F491908
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1224 | 465 | 2448 | 326 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2675902999|2676203048 |
| Length | 382 |
| Sequence | GQEPTPPRQRRPPPDAPTGGLTSGDLTPAGLAPAGLAPAGLAGASAGPGSEIVIEAERVRKTFVQRRRIAGQRLRRERIDVHAVRDVSFTVRAGEIIGYLGPNGAGKSTTIKMLIGVLTPSAGRLRVAGLDPAHQRIALARRIGVVFGQRSTLWWDLPLRDSFELVRHLYRVPPGQFRANLARFVEMLDLGPFLDTPVRQLSLGQRMRGDLTAAFLHDPSIVYLDEPTIGLDVVSKAAVRAFLAEKNREQATTIMLTTHDTADIEQLCQRVLVIDHGRLGFDGDLATLRERLGGERTLVVDLAAPMPPLTVATPGAHVIRVDGPRQWLAFPARASAAPLVAEIAARYPLVDLAIREPPIEDVITRLYTTGPEPRPAAEPAAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 121 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 189 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 190 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 191 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 192 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 193 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 194 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 195 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 200 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 204 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 206 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 218 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 219 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 235 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 242 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 243 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 244 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 245 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 246 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 247 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 251 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 252 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 259 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 260 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 261 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 262 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 263 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 266 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 327 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 328 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 329 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 330 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 331 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 364 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 366 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 383 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 384 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 385 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 387 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 388 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 390 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 396 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 397 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 398 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 399 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 400 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 401 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 402 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 403 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 404 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 405 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 406 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 407 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 408 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 409 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 410 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 411 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 412 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 413 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 414 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 415 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 416 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 417 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 418 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 419 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 420 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 421 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 422 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 423 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 424 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 425 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 426 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 427 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 428 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 429 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 430 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 431 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 432 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 433 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 434 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 435 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 436 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 437 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 438 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 439 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 440 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 441 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 442 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 443 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 444 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 445 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 446 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 447 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 448 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 449 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 450 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 451 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 452 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 453 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 454 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 455 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 456 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 457 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 458 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 459 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 460 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 461 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 462 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 463 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 464 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 465 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.87 |
| Metatranscriptomes | 0.25 |
| Isolates | 5.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.02 |
| Nodule | 0.74 |
| Rhizoplane | 3.59 |
| Rhizosphere | 82.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10030120 | 3300001979 | Bacteria | 1772 |
| 2 | JGI25406J46586_10008109 | 3300003203 | Bacteria | 4769 |
| 3 | Ga0006562J51391_1109263 | 3300003578 | Bacteria | 8282 |
| 4 | Ga0065704_10075364 | 3300005289 | Bacteria | 5634 |
| 5 | Ga0070658_10002128 | 3300005327 | Bacteria | 16625 |
| 6 | Ga0070658_10003610 | 3300005327 | Bacteria | 12676 |
| 7 | Ga0070676_10032042 | 3300005328 | Bacteria | 3008 |
| 8 | Ga0070676_10170399 | 3300005328 | Bacteria | 1408 |
| 9 | Ga0070683_100004647 | 3300005329 | Bacteria | 11347 |
| 10 | Ga0070683_100098404 | 3300005329 | Bacteria | 2753 |
| 11 | Ga0070670_100301114 | 3300005331 | Bacteria | 1402 |
| 12 | Ga0068869_100013851 | 3300005334 | Bacteria | 5376 |
| 13 | Ga0068869_100021890 | 3300005334 | Bacteria | 4400 |
| 14 | Ga0068869_100023099 | 3300005334 | Bacteria | 4291 |
| 15 | Ga0068869_100248774 | 3300005334 | Bacteria | 1419 |
| 16 | Ga0068869_100318843 | 3300005334 | Bacteria | 1260 |
| 17 | Ga0070680_100023832 | 3300005336 | Bacteria | 4885 |
| 18 | Ga0070680_100274494 | 3300005336 | Bacteria | 1428 |
| 19 | Ga0070682_100006150 | 3300005337 | Bacteria | 6723 |
| 20 | Ga0068868_100006011 | 3300005338 | Bacteria | 8572 |
| 21 | Ga0068868_100077093 | 3300005338 | Bacteria | 2666 |
| 22 | Ga0068868_100277931 | 3300005338 | Bacteria | 1416 |
| 23 | Ga0070660_100029985 | 3300005339 | Bacteria | 4078 |
| 24 | Ga0070660_100064245 | 3300005339 | Bacteria | 2855 |
| 25 | Ga0070660_100084966 | 3300005339 | Bacteria | 2488 |
| 26 | Ga0070691_10003836 | 3300005341 | Bacteria | 6790 |
| 27 | Ga0070691_10010580 | 3300005341 | Bacteria | 4213 |
| 28 | Ga0070661_100085500 | 3300005344 | Bacteria | 2331 |
| 29 | Ga0070661_100176452 | 3300005344 | Bacteria | 1624 |
| 30 | Ga0070692_10021226 | 3300005345 | Bacteria | 3157 |
| 31 | Ga0070692_10029569 | 3300005345 | Bacteria | 2732 |
| 32 | Ga0070668_100020231 | 3300005347 | Bacteria | 5021 |
| 33 | Ga0070668_100090532 | 3300005347 | Bacteria | 2410 |
| 34 | Ga0070669_100025062 | 3300005353 | Bacteria | 4282 |
| 35 | Ga0070675_100004065 | 3300005354 | Bacteria | 11105 |
| 36 | Ga0070671_100001993 | 3300005355 | Bacteria | 15683 |
| 37 | Ga0070688_100037812 | 3300005365 | Bacteria | 2943 |
| 38 | Ga0070659_100006159 | 3300005366 | Bacteria | 8659 |
| 39 | Ga0070659_100023614 | 3300005366 | Bacteria | 4708 |
| 40 | Ga0070667_100338358 | 3300005367 | Bacteria | 1360 |
| 41 | Ga0070714_100003209 | 3300005435 | Bacteria | 12171 |
| 42 | Ga0070714_100016998 | 3300005435 | Bacteria | 5886 |
| 43 | Ga0070714_100021665 | 3300005435 | Bacteria | 5260 |
| 44 | Ga0070714_100332374 | 3300005435 | Bacteria | 1423 |
| 45 | Ga0070714_100443245 | 3300005435 | Bacteria | 1233 |
| 46 | Ga0070713_100143230 | 3300005436 | Bacteria | 2119 |
| 47 | Ga0070710_10000775 | 3300005437 | Bacteria | 15263 |
| 48 | Ga0070701_10027921 | 3300005438 | Bacteria | 2770 |
| 49 | Ga0070711_100083947 | 3300005439 | Bacteria | 2278 |
| 50 | Ga0070705_100011854 | 3300005440 | Bacteria | 4414 |
| 51 | Ga0070705_100041044 | 3300005440 | Bacteria | 2635 |
| 52 | Ga0070705_100041631 | 3300005440 | Bacteria | 2621 |
| 53 | Ga0070700_100012214 | 3300005441 | Bacteria | 4784 |
| 54 | Ga0070708_100063505 | 3300005445 | Bacteria | 3306 |
| 55 | Ga0070708_100086149 | 3300005445 | Bacteria | 2852 |
| 56 | Ga0070708_100092416 | 3300005445 | Bacteria | 2756 |
| 57 | Ga0070708_100206017 | 3300005445 | Bacteria | 1842 |
| 58 | Ga0070708_100239624 | 3300005445 | Bacteria | 1703 |
| 59 | Ga0070708_100400670 | 3300005445 | Bacteria | 1294 |
| 60 | Ga0070663_100017361 | 3300005455 | Bacteria | 4696 |
| 61 | Ga0070663_100031316 | 3300005455 | Bacteria | 3655 |
| 62 | Ga0070663_100208902 | 3300005455 | Bacteria | 1528 |
| 63 | Ga0070663_100310180 | 3300005455 | Bacteria | 1266 |
| 64 | Ga0070678_100001267 | 3300005456 | Bacteria | 13414 |
| 65 | Ga0070678_100068564 | 3300005456 | Bacteria | 2645 |
| 66 | Ga0070678_100183110 | 3300005456 | Bacteria | 1716 |
| 67 | Ga0070681_10051198 | 3300005458 | Bacteria | 4119 |
| 68 | Ga0070681_10052482 | 3300005458 | Bacteria | 4066 |
| 69 | Ga0070681_10108742 | 3300005458 | Bacteria | 2713 |
| 70 | Ga0070681_10381085 | 3300005458 | Bacteria | 1321 |
| 71 | Ga0070685_10251935 | 3300005466 | Bacteria | 1170 |
| 72 | Ga0070706_100092923 | 3300005467 | Bacteria | 2799 |
| 73 | Ga0070707_100024129 | 3300005468 | Bacteria | 5756 |
| 74 | Ga0070707_100047075 | 3300005468 | Bacteria | 4127 |
| 75 | Ga0070707_100093846 | 3300005468 | Bacteria | 2905 |
| 76 | Ga0070707_100099103 | 3300005468 | Bacteria | 2823 |
| 77 | Ga0070707_100151759 | 3300005468 | Bacteria | 2256 |
| 78 | Ga0070707_100265591 | 3300005468 | Bacteria | 1669 |
| 79 | Ga0070698_100001988 | 3300005471 | Bacteria | 22693 |
| 80 | Ga0070698_100014445 | 3300005471 | Bacteria | 8340 |
| 81 | Ga0070698_100019295 | 3300005471 | Bacteria | 7161 |
| 82 | Ga0070698_100134247 | 3300005471 | Bacteria | 2429 |
| 83 | Ga0070698_100256648 | 3300005471 | Bacteria | 1680 |
| 84 | Ga0070699_100000014 | 3300005518 | Bacteria | 218133 |
| 85 | Ga0070699_100009053 | 3300005518 | Bacteria | 8626 |
| 86 | Ga0070699_100011634 | 3300005518 | Bacteria | 7595 |
| 87 | Ga0070699_100059992 | 3300005518 | Bacteria | 3295 |
| 88 | Ga0070699_100107366 | 3300005518 | Bacteria | 2449 |
| 89 | Ga0070699_100380682 | 3300005518 | Bacteria | 1274 |
| 90 | Ga0070679_100020925 | 3300005530 | Bacteria | 6382 |
| 91 | Ga0070679_100047023 | 3300005530 | Bacteria | 4302 |
| 92 | Ga0070679_100065358 | 3300005530 | Bacteria | 3626 |
| 93 | Ga0070679_100124012 | 3300005530 | Bacteria | 2566 |
| 94 | Ga0070679_100318480 | 3300005530 | Bacteria | 1505 |
| 95 | Ga0070679_100346854 | 3300005530 | Bacteria | 1433 |
| 96 | Ga0070684_100002845 | 3300005535 | Bacteria | 12858 |
| 97 | Ga0070684_100118682 | 3300005535 | Bacteria | 2378 |
| 98 | Ga0070684_100142336 | 3300005535 | Bacteria | 2169 |
| 99 | Ga0070684_100184394 | 3300005535 | Bacteria | 1898 |
| 100 | Ga0070697_100192092 | 3300005536 | Bacteria | 1733 |
| 101 | Ga0068853_100017236 | 3300005539 | Bacteria | 5962 |
| 102 | Ga0068853_100061176 | 3300005539 | Bacteria | 3256 |
| 103 | Ga0068853_100098148 | 3300005539 | Bacteria | 2587 |
| 104 | Ga0068853_100125058 | 3300005539 | Bacteria | 2297 |
| 105 | Ga0070686_100091295 | 3300005544 | Bacteria | 2037 |
| 106 | Ga0070695_100016847 | 3300005545 | Bacteria | 4429 |
| 107 | Ga0070696_100168747 | 3300005546 | Bacteria | 1617 |
| 108 | Ga0070696_100231302 | 3300005546 | Bacteria | 1391 |
| 109 | Ga0070693_100002045 | 3300005547 | Bacteria | 9232 |
| 110 | Ga0070665_100001502 | 3300005548 | Bacteria | 27146 |
| 111 | Ga0070665_100025806 | 3300005548 | Bacteria | 5918 |
| 112 | Ga0070665_100375697 | 3300005548 | Bacteria | 1428 |
| 113 | Ga0070704_100116968 | 3300005549 | Bacteria | 2039 |
| 114 | Ga0070704_100175124 | 3300005549 | Bacteria | 1710 |
| 115 | Ga0068855_100002943 | 3300005563 | Bacteria | 20810 |
| 116 | Ga0068855_100003272 | 3300005563 | Bacteria | 19828 |
| 117 | Ga0068855_100011259 | 3300005563 | Bacteria | 10803 |
| 118 | Ga0068855_100028270 | 3300005563 | Bacteria | 6706 |
| 119 | Ga0068855_100261862 | 3300005563 | Bacteria | 1926 |
| 120 | Ga0070664_100003004 | 3300005564 | Bacteria | 13641 |
| 121 | Ga0070664_100163364 | 3300005564 | Bacteria | 1971 |
| 122 | Ga0068857_100005857 | 3300005577 | Bacteria | 10494 |
| 123 | Ga0068857_100016349 | 3300005577 | Bacteria | 6500 |
| 124 | Ga0068857_100082226 | 3300005577 | Bacteria | 2876 |
| 125 | Ga0068857_100150512 | 3300005577 | Bacteria | 2108 |
| 126 | Ga0068857_100168509 | 3300005577 | Bacteria | 1990 |
| 127 | Ga0068854_100000001 | 3300005578 | Bacteria | 608908 |
| 128 | Ga0068854_100006613 | 3300005578 | Bacteria | 7385 |
| 129 | Ga0068856_100032941 | 3300005614 | Bacteria | 5075 |
| 130 | Ga0068856_100050737 | 3300005614 | Bacteria | 4090 |
| 131 | Ga0068856_100058806 | 3300005614 | Bacteria | 3797 |
| 132 | Ga0068856_100251915 | 3300005614 | Bacteria | 1781 |
| 133 | Ga0068856_100356445 | 3300005614 | Bacteria | 1481 |
| 134 | Ga0070702_100002421 | 3300005615 | Bacteria | 8041 |
| 135 | Ga0068852_100041338 | 3300005616 | Bacteria | 3895 |
