structure of 2-octaprenyl-6-methoxyphenol hydroxylase ubih from acinetobacter baumannii, apoenzyme 0.8678 8 377
ID Description Score Start End Superfamily
af_K7LAM2_371_510_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9499 266 399 3.50.50.60
af_Q54EN1_358_493_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9477 266 396 3.50.50.60
af_Q5AHZ4_349_480_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.945 274 396 3.50.50.60
4k22B02 Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2;D-Amino Acid Oxidase, subunit A, domain 2 0.9371 192 275 3.30.9.10
af_Q8R1S0_347_476_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9142 274 395 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A1S6XS37-F1-model_v4 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-) 0.9849 65 410 GO:0004497
GO:0006744
GO:0016705
GO:0071949
AF-A0A0X6ZUC7-F1-model_v4 2-octaprenyl-6-methoxyphenyl hydroxylase 0.9814 8 410 GO:0004497
GO:0006744
GO:0016705
GO:0071949
AF-A0A353GDC4-F1-model_v4 Ubiquinone biosynthesis hydroxylase 0.9794 8 410 GO:0004497
GO:0006744
GO:0016705
GO:0071949
AF-A0A561QIG5-F1-model_v4 2-octaprenyl-6-methoxyphenol hydroxylase 0.9793 8 410 GO:0004497
GO:0006744
GO:0016705
GO:0071949
AF-A0A2A6L0G5-F1-model_v4 deleted 0.979 8 410

Map