| 136 | Ga0068852_100075664 | 3300005616 | Bacteria | 2970 |
| 137 | Ga0068852_100093961 | 3300005616 | Bacteria | 2689 |
| 138 | Ga0068859_100000054 | 3300005617 | Bacteria | 123173 |
| 139 | Ga0068859_100142290 | 3300005617 | Bacteria | 2472 |
| 140 | Ga0068859_100157915 | 3300005617 | Bacteria | 2346 |
| 141 | Ga0068864_100010703 | 3300005618 | Bacteria | 7582 |
| 142 | Ga0068864_100038517 | 3300005618 | Bacteria | 4084 |
| 143 | Ga0068864_100180367 | 3300005618 | Bacteria | 1930 |
| 144 | Ga0068864_100198574 | 3300005618 | Bacteria | 1842 |
| 145 | Ga0068864_100384341 | 3300005618 | Bacteria | 1331 |
| 146 | Ga0068861_100083856 | 3300005719 | Bacteria | 2501 |
| 147 | Ga0068861_100282245 | 3300005719 | Bacteria | 1430 |
| 148 | Ga0068870_10000527 | 3300005840 | Bacteria | 14400 |
| 149 | Ga0068870_10075996 | 3300005840 | Bacteria | 1843 |
| 150 | Ga0068863_100002724 | 3300005841 | Bacteria | 17464 |
| 151 | Ga0068863_100016498 | 3300005841 | Bacteria | 7084 |
| 152 | Ga0068863_100073397 | 3300005841 | Bacteria | 3237 |
| 153 | Ga0068858_100069663 | 3300005842 | Bacteria | 3260 |
| 154 | Ga0068858_100264415 | 3300005842 | Bacteria | 1636 |
| 155 | Ga0068858_100314483 | 3300005842 | Bacteria | 1496 |
| 156 | Ga0068858_100347344 | 3300005842 | Bacteria | 1421 |
| 157 | Ga0068860_100100556 | 3300005843 | Bacteria | 2759 |
| 158 | Ga0068862_100000037 | 3300005844 | Bacteria | 172796 |
| 159 | Ga0068862_100016913 | 3300005844 | Bacteria | 6070 |
| 160 | Ga0068862_100115331 | 3300005844 | Bacteria | 2362 |
| 161 | Ga0081455_10002734 | 3300005937 | Bacteria | 20806 |
| 162 | Ga0081455_10009950 | 3300005937 | Bacteria | 9725 |
| 163 | Ga0081455_10082302 | 3300005937 | Bacteria | 2633 |
| 164 | Ga0081538_10134667 | 3300005981 | Bacteria | 1153 |
| 165 | Ga0081539_10000364 | 3300005985 | Bacteria | 99066 |
| 166 | Ga0081539_10000447 | 3300005985 | Bacteria | 87935 |
| 167 | Ga0081539_10004113 | 3300005985 | Bacteria | 16590 |
| 168 | Ga0075365_10059063 | 3300006038 | Bacteria | 2555 |
| 169 | Ga0075365_10099899 | 3300006038 | Bacteria | 1986 |
| 170 | Ga0075365_10170853 | 3300006038 | Bacteria | 1517 |
| 171 | Ga0075365_10217726 | 3300006038 | Bacteria | 1339 |
| 172 | Ga0075368_10001870 | 3300006042 | Bacteria | 6761 |
| 173 | Ga0075363_100004732 | 3300006048 | Bacteria | 5994 |
| 174 | Ga0075363_100049348 | 3300006048 | Bacteria | 2241 |
| 175 | Ga0075364_10013390 | 3300006051 | Bacteria | 5040 |
| 176 | Ga0075364_10116147 | 3300006051 | Bacteria | 1789 |
| 177 | Ga0075432_10057297 | 3300006058 | Bacteria | 1382 |
| 178 | Ga0070716_100005011 | 3300006173 | Bacteria | 6385 |
| 179 | Ga0070716_100239250 | 3300006173 | Bacteria | 1230 |
| 180 | Ga0075362_10024379 | 3300006177 | Bacteria | 2566 |
| 181 | Ga0097621_100144738 | 3300006237 | Bacteria | 2034 |
| 182 | Ga0068871_100025364 | 3300006358 | Bacteria | 4611 |
| 183 | Ga0075428_100000006 | 3300006844 | Bacteria | 288592 |
| 184 | Ga0075428_100001979 | 3300006844 | Bacteria | 22079 |
| 185 | Ga0075428_100009926 | 3300006844 | Bacteria | 10575 |
| 186 | Ga0075428_100028992 | 3300006844 | Bacteria | 6125 |
| 187 | Ga0075428_100050574 | 3300006844 | Bacteria | 4557 |
| 188 | Ga0075428_100113278 | 3300006844 | Bacteria | 2955 |
| 189 | Ga0075428_100193527 | 3300006844 | Bacteria | 2199 |
| 190 | Ga0075428_100229677 | 3300006844 | Bacteria | 2002 |
| 191 | Ga0075428_100317267 | 3300006844 | Bacteria | 1675 |
| 192 | Ga0075430_100001233 | 3300006846 | Bacteria | 20587 |
| 193 | Ga0075430_100001764 | 3300006846 | Bacteria | 17686 |
| 194 | Ga0075430_100018773 | 3300006846 | Bacteria | 5885 |
| 195 | Ga0075430_100022712 | 3300006846 | Bacteria | 5336 |
| 196 | Ga0075430_100034453 | 3300006846 | Bacteria | 4297 |
| 197 | Ga0075430_100364673 | 3300006846 | Bacteria | 1193 |
| 198 | Ga0075431_100003806 | 3300006847 | Bacteria | 14671 |
| 199 | Ga0075431_100006015 | 3300006847 | Bacteria | 12023 |
| 200 | Ga0075431_100018026 | 3300006847 | Bacteria | 7182 |
| 201 | Ga0075431_100031642 | 3300006847 | Bacteria | 5449 |
| 202 | Ga0075431_100032158 | 3300006847 | Bacteria | 5407 |
| 203 | Ga0075431_100093757 | 3300006847 | Bacteria | 3098 |
| 204 | Ga0075431_100153717 | 3300006847 | Bacteria | 2368 |
| 205 | Ga0075433_10000529 | 3300006852 | Bacteria | 25025 |
| 206 | Ga0075433_10003481 | 3300006852 | Bacteria | 12160 |
| 207 | Ga0075433_10005330 | 3300006852 | Bacteria | 10090 |
| 208 | Ga0075433_10016491 | 3300006852 | Bacteria | 6092 |
| 209 | Ga0075433_10098793 | 3300006852 | Bacteria | 2584 |
| 210 | Ga0075433_10099415 | 3300006852 | Bacteria | 2575 |
| 211 | Ga0075434_100008277 | 3300006871 | Bacteria | 9660 |
| 212 | Ga0075434_100021611 | 3300006871 | Bacteria | 6257 |
| 213 | Ga0075434_100089201 | 3300006871 | Bacteria | 3085 |
| 214 | Ga0075434_100125364 | 3300006871 | Bacteria | 2585 |
| 215 | Ga0075434_100176048 | 3300006871 | Bacteria | 2159 |
| 216 | Ga0075429_100001818 | 3300006880 | Bacteria | 17659 |
| 217 | Ga0075429_100008473 | 3300006880 | Bacteria | 8952 |
| 218 | Ga0075429_100008552 | 3300006880 | Bacteria | 8904 |
| 219 | Ga0075429_100010603 | 3300006880 | Bacteria | 7973 |
| 220 | Ga0075429_100036712 | 3300006880 | Bacteria | 4264 |
| 221 | Ga0075429_100061359 | 3300006880 | Bacteria | 3275 |
| 222 | Ga0075429_100137690 | 3300006880 | Bacteria | 2137 |
| 223 | Ga0075429_100226856 | 3300006880 | Bacteria | 1636 |
| 224 | Ga0075429_100399310 | 3300006880 | Bacteria | 1204 |
| 225 | Ga0075429_100438320 | 3300006880 | Bacteria | 1145 |
| 226 | Ga0068865_100029500 | 3300006881 | Bacteria | 3641 |
| 227 | Ga0068865_100406103 | 3300006881 | Bacteria | 1117 |
| 228 | Ga0075436_100000719 | 3300006914 | Bacteria | 21903 |
| 229 | Ga0075436_100026256 | 3300006914 | Bacteria | 4009 |
| 230 | Ga0075436_100122163 | 3300006914 | Bacteria | 1823 |
| 231 | Ga0097620_100000054 | 3300006931 | Bacteria | 123173 |
| 232 | Ga0097620_100142287 | 3300006931 | Bacteria | 2472 |
| 233 | Ga0097620_100157917 | 3300006931 | Bacteria | 2346 |
| 234 | Ga0075435_100001179 | 3300007076 | Bacteria | 16688 |
| 235 | Ga0075435_100013874 | 3300007076 | Bacteria | 6008 |
| 236 | Ga0075435_100034172 | 3300007076 | Bacteria | 4026 |
| 237 | Ga0075435_100047646 | 3300007076 | Bacteria | 3441 |
| 238 | Ga0075435_100056230 | 3300007076 | Bacteria | 3180 |
| 239 | Ga0075435_100191651 | 3300007076 | Bacteria | 1730 |
| 240 | Ga0075435_100207584 | 3300007076 | Bacteria | 1661 |
| 241 | Ga0075435_100261610 | 3300007076 | Bacteria | 1474 |
| 242 | Ga0105240_10005833 | 3300009093 | Bacteria | 18256 |
| 243 | Ga0105240_10015490 | 3300009093 | Bacteria | 10364 |
| 244 | Ga0105240_10069876 | 3300009093 | Bacteria | 4346 |
| 245 | Ga0105240_10165169 | 3300009093 | Bacteria | 2626 |
| 246 | Ga0111539_10022401 | 3300009094 | Bacteria | 7764 |
| 247 | Ga0111539_10040672 | 3300009094 | Bacteria | 5594 |
| 248 | Ga0111539_10062336 | 3300009094 | Bacteria | 4415 |
| 249 | Ga0111539_10064998 | 3300009094 | Bacteria | 4314 |
| 250 | Ga0111539_10089831 | 3300009094 | Bacteria | 3610 |
| 251 | Ga0111539_10157350 | 3300009094 | Bacteria | 2659 |
| 252 | Ga0111539_10254320 | 3300009094 | Bacteria | 2046 |
| 253 | Ga0111539_10572424 | 3300009094 | Bacteria | 1316 |
| 254 | Ga0111539_10830668 | 3300009094 | Bacteria | 1075 |
| 255 | Ga0105245_10004191 | 3300009098 | Bacteria | 12802 |
| 256 | Ga0105245_10009816 | 3300009098 | Bacteria | 8341 |
| 257 | Ga0105245_10034197 | 3300009098 | Bacteria | 4507 |
| 258 | Ga0105245_10312155 | 3300009098 | Bacteria | 1546 |
| 259 | Ga0105245_10460145 | 3300009098 | Bacteria | 1282 |
| 260 | Ga0114129_10000004 | 3300009147 | Bacteria | 160944 |
| 261 | Ga0114129_10000050 | 3300009147 | Bacteria | 102066 |
| 262 | Ga0114129_10002267 | 3300009147 | Bacteria | 26615 |
| 263 | Ga0114129_10004085 | 3300009147 | Bacteria | 20622 |
| 264 | Ga0114129_10005032 | 3300009147 | Bacteria | 18605 |
| 265 | Ga0114129_10054859 | 3300009147 | Bacteria | 5586 |
| 266 | Ga0114129_10077578 | 3300009147 | Bacteria | 4620 |
| 267 | Ga0114129_10089605 | 3300009147 | Bacteria | 4264 |
| 268 | Ga0114129_10132360 | 3300009147 | Bacteria | 3424 |
| 269 | Ga0114129_10139045 | 3300009147 | Bacteria | 3330 |
| 270 | Ga0114129_10154146 | 3300009147 | Bacteria | 3143 |
| 271 | Ga0114129_10227573 | 3300009147 | Bacteria | 2512 |
| 272 | Ga0114129_10270569 | 3300009147 | Bacteria | 2273 |
| 273 | Ga0114129_10378608 | 3300009147 | Bacteria | 1870 |
| 274 | Ga0114129_10903119 | 3300009147 | Bacteria | 1119 |
| 275 | Ga0105243_10142023 | 3300009148 | Bacteria | 2050 |
| 276 | Ga0105243_10609529 | 3300009148 | Bacteria | 1052 |
| 277 | Ga0105241_10002402 | 3300009174 | Bacteria | 14064 |
| 278 | Ga0105241_10006773 | 3300009174 | Bacteria | 8432 |
| 279 | Ga0105242_10065950 | 3300009176 | Bacteria | 2989 |
| 280 | Ga0105242_10101799 | 3300009176 | Bacteria | 2435 |
| 281 | Ga0105248_10000018 | 3300009177 | Bacteria | 294894 |
| 282 | Ga0105248_10064419 | 3300009177 | Bacteria | 4115 |
| 283 | Ga0105248_10099938 | 3300009177 | Bacteria | 3269 |
| 284 | Ga0105248_10227451 | 3300009177 | Bacteria | 2100 |
| 285 | Ga0105248_10243325 | 3300009177 | Bacteria | 2025 |
| 286 | Ga0105237_10139516 | 3300009545 | Bacteria | 2418 |
| 287 | Ga0105237_10338072 | 3300009545 | Bacteria | 1510 |
| 288 | Ga0105237_10437115 | 3300009545 | Bacteria | 1314 |
| 289 | Ga0105238_10037303 | 3300009551 | Bacteria | 4941 |
| 290 | Ga0105249_10005207 | 3300009553 | Bacteria | 11223 |
| 291 | Ga0105249_10043006 | 3300009553 | Bacteria | 4109 |
| 292 | Ga0105249_10166828 | 3300009553 | Bacteria | 2132 |
| 293 | Ga0105249_10358456 | 3300009553 | Bacteria | 1479 |
| 294 | Ga0105239_10001401 | 3300010375 | Bacteria | 32259 |
| 295 | Ga0105239_10123712 | 3300010375 | Bacteria | 2874 |
| 296 | Ga0105239_10247704 | 3300010375 | Bacteria | 2001 |
| 297 | Ga0105246_10000043 | 3300011119 | Bacteria | 47690 |
| 298 | Ga0105246_10018753 | 3300011119 | Bacteria | 4411 |
| 299 | Ga0105246_10226677 | 3300011119 | Bacteria | 1469 |
| 300 | Ga0157373_10028008 | 3300013100 | Bacteria | 4065 |
| 301 | Ga0157373_10053563 | 3300013100 | Bacteria | 2869 |
| 302 | Ga0157371_10004316 | 3300013102 | Bacteria | 12464 |
| 303 | Ga0157370_10036631 | 3300013104 | Bacteria | 4759 |
| 304 | Ga0157369_10010249 | 3300013105 | Bacteria | 10695 |
| 305 | Ga0157369_10019495 | 3300013105 | Bacteria | 7590 |
| 306 | Ga0157369_10041192 | 3300013105 | Bacteria | 5041 |
| 307 | Ga0157374_10091348 | 3300013296 | Bacteria | 2903 |
| 308 | Ga0157374_10324572 | 3300013296 | Bacteria | 1526 |
| 309 | Ga0157378_10191578 | 3300013297 | Bacteria | 1929 |
| 310 | Ga0163162_10024427 | 3300013306 | Bacteria | 5965 |
| 311 | Ga0163162_10083227 | 3300013306 | Bacteria | 3273 |
| 312 | Ga0157372_10003488 | 3300013307 | Bacteria | 16951 |
| 313 | Ga0157372_10028325 | 3300013307 | Bacteria | 6113 |
| 314 | Ga0157372_10263775 | 3300013307 | Bacteria | 2000 |
| 315 | Ga0157375_10106921 | 3300013308 | Bacteria | 2890 |
| 316 | Ga0157375_10125173 | 3300013308 | Bacteria | 2684 |
| 317 | Ga0157375_10382192 | 3300013308 | Bacteria | 1575 |
| 318 | Ga0157375_10457802 | 3300013308 | Bacteria | 1441 |
| 319 | Ga0163163_10033828 | 3300014325 | Bacteria | 4947 |
| 320 | Ga0163163_10091573 | 3300014325 | Bacteria | 3055 |
| 321 | Ga0163163_10109199 | 3300014325 | Bacteria | 2793 |
| 322 | Ga0163163_10110734 | 3300014325 | Bacteria | 2774 |
| 323 | Ga0163163_10153726 | 3300014325 | Bacteria | 2344 |
| 324 | Ga0157380_10332990 | 3300014326 | Bacteria | 1412 |
| 325 | Ga0157377_10008166 | 3300014745 | Bacteria | 5092 |
| 326 | Ga0157377_10052744 | 3300014745 | Bacteria | 2297 |
| 327 | Ga0157377_10150666 | 3300014745 | Bacteria | 1438 |
| 328 | Ga0157379_10536148 | 3300014968 | Bacteria | 1088 |
| 329 | Ga0157376_10462266 | 3300014969 | Bacteria | 1240 |
| 330 | Ga0206356_10202247 | 3300020070 | Bacteria | 5095 |
| 331 | Ga0213873_10009109 | 3300021358 | Bacteria | 2050 |
| 332 | Ga0213873_10015007 | 3300021358 | Bacteria | 1727 |
| 333 | Ga0213873_10034310 | 3300021358 | Bacteria | 1278 |
| 334 | Ga0213872_10003060 | 3300021361 | Bacteria | 9430 |
| 335 | Ga0213872_10094699 | 3300021361 | Bacteria | 1334 |
| 336 | Ga0213874_10002416 | 3300021377 | Bacteria | 4020 |
| 337 | Ga0213874_10008293 | 3300021377 | Bacteria | 2530 |
| 338 | Ga0213874_10030048 | 3300021377 | Bacteria | 1563 |
| 339 | Ga0213876_10000392 | 3300021384 | Bacteria | 36739 |
| 340 | Ga0213876_10015196 | 3300021384 | Bacteria | 4077 |
| 341 | Ga0213876_10041304 | 3300021384 | Bacteria | 2437 |
| 342 | Ga0213876_10089653 | 3300021384 | Bacteria | 1629 |
| 343 | Ga0213876_10094785 | 3300021384 | Bacteria | 1581 |
| 344 | Ga0213875_10000001 | 3300021388 | Bacteria | 2793540 |
| 345 | Ga0213875_10000563 | 3300021388 | Bacteria | 30193 |
| 346 | Ga0213875_10003758 | 3300021388 | Bacteria | 8551 |
| 347 | Ga0213875_10004499 | 3300021388 | Bacteria | 7631 |
| 348 | Ga0213875_10043724 | 3300021388 | Bacteria | 2103 |
| 349 | Ga0213875_10076058 | 3300021388 | Bacteria | 1567 |
| 350 | Ga0213871_10003379 | 3300021441 | Bacteria | 3066 |
| 351 | Ga0213871_10008924 | 3300021441 | Bacteria | 2228 |
| 352 | Ga0213871_10012597 | 3300021441 | Bacteria | 1969 |
| 353 | Ga0213871_10026748 | 3300021441 | Bacteria | 1478 |
| 354 | Ga0207426_1000811 | 3300025302 | Bacteria | 33613 |
| 355 | Ga0207426_1005346 | 3300025302 | Bacteria | 5897 |
| 356 | Ga0207692_10126433 | 3300025898 | Bacteria | 1438 |
| 357 | Ga0207688_10004787 | 3300025901 | Bacteria | 7373 |
| 358 | Ga0207688_10005818 | 3300025901 | Bacteria | 6711 |
| 359 | Ga0207688_10024320 | 3300025901 | Bacteria | 3321 |
| 360 | Ga0207647_10035183 | 3300025904 | Bacteria | 3193 |
| 361 | Ga0207699_10080877 | 3300025906 | Bacteria | 2014 |
| 362 | Ga0207645_10028939 | 3300025907 | Bacteria | 3573 |
| 363 | Ga0207645_10059072 | 3300025907 | Bacteria | 2449 |
| 364 | Ga0207645_10186915 | 3300025907 | Bacteria | 1360 |
| 365 | Ga0207643_10000255 | 3300025908 | Bacteria | 37233 |
| 366 | Ga0207643_10006057 | 3300025908 | Bacteria | 6462 |
| 367 | Ga0207705_10001884 | 3300025909 | Bacteria | 16457 |
| 368 | Ga0207705_10005307 | 3300025909 | Bacteria | 9641 |
| 369 | Ga0207705_10017368 | 3300025909 | Bacteria | 5153 |
| 370 | Ga0207705_10041114 | 3300025909 | Bacteria | 3316 |
| 371 | Ga0207705_10050948 | 3300025909 | Bacteria | 2980 |
| 372 | Ga0207684_10007467 | 3300025910 | Bacteria | 9837 |
| 373 | Ga0207684_10081761 | 3300025910 | Bacteria | 2749 |
| 374 | Ga0207684_10133326 | 3300025910 | Bacteria | 2132 |
| 375 | Ga0207654_10026303 | 3300025911 | Bacteria | 3149 |
| 376 | Ga0207654_10188316 | 3300025911 | Bacteria | 1351 |
| 377 | Ga0207707_10065837 | 3300025912 | Bacteria | 3155 |
| 378 | Ga0207707_10069855 | 3300025912 | Bacteria | 3061 |
| 379 | Ga0207707_10140946 | 3300025912 | Bacteria | 2108 |
| 380 | Ga0207695_10002892 | 3300025913 | Bacteria | 24881 |
| 381 | Ga0207695_10039707 | 3300025913 | Bacteria | 5055 |
| 382 | Ga0207695_10194408 | 3300025913 | Bacteria | 1945 |
| 383 | Ga0207671_10000492 | 3300025914 | Bacteria | 53745 |
| 384 | Ga0207671_10092368 | 3300025914 | Bacteria | 2282 |
| 385 | Ga0207671_10119397 | 3300025914 | Bacteria | 2014 |
| 386 | Ga0207693_10313042 | 3300025915 | Bacteria | 1229 |
| 387 | Ga0207663_10069250 | 3300025916 | Bacteria | 2269 |
| 388 | Ga0207663_10230367 | 3300025916 | Bacteria | 1353 |
| 389 | Ga0207660_10191671 | 3300025917 | Bacteria | 1592 |
| 390 | Ga0207660_10326112 | 3300025917 | Bacteria | 1227 |
| 391 | Ga0207657_10017156 | 3300025919 | Bacteria | 6955 |
| 392 | Ga0207657_10017298 | 3300025919 | Bacteria | 6919 |
| 393 | Ga0207657_10035544 | 3300025919 | Bacteria | 4467 |
| 394 | Ga0207657_10043946 | 3300025919 | Bacteria | 3932 |
| 395 | Ga0207649_10014228 | 3300025920 | Bacteria | 4452 |
| 396 | Ga0207649_10029333 | 3300025920 | Bacteria | 3248 |
| 397 | Ga0207652_10007647 | 3300025921 | Bacteria | 8695 |
| 398 | Ga0207652_10030737 | 3300025921 | Bacteria | 4500 |
| 399 | Ga0207652_10315662 | 3300025921 | Bacteria | 1411 |
| 400 | Ga0207646_10012726 | 3300025922 | Bacteria | 8074 |
| 401 | Ga0207646_10029254 | 3300025922 | Bacteria | 5008 |
| 402 | Ga0207646_10137222 | 3300025922 | Bacteria | 2202 |
| 403 | Ga0207646_10140434 | 3300025922 | Bacteria | 2175 |
| 404 | Ga0207646_10250578 | 3300025922 | Bacteria | 1600 |
| 405 | Ga0207646_10271504 | 3300025922 | Bacteria | 1533 |
| 406 | Ga0207681_10152156 | 3300025923 | Bacteria | 1735 |
| 407 | Ga0207694_10002567 | 3300025924 | Bacteria | 14741 |
| 408 | Ga0207694_10025522 | 3300025924 | Bacteria | 4492 |
| 409 | Ga0207694_10028556 | 3300025924 | Bacteria | 4253 |
| 410 | Ga0207650_10018346 | 3300025925 | Bacteria | 4909 |
| 411 | Ga0207650_10066617 | 3300025925 | Bacteria | 2701 |
| 412 | Ga0207659_10002694 | 3300025926 | Bacteria | 10582 |
| 413 | Ga0207659_10310316 | 3300025926 | Bacteria | 1298 |
| 414 | Ga0207687_10006625 | 3300025927 | Bacteria | 7642 |
| 415 | Ga0207687_10043025 | 3300025927 | Bacteria | 3111 |
| 416 | Ga0207687_10222120 | 3300025927 | Bacteria | 1488 |
| 417 | Ga0207700_10173293 | 3300025928 | Bacteria | 1801 |
| 418 | Ga0207700_10205849 | 3300025928 | Bacteria | 1661 |
| 419 | Ga0207700_10485516 | 3300025928 | Bacteria | 1092 |
| 420 | Ga0207664_10019225 | 3300025929 | Bacteria | 5045 |
| 421 | Ga0207664_10030674 | 3300025929 | Bacteria | 4108 |
| 422 | Ga0207664_10076997 | 3300025929 | Bacteria | 2701 |
| 423 | Ga0207664_10449181 | 3300025929 | Bacteria | 1150 |
| 424 | Ga0207664_10533911 | 3300025929 | Bacteria | 1052 |
| 425 | Ga0207644_10033748 | 3300025931 | Bacteria | 3579 |
| 426 | Ga0207690_10013870 | 3300025932 | Bacteria | 4854 |
| 427 | Ga0207690_10015584 | 3300025932 | Bacteria | 4608 |
| 428 | Ga0207690_10180298 | 3300025932 | Bacteria | 1590 |
| 429 | Ga0207706_10077313 | 3300025933 | Bacteria | 2927 |
| 430 | Ga0207706_10092644 | 3300025933 | Bacteria | 2657 |
| 431 | Ga0207686_10164509 | 3300025934 | Bacteria | 1558 |
| 432 | Ga0207709_10094864 | 3300025935 | Bacteria | 1959 |
| 433 | Ga0207709_10141404 | 3300025935 | Bacteria | 1655 |
| 434 | Ga0207669_10352314 | 3300025937 | Bacteria | 1138 |
| 435 | Ga0207704_10011020 | 3300025938 | Bacteria | 4435 |
| 436 | Ga0207665_10005460 | 3300025939 | Bacteria | 8484 |
| 437 | Ga0207691_10035406 | 3300025940 | Bacteria | 4634 |
| 438 | Ga0207711_10000313 | 3300025941 | Bacteria | 51800 |
| 439 | Ga0207711_10088724 | 3300025941 | Bacteria | 2715 |
| 440 | Ga0207689_10005049 | 3300025942 | Bacteria | 11894 |
| 441 | Ga0207689_10028236 | 3300025942 | Bacteria | 4693 |
| 442 | Ga0207661_10005765 | 3300025944 | Bacteria | 8732 |
| 443 | Ga0207661_10023643 | 3300025944 | Bacteria | 4646 |
| 444 | Ga0207661_10131900 | 3300025944 | Bacteria | 2141 |
| 445 | Ga0207661_10149418 | 3300025944 | Bacteria | 2018 |
| 446 | Ga0207661_10220389 | 3300025944 | Bacteria | 1676 |
| 447 | Ga0207661_10401432 | 3300025944 | Bacteria | 1243 |
| 448 | Ga0207679_10058656 | 3300025945 | Bacteria | 2853 |
| 449 | Ga0207679_10085332 | 3300025945 | Bacteria | 2425 |
| 450 | Ga0207679_10368156 | 3300025945 | Bacteria | 1257 |
| 451 | Ga0207667_10000018 | 3300025949 | Bacteria | 388308 |
| 452 | Ga0207667_10007907 | 3300025949 | Bacteria | 12697 |
| 453 | Ga0207667_10009879 | 3300025949 | Bacteria | 11199 |
| 454 | Ga0207667_10032464 | 3300025949 | Bacteria | 5626 |
| 455 | Ga0207667_10146658 | 3300025949 | Bacteria | 2429 |
| 456 | Ga0207667_10167382 | 3300025949 | Bacteria | 2259 |
| 457 | Ga0207667_10351792 | 3300025949 | Bacteria | 1502 |
| 458 | Ga0207712_10003342 | 3300025961 | Bacteria | 10162 |
| 459 | Ga0207712_10042746 | 3300025961 | Bacteria | 3123 |
| 460 | Ga0207712_10058717 | 3300025961 | Bacteria | 2719 |
| 461 | Ga0207712_10102291 | 3300025961 | Bacteria | 2132 |
| 462 | Ga0207668_10003497 | 3300025972 | Bacteria | 9226 |
| 463 | Ga0207640_10000003 | 3300025981 | Bacteria | 505282 |
| 464 | Ga0207640_10028362 | 3300025981 | Bacteria | 3422 |
| 465 | Ga0207677_10055756 | 3300026023 | Bacteria | 2704 |
| 466 | Ga0207703_10081605 | 3300026035 | Bacteria | 2696 |
| 467 | Ga0207703_10164053 | 3300026035 | Bacteria | 1948 |
| 468 | Ga0207639_10012194 | 3300026041 | Bacteria | 5981 |
| 469 | Ga0207678_10000346 | 3300026067 | Bacteria | 41986 |
| 470 | Ga0207678_10006802 | 3300026067 | Bacteria | 10142 |
| 471 | Ga0207678_10031327 | 3300026067 | Bacteria | 4639 |
| 472 | Ga0207708_10005711 | 3300026075 | Bacteria | 9199 |
| 473 | Ga0207708_10034322 | 3300026075 | Bacteria | 3858 |
| 474 | Ga0207708_10221244 | 3300026075 | Bacteria | 1517 |
| 475 | Ga0207702_10000631 | 3300026078 | Bacteria | 38615 |
| 476 | Ga0207702_10054568 | 3300026078 | Bacteria | 3387 |
| 477 | Ga0207702_10061875 | 3300026078 | Bacteria | 3194 |
| 478 | Ga0207702_10224978 | 3300026078 | Bacteria | 1750 |
| 479 | Ga0207641_10004672 | 3300026088 | Bacteria | 11815 |
| 480 | Ga0207641_10008384 | 3300026088 | Bacteria | 8542 |
| 481 | Ga0207641_10042093 | 3300026088 | Bacteria | 3831 |
| 482 | Ga0207648_10022678 | 3300026089 | Bacteria | 5636 |
| 483 | Ga0207648_10116813 | 3300026089 | Bacteria | 2345 |
| 484 | Ga0207648_10206407 | 3300026089 | Bacteria | 1744 |
| 485 | Ga0207648_10417569 | 3300026089 | Bacteria | 1218 |
| 486 | Ga0207676_10025873 | 3300026095 | Bacteria | 4357 |
| 487 | Ga0207676_10193310 | 3300026095 | Bacteria | 1792 |
| 488 | Ga0207676_10552279 | 3300026095 | Bacteria | 1100 |
| 489 | Ga0207674_10001502 | 3300026116 | Bacteria | 30105 |
| 490 | Ga0207674_10021127 | 3300026116 | Bacteria | 7017 |
| 491 | Ga0207674_10049528 | 3300026116 | Bacteria | 4296 |
| 492 | Ga0207674_10062455 | 3300026116 | Bacteria | 3763 |
| 493 | Ga0207674_10079185 | 3300026116 | Bacteria | 3291 |
| 494 | Ga0207674_10176858 | 3300026116 | Bacteria | 2086 |
| 495 | Ga0207675_100029374 | 3300026118 | Bacteria | 5123 |
| 496 | Ga0207683_10000342 | 3300026121 | Bacteria | 42329 |
| 497 | Ga0207683_10094863 | 3300026121 | Bacteria | 2659 |
| 498 | Ga0207698_10025503 | 3300026142 | Bacteria | 4167 |
| 499 | Ga0207698_10066856 | 3300026142 | Bacteria | 2832 |
| 500 | Ga0207698_10071393 | 3300026142 | Bacteria | 2755 |
| 501 | Ga0207698_10120705 | 3300026142 | Bacteria | 2218 |
| 502 | Ga0209813_10006654 | 3300027866 | Bacteria | 2861 |
| 503 | Ga0207428_10000213 | 3300027907 | Bacteria | 80079 |
| 504 | Ga0207428_10013436 | 3300027907 | Bacteria | 7152 |
| 505 | Ga0207428_10028679 | 3300027907 | Bacteria | 4622 |
| 506 | Ga0265356_1000276 | 3300028017 | Bacteria | 9607 |
| 507 | Ga0268266_10030662 | 3300028379 | Bacteria | 4567 |
| 508 | Ga0268266_10173281 | 3300028379 | Bacteria | 1959 |
| 509 | Ga0268266_10350945 | 3300028379 | Bacteria | 1386 |
| 510 | Ga0268265_10000008 | 3300028380 | Bacteria | 417328 |
| 511 | Ga0268265_10010617 | 3300028380 | Bacteria | 6220 |
| 512 | Ga0268265_10057623 | 3300028380 | Bacteria | 2962 |
| 513 | Ga0268265_10061613 | 3300028380 | Bacteria | 2879 |
| 514 | Ga0268265_10067603 | 3300028380 | Bacteria | 2767 |
| 515 | Ga0268265_10184166 | 3300028380 | Bacteria | 1797 |
| 516 | Ga0268264_10434152 | 3300028381 | Bacteria | 1269 |
| 517 | Ga0265334_10026764 | 3300028573 | Bacteria | 2326 |
| 518 | Ga0307515_10004662 | 3300028794 | Bacteria | 28143 |
| 519 | Ga0307515_10004732 | 3300028794 | Bacteria | 27881 |
| 520 | Ga0307515_10021895 | 3300028794 | Bacteria | 11305 |
| 521 | Ga0307515_10030848 | 3300028794 | Bacteria | 8975 |
| 522 | Ga0307515_10078253 | 3300028794 | Bacteria | 4352 |
| 523 | Ga0307515_10080122 | 3300028794 | Bacteria | 4264 |
| 524 | Ga0307515_10102556 | 3300028794 | Bacteria | 3440 |
| 525 | Ga0265338_10000157 | 3300028800 | Bacteria | 124607 |
| 526 | Ga0265338_10023339 | 3300028800 | Bacteria | 6365 |
| 527 | Ga0265338_10027991 | 3300028800 | Bacteria | 5637 |
| 528 | Ga0265338_10073751 | 3300028800 | Bacteria | 2907 |
| 529 | Ga0265324_10077017 | 3300029957 | Archaea | 1135 |
| 530 | Ga0237817_10142 | 3300030083 | Bacteria | 21441 |
| 531 | Ga0307511_10000068 | 3300030521 | Bacteria | 85766 |
| 532 | Ga0307512_10002870 | 3300030522 | Bacteria | 20931 |
| 533 | Ga0307512_10007686 | 3300030522 | Bacteria | 10629 |
| 534 | Ga0307512_10020139 | 3300030522 | Bacteria | 6049 |
| 535 | Ga0307512_10037274 | 3300030522 | Bacteria | 4109 |
| 536 | Ga0307512_10117234 | 3300030522 | Bacteria | 1727 |
| 537 | Ga0316177_1163023 | 3300030731 | Bacteria | 5376 |
| 538 | Ga0314311_1152082 | 3300030733 | Bacteria | 4227 |
| 539 | Ga0316178_1125740 | 3300030735 | Bacteria | 1271 |
| 540 | Ga0316180_1088936 | 3300030736 | Bacteria | 4199 |
| 541 | Ga0265760_10032833 | 3300031090 | Bacteria | 1533 |
| 542 | Ga0265332_10016284 | 3300031238 | Bacteria | 3280 |
| 543 | Ga0265328_10034544 | 3300031239 | Bacteria | 1872 |
| 544 | Ga0265325_10000121 | 3300031241 | Bacteria | 53821 |
| 545 | Ga0265325_10020563 | 3300031241 | Bacteria | 3638 |
| 546 | Ga0265340_10024843 | 3300031247 | Bacteria | 3039 |
| 547 | Ga0265339_10033397 | 3300031249 | Bacteria | 2897 |
| 548 | Ga0265339_10087508 | 3300031249 | Bacteria | 1638 |
| 549 | Ga0265316_10003591 | 3300031344 | Bacteria | 15635 |
| 550 | Ga0307513_10001964 | 3300031456 | Bacteria | 29107 |
| 551 | Ga0307513_10046888 | 3300031456 | Bacteria | 4706 |
| 552 | Ga0307509_10080709 | 3300031507 | Bacteria | 3363 |
| 553 | Ga0307509_10100779 | 3300031507 | Bacteria | 2925 |
| 554 | Ga0265313_10000136 | 3300031595 | Bacteria | 75600 |
| 555 | Ga0307508_10002257 | 3300031616 | Bacteria | 20546 |
| 556 | Ga0307508_10003547 | 3300031616 | Bacteria | 15728 |
| 557 | Ga0307508_10006649 | 3300031616 | Bacteria | 10860 |
| 558 | Ga0307508_10083289 | 3300031616 | Bacteria | 2781 |
| 559 | Ga0307514_10028499 | 3300031649 | Bacteria | 4504 |
| 560 | Ga0265342_10002122 | 3300031712 | Bacteria | 17487 |
| 561 | Ga0265342_10005561 | 3300031712 | Bacteria | 9560 |
| 562 | Ga0307516_10005035 | 3300031730 | Bacteria | 15990 |
| 563 | Ga0307516_10006276 | 3300031730 | Bacteria | 13973 |
| 564 | Ga0307516_10012708 | 3300031730 | Bacteria | 9051 |
| 565 | Ga0307516_10015935 | 3300031730 | Bacteria | 7885 |
| 566 | Ga0307516_10017555 | 3300031730 | Bacteria | 7458 |
| 567 | Ga0307516_10026185 | 3300031730 | Bacteria | 5926 |
| 568 | Ga0307516_10048379 | 3300031730 | Bacteria | 4184 |
| 569 | Ga0307413_10046724 | 3300031824 | Bacteria | 2577 |
| 570 | Ga0307413_10050002 | 3300031824 | Bacteria | 2509 |
| 571 | Ga0307410_10021650 | 3300031852 | Bacteria | 3958 |
| 572 | Ga0307410_10034314 | 3300031852 | Bacteria | 3285 |
| 573 | Ga0307406_10031439 | 3300031901 | Bacteria | 3233 |
| 574 | Ga0307406_10116453 | 3300031901 | Bacteria | 1849 |
| 575 | Ga0307407_10097222 | 3300031903 | Bacteria | 1819 |
| 576 | Ga0307409_100012482 | 3300031995 | Bacteria | 5416 |
| 577 | Ga0307409_100029090 | 3300031995 | Bacteria | 3949 |
| 578 | Ga0307409_100091047 | 3300031995 | Bacteria | 2498 |
| 579 | Ga0307409_100297883 | 3300031995 | Bacteria | 1499 |
| 580 | Ga0307416_100073061 | 3300032002 | Bacteria | 2858 |
| 581 | Ga0307411_10076178 | 3300032005 | Bacteria | 2292 |
| 582 | Ga0307415_100008771 | 3300032126 | Bacteria | 5627 |
| 583 | Ga0307415_100023226 | 3300032126 | Bacteria | 3845 |
| 584 | Ga0307415_100042054 | 3300032126 | Bacteria | 3039 |
| 585 | Ga0307415_100057450 | 3300032126 | Bacteria | 2674 |
| 586 | Ga0307415_100114205 | 3300032126 | Bacteria | 2010 |
| 587 | Ga0307507_10072905 | 3300033179 | Bacteria | 3090 |
| 588 | Ga0307510_10159385 | 3300033180 | Bacteria | 1857 |
| 589 | Ga0307510_10164335 | 3300033180 | Bacteria | 1811 |
| 590 | Ga0373940_0028742 | 3300035088 | Bacteria | 1469 |
| 591 | Ga0373951_0000228 | 3300035091 | Bacteria | 19339 |
| 592 | Ga0373932_0071632 | 3300035112 | Bacteria | 1076 |
| 593 | Ga0373942_0000477 | 3300035207 | Bacteria | 11400 |
| 594 | Ga0373931_0023595 | 3300035691 | Bacteria | 3108 |
| 595 | Ga0373935_0019960 | 3300035692 | Bacteria | 4090 |
| 596 | Ga0373927_0000164 | 3300035695 | Bacteria | 51851 |
| 597 | Ga0373937_0101745 | 3300036401 | Bacteria | 2667 |
| 598 | Ga0373925_0020290 | 3300037068 | Bacteria | 4837 |
| 599 | Ga0395899_0016934 | 3300037312 | Bacteria | 5556 |
| 600 | Ga0395899_0037324 | 3300037312 | Bacteria | 3642 |
| 601 | Ga0395900_0029675 | 3300037418 | Bacteria | 5611 |
| 602 | Ga0395900_0121557 | 3300037418 | Bacteria | 2679 |
| 603 | Ga0395900_0194038 | 3300037418 | Bacteria | 2058 |
| 604 | Ga0395900_0267543 | 3300037418 | Bacteria | 1705 |
| 605 | Ga0395900_0914544 | 3300037418 | Bacteria | 800 |
| 606 | Ga0395898_0009560 | 3300037466 | Bacteria | 10184 |
| 607 | Ga0395898_0075347 | 3300037466 | Bacteria | 3259 |
| 608 | Ga0395898_0090014 | 3300037466 | Bacteria | 2953 |
| 609 | Ga0395898_0290461 | 3300037466 | Bacteria | 1560 |
| 610 | Ga0395905_0030937 | 3300037471 | Bacteria | 5041 |
| 611 | Ga0395905_0535822 | 3300037471 | Bacteria | 1072 |
| 612 | Ga0436364_0031147 | 3300037853 | Bacteria | 12344 |
| 613 | Ga0436364_0056800 | 3300037853 | Bacteria | 6930 |
| 614 | Ga0436364_0130866 | 3300037853 | Bacteria | 53503 |
| 615 | Ga0436364_0258512 | 3300037853 | Bacteria | 8715 |
| 616 | Ga0436364_0273345 | 3300037853 | Bacteria | 2794207 |
| 617 | Ga0436364_0306718 | 3300037853 | Bacteria | 6032 |
| 618 | Ga0436364_0381375 | 3300037853 | Bacteria | 1578 |
| 619 | Ga0436364_0817615 | 3300037853 | Bacteria | 9851 |
| 620 | Ga0436364_0830434 | 3300037853 | Bacteria | 1504 |
| 621 | Ga0436364_1286690 | 3300037853 | Bacteria | 3755 |
| 622 | Ga0436364_1436469 | 3300037853 | Bacteria | 2480 |
| 623 | Ga0436364_1499753 | 3300037853 | Bacteria | 1673 |
| 624 | Ga0436364_1550326 | 3300037853 | Bacteria | 15744 |
| 625 | Ga0395901_0005476 | 3300038443 | Bacteria | 12856 |
| 626 | Ga0395901_0010309 | 3300038443 | Bacteria | 9466 |
| 627 | Ga0395901_0066823 | 3300038443 | Bacteria | 3744 |
| 628 | Ga0395901_0102002 | 3300038443 | Bacteria | 3011 |
| 629 | Ga0395901_0121835 | 3300038443 | Bacteria | 2741 |
| 630 | Ga0395901_0309463 | 3300038443 | Bacteria | 1636 |
| 631 | Ga0400485_01398 | 3300038735 | Bacteria | 4928 |
| 632 | Ga0400483_051011 | 3300039062 | Bacteria | 5689 |
| 633 | Ga0400483_146421 | 3300039062 | Bacteria | 7762 |
| 634 | Ga0400483_281577 | 3300039062 | Bacteria | 14576 |
| 635 | Ga0436365_0196318 | 3300039437 | Bacteria | 8677 |
| 636 | Ga0436365_0853215 | 3300039437 | Bacteria | 1565 |
| 637 | Ga0436365_0934173 | 3300039437 | Bacteria | 1596 |
| 638 | Ga0436365_0980504 | 3300039437 | Bacteria | 1864 |
| 639 | Ga0436365_1206342 | 3300039437 | Bacteria | 3963 |
| 640 | Ga0436365_1493597 | 3300039437 | Bacteria | 2459 |
| 641 | Ga0436365_1589201 | 3300039437 | Bacteria | 2159 |
| 642 | Ga0436365_1607019 | 3300039437 | Bacteria | 2322 |
| 643 | Ga0436360_0009449 | 3300039438 | Bacteria | 8390 |
| 644 | Ga0436360_0037933 | 3300039438 | Bacteria | 3110 |
| 645 | Ga0436360_0098126 | 3300039438 | Bacteria | 2702 |
| 646 | Ga0436360_0141554 | 3300039438 | Bacteria | 3385 |
| 647 | Ga0436360_0153847 | 3300039438 | Bacteria | 1485 |
| 648 | Ga0436360_0412872 | 3300039438 | Bacteria | 6025 |
| 649 | Ga0436360_0581232 | 3300039438 | Bacteria | 1280 |
| 650 | Ga0436360_0930976 | 3300039438 | Bacteria | 2393 |
| 651 | Ga0436360_1004013 | 3300039438 | Bacteria | 3453 |
| 652 | Ga0436360_1038089 | 3300039438 | Bacteria | 3937 |
| 653 | Ga0436360_1093826 | 3300039438 | Bacteria | 2537 |
| 654 | Ga0436360_1197386 | 3300039438 | Bacteria | 1984 |
| 655 | Ga0436360_1228528 | 3300039438 | Bacteria | 3754 |
| 656 | Ga0436361_0303992 | 3300039447 | Bacteria | 10200 |
| 657 | Ga0436361_0353974 | 3300039447 | Bacteria | 2435 |
| 658 | Ga0436361_0493910 | 3300039447 | Bacteria | 2630 |
| 659 | Ga0436361_0571302 | 3300039447 | Bacteria | 101663 |
| 660 | Ga0436361_0684318 | 3300039447 | Bacteria | 1630 |
| 661 | Ga0436361_0787384 | 3300039447 | Bacteria | 6263 |
| 662 | Ga0436361_0790320 | 3300039447 | Bacteria | 1567 |
| 663 | Ga0436361_0913090 | 3300039447 | Bacteria | 5785 |
| 664 | Ga0436361_1210671 | 3300039447 | Bacteria | 10125 |
| 665 | Ga0436363_0032621 | 3300039450 | Bacteria | 48468 |
| 666 | Ga0436363_0082939 | 3300039450 | Bacteria | 2765 |
| 667 | Ga0436363_0170474 | 3300039450 | Bacteria | 1380 |
| 668 | Ga0436363_0356929 | 3300039450 | Bacteria | 1190 |
| 669 | Ga0436363_0452825 | 3300039450 | Bacteria | 5490 |
| 670 | Ga0436363_0629336 | 3300039450 | Bacteria | 1604 |
| 671 | Ga0436363_0776175 | 3300039450 | Bacteria | 2242 |
| 672 | Ga0436363_1465945 | 3300039450 | Bacteria | 1211 |
| 673 | Ga0436363_1620918 | 3300039450 | Bacteria | 5020 |
| 674 | Ga0436362_0027826 | 3300039453 | Bacteria | 1135 |
| 675 | Ga0436362_0051025 | 3300039453 | Bacteria | 2709 |
| 676 | Ga0436362_0406634 | 3300039453 | Bacteria | 2048 |
| 677 | Ga0436362_0483944 | 3300039453 | Bacteria | 3150 |
| 678 | Ga0436362_0486730 | 3300039453 | Bacteria | 3286 |
| 679 | Ga0436362_0540144 | 3300039453 | Bacteria | 1300 |
| 680 | Ga0436362_0653197 | 3300039453 | Bacteria | 3893 |
| 681 | Ga0436362_0767395 | 3300039453 | Bacteria | 2835 |
| 682 | Ga0436362_0853964 | 3300039453 | Bacteria | 3472 |
| 683 | Ga0436362_1003461 | 3300039453 | Bacteria | 29888 |
| 684 | Ga0436362_1013653 | 3300039453 | Bacteria | 4444 |
| 685 | Ga0436362_1187126 | 3300039453 | Bacteria | 2571 |
| 686 | Ga0439439_0003999 | 3300041406 | Bacteria | 3289 |
| 687 | Ga0451853_1738478 | 3300041512 | Bacteria | 4476 |
| 688 | Ga0439433_0013204 | 3300041999 | Bacteria | 1812 |
| 689 | Ga0439448_0064010 | 3300042005 | Bacteria | 1219 |
| 690 | Ga0439449_0000392 | 3300042007 | Bacteria | 16234 |
| 691 | Ga0439449_0000447 | 3300042007 | Bacteria | 15359 |
| 692 | Ga0439462_0000062 | 3300042015 | Bacteria | 15886 |
| 693 | Ga0439462_0006819 | 3300042015 | Bacteria | 2849 |
| 694 | Ga0439459_0015659 | 3300042438 | Bacteria | 1392 |
| 695 | Ga0451577_0024855 | 3300042876 | Bacteria | 5442 |
| 696 | Ga0451577_0105966 | 3300042876 | Bacteria | 2513 |
| 697 | Ga0466969_0000414 | 3300044656 | Bacteria | 23339 |
| 698 | Ga0466969_0010863 | 3300044656 | Bacteria | 4824 |
| 699 | Ga0466969_0025286 | 3300044656 | Bacteria | 3053 |
| 700 | Ga0466969_0026364 | 3300044656 | Bacteria | 2981 |
| 701 | Ga0466969_0083340 | 3300044656 | Bacteria | 1523 |
| 702 | Ga0466969_0105166 | 3300044656 | Bacteria | 1325 |
| 703 | Ga0466969_0118489 | 3300044656 | Bacteria | 1234 |
| 704 | Ga0466972_0003966 | 3300044658 | Bacteria | 7375 |
| 705 | Ga0466972_0008316 | 3300044658 | Bacteria | 5201 |
| 706 | Ga0466972_0009638 | 3300044658 | Bacteria | 4847 |
| 707 | Ga0466972_0012940 | 3300044658 | Bacteria | 4190 |
| 708 | Ga0466972_0038777 | 3300044658 | Bacteria | 2327 |
| 709 | Ga0453683_0007388 | 3300044673 | Bacteria | 7458 |
| 710 | Ga0466965_0005786 | 3300044683 | Bacteria | 5578 |
| 711 | Ga0466965_0009509 | 3300044683 | Bacteria | 4517 |
| 712 | Ga0466965_0009647 | 3300044683 | Bacteria | 4489 |
| 713 | Ga0466965_0013094 | 3300044683 | Bacteria | 3909 |
| 714 | Ga0466965_0014434 | 3300044683 | Bacteria | 3739 |
| 715 | Ga0466965_0101240 | 3300044683 | Bacteria | 1473 |
| 716 | Ga0466965_0275215 | 3300044683 | Bacteria | 908 |
| 717 | Ga0466966_0000993 | 3300044684 | Bacteria | 18195 |
| 718 | Ga0466966_0003994 | 3300044684 | Bacteria | 9741 |
| 719 | Ga0466966_0006867 | 3300044684 | Bacteria | 7540 |
| 720 | Ga0466966_0020631 | 3300044684 | Bacteria | 4330 |
| 721 | Ga0466966_0049959 | 3300044684 | Bacteria | 2662 |
| 722 | Ga0466966_0056067 | 3300044684 | Bacteria | 2494 |
| 723 | Ga0466961_0002381 | 3300044693 | Bacteria | 11678 |
| 724 | Ga0466961_0002837 | 3300044693 | Bacteria | 10763 |
| 725 | Ga0466961_0007163 | 3300044693 | Bacteria | 7095 |
| 726 | Ga0466961_0023862 | 3300044693 | Bacteria | 3935 |
| 727 | Ga0466961_0025553 | 3300044693 | Bacteria | 3798 |
| 728 | Ga0466961_0044420 | 3300044693 | Bacteria | 2843 |
| 729 | Ga0466961_0089856 | 3300044693 | Bacteria | 1940 |
| 730 | Ga0466963_0006200 | 3300044694 | Bacteria | 7062 |
| 731 | Ga0466963_0196031 | 3300044694 | Bacteria | 1412 |
| 732 | Ga0466964_0012379 | 3300044706 | Bacteria | 3228 |
| 733 | Ga0453684_0008665 | 3300044712 | Bacteria | 18098 |
| 734 | Ga0453684_0336544 | 3300044712 | Bacteria | 1705 |
| 735 | Ga0466971_0027309 | 3300044719 | Bacteria | 2556 |
| 736 | Ga0466971_0046671 | 3300044719 | Bacteria | 1946 |
| 737 | Ga0466968_0003347 | 3300044735 | Bacteria | 5923 |
| 738 | Ga0466968_0009274 | 3300044735 | Bacteria | 3785 |
| 739 | Ga0466970_0006945 | 3300044765 | Bacteria | 5668 |
| 740 | Ga0466970_0014160 | 3300044765 | Bacteria | 4090 |
| 741 | Ga0466970_0033316 | 3300044765 | Bacteria | 2723 |
| 742 | Ga0466957_0003558 | 3300044842 | Bacteria | 8582 |
| 743 | Ga0466957_0023274 | 3300044842 | Bacteria | 3661 |
| 744 | Ga0466960_0044927 | 3300044901 | Bacteria | 2108 |
| 745 | Ga0466960_0083661 | 3300044901 | Bacteria | 1613 |
| 746 | Ga0466959_0001670 | 3300045049 | Bacteria | 13743 |
| 747 | Ga0466959_0004585 | 3300045049 | Bacteria | 9276 |
| 748 | Ga0466959_0043109 | 3300045049 | Bacteria | 3328 |
| 749 | Ga0466959_0070827 | 3300045049 | Bacteria | 2526 |
| 750 | Ga0466959_0073006 | 3300045049 | Bacteria | 2482 |
| 751 | Ga0466959_0107447 | 3300045049 | Unclassified | 1994 |
| 752 | Ga0451576_0001906 | 3300045051 | Bacteria | 33422 |
| 753 | Ga0466958_0009229 | 3300045836 | Bacteria | 5489 |
| 754 | Ga0466958_0011075 | 3300045836 | Bacteria | 5071 |
| 755 | Ga0466958_0059455 | 3300045836 | Bacteria | 2325 |
| 756 | Ga0466967_0008264 | 3300045976 | Bacteria | 7603 |
| 757 | Ga0466967_0032142 | 3300045976 | Bacteria | 4427 |
| 758 | Ga0466967_0064210 | 3300045976 | Bacteria | 3265 |
| 759 | Ga0466967_0080908 | 3300045976 | Bacteria | 2933 |
| 760 | Ga0466967_0109693 | 3300045976 | Bacteria | 2534 |
| 761 | Ga0466967_0191553 | 3300045976 | Bacteria | 1933 |
| 762 | Ga0466967_0255721 | 3300045976 | Bacteria | 1674 |
| 763 | Ga0466967_0271137 | 3300045976 | Bacteria | 1626 |
| 764 | Ga0495592_0096768 | 3300046454 | Bacteria | 2109 |
| 765 | Ga0495592_0187586 | 3300046454 | Bacteria | 1403 |
| 766 | Ga0495603_0086793 | 3300046455 | Bacteria | 1831 |
| 767 | Ga0495603_0168564 | 3300046455 | Bacteria | 1269 |
| 768 | Ga0495629_0001390 | 3300046459 | Bacteria | 19101 |
| 769 | Ga0495629_0024512 | 3300046459 | Bacteria | 4296 |
| 770 | Ga0495629_0044251 | 3300046459 | Bacteria | 3125 |
| 771 | Ga0495629_0172944 | 3300046459 | Bacteria | 1498 |
| 772 | Ga0495638_0239700 | 3300046460 | Bacteria | 1005 |
| 773 | Ga0495651_0000128 | 3300046462 | Bacteria | 56236 |
| 774 | Ga0495651_0004211 | 3300046462 | Bacteria | 11022 |
| 775 | Ga0495580_0283533 | 3300046472 | Bacteria | 1130 |
| 776 | Ga0495582_0238703 | 3300046473 | Bacteria | 1041 |
| 777 | Ga0495662_0002245 | 3300046476 | Bacteria | 9742 |
| 778 | Ga0495664_0003058 | 3300046477 | Bacteria | 9063 |
| 779 | Ga0495664_0090208 | 3300046477 | Bacteria | 1843 |
| 780 | Ga0495583_0035582 | 3300046506 | Bacteria | 2376 |
| 781 | Ga0495618_0156474 | 3300046514 | Bacteria | 1454 |
| 782 | Ga0495628_0002560 | 3300046516 | Bacteria | 16353 |
| 783 | Ga0495628_0286339 | 3300046516 | Bacteria | 1222 |
| 784 | Ga0495630_0321145 | 3300046517 | Bacteria | 1184 |
| 785 | Ga0495632_0118850 | 3300046519 | Bacteria | 1236 |
| 786 | Ga0495666_0000540 | 3300046526 | Bacteria | 16836 |
| 787 | Ga0495652_0000358 | 3300046529 | Bacteria | 54461 |
| 788 | Ga0495652_0120869 | 3300046529 | Bacteria | 2089 |
| 789 | Ga0495652_0129573 | 3300046529 | Bacteria | 1999 |
| 790 | Ga0495665_0015774 | 3300046531 | Bacteria | 4068 |
| 791 | Ga0495640_0011237 | 3300046533 | Bacteria | 6893 |
| 792 | Ga0495640_0011357 | 3300046533 | Bacteria | 6856 |
| 793 | Ga0495640_0065157 | 3300046533 | Bacteria | 2461 |
| 794 | Ga0495586_0034545 | 3300046535 | Bacteria | 2716 |
| 795 | Ga0495587_0020875 | 3300046536 | Bacteria | 4040 |
| 796 | Ga0495587_0055764 | 3300046536 | Bacteria | 2326 |
| 797 | Ga0495587_0164379 | 3300046536 | Bacteria | 1262 |
| 798 | Ga0495645_0010190 | 3300046543 | Bacteria | 6585 |
| 799 | Ga0495645_0114620 | 3300046543 | Bacteria | 1904 |
| 800 | Ga0495622_0074017 | 3300046557 | Bacteria | 1571 |
| 801 | Ga0495634_0002087 | 3300046642 | Bacteria | 16892 |
| 802 | Ga0495634_0017275 | 3300046642 | Bacteria | 5151 |
| 803 | Ga0495635_0009480 | 3300046663 | Bacteria | 6802 |
| 804 | Ga0495635_0016699 | 3300046663 | Bacteria | 5127 |
| 805 | Ga0495588_0124167 | 3300046674 | Bacteria | 1361 |
| 806 | Ga0495657_0001170 | 3300046675 | Bacteria | 22966 |
| 807 | Ga0495657_0102885 | 3300046675 | Bacteria | 1817 |
| 808 | Ga0495599_0012543 | 3300046678 | Bacteria | 5228 |
| 809 | Ga0495599_0231129 | 3300046678 | Bacteria | 1129 |
| 810 | Ga0495623_0007760 | 3300046679 | Bacteria | 6972 |
| 811 | Ga0495623_0041368 | 3300046679 | Bacteria | 2939 |
| 812 | Ga0495646_0001835 | 3300046680 | Bacteria | 12775 |
| 813 | Ga0495658_0193481 | 3300046683 | Bacteria | 1265 |
| 814 | Ga0495613_0000357 | 3300046689 | Bacteria | 40386 |
| 815 | Ga0495613_0002729 | 3300046689 | Bacteria | 13247 |
| 816 | Ga0495613_0033173 | 3300046689 | Bacteria | 3836 |
| 817 | Ga0495613_0292466 | 3300046689 | Bacteria | 1129 |
| 818 | Ga0495624_0090964 | 3300046690 | Bacteria | 1883 |
| 819 | Ga0495600_0000178 | 3300046809 | Bacteria | 37350 |
| 820 | Ga0495600_0002662 | 3300046809 | Bacteria | 10325 |
| 821 | Ga0495600_0097979 | 3300046809 | Bacteria | 1911 |
| 822 | Ga0495600_0113106 | 3300046809 | Bacteria | 1767 |
| 823 | Ga0495581_0000040 | 3300047315 | Bacteria | 47542 |
| 824 | Ga0495581_0009314 | 3300047315 | Bacteria | 5683 |
| 825 | Ga0495604_0000800 | 3300047317 | Bacteria | 26453 |
| 826 | Ga0495604_0005570 | 3300047317 | Bacteria | 9982 |
| 827 | Ga0495604_0009368 | 3300047317 | Bacteria | 7746 |
| 828 | Ga0495604_0012191 | 3300047317 | Bacteria | 6833 |
| 829 | Ga0495604_0104554 | 3300047317 | Bacteria | 2074 |
| 830 | Ga0495604_0124391 | 3300047317 | Bacteria | 1862 |
| 831 | Ga0495604_0223930 | 3300047317 | Bacteria | 1293 |
| 832 | Ga0495636_0044974 | 3300047318 | Bacteria | 1839 |
| 833 | Ga0495674_0022744 | 3300047319 | Bacteria | 5778 |
| 834 | Ga0495674_0151193 | 3300047319 | Bacteria | 1947 |
| 835 | Ga0495674_0207709 | 3300047319 | Bacteria | 1623 |
| 836 | Ga0495680_0282145 | 3300047322 | Bacteria | 1170 |
| 837 | Ga0495675_0006373 | 3300047444 | Bacteria | 7222 |
| 838 | Ga0495675_0016735 | 3300047444 | Bacteria | 4637 |
| 839 | Ga0495675_0030131 | 3300047444 | Bacteria | 3462 |
| 840 | Ga0495685_044655 | 3300047447 | Bacteria | 1511 |
| 841 | Ga0495684_0282577 | 3300047471 | Bacteria | 1197 |
| 842 | Ga0495593_0019143 | 3300047673 | Bacteria | 3842 |
| 843 | Ga0495602_0023816 | 3300048088 | Bacteria | 5955 |
| 844 | Ga0495614_0021518 | 3300048089 | Bacteria | 2785 |
| 845 | Ga0496101_0009664 | 3300048904 | Bacteria | 6346 |
| 846 | Ga0496101_0065876 | 3300048904 | Bacteria | 2641 |
| 847 | Ga0496102_0020974 | 3300048905 | Bacteria | 5777 |
| 848 | Ga0496102_0081411 | 3300048905 | Bacteria | 2985 |
| 849 | Ga0496102_0108764 | 3300048905 | Bacteria | 2582 |
| 850 | Ga0496102_0171722 | 3300048905 | Bacteria | 2041 |
| 851 | Ga0496102_0377527 | 3300048905 | Bacteria | 1334 |
| 852 | Ga0496102_0425535 | 3300048905 | Bacteria | 1247 |
| 853 | Ga0496102_0452945 | 3300048905 | Bacteria | 1204 |
| 854 | Ga0496103_0036480 | 3300048906 | Bacteria | 3011 |
| 855 | Ga0496103_0203300 | 3300048906 | Bacteria | 1274 |
| 856 | Ga0496104_0124350 | 3300048907 | Bacteria | 2476 |
| 857 | Ga0496105_0043333 | 3300048908 | Bacteria | 3711 |
| 858 | Ga0496106_0023913 | 3300048909 | Bacteria | 4540 |
| 859 | Ga0496106_0042183 | 3300048909 | Bacteria | 3421 |
| 860 | Ga0496107_0038771 | 3300048910 | Bacteria | 3417 |
| 861 | Ga0496107_0188677 | 3300048910 | Bacteria | 1531 |
| 862 | Ga0496107_0246964 | 3300048910 | Bacteria | 1328 |
| 863 | Ga0496108_0019388 | 3300048911 | Bacteria | 5584 |
| 864 | Ga0496108_0250093 | 3300048911 | Bacteria | 1542 |
| 865 | Ga0496109_0010941 | 3300048912 | Bacteria | 7773 |
| 866 | Ga0496109_0023913 | 3300048912 | Bacteria | 5425 |
| 867 | Ga0496109_0054068 | 3300048912 | Bacteria | 3664 |
| 868 | Ga0496109_0231233 | 3300048912 | Bacteria | 1739 |
| 869 | Ga0496109_0285405 | 3300048912 | Bacteria | 1556 |
| 870 | Ga0496110_0020699 | 3300048913 | Bacteria | 5555 |
| 871 | Ga0496110_0366249 | 3300048913 | Bacteria | 1313 |
| 872 | Ga0496111_0047594 | 3300048914 | Bacteria | 3088 |
| 873 | Ga0496111_0048162 | 3300048914 | Bacteria | 3070 |
| 874 | Ga0496111_0071541 | 3300048914 | Bacteria | 2524 |
| 875 | Ga0496112_0017869 | 3300048915 | Bacteria | 6674 |
| 876 | Ga0496112_0072606 | 3300048915 | Bacteria | 3402 |
| 877 | Ga0496112_0141254 | 3300048915 | Bacteria | 2377 |
| 878 | Ga0496112_0311991 | 3300048915 | Bacteria | 1518 |
| 879 | Ga0496112_0315552 | 3300048915 | Bacteria | 1508 |
| 880 | Ga0496113_0010420 | 3300048916 | Bacteria | 6145 |
| 881 | Ga0496113_0056230 | 3300048916 | Bacteria | 2953 |
| 882 | Ga0496113_0268552 | 3300048916 | Bacteria | 1363 |
| 883 | Ga0496114_0044500 | 3300048917 | Bacteria | 3683 |
| 884 | Ga0496114_0058815 | 3300048917 | Bacteria | 3210 |
| 885 | Ga0496114_0135324 | 3300048917 | Bacteria | 2131 |
| 886 | Ga0496114_0177331 | 3300048917 | Bacteria | 1860 |
| 887 | Ga0496115_0013221 | 3300048918 | Bacteria | 6237 |
| 888 | Ga0496115_0079915 | 3300048918 | Bacteria | 2662 |
| 889 | Ga0496116_0000474 | 3300048919 | Bacteria | 55522 |
| 890 | Ga0496117_0010797 | 3300048920 | Bacteria | 8249 |
| 891 | Ga0496117_0034548 | 3300048920 | Bacteria | 3807 |
| 892 | Ga0496118_0000781 | 3300048921 | Bacteria | 51011 |
| 893 | Ga0496118_0015570 | 3300048921 | Bacteria | 7032 |
| 894 | Ga0496119_0004505 | 3300048922 | Bacteria | 13830 |
| 895 | Ga0496124_0101651 | 3300048927 | Bacteria | 2329 |
| 896 | Ga0501291_016764 | 3300049514 | Bacteria | 1121 |
| 897 | Ga0501031_0000115 | 3300049568 | Bacteria | 43139 |
| 898 | Ga0501031_0007958 | 3300049568 | Bacteria | 6900 |
| 899 | Ga0501031_0041878 | 3300049568 | Bacteria | 2990 |
| 900 | Ga0501031_0072043 | 3300049568 | Bacteria | 2250 |
| 901 | Ga0501031_0148899 | 3300049568 | Bacteria | 1529 |
| 902 | Ga0501031_0193384 | 3300049568 | Bacteria | 1328 |
| 903 | Ga0501032_0000052 | 3300049569 | Bacteria | 101001 |
| 904 | Ga0501032_0000872 | 3300049569 | Bacteria | 24521 |
| 905 | Ga0501032_0060474 | 3300049569 | Bacteria | 2540 |
| 906 | Ga0501032_0114967 | 3300049569 | Bacteria | 1779 |
| 907 | Ga0501032_0125585 | 3300049569 | Bacteria | 1695 |
| 908 | Ga0501032_0128804 | 3300049569 | Bacteria | 1670 |
| 909 | Ga0501033_0001762 | 3300049570 | Bacteria | 18926 |
| 910 | Ga0501033_0005593 | 3300049570 | Bacteria | 9930 |
| 911 | Ga0501033_0009214 | 3300049570 | Bacteria | 7601 |
| 912 | Ga0501033_0010098 | 3300049570 | Bacteria | 7245 |
| 913 | Ga0501033_0020037 | 3300049570 | Bacteria | 5056 |
| 914 | Ga0501033_0096484 | 3300049570 | Bacteria | 2160 |
| 915 | Ga0501034_0002674 | 3300049571 | Bacteria | 21031 |
| 916 | Ga0501034_0003126 | 3300049571 | Bacteria | 19067 |
| 917 | Ga0501034_0003912 | 3300049571 | Bacteria | 16734 |
| 918 | Ga0501034_0042386 | 3300049571 | Bacteria | 4607 |
| 919 | Ga0501034_0058411 | 3300049571 | Bacteria | 3877 |
| 920 | Ga0501034_0099515 | 3300049571 | Bacteria | 2902 |
| 921 | Ga0501036_0001596 | 3300049572 | Bacteria | 17545 |
| 922 | Ga0501036_0001835 | 3300049572 | Bacteria | 16492 |
| 923 | Ga0501036_0002136 | 3300049572 | Bacteria | 15421 |
| 924 | Ga0501036_0004954 | 3300049572 | Bacteria | 10765 |
| 925 | Ga0501036_0007977 | 3300049572 | Bacteria | 8664 |
| 926 | Ga0501036_0011181 | 3300049572 | Bacteria | 7427 |
| 927 | Ga0501036_0017286 | 3300049572 | Bacteria | 6028 |
| 928 | Ga0501036_0022220 | 3300049572 | Bacteria | 5336 |
| 929 | Ga0501036_0267546 | 3300049572 | Bacteria | 1432 |
| 930 | Ga0501036_0285553 | 3300049572 | Bacteria | 1381 |
| 931 | Ga0501037_0000046 | 3300049573 | Bacteria | 116524 |
| 932 | Ga0501037_0001427 | 3300049573 | Bacteria | 17526 |
| 933 | Ga0501037_0016043 | 3300049573 | Bacteria | 5513 |
| 934 | Ga0501037_0021174 | 3300049573 | Bacteria | 4804 |
| 935 | Ga0501037_0104384 | 3300049573 | Bacteria | 2043 |
| 936 | Ga0501038_0000068 | 3300049574 | Bacteria | 84886 |
| 937 | Ga0501038_0010363 | 3300049574 | Bacteria | 8528 |
| 938 | Ga0501038_0014618 | 3300049574 | Bacteria | 7152 |
| 939 | Ga0501038_0056014 | 3300049574 | Bacteria | 3386 |
| 940 | Ga0501038_0068510 | 3300049574 | Bacteria | 3016 |
| 941 | Ga0501038_0072376 | 3300049574 | Bacteria | 2921 |
| 942 | Ga0501038_0169816 | 3300049574 | Bacteria | 1766 |
| 943 | Ga0501039_0000362 | 3300049575 | Bacteria | 32461 |
| 944 | Ga0501039_0002635 | 3300049575 | Bacteria | 13398 |
| 945 | Ga0501039_0011902 | 3300049575 | Bacteria | 6630 |
| 946 | Ga0501039_0014225 | 3300049575 | Bacteria | 6093 |
| 947 | Ga0501039_0161714 | 3300049575 | Bacteria | 1760 |
| 948 | Ga0501041_0003245 | 3300049577 | Bacteria | 9354 |
| 949 | Ga0501041_0010412 | 3300049577 | Bacteria | 5481 |
| 950 | Ga0501042_0005655 | 3300049578 | Bacteria | 8068 |
| 951 | Ga0501042_0010326 | 3300049578 | Bacteria | 6254 |
| 952 | Ga0501042_0018124 | 3300049578 | Bacteria | 4871 |
| 953 | Ga0501043_0000783 | 3300049579 | Bacteria | 28276 |
| 954 | Ga0501043_0000785 | 3300049579 | Bacteria | 28257 |
| 955 | Ga0501043_0002726 | 3300049579 | Bacteria | 14768 |
| 956 | Ga0501043_0009599 | 3300049579 | Bacteria | 7581 |
| 957 | Ga0501043_0033694 | 3300049579 | Bacteria | 4030 |
| 958 | Ga0501043_0036588 | 3300049579 | Bacteria | 3862 |
| 959 | Ga0501043_0150790 | 3300049579 | Bacteria | 1819 |
| 960 | Ga0501046_0000102 | 3300049580 | Bacteria | 89938 |
| 961 | Ga0501046_0003286 | 3300049580 | Bacteria | 14854 |
| 962 | Ga0501046_0011973 | 3300049580 | Bacteria | 7401 |
| 963 | Ga0501046_0036275 | 3300049580 | Bacteria | 3969 |
| 964 | Ga0501047_0000327 | 3300049581 | Bacteria | 54775 |
| 965 | Ga0501047_0002504 | 3300049581 | Bacteria | 17509 |
| 966 | Ga0501047_0003586 | 3300049581 | Bacteria | 14645 |
| 967 | Ga0501047_0005305 | 3300049581 | Bacteria | 12108 |
| 968 | Ga0501047_0020357 | 3300049581 | Bacteria | 6371 |
| 969 | Ga0501047_0027822 | 3300049581 | Bacteria | 5448 |
| 970 | Ga0501047_0100599 | 3300049581 | Bacteria | 2770 |
| 971 | Ga0501047_0118040 | 3300049581 | Bacteria | 2534 |
| 972 | Ga0501047_0119289 | 3300049581 | Bacteria | 2520 |
| 973 | Ga0501047_0151207 | 3300049581 | Bacteria | 2197 |
| 974 | Ga0501047_0337040 | 3300049581 | Bacteria | 1346 |
| 975 | Ga0501048_0000006 | 3300049582 | Bacteria | 93252 |
| 976 | Ga0501048_0004360 | 3300049582 | Bacteria | 10770 |
| 977 | Ga0501048_0007307 | 3300049582 | Bacteria | 8375 |
| 978 | Ga0501048_0144963 | 3300049582 | Bacteria | 1680 |
| 979 | Ga0501048_0227848 | 3300049582 | Bacteria | 1322 |
| 980 | Ga0501067_0002695 | 3300049583 | Bacteria | 9799 |
| 981 | Ga0501067_0003477 | 3300049583 | Bacteria | 8656 |
| 982 | Ga0501067_0005126 | 3300049583 | Bacteria | 7278 |
| 983 | Ga0501067_0025636 | 3300049583 | Bacteria | 3268 |
| 984 | Ga0501067_0069808 | 3300049583 | Bacteria | 1945 |
| 985 | Ga0501068_0003083 | 3300049584 | Bacteria | 8901 |
| 986 | Ga0501068_0021718 | 3300049584 | Bacteria | 3751 |
| 987 | Ga0501068_0022413 | 3300049584 | Bacteria | 3693 |
| 988 | Ga0501068_0035562 | 3300049584 | Bacteria | 2974 |
| 989 | Ga0501068_0049650 | 3300049584 | Bacteria | 2535 |
| 990 | Ga0501068_0067976 | 3300049584 | Bacteria | 2172 |
| 991 | Ga0501069_0000146 | 3300049585 | Bacteria | 31605 |
| 992 | Ga0501069_0002076 | 3300049585 | Bacteria | 10077 |
| 993 | Ga0501069_0055070 | 3300049585 | Bacteria | 2215 |
| 994 | Ga0501069_0065550 | 3300049585 | Bacteria | 2031 |
| 995 | Ga0501069_0066183 | 3300049585 | Bacteria | 2021 |
| 996 | Ga0501070_0002259 | 3300049586 | Bacteria | 16929 |
| 997 | Ga0501070_0010017 | 3300049586 | Bacteria | 8018 |
| 998 | Ga0501070_0010181 | 3300049586 | Bacteria | 7959 |
| 999 | Ga0501070_0014063 | 3300049586 | Bacteria | 6737 |
| 1000 | Ga0501070_0041514 | 3300049586 | Bacteria | 3832 |
| 1001 | Ga0501070_0069932 | 3300049586 | Bacteria | 2906 |
| 1002 | Ga0501070_0257476 | 3300049586 | Bacteria | 1427 |
| 1003 | Ga0501071_0001127 | 3300049587 | Bacteria | 14926 |
| 1004 | Ga0501071_0023497 | 3300049587 | Bacteria | 4306 |
| 1005 | Ga0501071_0197455 | 3300049587 | Bacteria | 1510 |
| 1006 | Ga0501071_0202623 | 3300049587 | Bacteria | 1491 |
| 1007 | Ga0501072_0008503 | 3300049588 | Bacteria | 7788 |
| 1008 | Ga0501072_0025371 | 3300049588 | Bacteria | 4618 |
| 1009 | Ga0501072_0027313 | 3300049588 | Bacteria | 4453 |
| 1010 | Ga0501072_0091904 | 3300049588 | Bacteria | 2409 |
| 1011 | Ga0501073_0001270 | 3300049589 | Bacteria | 18521 |
| 1012 | Ga0501073_0015148 | 3300049589 | Bacteria | 5592 |
| 1013 | Ga0501073_0030252 | 3300049589 | Bacteria | 3866 |
| 1014 | Ga0501073_0034575 | 3300049589 | Bacteria | 3596 |
| 1015 | Ga0501073_0040903 | 3300049589 | Bacteria | 3277 |
| 1016 | Ga0501073_0071130 | 3300049589 | Bacteria | 2424 |
| 1017 | Ga0501073_0151222 | 3300049589 | Bacteria | 1609 |
| 1018 | Ga0501074_0000916 | 3300049590 | Bacteria | 18891 |
| 1019 | Ga0501074_0002190 | 3300049590 | Bacteria | 13535 |
| 1020 | Ga0501074_0005053 | 3300049590 | Bacteria | 9465 |
| 1021 | Ga0501074_0009089 | 3300049590 | Bacteria | 7219 |
| 1022 | Ga0501074_0013626 | 3300049590 | Bacteria | 5909 |
| 1023 | Ga0501074_0018664 | 3300049590 | Bacteria | 5040 |
| 1024 | Ga0501076_0003910 | 3300049592 | Bacteria | 10503 |
| 1025 | Ga0501077_0014193 | 3300049593 | Bacteria | 5000 |
| 1026 | Ga0501077_0019104 | 3300049593 | Bacteria | 4333 |
| 1027 | Ga0501079_0010413 | 3300049741 | Bacteria | 7069 |
| 1028 | Ga0501080_0000051 | 3300049742 | Bacteria | 75804 |
| 1029 | Ga0501080_0011811 | 3300049742 | Bacteria | 8002 |
| 1030 | Ga0501080_0037882 | 3300049742 | Bacteria | 4503 |
| 1031 | Ga0501080_0233186 | 3300049742 | Bacteria | 1682 |
| 1032 | Ga0501081_0005680 | 3300049743 | Bacteria | 8073 |
| 1033 | Ga0501083_0005707 | 3300049744 | Bacteria | 8808 |
| 1034 | Ga0501083_0020112 | 3300049744 | Bacteria | 4645 |
| 1035 | Ga0501035_0001405 | 3300049822 | Bacteria | 24717 |
| 1036 | Ga0501035_0007893 | 3300049822 | Bacteria | 9937 |
| 1037 | Ga0501035_0008657 | 3300049822 | Bacteria | 9472 |
| 1038 | Ga0501035_0020910 | 3300049822 | Bacteria | 6014 |
| 1039 | Ga0501035_0036021 | 3300049822 | Bacteria | 4487 |
| 1040 | Ga0501035_0045589 | 3300049822 | Bacteria | 3944 |
| 1041 | Ga0501035_0052798 | 3300049822 | Bacteria | 3636 |
| 1042 | Ga0501035_0060821 | 3300049822 | Bacteria | 3362 |
| 1043 | Ga0501044_0000137 | 3300049823 | Bacteria | 89352 |
| 1044 | Ga0501044_0000976 | 3300049823 | Bacteria | 34361 |
| 1045 | Ga0501044_0015778 | 3300049823 | Bacteria | 8133 |
| 1046 | Ga0501044_0017207 | 3300049823 | Bacteria | 7756 |
| 1047 | Ga0501044_0029117 | 3300049823 | Bacteria | 5824 |
| 1048 | Ga0501044_0031288 | 3300049823 | Bacteria | 5602 |
| 1049 | Ga0501044_0034459 | 3300049823 | Bacteria | 5309 |
| 1050 | Ga0501044_0102587 | 3300049823 | Bacteria | 2876 |
| 1051 | Ga0501044_0103308 | 3300049823 | Bacteria | 2864 |
| 1052 | Ga0501044_0307019 | 3300049823 | Bacteria | 1514 |
| 1053 | Ga0501045_0036204 | 3300049824 | Bacteria | 3583 |
| 1054 | Ga0501045_0044326 | 3300049824 | Bacteria | 3240 |
| 1055 | Ga0501045_0157980 | 3300049824 | Bacteria | 1687 |
| 1056 | nmdc:mga03n38_106910_c1 | 3300050490 | Bacteria | 1357 |
| 1057 | nmdc:mga03n38_18585_c1 | 3300050490 | Bacteria | 2747 |
| 1058 | nmdc:mga00v17_294097_c1 | 3300050491 | Bacteria | 1055 |
| 1059 | nmdc:mga00v17_53709_c1 | 3300050491 | Bacteria | 2456 |
| 1060 | nmdc:mga0yw44_12964_c1 | 3300050492 | Bacteria | 4368 |
| 1061 | nmdc:mga0yw44_1576_c1 | 3300050492 | Bacteria | 9147 |
| 1062 | nmdc:mga0yw44_45472_c1 | 3300050492 | Bacteria | 2632 |
| 1063 | nmdc:mga04h51_14036_c1 | 3300050495 | Bacteria | 2281 |
| 1064 | nmdc:mga07m45_19873_c2 | 3300050496 | Bacteria | 2299 |
| 1065 | nmdc:mga07m45_34847_c1 | 3300050496 | Bacteria | 2799 |
| 1066 | nmdc:mga05p37_102271_c1 | 3300050507 | Bacteria | 3529 |
| 1067 | nmdc:mga05p37_150806_c1 | 3300050507 | Bacteria | 2843 |
| 1068 | nmdc:mga05p37_159676_c1 | 3300050507 | Bacteria | 2753 |
| 1069 | nmdc:mga05p37_171477_c1 | 3300050507 | Bacteria | 2646 |
| 1070 | nmdc:mga05p37_17429_c1 | 3300050507 | Bacteria | 8669 |
| 1071 | nmdc:mga05p37_178_c1 | 3300050507 | Bacteria | 62028 |
| 1072 | nmdc:mga05p37_1839_c1 | 3300050507 | Bacteria | 24733 |
| 1073 | nmdc:mga05p37_23475_c1 | 3300050507 | Bacteria | 7484 |
| 1074 | nmdc:mga05p37_300499_c1 | 3300050507 | Bacteria | 1907 |
| 1075 | nmdc:mga05p37_416057_c1 | 3300050507 | Bacteria | 1565 |
| 1076 | nmdc:mga05p37_68693_c1 | 3300050507 | Bacteria | 2480 |
| 1077 | nmdc:mga05p37_73494_c1 | 3300050507 | Bacteria | 4208 |
| 1078 | nmdc:mga05p37_815_c1 | 3300050507 | Bacteria | 34870 |
| 1079 | nmdc:mga09592_14_c2 | 3300050508 | Bacteria | 34534 |
| 1080 | nmdc:mga09592_1518_c1 | 3300050508 | Bacteria | 18690 |
| 1081 | nmdc:mga09592_178469_c1 | 3300050508 | Bacteria | 1837 |
| 1082 | nmdc:mga09592_428140_c1 | 3300050508 | Bacteria | 1143 |
| 1083 | nmdc:mga09592_4353_c1 | 3300050508 | Bacteria | 11446 |
| 1084 | nmdc:mga0qj67_1167_c1 | 3300050509 | Bacteria | 18189 |
| 1085 | nmdc:mga0qj67_17115_c1 | 3300050509 | Bacteria | 5509 |
| 1086 | nmdc:mga0qj67_2703_c1 | 3300050509 | Bacteria | 12716 |
| 1087 | nmdc:mga0qj67_6067_c1 | 3300050509 | Bacteria | 8852 |
| 1088 | nmdc:mga06r32_1482_c1 | 3300050510 | Bacteria | 21098 |
| 1089 | nmdc:mga06r32_175901_c1 | 3300050510 | Bacteria | 2125 |
| 1090 | nmdc:mga06r32_18_c1 | 3300050510 | Bacteria | 34210 |
| 1091 | nmdc:mga06r32_555_c1 | 3300050510 | Bacteria | 32486 |
| 1092 | nmdc:mga06r32_5891_c1 | 3300050510 | Bacteria | 11031 |
| 1093 | nmdc:mga06r32_8942_c1 | 3300050510 | Bacteria | 9027 |
| 1094 | nmdc:mga06r32_92605_c1 | 3300050510 | Bacteria | 2955 |
| 1095 | nmdc:mga08y16_19086_c1 | 3300050511 | Bacteria | 7224 |
| 1096 | nmdc:mga08y16_2869_c1 | 3300050511 | Bacteria | 17731 |
| 1097 | nmdc:mga08y16_3646_c1 | 3300050511 | Bacteria | 16009 |
| 1098 | nmdc:mga08y16_37998_c1 | 3300050511 | Bacteria | 5055 |
| 1099 | nmdc:mga08y16_524995_c1 | 3300050511 | Bacteria | 1200 |
| 1100 | nmdc:mga08y16_677384_c1 | 3300050511 | Bacteria | 1033 |
| 1101 | nmdc:mga08y16_68388_c1 | 3300050511 | Bacteria | 3703 |
| 1102 | nmdc:mga0n895_116339_c1 | 3300050512 | Bacteria | 2693 |
| 1103 | nmdc:mga0n895_30224_c1 | 3300050512 | Bacteria | 5175 |
| 1104 | nmdc:mga0n895_3057_c1 | 3300050512 | Bacteria | 13297 |
| 1105 | nmdc:mga0n895_44096_c1 | 3300050512 | Bacteria | 4350 |
| 1106 | nmdc:mga0n895_70179_c1 | 3300050512 | Bacteria | 3473 |
| 1107 | nmdc:mga0n895_77420_c1 | 3300050512 | Bacteria | 3309 |
| 1108 | nmdc:mga0rr50_17910_c1 | 3300050513 | Bacteria | 4744 |
| 1109 | nmdc:mga0rr50_200138_c1 | 3300050513 | Bacteria | 1641 |
| 1110 | nmdc:mga0rr50_44979_c1 | 3300050513 | Bacteria | 3242 |
| 1111 | nmdc:mga0rr50_79643_c1 | 3300050513 | Bacteria | 2524 |
| 1112 | nmdc:mga0rr50_9865_c1 | 3300050513 | Bacteria | 6034 |
| 1113 | nmdc:mga08x19_26443_c1 | 3300050514 | Bacteria | 3622 |
| 1114 | nmdc:mga08x19_28889_c1 | 3300050514 | Bacteria | 3476 |
| 1115 | nmdc:mga08x19_52676_c1 | 3300050514 | Bacteria | 2618 |
| 1116 | nmdc:mga08x19_60823_c1 | 3300050514 | Bacteria | 2447 |
| 1117 | nmdc:mga0a205_20399_c1 | 3300050515 | Bacteria | 6252 |
| 1118 | nmdc:mga0a205_206535_c1 | 3300050515 | Bacteria | 1853 |
| 1119 | nmdc:mga0a205_21078_c1 | 3300050515 | Bacteria | 6163 |
| 1120 | nmdc:mga0a205_234254_c1 | 3300050515 | Bacteria | 1719 |
| 1121 | nmdc:mga0a205_6162_c1 | 3300050515 | Bacteria | 10822 |
| 1122 | nmdc:mga0a205_65750_c1 | 3300050515 | Bacteria | 3504 |
| 1123 | Ga0495601_0017205 | 3300053077 | Bacteria | 4389 |
| 1124 | Ga0495601_0061885 | 3300053077 | Bacteria | 2377 |
| 1125 | Ga0495612_0002530 | 3300053078 | Bacteria | 7542 |
| 1126 | Ga0495655_0004943 | 3300053083 | Bacteria | 2320 |
| 1127 | Ga0495619_0063268 | 3300053085 | Bacteria | 2465 |
| 1128 | Ga0500644_0030924 | 3300053088 | Bacteria | 1698 |
| 1129 | Ga0500644_0090365 | 3300053088 | Bacteria | 1145 |
| 1130 | Ga0500646_0000167 | 3300053090 | Bacteria | 19617 |
| 1131 | Ga0500646_0000205 | 3300053090 | Bacteria | 17753 |
| 1132 | Ga0500641_0024919 | 3300053096 | Bacteria | 2311 |
| 1133 | Ga0500641_0026240 | 3300053096 | Bacteria | 2261 |
| 1134 | Ga0500553_000116 | 3300053101 | Bacteria | 22026 |
| 1135 | Ga0500556_0004985 | 3300053104 | Bacteria | 3757 |
| 1136 | Ga0500560_008536 | 3300053107 | Bacteria | 2473 |
| 1137 | Ga0500573_0043418 | 3300053140 | Bacteria | 2594 |
| 1138 | Ga0500573_0043889 | 3300053140 | Bacteria | 2579 |
| 1139 | Ga0500577_0018450 | 3300053142 | Bacteria | 2243 |
| 1140 | Ga0500637_0026467 | 3300053178 | Bacteria | 3196 |
| 1141 | Ga0500645_027931 | 3300053730 | Bacteria | 1710 |
| 1142 | Ga0501084_0000567 | 3300054114 | Bacteria | 28265 |
| 1143 | Ga0501084_0003883 | 3300054114 | Bacteria | 12160 |
| 1144 | Ga0501084_0058067 | 3300054114 | Bacteria | 3237 |
| 1145 | Ga0590075_005905 | 3300059424 | Bacteria | 2896 |
| 1146 | Ga0501082_0036924 | 3300060353 | Bacteria | 4209 |
| 1147 | Ga0501082_0054265 | 3300060353 | Bacteria | 3454 |
| 1148 | Ga0501082_0059903 | 3300060353 | Bacteria | 3280 |
| 1149 | Ga0466962_0002637 | 3300061719 | Bacteria | 8525 |
| 1150 | Ga0466962_0003080 | 3300061719 | Bacteria | 7936 |
| 1151 | Ga0466962_0014836 | 3300061719 | Bacteria | 3753 |
| 1152 | Ga0530510_0459877 | 3300061734 | Bacteria | 963 |
| 1153 | 2676203048 | 2675902999 | Bacteria | 9438463 |
| 1154 | 2501942207 | 2501939600 | Bacteria | 6907073 |
| 1155 | 2508674230 | 2508501039 | Bacteria | 9978592 |
| 1156 | 2515854319 | 2515154155 | Bacteria | 7985436 |
| 1157 | 2524186023 | 2524023129 | Bacteria | 6762600 |
| 1158 | 2559428894 | 2558860280 | Bacteria | 11429938 |
| 1159 | 2587739664 | 2585428059 | Bacteria | 8696589 |
| 1160 | 2616906431 | 2616644941 | Bacteria | 8510691 |
| 1161 | 2644232255 | 2643221641 | Bacteria | 4490190 |
| 1162 | 2644385626 | 2643221670 | Bacteria | 6497041 |
| 1163 | 2644436682 | 2643221678 | Bacteria | 9540101 |
| 1164 | 2644445760 | 2643221679 | Bacteria | 3839507 |
| 1165 | 2644625506 | 2643221714 | Bacteria | 9015452 |
| 1166 | 2671832687 | 2671180195 | Bacteria | 9757215 |
| 1167 | 2676476673 | 2675903058 | Bacteria | 6822861 |
| 1168 | 2676483434 | 2675903059 | Bacteria | 8644972 |
| 1169 | 2686538689 | 2684623035 | Bacteria | 8032739 |
| 1170 | 2689990263 | 2687453743 | Bacteria | 8361025 |
| 1171 | 2740169335 | 2739367898 | Bacteria | 4367674 |
| 1172 | 2753070081 | 2751185734 | Bacteria | 8863695 |
| 1173 | 2753272299 | 2751185782 | Bacteria | 11227053 |
| 1174 | 2774847624 | 2773857921 | Bacteria | 9435764 |
| 1175 | 2774850843 | 2773857922 | Bacteria | 9757215 |
| 1176 | 2774903390 | 2773857933 | Bacteria | 5818019 |
| 1177 | 2808841580 | 2808606359 | Bacteria | 9866990 |
| 1178 | 2816426788 | 2816332119 | Bacteria | 8120218 |
| 1179 | 2816505452 | 2816332139 | Bacteria | 9138787 |
| 1180 | 2819742617 | 2818991472 | Bacteria | 10089953 |
| 1181 | 2848551799 | 2848551377 | Bacteria | 3720646 |
| 1182 | 2855686794 | 2855683550 | Bacteria | 7134265 |
| 1183 | 2856864585 | 2856858025 | Bacteria | 7255264 |
| 1184 | 2857477520 | 2857472729 | Bacteria | 6568124 |
| 1185 | 2858873325 | 2858868258 | Bacteria | 7683772 |
| 1186 | 2861522952 | 2861520306 | Bacteria | 8348283 |
| 1187 | 2861524298 | 2861520306 | Bacteria | 8348283 |
| 1188 | 2862293230 | 2862290372 | Bacteria | 7471434 |
| 1189 | 2862515013 | 2862507626 | Bacteria | 9425308 |
| 1190 | 2867303440 | 2867302475 | Bacteria | 7087181 |
| 1191 | 2867316204 | 2867312974 | Bacteria | 7058875 |
| 1192 | 2867321070 | 2867319477 | Bacteria | 7069771 |
| 1193 | 2867371460 | 2867369537 | Bacteria | 6501581 |
| 1194 | 2867481337 | 2867475112 | Bacteria | 6909112 |
| 1195 | 2870727427 | 2870721527 | Bacteria | 9689237 |
| 1196 | 2887481033 | 2887478801 | Bacteria | 8972725 |
| 1197 | 2895887479 | 2895880812 | Bacteria | 11255272 |
| 1198 | 2902588080 | 2902582711 | Bacteria | 6187705 |
| 1199 | 2904117965 | 2904113452 | Bacteria | 7796941 |
| 1200 | 2919473428 | 2919468124 | Bacteria | 9133025 |
| 1201 | 2935394703 | 2935390628 | Bacteria | 7043367 |
| 1202 | 2946075487 | 2946072368 | Bacteria | 8999607 |
| 1203 | 2990048708 | 2990044586 | Bacteria | 6603797 |
| 1204 | 2990094265 | 2990088156 | Bacteria | 6657676 |
| 1205 | 2995466119 | 2995463766 | Bacteria | 8577691 |
| 1206 | 2996227476 | 2996221748 | Bacteria | 6799777 |
| 1207 | 2997456788 | 2997451912 | Bacteria | 8492419 |
| 1208 | 3003003351 | 3002998708 | Bacteria | 11715108 |
| 1209 | 3006321669 | 3006321560 | Bacteria | 8247479 |
| 1210 | 3006491704 | 3006486233 | Bacteria | 8157040 |
| 1211 | 649813888 | 649633069 | Bacteria | 6962533 |
| 1212 | 8002779266 | 8002775197 | Bacteria | 10728764 |
| 1213 | 8002788849 | 8002784119 | Bacteria | 9788632 |
| 1214 | 8003862066 | 8003856774 | Bacteria | 7675274 |
| 1215 | 8008489807 | 8008485437 | Bacteria | 7198341 |
| 1216 | 8025527419 | 8025524527 | Bacteria | 7197316 |
| 1217 | 8047719384 | 8047710418 | Bacteria | 11023148 |
| 1218 | 8053953006 | 8053945823 | Bacteria | 8962862 |
| 1219 | 8054161095 | 8054160619 | Bacteria | 7783213 |
| 1220 | 8056063567 | 8056060235 | Bacteria | 7259403 |
| 1221 | 8056450893 | 8056447290 | Bacteria | 7680491 |
| 1222 | 8056668080 | 8056667051 | Bacteria | 6953971 |
| 1223 | 8057570939 | 8057568493 | Bacteria | 7221719 |
| 1224 | 8057573300 | 8057568493 | Bacteria | 7221719 |
| 1225 | JGI24740J21852_10030120 | |||
| 1226 | JGI25406J46586_10008109 | |||
| 1227 | Ga0006562J51391_1109263 | |||
| 1228 | Ga0065704_10075364 | |||
| 1229 | Ga0070658_10002128 | |||
| 1230 | Ga0070658_10003610 | |||
| 1231 | Ga0070676_10032042 | |||
| 1232 | Ga0070676_10170399 | |||
| 1233 | Ga0070683_100004647 | |||
| 1234 | Ga0070683_100098404 | |||
| 1235 | Ga0070670_100301114 | |||
| 1236 | Ga0068869_100013851 | |||
| 1237 | Ga0068869_100021890 | |||
| 1238 | Ga0068869_100023099 | |||
| 1239 | Ga0068869_100248774 | |||
| 1240 | Ga0068869_100318843 | |||
| 1241 | Ga0070680_100023832 | |||
| 1242 | Ga0070680_100274494 | |||
| 1243 | Ga0070682_100006150 | |||
| 1244 | Ga0068868_100006011 | |||
| 1245 | Ga0068868_100077093 | |||
| 1246 | Ga0068868_100277931 | |||
| 1247 | Ga0070660_100029985 | |||
| 1248 | Ga0070660_100064245 | |||
| 1249 | Ga0070660_100084966 | |||
| 1250 | Ga0070691_10003836 | |||
| 1251 | Ga0070691_10010580 | |||
| 1252 | Ga0070661_100085500 | |||
| 1253 | Ga0070661_100176452 | |||
| 1254 | Ga0070692_10021226 | |||
| 1255 | Ga0070692_10029569 | |||
| 1256 | Ga0070668_100020231 | |||
| 1257 | Ga0070668_100090532 | |||
| 1258 | Ga0070669_100025062 | |||
| 1259 | Ga0070675_100004065 | |||
| 1260 | Ga0070671_100001993 | |||
| 1261 | Ga0070688_100037812 | |||
| 1262 | Ga0070659_100006159 | |||
| 1263 | Ga0070659_100023614 | |||
| 1264 | Ga0070667_100338358 | |||
| 1265 | Ga0070714_100003209 | |||
| 1266 | Ga0070714_100016998 | |||
| 1267 | Ga0070714_100021665 | |||
| 1268 | Ga0070714_100332374 | |||
| 1269 | Ga0070714_100443245 | |||
| 1270 | Ga0070713_100143230 | |||
| 1271 | Ga0070710_10000775 | |||
| 1272 | Ga0070701_10027921 | |||
| 1273 | Ga0070711_100083947 | |||
| 1274 | Ga0070705_100011854 | |||
| 1275 | Ga0070705_100041044 | |||
| 1276 | Ga0070705_100041631 | |||
| 1277 | Ga0070700_100012214 | |||
| 1278 | Ga0070708_100063505 | |||
| 1279 | Ga0070708_100086149 | |||
| 1280 | Ga0070708_100092416 | |||
| 1281 | Ga0070708_100206017 | |||
| 1282 | Ga0070708_100239624 | |||
| 1283 | Ga0070708_100400670 | |||
| 1284 | Ga0070663_100017361 | |||
| 1285 | Ga0070663_100031316 | |||
| 1286 | Ga0070663_100208902 | |||
| 1287 | Ga0070663_100310180 | |||
| 1288 | Ga0070678_100001267 | |||
| 1289 | Ga0070678_100068564 | |||
| 1290 | Ga0070678_100183110 | |||
| 1291 | Ga0070681_10051198 | |||
| 1292 | Ga0070681_10052482 | |||
| 1293 | Ga0070681_10108742 | |||
| 1294 | Ga0070681_10381085 | |||
| 1295 | Ga0070685_10251935 | |||
| 1296 | Ga0070706_100092923 | |||
| 1297 | Ga0070707_100024129 | |||
| 1298 | Ga0070707_100047075 | |||
| 1299 | Ga0070707_100093846 | |||
| 1300 | Ga0070707_100099103 | |||
| 1301 | Ga0070707_100151759 | |||
| 1302 | Ga0070707_100265591 | |||
| 1303 | Ga0070698_100001988 | |||
| 1304 | Ga0070698_100014445 | |||
| 1305 | Ga0070698_100019295 | |||
| 1306 | Ga0070698_100134247 | |||
| 1307 | Ga0070698_100256648 | |||
| 1308 | Ga0070699_100000014 | |||
| 1309 | Ga0070699_100009053 | |||
| 1310 | Ga0070699_100011634 | |||
| 1311 | Ga0070699_100059992 | |||
| 1312 | Ga0070699_100107366 | |||
| 1313 | Ga0070699_100380682 | |||
| 1314 | Ga0070679_100020925 | |||
| 1315 | Ga0070679_100047023 | |||
| 1316 | Ga0070679_100065358 | |||
| 1317 | Ga0070679_100124012 | |||
| 1318 | Ga0070679_100318480 | |||
| 1319 | Ga0070679_100346854 | |||
| 1320 | Ga0070684_100002845 | |||
| 1321 | Ga0070684_100118682 | |||
| 1322 | Ga0070684_100142336 | |||
| 1323 | Ga0070684_100184394 | |||
| 1324 | Ga0070697_100192092 | |||
| 1325 | Ga0068853_100017236 | |||
| 1326 | Ga0068853_100061176 | |||
| 1327 | Ga0068853_100098148 | |||
| 1328 | Ga0068853_100125058 | |||
| 1329 | Ga0070686_100091295 | |||
| 1330 | Ga0070695_100016847 | |||
| 1331 | Ga0070696_100168747 | |||
| 1332 | Ga0070696_100231302 | |||
| 1333 | Ga0070693_100002045 | |||
| 1334 | Ga0070665_100001502 | |||
| 1335 | Ga0070665_100025806 | |||
| 1336 | Ga0070665_100375697 | |||
| 1337 | Ga0070704_100116968 | |||
| 1338 | Ga0070704_100175124 | |||
| 1339 | Ga0068855_100002943 | |||
| 1340 | Ga0068855_100003272 | |||
| 1341 | Ga0068855_100011259 | |||
| 1342 | Ga0068855_100028270 | |||
| 1343 | Ga0068855_100261862 | |||
| 1344 | Ga0070664_100003004 | |||
| 1345 | Ga0070664_100163364 | |||
| 1346 | Ga0068857_100005857 | |||
| 1347 | Ga0068857_100016349 | |||
| 1348 | Ga0068857_100082226 | |||
| 1349 | Ga0068857_100150512 | |||
| 1350 | Ga0068857_100168509 | |||
| 1351 | Ga0068854_100000001 | |||
| 1352 | Ga0068854_100006613 | |||
| 1353 | Ga0068856_100032941 | |||
| 1354 | Ga0068856_100050737 | |||
| 1355 | Ga0068856_100058806 | |||
| 1356 | Ga0068856_100251915 | |||
| 1357 | Ga0068856_100356445 | |||
| 1358 | Ga0070702_100002421 | |||
| 1359 | Ga0068852_100041338 | |||
| 1360 | Ga0068852_100075664 | |||
| 1361 | Ga0068852_100093961 | |||
| 1362 | Ga0068859_100000054 | |||
| 1363 | Ga0068859_100142290 | |||
| 1364 | Ga0068859_100157915 | |||
| 1365 | Ga0068864_100010703 | |||
| 1366 | Ga0068864_100038517 | |||
| 1367 | Ga0068864_100180367 | |||
| 1368 | Ga0068864_100198574 | |||
| 1369 | Ga0068864_100384341 | |||
| 1370 | Ga0068861_100083856 | |||
| 1371 | Ga0068861_100282245 | |||
| 1372 | Ga0068870_10000527 | |||
| 1373 | Ga0068870_10075996 | |||
| 1374 | Ga0068863_100002724 | |||
| 1375 | Ga0068863_100016498 | |||
| 1376 | Ga0068863_100073397 | |||
| 1377 | Ga0068858_100069663 | |||
| 1378 | Ga0068858_100264415 | |||
| 1379 | Ga0068858_100314483 | |||
| 1380 | Ga0068858_100347344 | |||
| 1381 | Ga0068860_100100556 | |||
| 1382 | Ga0068862_100000037 | |||
| 1383 | Ga0068862_100016913 | |||
| 1384 | Ga0068862_100115331 | |||
| 1385 | Ga0081455_10002734 | |||
| 1386 | Ga0081455_10009950 | |||
| 1387 | Ga0081455_10082302 | |||
| 1388 | Ga0081538_10134667 | |||
| 1389 | Ga0081539_10000364 | |||
| 1390 | Ga0081539_10000447 | |||
| 1391 | Ga0081539_10004113 | |||
| 1392 | Ga0075365_10059063 | |||
| 1393 | Ga0075365_10099899 | |||
| 1394 | Ga0075365_10170853 | |||
| 1395 | Ga0075365_10217726 | |||
| 1396 | Ga0075368_10001870 | |||
| 1397 | Ga0075363_100004732 | |||
| 1398 | Ga0075363_100049348 | |||
| 1399 | Ga0075364_10013390 | |||
| 1400 | Ga0075364_10116147 | |||
| 1401 | Ga0075432_10057297 | |||
| 1402 | Ga0070716_100005011 | |||
| 1403 | Ga0070716_100239250 | |||
| 1404 | Ga0075362_10024379 | |||
| 1405 | Ga0097621_100144738 | |||
| 1406 | Ga0068871_100025364 | |||
| 1407 | Ga0075428_100000006 | |||
| 1408 | Ga0075428_100001979 | |||
| 1409 | Ga0075428_100009926 | |||
| 1410 | Ga0075428_100028992 | |||
| 1411 | Ga0075428_100050574 | |||
| 1412 | Ga0075428_100113278 | |||
| 1413 | Ga0075428_100193527 | |||
| 1414 | Ga0075428_100229677 | |||
| 1415 | Ga0075428_100317267 | |||
| 1416 | Ga0075430_100001233 | |||
| 1417 | Ga0075430_100001764 | |||
| 1418 | Ga0075430_100018773 | |||
| 1419 | Ga0075430_100022712 | |||
| 1420 | Ga0075430_100034453 | |||
| 1421 | Ga0075430_100364673 | |||
| 1422 | Ga0075431_100003806 | |||
| 1423 | Ga0075431_100006015 | |||
| 1424 | Ga0075431_100018026 | |||
| 1425 | Ga0075431_100031642 | |||
| 1426 | Ga0075431_100032158 | |||
| 1427 | Ga0075431_100093757 | |||
| 1428 | Ga0075431_100153717 | |||
| 1429 | Ga0075433_10000529 | |||
| 1430 | Ga0075433_10003481 | |||
| 1431 | Ga0075433_10005330 | |||
| 1432 | Ga0075433_10016491 | |||
| 1433 | Ga0075433_10098793 | |||
| 1434 | Ga0075433_10099415 | |||
| 1435 | Ga0075434_100008277 | |||
| 1436 | Ga0075434_100021611 | |||
| 1437 | Ga0075434_100089201 | |||
| 1438 | Ga0075434_100125364 | |||
| 1439 | Ga0075434_100176048 | |||
| 1440 | Ga0075429_100001818 | |||
| 1441 | Ga0075429_100008473 | |||
| 1442 | Ga0075429_100008552 | |||
| 1443 | Ga0075429_100010603 | |||
| 1444 | Ga0075429_100036712 | |||
| 1445 | Ga0075429_100061359 | |||
| 1446 | Ga0075429_100137690 | |||
| 1447 | Ga0075429_100226856 | |||
| 1448 | Ga0075429_100399310 | |||
| 1449 | Ga0075429_100438320 | |||
| 1450 | Ga0068865_100029500 | |||
| 1451 | Ga0068865_100406103 | |||
| 1452 | Ga0075436_100000719 | |||
| 1453 | Ga0075436_100026256 | |||
| 1454 | Ga0075436_100122163 | |||
| 1455 | Ga0097620_100000054 | |||
| 1456 | Ga0097620_100142287 | |||
| 1457 | Ga0097620_100157917 | |||
| 1458 | Ga0075435_100001179 | |||
| 1459 | Ga0075435_100013874 | |||
| 1460 | Ga0075435_100034172 | |||
| 1461 | Ga0075435_100047646 | |||
| 1462 | Ga0075435_100056230 | |||
| 1463 | Ga0075435_100191651 | |||
| 1464 | Ga0075435_100207584 | |||
| 1465 | Ga0075435_100261610 | |||
| 1466 | Ga0105240_10005833 | |||
| 1467 | Ga0105240_10015490 | |||
| 1468 | Ga0105240_10069876 | |||
| 1469 | Ga0105240_10165169 | |||
| 1470 | Ga0111539_10022401 | |||
| 1471 | Ga0111539_10040672 | |||
| 1472 | Ga0111539_10062336 | |||
| 1473 | Ga0111539_10064998 | |||
| 1474 | Ga0111539_10089831 | |||
| 1475 | Ga0111539_10157350 | |||
| 1476 | Ga0111539_10254320 | |||
| 1477 | Ga0111539_10572424 | |||
| 1478 | Ga0111539_10830668 | |||
| 1479 | Ga0105245_10004191 | |||
| 1480 | Ga0105245_10009816 | |||
| 1481 | Ga0105245_10034197 | |||
| 1482 | Ga0105245_10312155 | |||
| 1483 | Ga0105245_10460145 | |||
| 1484 | Ga0114129_10000004 | |||
| 1485 | Ga0114129_10000050 | |||
| 1486 | Ga0114129_10002267 | |||
| 1487 | Ga0114129_10004085 | |||
| 1488 | Ga0114129_10005032 | |||
| 1489 | Ga0114129_10054859 | |||
| 1490 | Ga0114129_10077578 | |||
| 1491 | Ga0114129_10089605 | |||
| 1492 | Ga0114129_10132360 | |||
| 1493 | Ga0114129_10139045 | |||
| 1494 | Ga0114129_10154146 | |||
| 1495 | Ga0114129_10227573 | |||
| 1496 | Ga0114129_10270569 | |||
| 1497 | Ga0114129_10378608 | |||
| 1498 | Ga0114129_10903119 | |||
| 1499 | Ga0105243_10142023 | |||
| 1500 | Ga0105243_10609529 | |||
| 1501 | Ga0105241_10002402 | |||
| 1502 | Ga0105241_10006773 | |||
| 1503 | Ga0105242_10065950 | |||
| 1504 | Ga0105242_10101799 | |||
| 1505 | Ga0105248_10000018 | |||
| 1506 | Ga0105248_10064419 | |||
| 1507 | Ga0105248_10099938 | |||
| 1508 | Ga0105248_10227451 | |||
| 1509 | Ga0105248_10243325 | |||
| 1510 | Ga0105237_10139516 | |||
| 1511 | Ga0105237_10338072 | |||
| 1512 | Ga0105237_10437115 | |||
| 1513 | Ga0105238_10037303 | |||
| 1514 | Ga0105249_10005207 | |||
| 1515 | Ga0105249_10043006 | |||
| 1516 | Ga0105249_10166828 | |||
| 1517 | Ga0105249_10358456 | |||
| 1518 | Ga0105239_10001401 | |||
| 1519 | Ga0105239_10123712 | |||
| 1520 | Ga0105239_10247704 | |||
| 1521 | Ga0105246_10000043 | |||
| 1522 | Ga0105246_10018753 | |||
| 1523 | Ga0105246_10226677 | |||
| 1524 | Ga0157373_10028008 | |||
| 1525 | Ga0157373_10053563 | |||
| 1526 | Ga0157371_10004316 | |||
| 1527 | Ga0157370_10036631 | |||
| 1528 | Ga0157369_10010249 | |||
| 1529 | Ga0157369_10019495 | |||
| 1530 | Ga0157369_10041192 | |||
| 1531 | Ga0157374_10091348 | |||
| 1532 | Ga0157374_10324572 | |||
| 1533 | Ga0157378_10191578 | |||
| 1534 | Ga0163162_10024427 | |||
| 1535 | Ga0163162_10083227 | |||
| 1536 | Ga0157372_10003488 | |||
| 1537 | Ga0157372_10028325 | |||
| 1538 | Ga0157372_10263775 | |||
| 1539 | Ga0157375_10106921 | |||
| 1540 | Ga0157375_10125173 | |||
| 1541 | Ga0157375_10382192 | |||
| 1542 | Ga0157375_10457802 | |||
| 1543 | Ga0163163_10033828 | |||
| 1544 | Ga0163163_10091573 | |||
| 1545 | Ga0163163_10109199 | |||
| 1546 | Ga0163163_10110734 | |||
| 1547 | Ga0163163_10153726 | |||
| 1548 | Ga0157380_10332990 | |||
| 1549 | Ga0157377_10008166 | |||
| 1550 | Ga0157377_10052744 | |||
| 1551 | Ga0157377_10150666 | |||
| 1552 | Ga0157379_10536148 | |||
| 1553 | Ga0157376_10462266 | |||
| 1554 | Ga0206356_10202247 | |||
| 1555 | Ga0213873_10009109 | |||
| 1556 | Ga0213873_10015007 | |||
| 1557 | Ga0213873_10034310 | |||
| 1558 | Ga0213872_10003060 | |||
| 1559 | Ga0213872_10094699 | |||
| 1560 | Ga0213874_10002416 | |||
| 1561 | Ga0213874_10008293 | |||
| 1562 | Ga0213874_10030048 | |||
| 1563 | Ga0213876_10000392 | |||
| 1564 | Ga0213876_10015196 | |||
| 1565 | Ga0213876_10041304 | |||
| 1566 | Ga0213876_10089653 | |||
| 1567 | Ga0213876_10094785 | |||
| 1568 | Ga0213875_10000001 | |||
| 1569 | Ga0213875_10000563 | |||
| 1570 | Ga0213875_10003758 | |||
| 1571 | Ga0213875_10004499 | |||
| 1572 | Ga0213875_10043724 | |||
| 1573 | Ga0213875_10076058 | |||
| 1574 | Ga0213871_10003379 | |||
| 1575 | Ga0213871_10008924 | |||
| 1576 | Ga0213871_10012597 | |||
| 1577 | Ga0213871_10026748 | |||
| 1578 | Ga0207426_1000811 | |||
| 1579 | Ga0207426_1005346 | |||
| 1580 | Ga0207692_10126433 | |||
| 1581 | Ga0207688_10004787 | |||
| 1582 | Ga0207688_10005818 | |||
| 1583 | Ga0207688_10024320 | |||
| 1584 | Ga0207647_10035183 | |||
| 1585 | Ga0207699_10080877 | |||
| 1586 | Ga0207645_10028939 | |||
| 1587 | Ga0207645_10059072 | |||
| 1588 | Ga0207645_10186915 | |||
| 1589 | Ga0207643_10000255 | |||
| 1590 | Ga0207643_10006057 | |||
| 1591 | Ga0207705_10001884 | |||
| 1592 | Ga0207705_10005307 | |||
| 1593 | Ga0207705_10017368 | |||
| 1594 | Ga0207705_10041114 | |||
| 1595 | Ga0207705_10050948 | |||
| 1596 | Ga0207684_10007467 | |||
| 1597 | Ga0207684_10081761 | |||
| 1598 | Ga0207684_10133326 | |||
| 1599 | Ga0207654_10026303 | |||
| 1600 | Ga0207654_10188316 | |||
| 1601 | Ga0207707_10065837 | |||
| 1602 | Ga0207707_10069855 | |||
| 1603 | Ga0207707_10140946 | |||
| 1604 | Ga0207695_10002892 | |||
| 1605 | Ga0207695_10039707 | |||
| 1606 | Ga0207695_10194408 | |||
| 1607 | Ga0207671_10000492 | |||
| 1608 | Ga0207671_10092368 | |||
| 1609 | Ga0207671_10119397 | |||
| 1610 | Ga0207693_10313042 | |||
| 1611 | Ga0207663_10069250 | |||
| 1612 | Ga0207663_10230367 | |||
| 1613 | Ga0207660_10191671 | |||
| 1614 | Ga0207660_10326112 | |||
| 1615 | Ga0207657_10017156 | |||
| 1616 | Ga0207657_10017298 | |||
| 1617 | Ga0207657_10035544 | |||
| 1618 | Ga0207657_10043946 | |||
| 1619 | Ga0207649_10014228 | |||
| 1620 | Ga0207649_10029333 | |||
| 1621 | Ga0207652_10007647 | |||
| 1622 | Ga0207652_10030737 | |||
| 1623 | Ga0207652_10315662 | |||
| 1624 | Ga0207646_10012726 | |||
| 1625 | Ga0207646_10029254 | |||
| 1626 | Ga0207646_10137222 | |||
| 1627 | Ga0207646_10140434 | |||
| 1628 | Ga0207646_10250578 | |||
| 1629 | Ga0207646_10271504 | |||
| 1630 | Ga0207681_10152156 | |||
| 1631 | Ga0207694_10002567 | |||
| 1632 | Ga0207694_10025522 | |||
| 1633 | Ga0207694_10028556 | |||
| 1634 | Ga0207650_10018346 | |||
| 1635 | Ga0207650_10066617 | |||
| 1636 | Ga0207659_10002694 | |||
| 1637 | Ga0207659_10310316 | |||
| 1638 | Ga0207687_10006625 | |||
| 1639 | Ga0207687_10043025 | |||
| 1640 | Ga0207687_10222120 | |||
| 1641 | Ga0207700_10173293 | |||
| 1642 | Ga0207700_10205849 | |||
| 1643 | Ga0207700_10485516 | |||
| 1644 | Ga0207664_10019225 | |||
| 1645 | Ga0207664_10030674 | |||
| 1646 | Ga0207664_10076997 | |||
| 1647 | Ga0207664_10449181 | |||
| 1648 | Ga0207664_10533911 | |||
| 1649 | Ga0207644_10033748 | |||
| 1650 | Ga0207690_10013870 | |||
| 1651 | Ga0207690_10015584 | |||
| 1652 | Ga0207690_10180298 | |||
| 1653 | Ga0207706_10077313 | |||
| 1654 | Ga0207706_10092644 | |||
| 1655 | Ga0207686_10164509 | |||
| 1656 | Ga0207709_10094864 | |||
| 1657 | Ga0207709_10141404 | |||
| 1658 | Ga0207669_10352314 | |||
| 1659 | Ga0207704_10011020 | |||
| 1660 | Ga0207665_10005460 | |||
| 1661 | Ga0207691_10035406 | |||
| 1662 | Ga0207711_10000313 | |||
| 1663 | Ga0207711_10088724 | |||
| 1664 | Ga0207689_10005049 | |||
| 1665 | Ga0207689_10028236 | |||
| 1666 | Ga0207661_10005765 | |||
| 1667 | Ga0207661_10023643 | |||
| 1668 | Ga0207661_10131900 | |||
| 1669 | Ga0207661_10149418 | |||
| 1670 | Ga0207661_10220389 | |||
| 1671 | Ga0207661_10401432 | |||
| 1672 | Ga0207679_10058656 | |||
| 1673 | Ga0207679_10085332 | |||
| 1674 | Ga0207679_10368156 | |||
| 1675 | Ga0207667_10000018 | |||
| 1676 | Ga0207667_10007907 | |||
| 1677 | Ga0207667_10009879 | |||
| 1678 | Ga0207667_10032464 | |||
| 1679 | Ga0207667_10146658 | |||
| 1680 | Ga0207667_10167382 | |||
| 1681 | Ga0207667_10351792 | |||
| 1682 | Ga0207712_10003342 | |||
| 1683 | Ga0207712_10042746 | |||
| 1684 | Ga0207712_10058717 | |||
| 1685 | Ga0207712_10102291 | |||
| 1686 | Ga0207668_10003497 | |||
| 1687 | Ga0207640_10000003 | |||
| 1688 | Ga0207640_10028362 | |||
| 1689 | Ga0207677_10055756 | |||
| 1690 | Ga0207703_10081605 | |||
| 1691 | Ga0207703_10164053 | |||
| 1692 | Ga0207639_10012194 | |||
| 1693 | Ga0207678_10000346 | |||
| 1694 | Ga0207678_10006802 | |||
| 1695 | Ga0207678_10031327 | |||
| 1696 | Ga0207708_10005711 | |||
| 1697 | Ga0207708_10034322 | |||
| 1698 | Ga0207708_10221244 | |||
| 1699 | Ga0207702_10000631 | |||
| 1700 | Ga0207702_10054568 | |||
| 1701 | Ga0207702_10061875 | |||
| 1702 | Ga0207702_10224978 | |||
| 1703 | Ga0207641_10004672 | |||
| 1704 | Ga0207641_10008384 | |||
| 1705 | Ga0207641_10042093 | |||
| 1706 | Ga0207648_10022678 | |||
| 1707 | Ga0207648_10116813 | |||
| 1708 | Ga0207648_10206407 | |||
| 1709 | Ga0207648_10417569 | |||
| 1710 | Ga0207676_10025873 | |||
| 1711 | Ga0207676_10193310 | |||
| 1712 | Ga0207676_10552279 | |||
| 1713 | Ga0207674_10001502 | |||
| 1714 | Ga0207674_10021127 | |||
| 1715 | Ga0207674_10049528 | |||
| 1716 | Ga0207674_10062455 | |||
| 1717 | Ga0207674_10079185 | |||
| 1718 | Ga0207674_10176858 | |||
| 1719 | Ga0207675_100029374 | |||
| 1720 | Ga0207683_10000342 | |||
| 1721 | Ga0207683_10094863 | |||
| 1722 | Ga0207698_10025503 | |||
| 1723 | Ga0207698_10066856 | |||
| 1724 | Ga0207698_10071393 | |||
| 1725 | Ga0207698_10120705 | |||
| 1726 | Ga0209813_10006654 | |||
| 1727 | Ga0207428_10000213 | |||
| 1728 | Ga0207428_10013436 | |||
| 1729 | Ga0207428_10028679 | |||
| 1730 | Ga0265356_1000276 | |||
| 1731 | Ga0268266_10030662 | |||
| 1732 | Ga0268266_10173281 | |||
| 1733 | Ga0268266_10350945 | |||
| 1734 | Ga0268265_10000008 | |||
| 1735 | Ga0268265_10010617 | |||
| 1736 | Ga0268265_10057623 | |||
| 1737 | Ga0268265_10061613 | |||
| 1738 | Ga0268265_10067603 | |||
| 1739 | Ga0268265_10184166 | |||
| 1740 | Ga0268264_10434152 | |||
| 1741 | Ga0265334_10026764 | |||
| 1742 | Ga0307515_10004662 | |||
| 1743 | Ga0307515_10004732 | |||
| 1744 | Ga0307515_10021895 | |||
| 1745 | Ga0307515_10030848 | |||
| 1746 | Ga0307515_10078253 | |||
| 1747 | Ga0307515_10080122 | |||
| 1748 | Ga0307515_10102556 | |||
| 1749 | Ga0265338_10000157 | |||
| 1750 | Ga0265338_10023339 | |||
| 1751 | Ga0265338_10027991 | |||
| 1752 | Ga0265338_10073751 | |||
| 1753 | Ga0265324_10077017 | |||
| 1754 | Ga0237817_10142 | |||
| 1755 | Ga0307511_10000068 | |||
| 1756 | Ga0307512_10002870 | |||
| 1757 | Ga0307512_10007686 | |||
| 1758 | Ga0307512_10020139 | |||
| 1759 | Ga0307512_10037274 | |||
| 1760 | Ga0307512_10117234 | |||
| 1761 | Ga0316177_1163023 | |||
| 1762 | Ga0314311_1152082 | |||
| 1763 | Ga0316178_1125740 | |||
| 1764 | Ga0316180_1088936 | |||
| 1765 | Ga0265760_10032833 | |||
| 1766 | Ga0265332_10016284 | |||
| 1767 | Ga0265328_10034544 | |||
| 1768 | Ga0265325_10000121 | |||
| 1769 | Ga0265325_10020563 | |||
| 1770 | Ga0265340_10024843 | |||
| 1771 | Ga0265339_10033397 | |||
| 1772 | Ga0265339_10087508 | |||
| 1773 | Ga0265316_10003591 | |||
| 1774 | Ga0307513_10001964 | |||
| 1775 | Ga0307513_10046888 | |||
| 1776 | Ga0307509_10080709 | |||
| 1777 | Ga0307509_10100779 | |||
| 1778 | Ga0265313_10000136 | |||
| 1779 | Ga0307508_10002257 | |||
| 1780 | Ga0307508_10003547 | |||
| 1781 | Ga0307508_10006649 | |||
| 1782 | Ga0307508_10083289 | |||
| 1783 | Ga0307514_10028499 | |||
| 1784 | Ga0265342_10002122 | |||
| 1785 | Ga0265342_10005561 | |||
| 1786 | Ga0307516_10005035 | |||
| 1787 | Ga0307516_10006276 | |||
| 1788 | Ga0307516_10012708 | |||
| 1789 | Ga0307516_10015935 | |||
| 1790 | Ga0307516_10017555 | |||
| 1791 | Ga0307516_10026185 | |||
| 1792 | Ga0307516_10048379 | |||
| 1793 | Ga0307413_10046724 | |||
| 1794 | Ga0307413_10050002 | |||
| 1795 | Ga0307410_10021650 | |||
| 1796 | Ga0307410_10034314 | |||
| 1797 | Ga0307406_10031439 | |||
| 1798 | Ga0307406_10116453 | |||
| 1799 | Ga0307407_10097222 | |||
| 1800 | Ga0307409_100012482 | |||
| 1801 | Ga0307409_100029090 | |||
| 1802 | Ga0307409_100091047 | |||
| 1803 | Ga0307409_100297883 | |||
| 1804 | Ga0307416_100073061 | |||
| 1805 | Ga0307411_10076178 | |||
| 1806 | Ga0307415_100008771 | |||
| 1807 | Ga0307415_100023226 | |||
| 1808 | Ga0307415_100042054 | |||
| 1809 | Ga0307415_100057450 | |||
| 1810 | Ga0307415_100114205 | |||
| 1811 | Ga0307507_10072905 | |||
| 1812 | Ga0307510_10159385 | |||
| 1813 | Ga0307510_10164335 | |||
| 1814 | Ga0373940_0028742 | |||
| 1815 | Ga0373951_0000228 | |||
| 1816 | Ga0373932_0071632 | |||
| 1817 | Ga0373942_0000477 | |||
| 1818 | Ga0373931_0023595 | |||
| 1819 | Ga0373935_0019960 | |||
| 1820 | Ga0373927_0000164 | |||
| 1821 | Ga0373937_0101745 | |||
| 1822 | Ga0373925_0020290 | |||
| 1823 | Ga0395899_0016934 | |||
| 1824 | Ga0395899_0037324 | |||
| 1825 | Ga0395900_0029675 | |||
| 1826 | Ga0395900_0121557 | |||
| 1827 | Ga0395900_0194038 | |||
| 1828 | Ga0395900_0267543 | |||
| 1829 | Ga0395900_0914544 | |||
| 1830 | Ga0395898_0009560 | |||
| 1831 | Ga0395898_0075347 | |||
| 1832 | Ga0395898_0090014 | |||
| 1833 | Ga0395898_0290461 | |||
| 1834 | Ga0395905_0030937 | |||
| 1835 | Ga0395905_0535822 | |||
| 1836 | Ga0436364_0031147 | |||
| 1837 | Ga0436364_0056800 | |||
| 1838 | Ga0436364_0130866 | |||
| 1839 | Ga0436364_0258512 | |||
| 1840 | Ga0436364_0273345 | |||
| 1841 | Ga0436364_0306718 | |||
| 1842 | Ga0436364_0381375 | |||
| 1843 | Ga0436364_0817615 | |||
| 1844 | Ga0436364_0830434 | |||
| 1845 | Ga0436364_1286690 | |||
| 1846 | Ga0436364_1436469 | |||
| 1847 | Ga0436364_1499753 | |||
| 1848 | Ga0436364_1550326 | |||
| 1849 | Ga0395901_0005476 | |||
| 1850 | Ga0395901_0010309 | |||
| 1851 | Ga0395901_0066823 | |||
| 1852 | Ga0395901_0102002 | |||
| 1853 | Ga0395901_0121835 | |||
| 1854 | Ga0395901_0309463 | |||
| 1855 | Ga0400485_01398 | |||
| 1856 | Ga0400483_051011 | |||
| 1857 | Ga0400483_146421 | |||
| 1858 | Ga0400483_281577 | |||
| 1859 | Ga0436365_0196318 | |||
| 1860 | Ga0436365_0853215 | |||
| 1861 | Ga0436365_0934173 | |||
| 1862 | Ga0436365_0980504 | |||
| 1863 | Ga0436365_1206342 | |||
| 1864 | Ga0436365_1493597 | |||
| 1865 | Ga0436365_1589201 | |||
| 1866 | Ga0436365_1607019 | |||
| 1867 | Ga0436360_0009449 | |||
| 1868 | Ga0436360_0037933 | |||
| 1869 | Ga0436360_0098126 | |||
| 1870 | Ga0436360_0141554 | |||
| 1871 | Ga0436360_0153847 | |||
| 1872 | Ga0436360_0412872 | |||
| 1873 | Ga0436360_0581232 | |||
| 1874 | Ga0436360_0930976 | |||
| 1875 | Ga0436360_1004013 | |||
| 1876 | Ga0436360_1038089 | |||
| 1877 | Ga0436360_1093826 | |||
| 1878 | Ga0436360_1197386 | |||
| 1879 | Ga0436360_1228528 | |||
| 1880 | Ga0436361_0303992 | |||
| 1881 | Ga0436361_0353974 | |||
| 1882 | Ga0436361_0493910 | |||
| 1883 | Ga0436361_0571302 | |||
| 1884 | Ga0436361_0684318 | |||
| 1885 | Ga0436361_0787384 | |||
| 1886 | Ga0436361_0790320 | |||
| 1887 | Ga0436361_0913090 | |||
| 1888 | Ga0436361_1210671 | |||
| 1889 | Ga0436363_0032621 | |||
| 1890 | Ga0436363_0082939 | |||
| 1891 | Ga0436363_0170474 | |||
| 1892 | Ga0436363_0356929 | |||
| 1893 | Ga0436363_0452825 | |||
| 1894 | Ga0436363_0629336 | |||
| 1895 | Ga0436363_0776175 | |||
| 1896 | Ga0436363_1465945 | |||
| 1897 | Ga0436363_1620918 | |||
| 1898 | Ga0436362_0027826 | |||
| 1899 | Ga0436362_0051025 | |||
| 1900 | Ga0436362_0406634 | |||
| 1901 | Ga0436362_0483944 | |||
| 1902 | Ga0436362_0486730 | |||
| 1903 | Ga0436362_0540144 | |||
| 1904 | Ga0436362_0653197 | |||
| 1905 | Ga0436362_0767395 | |||
| 1906 | Ga0436362_0853964 | |||
| 1907 | Ga0436362_1003461 | |||
| 1908 | Ga0436362_1013653 | |||
| 1909 | Ga0436362_1187126 | |||
| 1910 | Ga0439439_0003999 | |||
| 1911 | Ga0451853_1738478 | |||
| 1912 | Ga0439433_0013204 | |||
| 1913 | Ga0439448_0064010 | |||
| 1914 | Ga0439449_0000392 | |||
| 1915 | Ga0439449_0000447 | |||
| 1916 | Ga0439462_0000062 | |||
| 1917 | Ga0439462_0006819 | |||
| 1918 | Ga0439459_0015659 | |||
| 1919 | Ga0451577_0024855 | |||
| 1920 | Ga0451577_0105966 | |||
| 1921 | Ga0466969_0000414 | |||
| 1922 | Ga0466969_0010863 | |||
| 1923 | Ga0466969_0025286 | |||
| 1924 | Ga0466969_0026364 | |||
| 1925 | Ga0466969_0083340 | |||
| 1926 | Ga0466969_0105166 | |||
| 1927 | Ga0466969_0118489 | |||
| 1928 | Ga0466972_0003966 | |||
| 1929 | Ga0466972_0008316 | |||
| 1930 | Ga0466972_0009638 | |||
| 1931 | Ga0466972_0012940 | |||
| 1932 | Ga0466972_0038777 | |||
| 1933 | Ga0453683_0007388 | |||
| 1934 | Ga0466965_0005786 | |||
| 1935 | Ga0466965_0009509 | |||
| 1936 | Ga0466965_0009647 | |||
| 1937 | Ga0466965_0013094 | |||
| 1938 | Ga0466965_0014434 | |||
| 1939 | Ga0466965_0101240 | |||
| 1940 | Ga0466965_0275215 | |||
| 1941 | Ga0466966_0000993 | |||
| 1942 | Ga0466966_0003994 | |||
| 1943 | Ga0466966_0006867 | |||
| 1944 | Ga0466966_0020631 | |||
| 1945 | Ga0466966_0049959 | |||
| 1946 | Ga0466966_0056067 | |||
| 1947 | Ga0466961_0002381 | |||
| 1948 | Ga0466961_0002837 | |||
| 1949 | Ga0466961_0007163 | |||
| 1950 | Ga0466961_0023862 | |||
| 1951 | Ga0466961_0025553 | |||
| 1952 | Ga0466961_0044420 | |||
| 1953 | Ga0466961_0089856 | |||
| 1954 | Ga0466963_0006200 | |||
| 1955 | Ga0466963_0196031 | |||
| 1956 | Ga0466964_0012379 | |||
| 1957 | Ga0453684_0008665 | |||
| 1958 | Ga0453684_0336544 | |||
| 1959 | Ga0466971_0027309 | |||
| 1960 | Ga0466971_0046671 | |||
| 1961 | Ga0466968_0003347 | |||
| 1962 | Ga0466968_0009274 | |||
| 1963 | Ga0466970_0006945 | |||
| 1964 | Ga0466970_0014160 | |||
| 1965 | Ga0466970_0033316 | |||
| 1966 | Ga0466957_0003558 | |||
| 1967 | Ga0466957_0023274 | |||
| 1968 | Ga0466960_0044927 | |||
| 1969 | Ga0466960_0083661 | |||
| 1970 | Ga0466959_0001670 | |||
| 1971 | Ga0466959_0004585 | |||
| 1972 | Ga0466959_0043109 | |||
| 1973 | Ga0466959_0070827 | |||
| 1974 | Ga0466959_0073006 | |||
| 1975 | Ga0466959_0107447 | |||
| 1976 | Ga0451576_0001906 | |||
| 1977 | Ga0466958_0009229 | |||
| 1978 | Ga0466958_0011075 | |||
| 1979 | Ga0466958_0059455 | |||
| 1980 | Ga0466967_0008264 | |||
| 1981 | Ga0466967_0032142 | |||
| 1982 | Ga0466967_0064210 | |||
| 1983 | Ga0466967_0080908 | |||
| 1984 | Ga0466967_0109693 | |||
| 1985 | Ga0466967_0191553 | |||
| 1986 | Ga0466967_0255721 | |||
| 1987 | Ga0466967_0271137 | |||
| 1988 | Ga0495592_0096768 | |||
| 1989 | Ga0495592_0187586 | |||
| 1990 | Ga0495603_0086793 | |||
| 1991 | Ga0495603_0168564 | |||
| 1992 | Ga0495629_0001390 | |||
| 1993 | Ga0495629_0024512 | |||
| 1994 | Ga0495629_0044251 | |||
| 1995 | Ga0495629_0172944 | |||
| 1996 | Ga0495638_0239700 | |||
| 1997 | Ga0495651_0000128 | |||
| 1998 | Ga0495651_0004211 | |||
| 1999 | Ga0495580_0283533 | |||
| 2000 | Ga0495582_0238703 | |||
| 2001 | Ga0495662_0002245 | |||
| 2002 | Ga0495664_0003058 | |||
| 2003 | Ga0495664_0090208 | |||
| 2004 | Ga0495583_0035582 | |||
| 2005 | Ga0495618_0156474 | |||
| 2006 | Ga0495628_0002560 | |||
| 2007 | Ga0495628_0286339 | |||
| 2008 | Ga0495630_0321145 | |||
| 2009 | Ga0495632_0118850 | |||
| 2010 | Ga0495666_0000540 | |||
| 2011 | Ga0495652_0000358 | |||
| 2012 | Ga0495652_0120869 | |||
| 2013 | Ga0495652_0129573 | |||
| 2014 | Ga0495665_0015774 | |||
| 2015 | Ga0495640_0011237 | |||
| 2016 | Ga0495640_0011357 | |||
| 2017 | Ga0495640_0065157 | |||
| 2018 | Ga0495586_0034545 | |||
| 2019 | Ga0495587_0020875 | |||
| 2020 | Ga0495587_0055764 | |||
| 2021 | Ga0495587_0164379 | |||
| 2022 | Ga0495645_0010190 | |||
| 2023 | Ga0495645_0114620 | |||
| 2024 | Ga0495622_0074017 | |||
| 2025 | Ga0495634_0002087 | |||
| 2026 | Ga0495634_0017275 | |||
| 2027 | Ga0495635_0009480 | |||
| 2028 | Ga0495635_0016699 | |||
| 2029 | Ga0495588_0124167 | |||
| 2030 | Ga0495657_0001170 | |||
| 2031 | Ga0495657_0102885 | |||
| 2032 | Ga0495599_0012543 | |||
| 2033 | Ga0495599_0231129 | |||
| 2034 | Ga0495623_0007760 | |||
| 2035 | Ga0495623_0041368 | |||
| 2036 | Ga0495646_0001835 | |||
| 2037 | Ga0495658_0193481 | |||
| 2038 | Ga0495613_0000357 | |||
| 2039 | Ga0495613_0002729 | |||
| 2040 | Ga0495613_0033173 | |||
| 2041 | Ga0495613_0292466 | |||
| 2042 | Ga0495624_0090964 | |||
| 2043 | Ga0495600_0000178 | |||
| 2044 | Ga0495600_0002662 | |||
| 2045 | Ga0495600_0097979 | |||
| 2046 | Ga0495600_0113106 | |||
| 2047 | Ga0495581_0000040 | |||
| 2048 | Ga0495581_0009314 | |||
| 2049 | Ga0495604_0000800 | |||
| 2050 | Ga0495604_0005570 | |||
| 2051 | Ga0495604_0009368 | |||
| 2052 | Ga0495604_0012191 | |||
| 2053 | Ga0495604_0104554 | |||
| 2054 | Ga0495604_0124391 | |||
| 2055 | Ga0495604_0223930 | |||
| 2056 | Ga0495636_0044974 | |||
| 2057 | Ga0495674_0022744 | |||
| 2058 | Ga0495674_0151193 | |||
| 2059 | Ga0495674_0207709 | |||
| 2060 | Ga0495680_0282145 | |||
| 2061 | Ga0495675_0006373 | |||
| 2062 | Ga0495675_0016735 | |||
| 2063 | Ga0495675_0030131 | |||
| 2064 | Ga0495685_044655 | |||
| 2065 | Ga0495684_0282577 | |||
| 2066 | Ga0495593_0019143 | |||
| 2067 | Ga0495602_0023816 | |||
| 2068 | Ga0495614_0021518 | |||
| 2069 | Ga0496101_0009664 | |||
| 2070 | Ga0496101_0065876 | |||
| 2071 | Ga0496102_0020974 | |||
| 2072 | Ga0496102_0081411 | |||
| 2073 | Ga0496102_0108764 | |||
| 2074 | Ga0496102_0171722 | |||
| 2075 | Ga0496102_0377527 | |||
| 2076 | Ga0496102_0425535 | |||
| 2077 | Ga0496102_0452945 | |||
| 2078 | Ga0496103_0036480 | |||
| 2079 | Ga0496103_0203300 | |||
| 2080 | Ga0496104_0124350 | |||
| 2081 | Ga0496105_0043333 | |||
| 2082 | Ga0496106_0023913 | |||
| 2083 | Ga0496106_0042183 | |||
| 2084 | Ga0496107_0038771 | |||
| 2085 | Ga0496107_0188677 | |||
| 2086 | Ga0496107_0246964 | |||
| 2087 | Ga0496108_0019388 | |||
| 2088 | Ga0496108_0250093 | |||
| 2089 | Ga0496109_0010941 | |||
| 2090 | Ga0496109_0023913 | |||
| 2091 | Ga0496109_0054068 | |||
| 2092 | Ga0496109_0231233 | |||
| 2093 | Ga0496109_0285405 | |||
| 2094 | Ga0496110_0020699 | |||
| 2095 | Ga0496110_0366249 | |||
| 2096 | Ga0496111_0047594 | |||
| 2097 | Ga0496111_0048162 | |||
| 2098 | Ga0496111_0071541 | |||
| 2099 | Ga0496112_0017869 | |||
| 2100 | Ga0496112_0072606 | |||
| 2101 | Ga0496112_0141254 | |||
| 2102 | Ga0496112_0311991 | |||
| 2103 | Ga0496112_0315552 | |||
| 2104 | Ga0496113_0010420 | |||
| 2105 | Ga0496113_0056230 | |||
| 2106 | Ga0496113_0268552 | |||
| 2107 | Ga0496114_0044500 | |||
| 2108 | Ga0496114_0058815 | |||
| 2109 | Ga0496114_0135324 | |||
| 2110 | Ga0496114_0177331 | |||
| 2111 | Ga0496115_0013221 | |||
| 2112 | Ga0496115_0079915 | |||
| 2113 | Ga0496116_0000474 | |||
| 2114 | Ga0496117_0010797 | |||
| 2115 | Ga0496117_0034548 | |||
| 2116 | Ga0496118_0000781 | |||
| 2117 | Ga0496118_0015570 | |||
| 2118 | Ga0496119_0004505 | |||
| 2119 | Ga0496124_0101651 | |||
| 2120 | Ga0501291_016764 | |||
| 2121 | Ga0501031_0000115 | |||
| 2122 | Ga0501031_0007958 | |||
| 2123 | Ga0501031_0041878 | |||
| 2124 | Ga0501031_0072043 | |||
| 2125 | Ga0501031_0148899 | |||
| 2126 | Ga0501031_0193384 | |||
| 2127 | Ga0501032_0000052 | |||
| 2128 | Ga0501032_0000872 | |||
| 2129 | Ga0501032_0060474 | |||
| 2130 | Ga0501032_0114967 | |||
| 2131 | Ga0501032_0125585 | |||
| 2132 | Ga0501032_0128804 | |||
| 2133 | Ga0501033_0001762 | |||
| 2134 | Ga0501033_0005593 | |||
| 2135 | Ga0501033_0009214 | |||
| 2136 | Ga0501033_0010098 | |||
| 2137 | Ga0501033_0020037 | |||
| 2138 | Ga0501033_0096484 | |||
| 2139 | Ga0501034_0002674 | |||
| 2140 | Ga0501034_0003126 | |||
| 2141 | Ga0501034_0003912 | |||
| 2142 | Ga0501034_0042386 | |||
| 2143 | Ga0501034_0058411 | |||
| 2144 | Ga0501034_0099515 | |||
| 2145 | Ga0501036_0001596 | |||
| 2146 | Ga0501036_0001835 | |||
| 2147 | Ga0501036_0002136 | |||
| 2148 | Ga0501036_0004954 | |||
| 2149 | Ga0501036_0007977 | |||
| 2150 | Ga0501036_0011181 | |||
| 2151 | Ga0501036_0017286 | |||
| 2152 | Ga0501036_0022220 | |||
| 2153 | Ga0501036_0267546 | |||
| 2154 | Ga0501036_0285553 | |||
| 2155 | Ga0501037_0000046 | |||
| 2156 | Ga0501037_0001427 | |||
| 2157 | Ga0501037_0016043 | |||
| 2158 | Ga0501037_0021174 | |||
| 2159 | Ga0501037_0104384 | |||
| 2160 | Ga0501038_0000068 | |||
| 2161 | Ga0501038_0010363 | |||
| 2162 | Ga0501038_0014618 | |||
| 2163 | Ga0501038_0056014 | |||
| 2164 | Ga0501038_0068510 | |||
| 2165 | Ga0501038_0072376 | |||
| 2166 | Ga0501038_0169816 | |||
| 2167 | Ga0501039_0000362 | |||
| 2168 | Ga0501039_0002635 | |||
| 2169 | Ga0501039_0011902 | |||
| 2170 | Ga0501039_0014225 | |||
| 2171 | Ga0501039_0161714 | |||
| 2172 | Ga0501041_0003245 | |||
| 2173 | Ga0501041_0010412 | |||
| 2174 | Ga0501042_0005655 | |||
| 2175 | Ga0501042_0010326 | |||
| 2176 | Ga0501042_0018124 | |||
| 2177 | Ga0501043_0000783 | |||
| 2178 | Ga0501043_0000785 | |||
| 2179 | Ga0501043_0002726 | |||
| 2180 | Ga0501043_0009599 | |||
| 2181 | Ga0501043_0033694 | |||
| 2182 | Ga0501043_0036588 | |||
| 2183 | Ga0501043_0150790 | |||
| 2184 | Ga0501046_0000102 | |||
| 2185 | Ga0501046_0003286 | |||
| 2186 | Ga0501046_0011973 | |||
| 2187 | Ga0501046_0036275 | |||
| 2188 | Ga0501047_0000327 | |||
| 2189 | Ga0501047_0002504 | |||
| 2190 | Ga0501047_0003586 | |||
| 2191 | Ga0501047_0005305 | |||
| 2192 | Ga0501047_0020357 | |||
| 2193 | Ga0501047_0027822 | |||
| 2194 | Ga0501047_0100599 | |||
| 2195 | Ga0501047_0118040 | |||
| 2196 | Ga0501047_0119289 | |||
| 2197 | Ga0501047_0151207 | |||
| 2198 | Ga0501047_0337040 | |||
| 2199 | Ga0501048_0000006 | |||
| 2200 | Ga0501048_0004360 | |||
| 2201 | Ga0501048_0007307 | |||
| 2202 | Ga0501048_0144963 | |||
| 2203 | Ga0501048_0227848 | |||
| 2204 | Ga0501067_0002695 | |||
| 2205 | Ga0501067_0003477 | |||
| 2206 | Ga0501067_0005126 | |||
| 2207 | Ga0501067_0025636 | |||
| 2208 | Ga0501067_0069808 | |||
| 2209 | Ga0501068_0003083 | |||
| 2210 | Ga0501068_0021718 | |||
| 2211 | Ga0501068_0022413 | |||
| 2212 | Ga0501068_0035562 | |||
| 2213 | Ga0501068_0049650 | |||
| 2214 | Ga0501068_0067976 | |||
| 2215 | Ga0501069_0000146 | |||
| 2216 | Ga0501069_0002076 | |||
| 2217 | Ga0501069_0055070 | |||
| 2218 | Ga0501069_0065550 | |||
| 2219 | Ga0501069_0066183 | |||
| 2220 | Ga0501070_0002259 | |||
| 2221 | Ga0501070_0010017 | |||
| 2222 | Ga0501070_0010181 | |||
| 2223 | Ga0501070_0014063 | |||
| 2224 | Ga0501070_0041514 | |||
| 2225 | Ga0501070_0069932 | |||
| 2226 | Ga0501070_0257476 | |||
| 2227 | Ga0501071_0001127 | |||
| 2228 | Ga0501071_0023497 | |||
| 2229 | Ga0501071_0197455 | |||
| 2230 | Ga0501071_0202623 | |||
| 2231 | Ga0501072_0008503 | |||
| 2232 | Ga0501072_0025371 | |||
| 2233 | Ga0501072_0027313 | |||
| 2234 | Ga0501072_0091904 | |||
| 2235 | Ga0501073_0001270 | |||
| 2236 | Ga0501073_0015148 | |||
| 2237 | Ga0501073_0030252 | |||
| 2238 | Ga0501073_0034575 | |||
| 2239 | Ga0501073_0040903 | |||
| 2240 | Ga0501073_0071130 | |||
| 2241 | Ga0501073_0151222 | |||
| 2242 | Ga0501074_0000916 | |||
| 2243 | Ga0501074_0002190 | |||
| 2244 | Ga0501074_0005053 | |||
| 2245 | Ga0501074_0009089 | |||
| 2246 | Ga0501074_0013626 | |||
| 2247 | Ga0501074_0018664 | |||
| 2248 | Ga0501076_0003910 | |||
| 2249 | Ga0501077_0014193 | |||
| 2250 | Ga0501077_0019104 | |||
| 2251 | Ga0501079_0010413 | |||
| 2252 | Ga0501080_0000051 | |||
| 2253 | Ga0501080_0011811 | |||
| 2254 | Ga0501080_0037882 | |||
| 2255 | Ga0501080_0233186 | |||
| 2256 | Ga0501081_0005680 | |||
| 2257 | Ga0501083_0005707 | |||
| 2258 | Ga0501083_0020112 | |||
| 2259 | Ga0501035_0001405 | |||
| 2260 | Ga0501035_0007893 | |||
| 2261 | Ga0501035_0008657 | |||
| 2262 | Ga0501035_0020910 | |||
| 2263 | Ga0501035_0036021 | |||
| 2264 | Ga0501035_0045589 | |||
| 2265 | Ga0501035_0052798 | |||
| 2266 | Ga0501035_0060821 | |||
| 2267 | Ga0501044_0000137 | |||
| 2268 | Ga0501044_0000976 | |||
| 2269 | Ga0501044_0015778 | |||
| 2270 | Ga0501044_0017207 | |||
| 2271 | Ga0501044_0029117 | |||
| 2272 | Ga0501044_0031288 | |||
| 2273 | Ga0501044_0034459 | |||
| 2274 | Ga0501044_0102587 | |||
| 2275 | Ga0501044_0103308 | |||
| 2276 | Ga0501044_0307019 | |||
| 2277 | Ga0501045_0036204 | |||
| 2278 | Ga0501045_0044326 | |||
| 2279 | Ga0501045_0157980 | |||
| 2280 | nmdc:mga03n38_106910_c1 | |||
| 2281 | nmdc:mga03n38_18585_c1 | |||
| 2282 | nmdc:mga00v17_294097_c1 | |||
| 2283 | nmdc:mga00v17_53709_c1 | |||
| 2284 | nmdc:mga0yw44_12964_c1 | |||
| 2285 | nmdc:mga0yw44_1576_c1 | |||
| 2286 | nmdc:mga0yw44_45472_c1 | |||
| 2287 | nmdc:mga04h51_14036_c1 | |||
| 2288 | nmdc:mga07m45_19873_c2 | |||
| 2289 | nmdc:mga07m45_34847_c1 | |||
| 2290 | nmdc:mga05p37_102271_c1 | |||
| 2291 | nmdc:mga05p37_150806_c1 | |||
| 2292 | nmdc:mga05p37_159676_c1 | |||
| 2293 | nmdc:mga05p37_171477_c1 | |||
| 2294 | nmdc:mga05p37_17429_c1 | |||
| 2295 | nmdc:mga05p37_178_c1 | |||
| 2296 | nmdc:mga05p37_1839_c1 | |||
| 2297 | nmdc:mga05p37_23475_c1 | |||
| 2298 | nmdc:mga05p37_300499_c1 | |||
| 2299 | nmdc:mga05p37_416057_c1 | |||
| 2300 | nmdc:mga05p37_68693_c1 | |||
| 2301 | nmdc:mga05p37_73494_c1 | |||
| 2302 | nmdc:mga05p37_815_c1 | |||
| 2303 | nmdc:mga09592_14_c2 | |||
| 2304 | nmdc:mga09592_1518_c1 | |||
| 2305 | nmdc:mga09592_178469_c1 | |||
| 2306 | nmdc:mga09592_428140_c1 | |||
| 2307 | nmdc:mga09592_4353_c1 | |||
| 2308 | nmdc:mga0qj67_1167_c1 | |||
| 2309 | nmdc:mga0qj67_17115_c1 | |||
| 2310 | nmdc:mga0qj67_2703_c1 | |||
| 2311 | nmdc:mga0qj67_6067_c1 | |||
| 2312 | nmdc:mga06r32_1482_c1 | |||
| 2313 | nmdc:mga06r32_175901_c1 | |||
| 2314 | nmdc:mga06r32_18_c1 | |||
| 2315 | nmdc:mga06r32_555_c1 | |||
| 2316 | nmdc:mga06r32_5891_c1 | |||
| 2317 | nmdc:mga06r32_8942_c1 | |||
| 2318 | nmdc:mga06r32_92605_c1 | |||
| 2319 | nmdc:mga08y16_19086_c1 | |||
| 2320 | nmdc:mga08y16_2869_c1 | |||
| 2321 | nmdc:mga08y16_3646_c1 | |||
| 2322 | nmdc:mga08y16_37998_c1 | |||
| 2323 | nmdc:mga08y16_524995_c1 | |||
| 2324 | nmdc:mga08y16_677384_c1 | |||
| 2325 | nmdc:mga08y16_68388_c1 | |||
| 2326 | nmdc:mga0n895_116339_c1 | |||
| 2327 | nmdc:mga0n895_30224_c1 | |||
| 2328 | nmdc:mga0n895_3057_c1 | |||
| 2329 | nmdc:mga0n895_44096_c1 | |||
| 2330 | nmdc:mga0n895_70179_c1 | |||
| 2331 | nmdc:mga0n895_77420_c1 | |||
| 2332 | nmdc:mga0rr50_17910_c1 | |||
| 2333 | nmdc:mga0rr50_200138_c1 | |||
| 2334 | nmdc:mga0rr50_44979_c1 | |||
| 2335 | nmdc:mga0rr50_79643_c1 | |||
| 2336 | nmdc:mga0rr50_9865_c1 | |||
| 2337 | nmdc:mga08x19_26443_c1 | |||
| 2338 | nmdc:mga08x19_28889_c1 | |||
| 2339 | nmdc:mga08x19_52676_c1 | |||
| 2340 | nmdc:mga08x19_60823_c1 | |||
| 2341 | nmdc:mga0a205_20399_c1 | |||
| 2342 | nmdc:mga0a205_206535_c1 | |||
| 2343 | nmdc:mga0a205_21078_c1 | |||
| 2344 | nmdc:mga0a205_234254_c1 | |||
| 2345 | nmdc:mga0a205_6162_c1 | |||
| 2346 | nmdc:mga0a205_65750_c1 | |||
| 2347 | Ga0495601_0017205 | |||
| 2348 | Ga0495601_0061885 | |||
| 2349 | Ga0495612_0002530 | |||
| 2350 | Ga0495655_0004943 | |||
| 2351 | Ga0495619_0063268 | |||
| 2352 | Ga0500644_0030924 | |||
| 2353 | Ga0500644_0090365 | |||
| 2354 | Ga0500646_0000167 | |||
| 2355 | Ga0500646_0000205 | |||
| 2356 | Ga0500641_0024919 | |||
| 2357 | Ga0500641_0026240 | |||
| 2358 | Ga0500553_000116 | |||
| 2359 | Ga0500556_0004985 | |||
| 2360 | Ga0500560_008536 | |||
| 2361 | Ga0500573_0043418 | |||
| 2362 | Ga0500573_0043889 | |||
| 2363 | Ga0500577_0018450 | |||
| 2364 | Ga0500637_0026467 | |||
| 2365 | Ga0500645_027931 | |||
| 2366 | Ga0501084_0000567 | |||
| 2367 | Ga0501084_0003883 | |||
| 2368 | Ga0501084_0058067 | |||
| 2369 | Ga0590075_005905 | |||
| 2370 | Ga0501082_0036924 | |||
| 2371 | Ga0501082_0054265 | |||
| 2372 | Ga0501082_0059903 | |||
| 2373 | Ga0466962_0002637 | |||
| 2374 | Ga0466962_0003080 | |||
| 2375 | Ga0466962_0014836 | |||
| 2376 | Ga0530510_0459877 | |||
| 2377 | 2676203048 | |||
| 2378 | 2501942207 | |||
| 2379 | 2508674230 | |||
| 2380 | 2515854319 | |||
| 2381 | 2524186023 | |||
| 2382 | 2559428894 | |||
| 2383 | 2587739664 | |||
| 2384 | 2616906431 | |||
| 2385 | 2644232255 | |||
| 2386 | 2644385626 | |||
| 2387 | 2644436682 | |||
| 2388 | 2644445760 | |||
| 2389 | 2644625506 | |||
| 2390 | 2671832687 | |||
| 2391 | 2676476673 | |||
| 2392 | 2676483434 | |||
| 2393 | 2686538689 | |||
| 2394 | 2689990263 | |||
| 2395 | 2740169335 | |||
| 2396 | 2753070081 | |||
| 2397 | 2753272299 | |||
| 2398 | 2774847624 | |||
| 2399 | 2774850843 | |||
| 2400 | 2774903390 | |||
| 2401 | 2808841580 | |||
| 2402 | 2816426788 | |||
| 2403 | 2816505452 | |||
| 2404 | 2819742617 | |||
| 2405 | 2848551799 | |||
| 2406 | 2855686794 | |||
| 2407 | 2856864585 | |||
| 2408 | 2857477520 | |||
| 2409 | 2858873325 | |||
| 2410 | 2861522952 | |||
| 2411 | 2861524298 | |||
| 2412 | 2862293230 | |||
| 2413 | 2862515013 | |||
| 2414 | 2867303440 | |||
| 2415 | 2867316204 | |||
| 2416 | 2867321070 | |||
| 2417 | 2867371460 | |||
| 2418 | 2867481337 | |||
| 2419 | 2870727427 | |||
| 2420 | 2887481033 | |||
| 2421 | 2895887479 | |||
| 2422 | 2902588080 | |||
| 2423 | 2904117965 | |||
| 2424 | 2919473428 | |||
| 2425 | 2935394703 | |||
| 2426 | 2946075487 | |||
| 2427 | 2990048708 | |||
| 2428 | 2990094265 | |||
| 2429 | 2995466119 | |||
| 2430 | 2996227476 | |||
| 2431 | 2997456788 | |||
| 2432 | 3003003351 | |||
| 2433 | 3006321669 | |||
| 2434 | 3006491704 | |||
| 2435 | 649813888 | |||
| 2436 | 8002779266 | |||
| 2437 | 8002788849 | |||
| 2438 | 8003862066 | |||
| 2439 | 8008489807 | |||
| 2440 | 8025527419 | |||
| 2441 | 8047719384 | |||
| 2442 | 8053953006 | |||
| 2443 | 8054161095 | |||
| 2444 | 8056063567 | |||
| 2445 | 8056450893 | |||
| 2446 | 8056668080 | |||
| 2447 | 8057570939 | |||
| 2448 | 8057573300 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8eop-assembly1.cif.gz_A | cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state | 0.9058 | 2 | 248 |
| 7w7a-assembly2.cif.gz_E | heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data | 0.8943 | 2 | 234 |
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.8938 | 3 | 248 |
| 4rvc-assembly1.cif.gz_A | structure of atp binding subunit of abc transporter | 0.8897 | 3 | 248 |
| 7w7b-assembly2.cif.gz_G | heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data | 0.8896 | 1 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q1RS86_918_1157_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9325 | 1 | 231 | 3.40.50.300 |
| af_A4HV32_726_961_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9301 | 2 | 247 | 3.40.50.300 |
| af_Q9VVK6_333_568_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9281 | 1 | 247 | 3.40.50.300 |
| af_Q9XW49_440_685_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9268 | 1 | 248 | 3.40.50.300 |
| af_A1ZBS3_470_698_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9244 | 2 | 247 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0D1P4L1-F1-model_v4 | deleted | 0.9553 | 1 | 248 |
|
| AF-A0A0R0D0B4-F1-model_v4 | ABC transporter domain-containing protein | 0.9473 | 4 | 245 |
GO:0005524
GO:0016887 |
| AF-A0A2D4CKI9-F1-model_v4 | deleted | 0.9397 | 2 | 249 |
|
| AF-A0A0C5C8U0-F1-model_v4 | deleted | 0.9321 | 108 | 247 |
|
| AF-A0A382TRQ1-F1-model_v4 | Branched-chain amino acid ATP-binding cassette transporter C-terminal domain-containing protein | 0.9301 | 139 | 245 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |