F491908

General Info

Members Datasets Scaffolds Average Seq Length
1224 465 2448 326

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675902999|2676203048
Length 382
Sequence GQEPTPPRQRRPPPDAPTGGLTSGDLTPAGLAPAGLAPAGLAGASAGPGSEIVIEAERVRKTFVQRRRIAGQRLRRERIDVHAVRDVSFTVRAGEIIGYLGPNGAGKSTTIKMLIGVLTPSAGRLRVAGLDPAHQRIALARRIGVVFGQRSTLWWDLPLRDSFELVRHLYRVPPGQFRANLARFVEMLDLGPFLDTPVRQLSLGQRMRGDLTAAFLHDPSIVYLDEPTIGLDVVSKAAVRAFLAEKNREQATTIMLTTHDTADIEQLCQRVLVIDHGRLGFDGDLATLRERLGGERTLVVDLAAPMPPLTVATPGAHVIRVDGPRQWLAFPARASAAPLVAEIAARYPLVDLAIREPPIEDVITRLYTTGPEPRPAAEPAAN

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
188 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
189 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
190 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
191 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
192 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
193 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
194 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
195 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
220 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
221 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
222 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
235 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
244 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
245 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
246 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
247 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
252 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
259 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
260 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
275 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
284 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
285 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
306 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
359 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
366 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
380 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
381 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
382 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
383 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
384 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
385 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
386 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
387 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
388 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
389 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
390 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
396 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
397 2501939600 Micromonospora sp. L5 Isolate Unclassified
398 2508501039 Frankia saprophytica CN3 Isolate Nodule
399 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
400 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
401 2558860280 Kutzneria sp. 744 Isolate Unclassified
402 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
403 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
404 2643221641 Nocardioides sp. Root122 Isolate Unclassified
405 2643221670 Streptomyces sp. Root431 Isolate Unclassified
406 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
407 2643221679 Angustibacter sp. Root456 Isolate Unclassified
408 2643221714 Streptomyces sp. Root264 Isolate Unclassified
409 2671180195 Frankia sp. CcI49 Isolate Nodule
410 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
411 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
412 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
413 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
414 2739367898 Nocardioides sp. CF479 Isolate Unclassified
415 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
416 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
417 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
418 2773857922 Frankia sp. CcI49 Isolate Nodule
419 2773857933 Frankia sp. BMG5.30 Isolate Nodule
420 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
421 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
422 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
423 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
424 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
425 2855683550 Micromonospora sp. RP3T Isolate Unclassified
426 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
427 2857472729 Cohnella sp. R-74144 Isolate Unclassified
428 2858868258 Micromonospora sp. MH33 Isolate Unclassified
429 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
430 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
431 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
432 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
433 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
434 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
435 2867369537 Streptomyces sp. Z26 Isolate Unclassified
436 2867475112 Streptomyces sp. TM32 Isolate Unclassified
437 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
438 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
439 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
440 2902582711 Micromonospora sp. AP08 Isolate Unclassified
441 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
442 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
443 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
444 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
445 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
446 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
447 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
448 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
449 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
450 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
451 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
452 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
453 649633069 Micromonospora sp. L5 Isolate Unclassified
454 8002775197 Frankia nepalensis CN7 Isolate Nodule
455 8002784119 Frankia sp. AgB1.9 Isolate Nodule
456 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
457 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
458 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
459 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
460 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
461 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
462 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
463 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
464 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
465 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.87
Metatranscriptomes 0.25
Isolates 5.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0.74
Rhizoplane 3.59
Rhizosphere 82.19
Stem 0
Stem Tuber 0
Unclassified 0.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10030120 3300001979 Bacteria 1772
2 JGI25406J46586_10008109 3300003203 Bacteria 4769
3 Ga0006562J51391_1109263 3300003578 Bacteria 8282
4 Ga0065704_10075364 3300005289 Bacteria 5634
5 Ga0070658_10002128 3300005327 Bacteria 16625
6 Ga0070658_10003610 3300005327 Bacteria 12676
7 Ga0070676_10032042 3300005328 Bacteria 3008
8 Ga0070676_10170399 3300005328 Bacteria 1408
9 Ga0070683_100004647 3300005329 Bacteria 11347
10 Ga0070683_100098404 3300005329 Bacteria 2753
11 Ga0070670_100301114 3300005331 Bacteria 1402
12 Ga0068869_100013851 3300005334 Bacteria 5376
13 Ga0068869_100021890 3300005334 Bacteria 4400
14 Ga0068869_100023099 3300005334 Bacteria 4291
15 Ga0068869_100248774 3300005334 Bacteria 1419
16 Ga0068869_100318843 3300005334 Bacteria 1260
17 Ga0070680_100023832 3300005336 Bacteria 4885
18 Ga0070680_100274494 3300005336 Bacteria 1428
19 Ga0070682_100006150 3300005337 Bacteria 6723
20 Ga0068868_100006011 3300005338 Bacteria 8572
21 Ga0068868_100077093 3300005338 Bacteria 2666
22 Ga0068868_100277931 3300005338 Bacteria 1416
23 Ga0070660_100029985 3300005339 Bacteria 4078
24 Ga0070660_100064245 3300005339 Bacteria 2855
25 Ga0070660_100084966 3300005339 Bacteria 2488
26 Ga0070691_10003836 3300005341 Bacteria 6790
27 Ga0070691_10010580 3300005341 Bacteria 4213
28 Ga0070661_100085500 3300005344 Bacteria 2331
29 Ga0070661_100176452 3300005344 Bacteria 1624
30 Ga0070692_10021226 3300005345 Bacteria 3157
31 Ga0070692_10029569 3300005345 Bacteria 2732
32 Ga0070668_100020231 3300005347 Bacteria 5021
33 Ga0070668_100090532 3300005347 Bacteria 2410
34 Ga0070669_100025062 3300005353 Bacteria 4282
35 Ga0070675_100004065 3300005354 Bacteria 11105
36 Ga0070671_100001993 3300005355 Bacteria 15683
37 Ga0070688_100037812 3300005365 Bacteria 2943
38 Ga0070659_100006159 3300005366 Bacteria 8659
39 Ga0070659_100023614 3300005366 Bacteria 4708
40 Ga0070667_100338358 3300005367 Bacteria 1360
41 Ga0070714_100003209 3300005435 Bacteria 12171
42 Ga0070714_100016998 3300005435 Bacteria 5886
43 Ga0070714_100021665 3300005435 Bacteria 5260
44 Ga0070714_100332374 3300005435 Bacteria 1423
45 Ga0070714_100443245 3300005435 Bacteria 1233
46 Ga0070713_100143230 3300005436 Bacteria 2119
47 Ga0070710_10000775 3300005437 Bacteria 15263
48 Ga0070701_10027921 3300005438 Bacteria 2770
49 Ga0070711_100083947 3300005439 Bacteria 2278
50 Ga0070705_100011854 3300005440 Bacteria 4414
51 Ga0070705_100041044 3300005440 Bacteria 2635
52 Ga0070705_100041631 3300005440 Bacteria 2621
53 Ga0070700_100012214 3300005441 Bacteria 4784
54 Ga0070708_100063505 3300005445 Bacteria 3306
55 Ga0070708_100086149 3300005445 Bacteria 2852
56 Ga0070708_100092416 3300005445 Bacteria 2756
57 Ga0070708_100206017 3300005445 Bacteria 1842
58 Ga0070708_100239624 3300005445 Bacteria 1703
59 Ga0070708_100400670 3300005445 Bacteria 1294
60 Ga0070663_100017361 3300005455 Bacteria 4696
61 Ga0070663_100031316 3300005455 Bacteria 3655
62 Ga0070663_100208902 3300005455 Bacteria 1528
63 Ga0070663_100310180 3300005455 Bacteria 1266
64 Ga0070678_100001267 3300005456 Bacteria 13414
65 Ga0070678_100068564 3300005456 Bacteria 2645
66 Ga0070678_100183110 3300005456 Bacteria 1716
67 Ga0070681_10051198 3300005458 Bacteria 4119
68 Ga0070681_10052482 3300005458 Bacteria 4066
69 Ga0070681_10108742 3300005458 Bacteria 2713
70 Ga0070681_10381085 3300005458 Bacteria 1321
71 Ga0070685_10251935 3300005466 Bacteria 1170
72 Ga0070706_100092923 3300005467 Bacteria 2799
73 Ga0070707_100024129 3300005468 Bacteria 5756
74 Ga0070707_100047075 3300005468 Bacteria 4127
75 Ga0070707_100093846 3300005468 Bacteria 2905
76 Ga0070707_100099103 3300005468 Bacteria 2823
77 Ga0070707_100151759 3300005468 Bacteria 2256
78 Ga0070707_100265591 3300005468 Bacteria 1669
79 Ga0070698_100001988 3300005471 Bacteria 22693
80 Ga0070698_100014445 3300005471 Bacteria 8340
81 Ga0070698_100019295 3300005471 Bacteria 7161
82 Ga0070698_100134247 3300005471 Bacteria 2429
83 Ga0070698_100256648 3300005471 Bacteria 1680
84 Ga0070699_100000014 3300005518 Bacteria 218133
85 Ga0070699_100009053 3300005518 Bacteria 8626
86 Ga0070699_100011634 3300005518 Bacteria 7595
87 Ga0070699_100059992 3300005518 Bacteria 3295
88 Ga0070699_100107366 3300005518 Bacteria 2449
89 Ga0070699_100380682 3300005518 Bacteria 1274
90 Ga0070679_100020925 3300005530 Bacteria 6382
91 Ga0070679_100047023 3300005530 Bacteria 4302
92 Ga0070679_100065358 3300005530 Bacteria 3626
93 Ga0070679_100124012 3300005530 Bacteria 2566
94 Ga0070679_100318480 3300005530 Bacteria 1505
95 Ga0070679_100346854 3300005530 Bacteria 1433
96 Ga0070684_100002845 3300005535 Bacteria 12858
97 Ga0070684_100118682 3300005535 Bacteria 2378
98 Ga0070684_100142336 3300005535 Bacteria 2169
99 Ga0070684_100184394 3300005535 Bacteria 1898
100 Ga0070697_100192092 3300005536 Bacteria 1733
101 Ga0068853_100017236 3300005539 Bacteria 5962
102 Ga0068853_100061176 3300005539 Bacteria 3256
103 Ga0068853_100098148 3300005539 Bacteria 2587
104 Ga0068853_100125058 3300005539 Bacteria 2297
105 Ga0070686_100091295 3300005544 Bacteria 2037
106 Ga0070695_100016847 3300005545 Bacteria 4429
107 Ga0070696_100168747 3300005546 Bacteria 1617
108 Ga0070696_100231302 3300005546 Bacteria 1391
109 Ga0070693_100002045 3300005547 Bacteria 9232
110 Ga0070665_100001502 3300005548 Bacteria 27146
111 Ga0070665_100025806 3300005548 Bacteria 5918
112 Ga0070665_100375697 3300005548 Bacteria 1428
113 Ga0070704_100116968 3300005549 Bacteria 2039
114 Ga0070704_100175124 3300005549 Bacteria 1710
115 Ga0068855_100002943 3300005563 Bacteria 20810
116 Ga0068855_100003272 3300005563 Bacteria 19828
117 Ga0068855_100011259 3300005563 Bacteria 10803
118 Ga0068855_100028270 3300005563 Bacteria 6706
119 Ga0068855_100261862 3300005563 Bacteria 1926
120 Ga0070664_100003004 3300005564 Bacteria 13641
121 Ga0070664_100163364 3300005564 Bacteria 1971
122 Ga0068857_100005857 3300005577 Bacteria 10494
123 Ga0068857_100016349 3300005577 Bacteria 6500
124 Ga0068857_100082226 3300005577 Bacteria 2876
125 Ga0068857_100150512 3300005577 Bacteria 2108
126 Ga0068857_100168509 3300005577 Bacteria 1990
127 Ga0068854_100000001 3300005578 Bacteria 608908
128 Ga0068854_100006613 3300005578 Bacteria 7385
129 Ga0068856_100032941 3300005614 Bacteria 5075
130 Ga0068856_100050737 3300005614 Bacteria 4090
131 Ga0068856_100058806 3300005614 Bacteria 3797
132 Ga0068856_100251915 3300005614 Bacteria 1781
133 Ga0068856_100356445 3300005614 Bacteria 1481
134 Ga0070702_100002421 3300005615 Bacteria 8041
135 Ga0068852_100041338 3300005616 Bacteria 3895
136 Ga0068852_100075664 3300005616 Bacteria 2970
137 Ga0068852_100093961 3300005616 Bacteria 2689
138 Ga0068859_100000054 3300005617 Bacteria 123173
139 Ga0068859_100142290 3300005617 Bacteria 2472
140 Ga0068859_100157915 3300005617 Bacteria 2346
141 Ga0068864_100010703 3300005618 Bacteria 7582
142 Ga0068864_100038517 3300005618 Bacteria 4084
143 Ga0068864_100180367 3300005618 Bacteria 1930
144 Ga0068864_100198574 3300005618 Bacteria 1842
145 Ga0068864_100384341 3300005618 Bacteria 1331
146 Ga0068861_100083856 3300005719 Bacteria 2501
147 Ga0068861_100282245 3300005719 Bacteria 1430
148 Ga0068870_10000527 3300005840 Bacteria 14400
149 Ga0068870_10075996 3300005840 Bacteria 1843
150 Ga0068863_100002724 3300005841 Bacteria 17464
151 Ga0068863_100016498 3300005841 Bacteria 7084
152 Ga0068863_100073397 3300005841 Bacteria 3237
153 Ga0068858_100069663 3300005842 Bacteria 3260
154 Ga0068858_100264415 3300005842 Bacteria 1636
155 Ga0068858_100314483 3300005842 Bacteria 1496
156 Ga0068858_100347344 3300005842 Bacteria 1421
157 Ga0068860_100100556 3300005843 Bacteria 2759
158 Ga0068862_100000037 3300005844 Bacteria 172796
159 Ga0068862_100016913 3300005844 Bacteria 6070
160 Ga0068862_100115331 3300005844 Bacteria 2362
161 Ga0081455_10002734 3300005937 Bacteria 20806
162 Ga0081455_10009950 3300005937 Bacteria 9725
163 Ga0081455_10082302 3300005937 Bacteria 2633
164 Ga0081538_10134667 3300005981 Bacteria 1153
165 Ga0081539_10000364 3300005985 Bacteria 99066
166 Ga0081539_10000447 3300005985 Bacteria 87935
167 Ga0081539_10004113 3300005985 Bacteria 16590
168 Ga0075365_10059063 3300006038 Bacteria 2555
169 Ga0075365_10099899 3300006038 Bacteria 1986
170 Ga0075365_10170853 3300006038 Bacteria 1517
171 Ga0075365_10217726 3300006038 Bacteria 1339
172 Ga0075368_10001870 3300006042 Bacteria 6761
173 Ga0075363_100004732 3300006048 Bacteria 5994
174 Ga0075363_100049348 3300006048 Bacteria 2241
175 Ga0075364_10013390 3300006051 Bacteria 5040
176 Ga0075364_10116147 3300006051 Bacteria 1789
177 Ga0075432_10057297 3300006058 Bacteria 1382
178 Ga0070716_100005011 3300006173 Bacteria 6385
179 Ga0070716_100239250 3300006173 Bacteria 1230
180 Ga0075362_10024379 3300006177 Bacteria 2566
181 Ga0097621_100144738 3300006237 Bacteria 2034
182 Ga0068871_100025364 3300006358 Bacteria 4611
183 Ga0075428_100000006 3300006844 Bacteria 288592
184 Ga0075428_100001979 3300006844 Bacteria 22079
185 Ga0075428_100009926 3300006844 Bacteria 10575
186 Ga0075428_100028992 3300006844 Bacteria 6125
187 Ga0075428_100050574 3300006844 Bacteria 4557
188 Ga0075428_100113278 3300006844 Bacteria 2955
189 Ga0075428_100193527 3300006844 Bacteria 2199
190 Ga0075428_100229677 3300006844 Bacteria 2002
191 Ga0075428_100317267 3300006844 Bacteria 1675
192 Ga0075430_100001233 3300006846 Bacteria 20587
193 Ga0075430_100001764 3300006846 Bacteria 17686
194 Ga0075430_100018773 3300006846 Bacteria 5885
195 Ga0075430_100022712 3300006846 Bacteria 5336
196 Ga0075430_100034453 3300006846 Bacteria 4297
197 Ga0075430_100364673 3300006846 Bacteria 1193
198 Ga0075431_100003806 3300006847 Bacteria 14671
199 Ga0075431_100006015 3300006847 Bacteria 12023
200 Ga0075431_100018026 3300006847 Bacteria 7182
201 Ga0075431_100031642 3300006847 Bacteria 5449
202 Ga0075431_100032158 3300006847 Bacteria 5407
203 Ga0075431_100093757 3300006847 Bacteria 3098
204 Ga0075431_100153717 3300006847 Bacteria 2368
205 Ga0075433_10000529 3300006852 Bacteria 25025
206 Ga0075433_10003481 3300006852 Bacteria 12160
207 Ga0075433_10005330 3300006852 Bacteria 10090
208 Ga0075433_10016491 3300006852 Bacteria 6092
209 Ga0075433_10098793 3300006852 Bacteria 2584
210 Ga0075433_10099415 3300006852 Bacteria 2575
211 Ga0075434_100008277 3300006871 Bacteria 9660
212 Ga0075434_100021611 3300006871 Bacteria 6257
213 Ga0075434_100089201 3300006871 Bacteria 3085
214 Ga0075434_100125364 3300006871 Bacteria 2585
215 Ga0075434_100176048 3300006871 Bacteria 2159
216 Ga0075429_100001818 3300006880 Bacteria 17659
217 Ga0075429_100008473 3300006880 Bacteria 8952
218 Ga0075429_100008552 3300006880 Bacteria 8904
219 Ga0075429_100010603 3300006880 Bacteria 7973
220 Ga0075429_100036712 3300006880 Bacteria 4264
221 Ga0075429_100061359 3300006880 Bacteria 3275
222 Ga0075429_100137690 3300006880 Bacteria 2137
223 Ga0075429_100226856 3300006880 Bacteria 1636
224 Ga0075429_100399310 3300006880 Bacteria 1204
225 Ga0075429_100438320 3300006880 Bacteria 1145
226 Ga0068865_100029500 3300006881 Bacteria 3641
227 Ga0068865_100406103 3300006881 Bacteria 1117
228 Ga0075436_100000719 3300006914 Bacteria 21903
229 Ga0075436_100026256 3300006914 Bacteria 4009
230 Ga0075436_100122163 3300006914 Bacteria 1823
231 Ga0097620_100000054 3300006931 Bacteria 123173
232 Ga0097620_100142287 3300006931 Bacteria 2472
233 Ga0097620_100157917 3300006931 Bacteria 2346
234 Ga0075435_100001179 3300007076 Bacteria 16688
235 Ga0075435_100013874 3300007076 Bacteria 6008
236 Ga0075435_100034172 3300007076 Bacteria 4026
237 Ga0075435_100047646 3300007076 Bacteria 3441
238 Ga0075435_100056230 3300007076 Bacteria 3180
239 Ga0075435_100191651 3300007076 Bacteria 1730
240 Ga0075435_100207584 3300007076 Bacteria 1661
241 Ga0075435_100261610 3300007076 Bacteria 1474
242 Ga0105240_10005833 3300009093 Bacteria 18256
243 Ga0105240_10015490 3300009093 Bacteria 10364
244 Ga0105240_10069876 3300009093 Bacteria 4346
245 Ga0105240_10165169 3300009093 Bacteria 2626
246 Ga0111539_10022401 3300009094 Bacteria 7764
247 Ga0111539_10040672 3300009094 Bacteria 5594
248 Ga0111539_10062336 3300009094 Bacteria 4415
249 Ga0111539_10064998 3300009094 Bacteria 4314
250 Ga0111539_10089831 3300009094 Bacteria 3610
251 Ga0111539_10157350 3300009094 Bacteria 2659
252 Ga0111539_10254320 3300009094 Bacteria 2046
253 Ga0111539_10572424 3300009094 Bacteria 1316
254 Ga0111539_10830668 3300009094 Bacteria 1075
255 Ga0105245_10004191 3300009098 Bacteria 12802
256 Ga0105245_10009816 3300009098 Bacteria 8341
257 Ga0105245_10034197 3300009098 Bacteria 4507
258 Ga0105245_10312155 3300009098 Bacteria 1546
259 Ga0105245_10460145 3300009098 Bacteria 1282
260 Ga0114129_10000004 3300009147 Bacteria 160944
261 Ga0114129_10000050 3300009147 Bacteria 102066
262 Ga0114129_10002267 3300009147 Bacteria 26615
263 Ga0114129_10004085 3300009147 Bacteria 20622
264 Ga0114129_10005032 3300009147 Bacteria 18605
265 Ga0114129_10054859 3300009147 Bacteria 5586
266 Ga0114129_10077578 3300009147 Bacteria 4620
267 Ga0114129_10089605 3300009147 Bacteria 4264
268 Ga0114129_10132360 3300009147 Bacteria 3424
269 Ga0114129_10139045 3300009147 Bacteria 3330
270 Ga0114129_10154146 3300009147 Bacteria 3143
271 Ga0114129_10227573 3300009147 Bacteria 2512
272 Ga0114129_10270569 3300009147 Bacteria 2273
273 Ga0114129_10378608 3300009147 Bacteria 1870
274 Ga0114129_10903119 3300009147 Bacteria 1119
275 Ga0105243_10142023 3300009148 Bacteria 2050
276 Ga0105243_10609529 3300009148 Bacteria 1052
277 Ga0105241_10002402 3300009174 Bacteria 14064
278 Ga0105241_10006773 3300009174 Bacteria 8432
279 Ga0105242_10065950 3300009176 Bacteria 2989
280 Ga0105242_10101799 3300009176 Bacteria 2435
281 Ga0105248_10000018 3300009177 Bacteria 294894
282 Ga0105248_10064419 3300009177 Bacteria 4115
283 Ga0105248_10099938 3300009177 Bacteria 3269
284 Ga0105248_10227451 3300009177 Bacteria 2100
285 Ga0105248_10243325 3300009177 Bacteria 2025
286 Ga0105237_10139516 3300009545 Bacteria 2418
287 Ga0105237_10338072 3300009545 Bacteria 1510
288 Ga0105237_10437115 3300009545 Bacteria 1314
289 Ga0105238_10037303 3300009551 Bacteria 4941
290 Ga0105249_10005207 3300009553 Bacteria 11223
291 Ga0105249_10043006 3300009553 Bacteria 4109
292 Ga0105249_10166828 3300009553 Bacteria 2132
293 Ga0105249_10358456 3300009553 Bacteria 1479
294 Ga0105239_10001401 3300010375 Bacteria 32259
295 Ga0105239_10123712 3300010375 Bacteria 2874
296 Ga0105239_10247704 3300010375 Bacteria 2001
297 Ga0105246_10000043 3300011119 Bacteria 47690
298 Ga0105246_10018753 3300011119 Bacteria 4411
299 Ga0105246_10226677 3300011119 Bacteria 1469
300 Ga0157373_10028008 3300013100 Bacteria 4065
301 Ga0157373_10053563 3300013100 Bacteria 2869
302 Ga0157371_10004316 3300013102 Bacteria 12464
303 Ga0157370_10036631 3300013104 Bacteria 4759
304 Ga0157369_10010249 3300013105 Bacteria 10695
305 Ga0157369_10019495 3300013105 Bacteria 7590
306 Ga0157369_10041192 3300013105 Bacteria 5041
307 Ga0157374_10091348 3300013296 Bacteria 2903
308 Ga0157374_10324572 3300013296 Bacteria 1526
309 Ga0157378_10191578 3300013297 Bacteria 1929
310 Ga0163162_10024427 3300013306 Bacteria 5965
311 Ga0163162_10083227 3300013306 Bacteria 3273
312 Ga0157372_10003488 3300013307 Bacteria 16951
313 Ga0157372_10028325 3300013307 Bacteria 6113
314 Ga0157372_10263775 3300013307 Bacteria 2000
315 Ga0157375_10106921 3300013308 Bacteria 2890
316 Ga0157375_10125173 3300013308 Bacteria 2684
317 Ga0157375_10382192 3300013308 Bacteria 1575
318 Ga0157375_10457802 3300013308 Bacteria 1441
319 Ga0163163_10033828 3300014325 Bacteria 4947
320 Ga0163163_10091573 3300014325 Bacteria 3055
321 Ga0163163_10109199 3300014325 Bacteria 2793
322 Ga0163163_10110734 3300014325 Bacteria 2774
323 Ga0163163_10153726 3300014325 Bacteria 2344
324 Ga0157380_10332990 3300014326 Bacteria 1412
325 Ga0157377_10008166 3300014745 Bacteria 5092
326 Ga0157377_10052744 3300014745 Bacteria 2297
327 Ga0157377_10150666 3300014745 Bacteria 1438
328 Ga0157379_10536148 3300014968 Bacteria 1088
329 Ga0157376_10462266 3300014969 Bacteria 1240
330 Ga0206356_10202247 3300020070 Bacteria 5095
331 Ga0213873_10009109 3300021358 Bacteria 2050
332 Ga0213873_10015007 3300021358 Bacteria 1727
333 Ga0213873_10034310 3300021358 Bacteria 1278
334 Ga0213872_10003060 3300021361 Bacteria 9430
335 Ga0213872_10094699 3300021361 Bacteria 1334
336 Ga0213874_10002416 3300021377 Bacteria 4020
337 Ga0213874_10008293 3300021377 Bacteria 2530
338 Ga0213874_10030048 3300021377 Bacteria 1563
339 Ga0213876_10000392 3300021384 Bacteria 36739
340 Ga0213876_10015196 3300021384 Bacteria 4077
341 Ga0213876_10041304 3300021384 Bacteria 2437
342 Ga0213876_10089653 3300021384 Bacteria 1629
343 Ga0213876_10094785 3300021384 Bacteria 1581
344 Ga0213875_10000001 3300021388 Bacteria 2793540
345 Ga0213875_10000563 3300021388 Bacteria 30193
346 Ga0213875_10003758 3300021388 Bacteria 8551
347 Ga0213875_10004499 3300021388 Bacteria 7631
348 Ga0213875_10043724 3300021388 Bacteria 2103
349 Ga0213875_10076058 3300021388 Bacteria 1567
350 Ga0213871_10003379 3300021441 Bacteria 3066
351 Ga0213871_10008924 3300021441 Bacteria 2228
352 Ga0213871_10012597 3300021441 Bacteria 1969
353 Ga0213871_10026748 3300021441 Bacteria 1478
354 Ga0207426_1000811 3300025302 Bacteria 33613
355 Ga0207426_1005346 3300025302 Bacteria 5897
356 Ga0207692_10126433 3300025898 Bacteria 1438
357 Ga0207688_10004787 3300025901 Bacteria 7373
358 Ga0207688_10005818 3300025901 Bacteria 6711
359 Ga0207688_10024320 3300025901 Bacteria 3321
360 Ga0207647_10035183 3300025904 Bacteria 3193
361 Ga0207699_10080877 3300025906 Bacteria 2014
362 Ga0207645_10028939 3300025907 Bacteria 3573
363 Ga0207645_10059072 3300025907 Bacteria 2449
364 Ga0207645_10186915 3300025907 Bacteria 1360
365 Ga0207643_10000255 3300025908 Bacteria 37233
366 Ga0207643_10006057 3300025908 Bacteria 6462
367 Ga0207705_10001884 3300025909 Bacteria 16457
368 Ga0207705_10005307 3300025909 Bacteria 9641
369 Ga0207705_10017368 3300025909 Bacteria 5153
370 Ga0207705_10041114 3300025909 Bacteria 3316
371 Ga0207705_10050948 3300025909 Bacteria 2980
372 Ga0207684_10007467 3300025910 Bacteria 9837
373 Ga0207684_10081761 3300025910 Bacteria 2749
374 Ga0207684_10133326 3300025910 Bacteria 2132
375 Ga0207654_10026303 3300025911 Bacteria 3149
376 Ga0207654_10188316 3300025911 Bacteria 1351
377 Ga0207707_10065837 3300025912 Bacteria 3155
378 Ga0207707_10069855 3300025912 Bacteria 3061
379 Ga0207707_10140946 3300025912 Bacteria 2108
380 Ga0207695_10002892 3300025913 Bacteria 24881
381 Ga0207695_10039707 3300025913 Bacteria 5055
382 Ga0207695_10194408 3300025913 Bacteria 1945
383 Ga0207671_10000492 3300025914 Bacteria 53745
384 Ga0207671_10092368 3300025914 Bacteria 2282
385 Ga0207671_10119397 3300025914 Bacteria 2014
386 Ga0207693_10313042 3300025915 Bacteria 1229
387 Ga0207663_10069250 3300025916 Bacteria 2269
388 Ga0207663_10230367 3300025916 Bacteria 1353
389 Ga0207660_10191671 3300025917 Bacteria 1592
390 Ga0207660_10326112 3300025917 Bacteria 1227
391 Ga0207657_10017156 3300025919 Bacteria 6955
392 Ga0207657_10017298 3300025919 Bacteria 6919
393 Ga0207657_10035544 3300025919 Bacteria 4467
394 Ga0207657_10043946 3300025919 Bacteria 3932
395 Ga0207649_10014228 3300025920 Bacteria 4452
396 Ga0207649_10029333 3300025920 Bacteria 3248
397 Ga0207652_10007647 3300025921 Bacteria 8695
398 Ga0207652_10030737 3300025921 Bacteria 4500
399 Ga0207652_10315662 3300025921 Bacteria 1411
400 Ga0207646_10012726 3300025922 Bacteria 8074
401 Ga0207646_10029254 3300025922 Bacteria 5008
402 Ga0207646_10137222 3300025922 Bacteria 2202
403 Ga0207646_10140434 3300025922 Bacteria 2175
404 Ga0207646_10250578 3300025922 Bacteria 1600
405 Ga0207646_10271504 3300025922 Bacteria 1533
406 Ga0207681_10152156 3300025923 Bacteria 1735
407 Ga0207694_10002567 3300025924 Bacteria 14741
408 Ga0207694_10025522 3300025924 Bacteria 4492
409 Ga0207694_10028556 3300025924 Bacteria 4253
410 Ga0207650_10018346 3300025925 Bacteria 4909
411 Ga0207650_10066617 3300025925 Bacteria 2701
412 Ga0207659_10002694 3300025926 Bacteria 10582
413 Ga0207659_10310316 3300025926 Bacteria 1298
414 Ga0207687_10006625 3300025927 Bacteria 7642
415 Ga0207687_10043025 3300025927 Bacteria 3111
416 Ga0207687_10222120 3300025927 Bacteria 1488
417 Ga0207700_10173293 3300025928 Bacteria 1801
418 Ga0207700_10205849 3300025928 Bacteria 1661
419 Ga0207700_10485516 3300025928 Bacteria 1092
420 Ga0207664_10019225 3300025929 Bacteria 5045
421 Ga0207664_10030674 3300025929 Bacteria 4108
422 Ga0207664_10076997 3300025929 Bacteria 2701
423 Ga0207664_10449181 3300025929 Bacteria 1150
424 Ga0207664_10533911 3300025929 Bacteria 1052
425 Ga0207644_10033748 3300025931 Bacteria 3579
426 Ga0207690_10013870 3300025932 Bacteria 4854
427 Ga0207690_10015584 3300025932 Bacteria 4608
428 Ga0207690_10180298 3300025932 Bacteria 1590
429 Ga0207706_10077313 3300025933 Bacteria 2927
430 Ga0207706_10092644 3300025933 Bacteria 2657
431 Ga0207686_10164509 3300025934 Bacteria 1558
432 Ga0207709_10094864 3300025935 Bacteria 1959
433 Ga0207709_10141404 3300025935 Bacteria 1655
434 Ga0207669_10352314 3300025937 Bacteria 1138
435 Ga0207704_10011020 3300025938 Bacteria 4435
436 Ga0207665_10005460 3300025939 Bacteria 8484
437 Ga0207691_10035406 3300025940 Bacteria 4634
438 Ga0207711_10000313 3300025941 Bacteria 51800
439 Ga0207711_10088724 3300025941 Bacteria 2715
440 Ga0207689_10005049 3300025942 Bacteria 11894
441 Ga0207689_10028236 3300025942 Bacteria 4693
442 Ga0207661_10005765 3300025944 Bacteria 8732
443 Ga0207661_10023643 3300025944 Bacteria 4646
444 Ga0207661_10131900 3300025944 Bacteria 2141
445 Ga0207661_10149418 3300025944 Bacteria 2018
446 Ga0207661_10220389 3300025944 Bacteria 1676
447 Ga0207661_10401432 3300025944 Bacteria 1243
448 Ga0207679_10058656 3300025945 Bacteria 2853
449 Ga0207679_10085332 3300025945 Bacteria 2425
450 Ga0207679_10368156 3300025945 Bacteria 1257
451 Ga0207667_10000018 3300025949 Bacteria 388308
452 Ga0207667_10007907 3300025949 Bacteria 12697
453 Ga0207667_10009879 3300025949 Bacteria 11199
454 Ga0207667_10032464 3300025949 Bacteria 5626
455 Ga0207667_10146658 3300025949 Bacteria 2429
456 Ga0207667_10167382 3300025949 Bacteria 2259
457 Ga0207667_10351792 3300025949 Bacteria 1502
458 Ga0207712_10003342 3300025961 Bacteria 10162
459 Ga0207712_10042746 3300025961 Bacteria 3123
460 Ga0207712_10058717 3300025961 Bacteria 2719
461 Ga0207712_10102291 3300025961 Bacteria 2132
462 Ga0207668_10003497 3300025972 Bacteria 9226
463 Ga0207640_10000003 3300025981 Bacteria 505282
464 Ga0207640_10028362 3300025981 Bacteria 3422
465 Ga0207677_10055756 3300026023 Bacteria 2704
466 Ga0207703_10081605 3300026035 Bacteria 2696
467 Ga0207703_10164053 3300026035 Bacteria 1948
468 Ga0207639_10012194 3300026041 Bacteria 5981
469 Ga0207678_10000346 3300026067 Bacteria 41986
470 Ga0207678_10006802 3300026067 Bacteria 10142
471 Ga0207678_10031327 3300026067 Bacteria 4639
472 Ga0207708_10005711 3300026075 Bacteria 9199
473 Ga0207708_10034322 3300026075 Bacteria 3858
474 Ga0207708_10221244 3300026075 Bacteria 1517
475 Ga0207702_10000631 3300026078 Bacteria 38615
476 Ga0207702_10054568 3300026078 Bacteria 3387
477 Ga0207702_10061875 3300026078 Bacteria 3194
478 Ga0207702_10224978 3300026078 Bacteria 1750
479 Ga0207641_10004672 3300026088 Bacteria 11815
480 Ga0207641_10008384 3300026088 Bacteria 8542
481 Ga0207641_10042093 3300026088 Bacteria 3831
482 Ga0207648_10022678 3300026089 Bacteria 5636
483 Ga0207648_10116813 3300026089 Bacteria 2345
484 Ga0207648_10206407 3300026089 Bacteria 1744
485 Ga0207648_10417569 3300026089 Bacteria 1218
486 Ga0207676_10025873 3300026095 Bacteria 4357
487 Ga0207676_10193310 3300026095 Bacteria 1792
488 Ga0207676_10552279 3300026095 Bacteria 1100
489 Ga0207674_10001502 3300026116 Bacteria 30105
490 Ga0207674_10021127 3300026116 Bacteria 7017
491 Ga0207674_10049528 3300026116 Bacteria 4296
492 Ga0207674_10062455 3300026116 Bacteria 3763
493 Ga0207674_10079185 3300026116 Bacteria 3291
494 Ga0207674_10176858 3300026116 Bacteria 2086
495 Ga0207675_100029374 3300026118 Bacteria 5123
496 Ga0207683_10000342 3300026121 Bacteria 42329
497 Ga0207683_10094863 3300026121 Bacteria 2659
498 Ga0207698_10025503 3300026142 Bacteria 4167
499 Ga0207698_10066856 3300026142 Bacteria 2832
500 Ga0207698_10071393 3300026142 Bacteria 2755
501 Ga0207698_10120705 3300026142 Bacteria 2218
502 Ga0209813_10006654 3300027866 Bacteria 2861
503 Ga0207428_10000213 3300027907 Bacteria 80079
504 Ga0207428_10013436 3300027907 Bacteria 7152
505 Ga0207428_10028679 3300027907 Bacteria 4622
506 Ga0265356_1000276 3300028017 Bacteria 9607
507 Ga0268266_10030662 3300028379 Bacteria 4567
508 Ga0268266_10173281 3300028379 Bacteria 1959
509 Ga0268266_10350945 3300028379 Bacteria 1386
510 Ga0268265_10000008 3300028380 Bacteria 417328
511 Ga0268265_10010617 3300028380 Bacteria 6220
512 Ga0268265_10057623 3300028380 Bacteria 2962
513 Ga0268265_10061613 3300028380 Bacteria 2879
514 Ga0268265_10067603 3300028380 Bacteria 2767
515 Ga0268265_10184166 3300028380 Bacteria 1797
516 Ga0268264_10434152 3300028381 Bacteria 1269
517 Ga0265334_10026764 3300028573 Bacteria 2326
518 Ga0307515_10004662 3300028794 Bacteria 28143
519 Ga0307515_10004732 3300028794 Bacteria 27881
520 Ga0307515_10021895 3300028794 Bacteria 11305
521 Ga0307515_10030848 3300028794 Bacteria 8975
522 Ga0307515_10078253 3300028794 Bacteria 4352
523 Ga0307515_10080122 3300028794 Bacteria 4264
524 Ga0307515_10102556 3300028794 Bacteria 3440
525 Ga0265338_10000157 3300028800 Bacteria 124607
526 Ga0265338_10023339 3300028800 Bacteria 6365
527 Ga0265338_10027991 3300028800 Bacteria 5637
528 Ga0265338_10073751 3300028800 Bacteria 2907
529 Ga0265324_10077017 3300029957 Archaea 1135
530 Ga0237817_10142 3300030083 Bacteria 21441
531 Ga0307511_10000068 3300030521 Bacteria 85766
532 Ga0307512_10002870 3300030522 Bacteria 20931
533 Ga0307512_10007686 3300030522 Bacteria 10629
534 Ga0307512_10020139 3300030522 Bacteria 6049
535 Ga0307512_10037274 3300030522 Bacteria 4109
536 Ga0307512_10117234 3300030522 Bacteria 1727
537 Ga0316177_1163023 3300030731 Bacteria 5376
538 Ga0314311_1152082 3300030733 Bacteria 4227
539 Ga0316178_1125740 3300030735 Bacteria 1271
540 Ga0316180_1088936 3300030736 Bacteria 4199
541 Ga0265760_10032833 3300031090 Bacteria 1533
542 Ga0265332_10016284 3300031238 Bacteria 3280
543 Ga0265328_10034544 3300031239 Bacteria 1872
544 Ga0265325_10000121 3300031241 Bacteria 53821
545 Ga0265325_10020563 3300031241 Bacteria 3638
546 Ga0265340_10024843 3300031247 Bacteria 3039
547 Ga0265339_10033397 3300031249 Bacteria 2897
548 Ga0265339_10087508 3300031249 Bacteria 1638
549 Ga0265316_10003591 3300031344 Bacteria 15635
550 Ga0307513_10001964 3300031456 Bacteria 29107
551 Ga0307513_10046888 3300031456 Bacteria 4706
552 Ga0307509_10080709 3300031507 Bacteria 3363
553 Ga0307509_10100779 3300031507 Bacteria 2925
554 Ga0265313_10000136 3300031595 Bacteria 75600
555 Ga0307508_10002257 3300031616 Bacteria 20546
556 Ga0307508_10003547 3300031616 Bacteria 15728
557 Ga0307508_10006649 3300031616 Bacteria 10860
558 Ga0307508_10083289 3300031616 Bacteria 2781
559 Ga0307514_10028499 3300031649 Bacteria 4504
560 Ga0265342_10002122 3300031712 Bacteria 17487
561 Ga0265342_10005561 3300031712 Bacteria 9560
562 Ga0307516_10005035 3300031730 Bacteria 15990
563 Ga0307516_10006276 3300031730 Bacteria 13973
564 Ga0307516_10012708 3300031730 Bacteria 9051
565 Ga0307516_10015935 3300031730 Bacteria 7885
566 Ga0307516_10017555 3300031730 Bacteria 7458
567 Ga0307516_10026185 3300031730 Bacteria 5926
568 Ga0307516_10048379 3300031730 Bacteria 4184
569 Ga0307413_10046724 3300031824 Bacteria 2577
570 Ga0307413_10050002 3300031824 Bacteria 2509
571 Ga0307410_10021650 3300031852 Bacteria 3958
572 Ga0307410_10034314 3300031852 Bacteria 3285
573 Ga0307406_10031439 3300031901 Bacteria 3233
574 Ga0307406_10116453 3300031901 Bacteria 1849
575 Ga0307407_10097222 3300031903 Bacteria 1819
576 Ga0307409_100012482 3300031995 Bacteria 5416
577 Ga0307409_100029090 3300031995 Bacteria 3949
578 Ga0307409_100091047 3300031995 Bacteria 2498
579 Ga0307409_100297883 3300031995 Bacteria 1499
580 Ga0307416_100073061 3300032002 Bacteria 2858
581 Ga0307411_10076178 3300032005 Bacteria 2292
582 Ga0307415_100008771 3300032126 Bacteria 5627
583 Ga0307415_100023226 3300032126 Bacteria 3845
584 Ga0307415_100042054 3300032126 Bacteria 3039
585 Ga0307415_100057450 3300032126 Bacteria 2674
586 Ga0307415_100114205 3300032126 Bacteria 2010
587 Ga0307507_10072905 3300033179 Bacteria 3090
588 Ga0307510_10159385 3300033180 Bacteria 1857
589 Ga0307510_10164335 3300033180 Bacteria 1811
590 Ga0373940_0028742 3300035088 Bacteria 1469
591 Ga0373951_0000228 3300035091 Bacteria 19339
592 Ga0373932_0071632 3300035112 Bacteria 1076
593 Ga0373942_0000477 3300035207 Bacteria 11400
594 Ga0373931_0023595 3300035691 Bacteria 3108
595 Ga0373935_0019960 3300035692 Bacteria 4090
596 Ga0373927_0000164 3300035695 Bacteria 51851
597 Ga0373937_0101745 3300036401 Bacteria 2667
598 Ga0373925_0020290 3300037068 Bacteria 4837
599 Ga0395899_0016934 3300037312 Bacteria 5556
600 Ga0395899_0037324 3300037312 Bacteria 3642
601 Ga0395900_0029675 3300037418 Bacteria 5611
602 Ga0395900_0121557 3300037418 Bacteria 2679
603 Ga0395900_0194038 3300037418 Bacteria 2058
604 Ga0395900_0267543 3300037418 Bacteria 1705
605 Ga0395900_0914544 3300037418 Bacteria 800
606 Ga0395898_0009560 3300037466 Bacteria 10184
607 Ga0395898_0075347 3300037466 Bacteria 3259
608 Ga0395898_0090014 3300037466 Bacteria 2953
609 Ga0395898_0290461 3300037466 Bacteria 1560
610 Ga0395905_0030937 3300037471 Bacteria 5041
611 Ga0395905_0535822 3300037471 Bacteria 1072
612 Ga0436364_0031147 3300037853 Bacteria 12344
613 Ga0436364_0056800 3300037853 Bacteria 6930
614 Ga0436364_0130866 3300037853 Bacteria 53503
615 Ga0436364_0258512 3300037853 Bacteria 8715
616 Ga0436364_0273345 3300037853 Bacteria 2794207
617 Ga0436364_0306718 3300037853 Bacteria 6032
618 Ga0436364_0381375 3300037853 Bacteria 1578
619 Ga0436364_0817615 3300037853 Bacteria 9851
620 Ga0436364_0830434 3300037853 Bacteria 1504
621 Ga0436364_1286690 3300037853 Bacteria 3755
622 Ga0436364_1436469 3300037853 Bacteria 2480
623 Ga0436364_1499753 3300037853 Bacteria 1673
624 Ga0436364_1550326 3300037853 Bacteria 15744
625 Ga0395901_0005476 3300038443 Bacteria 12856
626 Ga0395901_0010309 3300038443 Bacteria 9466
627 Ga0395901_0066823 3300038443 Bacteria 3744
628 Ga0395901_0102002 3300038443 Bacteria 3011
629 Ga0395901_0121835 3300038443 Bacteria 2741
630 Ga0395901_0309463 3300038443 Bacteria 1636
631 Ga0400485_01398 3300038735 Bacteria 4928
632 Ga0400483_051011 3300039062 Bacteria 5689
633 Ga0400483_146421 3300039062 Bacteria 7762
634 Ga0400483_281577 3300039062 Bacteria 14576
635 Ga0436365_0196318 3300039437 Bacteria 8677
636 Ga0436365_0853215 3300039437 Bacteria 1565
637 Ga0436365_0934173 3300039437 Bacteria 1596
638 Ga0436365_0980504 3300039437 Bacteria 1864
639 Ga0436365_1206342 3300039437 Bacteria 3963
640 Ga0436365_1493597 3300039437 Bacteria 2459
641 Ga0436365_1589201 3300039437 Bacteria 2159
642 Ga0436365_1607019 3300039437 Bacteria 2322
643 Ga0436360_0009449 3300039438 Bacteria 8390
644 Ga0436360_0037933 3300039438 Bacteria 3110
645 Ga0436360_0098126 3300039438 Bacteria 2702
646 Ga0436360_0141554 3300039438 Bacteria 3385
647 Ga0436360_0153847 3300039438 Bacteria 1485
648 Ga0436360_0412872 3300039438 Bacteria 6025
649 Ga0436360_0581232 3300039438 Bacteria 1280
650 Ga0436360_0930976 3300039438 Bacteria 2393
651 Ga0436360_1004013 3300039438 Bacteria 3453
652 Ga0436360_1038089 3300039438 Bacteria 3937
653 Ga0436360_1093826 3300039438 Bacteria 2537
654 Ga0436360_1197386 3300039438 Bacteria 1984
655 Ga0436360_1228528 3300039438 Bacteria 3754
656 Ga0436361_0303992 3300039447 Bacteria 10200
657 Ga0436361_0353974 3300039447 Bacteria 2435
658 Ga0436361_0493910 3300039447 Bacteria 2630
659 Ga0436361_0571302 3300039447 Bacteria 101663
660 Ga0436361_0684318 3300039447 Bacteria 1630
661 Ga0436361_0787384 3300039447 Bacteria 6263
662 Ga0436361_0790320 3300039447 Bacteria 1567
663 Ga0436361_0913090 3300039447 Bacteria 5785
664 Ga0436361_1210671 3300039447 Bacteria 10125
665 Ga0436363_0032621 3300039450 Bacteria 48468
666 Ga0436363_0082939 3300039450 Bacteria 2765
667 Ga0436363_0170474 3300039450 Bacteria 1380
668 Ga0436363_0356929 3300039450 Bacteria 1190
669 Ga0436363_0452825 3300039450 Bacteria 5490
670 Ga0436363_0629336 3300039450 Bacteria 1604
671 Ga0436363_0776175 3300039450 Bacteria 2242
672 Ga0436363_1465945 3300039450 Bacteria 1211
673 Ga0436363_1620918 3300039450 Bacteria 5020
674 Ga0436362_0027826 3300039453 Bacteria 1135
675 Ga0436362_0051025 3300039453 Bacteria 2709
676 Ga0436362_0406634 3300039453 Bacteria 2048
677 Ga0436362_0483944 3300039453 Bacteria 3150
678 Ga0436362_0486730 3300039453 Bacteria 3286
679 Ga0436362_0540144 3300039453 Bacteria 1300
680 Ga0436362_0653197 3300039453 Bacteria 3893
681 Ga0436362_0767395 3300039453 Bacteria 2835
682 Ga0436362_0853964 3300039453 Bacteria 3472
683 Ga0436362_1003461 3300039453 Bacteria 29888
684 Ga0436362_1013653 3300039453 Bacteria 4444
685 Ga0436362_1187126 3300039453 Bacteria 2571
686 Ga0439439_0003999 3300041406 Bacteria 3289
687 Ga0451853_1738478 3300041512 Bacteria 4476
688 Ga0439433_0013204 3300041999 Bacteria 1812
689 Ga0439448_0064010 3300042005 Bacteria 1219
690 Ga0439449_0000392 3300042007 Bacteria 16234
691 Ga0439449_0000447 3300042007 Bacteria 15359
692 Ga0439462_0000062 3300042015 Bacteria 15886
693 Ga0439462_0006819 3300042015 Bacteria 2849
694 Ga0439459_0015659 3300042438 Bacteria 1392
695 Ga0451577_0024855 3300042876 Bacteria 5442
696 Ga0451577_0105966 3300042876 Bacteria 2513
697 Ga0466969_0000414 3300044656 Bacteria 23339
698 Ga0466969_0010863 3300044656 Bacteria 4824
699 Ga0466969_0025286 3300044656 Bacteria 3053
700 Ga0466969_0026364 3300044656 Bacteria 2981
701 Ga0466969_0083340 3300044656 Bacteria 1523
702 Ga0466969_0105166 3300044656 Bacteria 1325
703 Ga0466969_0118489 3300044656 Bacteria 1234
704 Ga0466972_0003966 3300044658 Bacteria 7375
705 Ga0466972_0008316 3300044658 Bacteria 5201
706 Ga0466972_0009638 3300044658 Bacteria 4847
707 Ga0466972_0012940 3300044658 Bacteria 4190
708 Ga0466972_0038777 3300044658 Bacteria 2327
709 Ga0453683_0007388 3300044673 Bacteria 7458
710 Ga0466965_0005786 3300044683 Bacteria 5578
711 Ga0466965_0009509 3300044683 Bacteria 4517
712 Ga0466965_0009647 3300044683 Bacteria 4489
713 Ga0466965_0013094 3300044683 Bacteria 3909
714 Ga0466965_0014434 3300044683 Bacteria 3739
715 Ga0466965_0101240 3300044683 Bacteria 1473
716 Ga0466965_0275215 3300044683 Bacteria 908
717 Ga0466966_0000993 3300044684 Bacteria 18195
718 Ga0466966_0003994 3300044684 Bacteria 9741
719 Ga0466966_0006867 3300044684 Bacteria 7540
720 Ga0466966_0020631 3300044684 Bacteria 4330
721 Ga0466966_0049959 3300044684 Bacteria 2662
722 Ga0466966_0056067 3300044684 Bacteria 2494
723 Ga0466961_0002381 3300044693 Bacteria 11678
724 Ga0466961_0002837 3300044693 Bacteria 10763
725 Ga0466961_0007163 3300044693 Bacteria 7095
726 Ga0466961_0023862 3300044693 Bacteria 3935
727 Ga0466961_0025553 3300044693 Bacteria 3798
728 Ga0466961_0044420 3300044693 Bacteria 2843
729 Ga0466961_0089856 3300044693 Bacteria 1940
730 Ga0466963_0006200 3300044694 Bacteria 7062
731 Ga0466963_0196031 3300044694 Bacteria 1412
732 Ga0466964_0012379 3300044706 Bacteria 3228
733 Ga0453684_0008665 3300044712 Bacteria 18098
734 Ga0453684_0336544 3300044712 Bacteria 1705
735 Ga0466971_0027309 3300044719 Bacteria 2556
736 Ga0466971_0046671 3300044719 Bacteria 1946
737 Ga0466968_0003347 3300044735 Bacteria 5923
738 Ga0466968_0009274 3300044735 Bacteria 3785
739 Ga0466970_0006945 3300044765 Bacteria 5668
740 Ga0466970_0014160 3300044765 Bacteria 4090
741 Ga0466970_0033316 3300044765 Bacteria 2723
742 Ga0466957_0003558 3300044842 Bacteria 8582
743 Ga0466957_0023274 3300044842 Bacteria 3661
744 Ga0466960_0044927 3300044901 Bacteria 2108
745 Ga0466960_0083661 3300044901 Bacteria 1613
746 Ga0466959_0001670 3300045049 Bacteria 13743
747 Ga0466959_0004585 3300045049 Bacteria 9276
748 Ga0466959_0043109 3300045049 Bacteria 3328
749 Ga0466959_0070827 3300045049 Bacteria 2526
750 Ga0466959_0073006 3300045049 Bacteria 2482
751 Ga0466959_0107447 3300045049 Unclassified 1994
752 Ga0451576_0001906 3300045051 Bacteria 33422
753 Ga0466958_0009229 3300045836 Bacteria 5489
754 Ga0466958_0011075 3300045836 Bacteria 5071
755 Ga0466958_0059455 3300045836 Bacteria 2325
756 Ga0466967_0008264 3300045976 Bacteria 7603
757 Ga0466967_0032142 3300045976 Bacteria 4427
758 Ga0466967_0064210 3300045976 Bacteria 3265
759 Ga0466967_0080908 3300045976 Bacteria 2933
760 Ga0466967_0109693 3300045976 Bacteria 2534
761 Ga0466967_0191553 3300045976 Bacteria 1933
762 Ga0466967_0255721 3300045976 Bacteria 1674
763 Ga0466967_0271137 3300045976 Bacteria 1626
764 Ga0495592_0096768 3300046454 Bacteria 2109
765 Ga0495592_0187586 3300046454 Bacteria 1403
766 Ga0495603_0086793 3300046455 Bacteria 1831
767 Ga0495603_0168564 3300046455 Bacteria 1269
768 Ga0495629_0001390 3300046459 Bacteria 19101
769 Ga0495629_0024512 3300046459 Bacteria 4296
770 Ga0495629_0044251 3300046459 Bacteria 3125
771 Ga0495629_0172944 3300046459 Bacteria 1498
772 Ga0495638_0239700 3300046460 Bacteria 1005
773 Ga0495651_0000128 3300046462 Bacteria 56236
774 Ga0495651_0004211 3300046462 Bacteria 11022
775 Ga0495580_0283533 3300046472 Bacteria 1130
776 Ga0495582_0238703 3300046473 Bacteria 1041
777 Ga0495662_0002245 3300046476 Bacteria 9742
778 Ga0495664_0003058 3300046477 Bacteria 9063
779 Ga0495664_0090208 3300046477 Bacteria 1843
780 Ga0495583_0035582 3300046506 Bacteria 2376
781 Ga0495618_0156474 3300046514 Bacteria 1454
782 Ga0495628_0002560 3300046516 Bacteria 16353
783 Ga0495628_0286339 3300046516 Bacteria 1222
784 Ga0495630_0321145 3300046517 Bacteria 1184
785 Ga0495632_0118850 3300046519 Bacteria 1236
786 Ga0495666_0000540 3300046526 Bacteria 16836
787 Ga0495652_0000358 3300046529 Bacteria 54461
788 Ga0495652_0120869 3300046529 Bacteria 2089
789 Ga0495652_0129573 3300046529 Bacteria 1999
790 Ga0495665_0015774 3300046531 Bacteria 4068
791 Ga0495640_0011237 3300046533 Bacteria 6893
792 Ga0495640_0011357 3300046533 Bacteria 6856
793 Ga0495640_0065157 3300046533 Bacteria 2461
794 Ga0495586_0034545 3300046535 Bacteria 2716
795 Ga0495587_0020875 3300046536 Bacteria 4040
796 Ga0495587_0055764 3300046536 Bacteria 2326
797 Ga0495587_0164379 3300046536 Bacteria 1262
798 Ga0495645_0010190 3300046543 Bacteria 6585
799 Ga0495645_0114620 3300046543 Bacteria 1904
800 Ga0495622_0074017 3300046557 Bacteria 1571
801 Ga0495634_0002087 3300046642 Bacteria 16892
802 Ga0495634_0017275 3300046642 Bacteria 5151
803 Ga0495635_0009480 3300046663 Bacteria 6802
804 Ga0495635_0016699 3300046663 Bacteria 5127
805 Ga0495588_0124167 3300046674 Bacteria 1361
806 Ga0495657_0001170 3300046675 Bacteria 22966
807 Ga0495657_0102885 3300046675 Bacteria 1817
808 Ga0495599_0012543 3300046678 Bacteria 5228
809 Ga0495599_0231129 3300046678 Bacteria 1129
810 Ga0495623_0007760 3300046679 Bacteria 6972
811 Ga0495623_0041368 3300046679 Bacteria 2939
812 Ga0495646_0001835 3300046680 Bacteria 12775
813 Ga0495658_0193481 3300046683 Bacteria 1265
814 Ga0495613_0000357 3300046689 Bacteria 40386
815 Ga0495613_0002729 3300046689 Bacteria 13247
816 Ga0495613_0033173 3300046689 Bacteria 3836
817 Ga0495613_0292466 3300046689 Bacteria 1129
818 Ga0495624_0090964 3300046690 Bacteria 1883
819 Ga0495600_0000178 3300046809 Bacteria 37350
820 Ga0495600_0002662 3300046809 Bacteria 10325
821 Ga0495600_0097979 3300046809 Bacteria 1911
822 Ga0495600_0113106 3300046809 Bacteria 1767
823 Ga0495581_0000040 3300047315 Bacteria 47542
824 Ga0495581_0009314 3300047315 Bacteria 5683
825 Ga0495604_0000800 3300047317 Bacteria 26453
826 Ga0495604_0005570 3300047317 Bacteria 9982
827 Ga0495604_0009368 3300047317 Bacteria 7746
828 Ga0495604_0012191 3300047317 Bacteria 6833
829 Ga0495604_0104554 3300047317 Bacteria 2074
830 Ga0495604_0124391 3300047317 Bacteria 1862
831 Ga0495604_0223930 3300047317 Bacteria 1293
832 Ga0495636_0044974 3300047318 Bacteria 1839
833 Ga0495674_0022744 3300047319 Bacteria 5778
834 Ga0495674_0151193 3300047319 Bacteria 1947
835 Ga0495674_0207709 3300047319 Bacteria 1623
836 Ga0495680_0282145 3300047322 Bacteria 1170
837 Ga0495675_0006373 3300047444 Bacteria 7222
838 Ga0495675_0016735 3300047444 Bacteria 4637
839 Ga0495675_0030131 3300047444 Bacteria 3462
840 Ga0495685_044655 3300047447 Bacteria 1511
841 Ga0495684_0282577 3300047471 Bacteria 1197
842 Ga0495593_0019143 3300047673 Bacteria 3842
843 Ga0495602_0023816 3300048088 Bacteria 5955
844 Ga0495614_0021518 3300048089 Bacteria 2785
845 Ga0496101_0009664 3300048904 Bacteria 6346
846 Ga0496101_0065876 3300048904 Bacteria 2641
847 Ga0496102_0020974 3300048905 Bacteria 5777
848 Ga0496102_0081411 3300048905 Bacteria 2985
849 Ga0496102_0108764 3300048905 Bacteria 2582
850 Ga0496102_0171722 3300048905 Bacteria 2041
851 Ga0496102_0377527 3300048905 Bacteria 1334
852 Ga0496102_0425535 3300048905 Bacteria 1247
853 Ga0496102_0452945 3300048905 Bacteria 1204
854 Ga0496103_0036480 3300048906 Bacteria 3011
855 Ga0496103_0203300 3300048906 Bacteria 1274
856 Ga0496104_0124350 3300048907 Bacteria 2476
857 Ga0496105_0043333 3300048908 Bacteria 3711
858 Ga0496106_0023913 3300048909 Bacteria 4540
859 Ga0496106_0042183 3300048909 Bacteria 3421
860 Ga0496107_0038771 3300048910 Bacteria 3417
861 Ga0496107_0188677 3300048910 Bacteria 1531
862 Ga0496107_0246964 3300048910 Bacteria 1328
863 Ga0496108_0019388 3300048911 Bacteria 5584
864 Ga0496108_0250093 3300048911 Bacteria 1542
865 Ga0496109_0010941 3300048912 Bacteria 7773
866 Ga0496109_0023913 3300048912 Bacteria 5425
867 Ga0496109_0054068 3300048912 Bacteria 3664
868 Ga0496109_0231233 3300048912 Bacteria 1739
869 Ga0496109_0285405 3300048912 Bacteria 1556
870 Ga0496110_0020699 3300048913 Bacteria 5555
871 Ga0496110_0366249 3300048913 Bacteria 1313
872 Ga0496111_0047594 3300048914 Bacteria 3088
873 Ga0496111_0048162 3300048914 Bacteria 3070
874 Ga0496111_0071541 3300048914 Bacteria 2524
875 Ga0496112_0017869 3300048915 Bacteria 6674
876 Ga0496112_0072606 3300048915 Bacteria 3402
877 Ga0496112_0141254 3300048915 Bacteria 2377
878 Ga0496112_0311991 3300048915 Bacteria 1518
879 Ga0496112_0315552 3300048915 Bacteria 1508
880 Ga0496113_0010420 3300048916 Bacteria 6145
881 Ga0496113_0056230 3300048916 Bacteria 2953
882 Ga0496113_0268552 3300048916 Bacteria 1363
883 Ga0496114_0044500 3300048917 Bacteria 3683
884 Ga0496114_0058815 3300048917 Bacteria 3210
885 Ga0496114_0135324 3300048917 Bacteria 2131
886 Ga0496114_0177331 3300048917 Bacteria 1860
887 Ga0496115_0013221 3300048918 Bacteria 6237
888 Ga0496115_0079915 3300048918 Bacteria 2662
889 Ga0496116_0000474 3300048919 Bacteria 55522
890 Ga0496117_0010797 3300048920 Bacteria 8249
891 Ga0496117_0034548 3300048920 Bacteria 3807
892 Ga0496118_0000781 3300048921 Bacteria 51011
893 Ga0496118_0015570 3300048921 Bacteria 7032
894 Ga0496119_0004505 3300048922 Bacteria 13830
895 Ga0496124_0101651 3300048927 Bacteria 2329
896 Ga0501291_016764 3300049514 Bacteria 1121
897 Ga0501031_0000115 3300049568 Bacteria 43139
898 Ga0501031_0007958 3300049568 Bacteria 6900
899 Ga0501031_0041878 3300049568 Bacteria 2990
900 Ga0501031_0072043 3300049568 Bacteria 2250
901 Ga0501031_0148899 3300049568 Bacteria 1529
902 Ga0501031_0193384 3300049568 Bacteria 1328
903 Ga0501032_0000052 3300049569 Bacteria 101001
904 Ga0501032_0000872 3300049569 Bacteria 24521
905 Ga0501032_0060474 3300049569 Bacteria 2540
906 Ga0501032_0114967 3300049569 Bacteria 1779
907 Ga0501032_0125585 3300049569 Bacteria 1695
908 Ga0501032_0128804 3300049569 Bacteria 1670
909 Ga0501033_0001762 3300049570 Bacteria 18926
910 Ga0501033_0005593 3300049570 Bacteria 9930
911 Ga0501033_0009214 3300049570 Bacteria 7601
912 Ga0501033_0010098 3300049570 Bacteria 7245
913 Ga0501033_0020037 3300049570 Bacteria 5056
914 Ga0501033_0096484 3300049570 Bacteria 2160
915 Ga0501034_0002674 3300049571 Bacteria 21031
916 Ga0501034_0003126 3300049571 Bacteria 19067
917 Ga0501034_0003912 3300049571 Bacteria 16734
918 Ga0501034_0042386 3300049571 Bacteria 4607
919 Ga0501034_0058411 3300049571 Bacteria 3877
920 Ga0501034_0099515 3300049571 Bacteria 2902
921 Ga0501036_0001596 3300049572 Bacteria 17545
922 Ga0501036_0001835 3300049572 Bacteria 16492
923 Ga0501036_0002136 3300049572 Bacteria 15421
924 Ga0501036_0004954 3300049572 Bacteria 10765
925 Ga0501036_0007977 3300049572 Bacteria 8664
926 Ga0501036_0011181 3300049572 Bacteria 7427
927 Ga0501036_0017286 3300049572 Bacteria 6028
928 Ga0501036_0022220 3300049572 Bacteria 5336
929 Ga0501036_0267546 3300049572 Bacteria 1432
930 Ga0501036_0285553 3300049572 Bacteria 1381
931 Ga0501037_0000046 3300049573 Bacteria 116524
932 Ga0501037_0001427 3300049573 Bacteria 17526
933 Ga0501037_0016043 3300049573 Bacteria 5513
934 Ga0501037_0021174 3300049573 Bacteria 4804
935 Ga0501037_0104384 3300049573 Bacteria 2043
936 Ga0501038_0000068 3300049574 Bacteria 84886
937 Ga0501038_0010363 3300049574 Bacteria 8528
938 Ga0501038_0014618 3300049574 Bacteria 7152
939 Ga0501038_0056014 3300049574 Bacteria 3386
940 Ga0501038_0068510 3300049574 Bacteria 3016
941 Ga0501038_0072376 3300049574 Bacteria 2921
942 Ga0501038_0169816 3300049574 Bacteria 1766
943 Ga0501039_0000362 3300049575 Bacteria 32461
944 Ga0501039_0002635 3300049575 Bacteria 13398
945 Ga0501039_0011902 3300049575 Bacteria 6630
946 Ga0501039_0014225 3300049575 Bacteria 6093
947 Ga0501039_0161714 3300049575 Bacteria 1760
948 Ga0501041_0003245 3300049577 Bacteria 9354
949 Ga0501041_0010412 3300049577 Bacteria 5481
950 Ga0501042_0005655 3300049578 Bacteria 8068
951 Ga0501042_0010326 3300049578 Bacteria 6254
952 Ga0501042_0018124 3300049578 Bacteria 4871
953 Ga0501043_0000783 3300049579 Bacteria 28276
954 Ga0501043_0000785 3300049579 Bacteria 28257
955 Ga0501043_0002726 3300049579 Bacteria 14768
956 Ga0501043_0009599 3300049579 Bacteria 7581
957 Ga0501043_0033694 3300049579 Bacteria 4030
958 Ga0501043_0036588 3300049579 Bacteria 3862
959 Ga0501043_0150790 3300049579 Bacteria 1819
960 Ga0501046_0000102 3300049580 Bacteria 89938
961 Ga0501046_0003286 3300049580 Bacteria 14854
962 Ga0501046_0011973 3300049580 Bacteria 7401
963 Ga0501046_0036275 3300049580 Bacteria 3969
964 Ga0501047_0000327 3300049581 Bacteria 54775
965 Ga0501047_0002504 3300049581 Bacteria 17509
966 Ga0501047_0003586 3300049581 Bacteria 14645
967 Ga0501047_0005305 3300049581 Bacteria 12108
968 Ga0501047_0020357 3300049581 Bacteria 6371
969 Ga0501047_0027822 3300049581 Bacteria 5448
970 Ga0501047_0100599 3300049581 Bacteria 2770
971 Ga0501047_0118040 3300049581 Bacteria 2534
972 Ga0501047_0119289 3300049581 Bacteria 2520
973 Ga0501047_0151207 3300049581 Bacteria 2197
974 Ga0501047_0337040 3300049581 Bacteria 1346
975 Ga0501048_0000006 3300049582 Bacteria 93252
976 Ga0501048_0004360 3300049582 Bacteria 10770
977 Ga0501048_0007307 3300049582 Bacteria 8375
978 Ga0501048_0144963 3300049582 Bacteria 1680
979 Ga0501048_0227848 3300049582 Bacteria 1322
980 Ga0501067_0002695 3300049583 Bacteria 9799
981 Ga0501067_0003477 3300049583 Bacteria 8656
982 Ga0501067_0005126 3300049583 Bacteria 7278
983 Ga0501067_0025636 3300049583 Bacteria 3268
984 Ga0501067_0069808 3300049583 Bacteria 1945
985 Ga0501068_0003083 3300049584 Bacteria 8901
986 Ga0501068_0021718 3300049584 Bacteria 3751
987 Ga0501068_0022413 3300049584 Bacteria 3693
988 Ga0501068_0035562 3300049584 Bacteria 2974
989 Ga0501068_0049650 3300049584 Bacteria 2535
990 Ga0501068_0067976 3300049584 Bacteria 2172
991 Ga0501069_0000146 3300049585 Bacteria 31605
992 Ga0501069_0002076 3300049585 Bacteria 10077
993 Ga0501069_0055070 3300049585 Bacteria 2215
994 Ga0501069_0065550 3300049585 Bacteria 2031
995 Ga0501069_0066183 3300049585 Bacteria 2021
996 Ga0501070_0002259 3300049586 Bacteria 16929
997 Ga0501070_0010017 3300049586 Bacteria 8018
998 Ga0501070_0010181 3300049586 Bacteria 7959
999 Ga0501070_0014063 3300049586 Bacteria 6737
1000 Ga0501070_0041514 3300049586 Bacteria 3832
1001 Ga0501070_0069932 3300049586 Bacteria 2906
1002 Ga0501070_0257476 3300049586 Bacteria 1427
1003 Ga0501071_0001127 3300049587 Bacteria 14926
1004 Ga0501071_0023497 3300049587 Bacteria 4306
1005 Ga0501071_0197455 3300049587 Bacteria 1510
1006 Ga0501071_0202623 3300049587 Bacteria 1491
1007 Ga0501072_0008503 3300049588 Bacteria 7788
1008 Ga0501072_0025371 3300049588 Bacteria 4618
1009 Ga0501072_0027313 3300049588 Bacteria 4453
1010 Ga0501072_0091904 3300049588 Bacteria 2409
1011 Ga0501073_0001270 3300049589 Bacteria 18521
1012 Ga0501073_0015148 3300049589 Bacteria 5592
1013 Ga0501073_0030252 3300049589 Bacteria 3866
1014 Ga0501073_0034575 3300049589 Bacteria 3596
1015 Ga0501073_0040903 3300049589 Bacteria 3277
1016 Ga0501073_0071130 3300049589 Bacteria 2424
1017 Ga0501073_0151222 3300049589 Bacteria 1609
1018 Ga0501074_0000916 3300049590 Bacteria 18891
1019 Ga0501074_0002190 3300049590 Bacteria 13535
1020 Ga0501074_0005053 3300049590 Bacteria 9465
1021 Ga0501074_0009089 3300049590 Bacteria 7219
1022 Ga0501074_0013626 3300049590 Bacteria 5909
1023 Ga0501074_0018664 3300049590 Bacteria 5040
1024 Ga0501076_0003910 3300049592 Bacteria 10503
1025 Ga0501077_0014193 3300049593 Bacteria 5000
1026 Ga0501077_0019104 3300049593 Bacteria 4333
1027 Ga0501079_0010413 3300049741 Bacteria 7069
1028 Ga0501080_0000051 3300049742 Bacteria 75804
1029 Ga0501080_0011811 3300049742 Bacteria 8002
1030 Ga0501080_0037882 3300049742 Bacteria 4503
1031 Ga0501080_0233186 3300049742 Bacteria 1682
1032 Ga0501081_0005680 3300049743 Bacteria 8073
1033 Ga0501083_0005707 3300049744 Bacteria 8808
1034 Ga0501083_0020112 3300049744 Bacteria 4645
1035 Ga0501035_0001405 3300049822 Bacteria 24717
1036 Ga0501035_0007893 3300049822 Bacteria 9937
1037 Ga0501035_0008657 3300049822 Bacteria 9472
1038 Ga0501035_0020910 3300049822 Bacteria 6014
1039 Ga0501035_0036021 3300049822 Bacteria 4487
1040 Ga0501035_0045589 3300049822 Bacteria 3944
1041 Ga0501035_0052798 3300049822 Bacteria 3636
1042 Ga0501035_0060821 3300049822 Bacteria 3362
1043 Ga0501044_0000137 3300049823 Bacteria 89352
1044 Ga0501044_0000976 3300049823 Bacteria 34361
1045 Ga0501044_0015778 3300049823 Bacteria 8133
1046 Ga0501044_0017207 3300049823 Bacteria 7756
1047 Ga0501044_0029117 3300049823 Bacteria 5824
1048 Ga0501044_0031288 3300049823 Bacteria 5602
1049 Ga0501044_0034459 3300049823 Bacteria 5309
1050 Ga0501044_0102587 3300049823 Bacteria 2876
1051 Ga0501044_0103308 3300049823 Bacteria 2864
1052 Ga0501044_0307019 3300049823 Bacteria 1514
1053 Ga0501045_0036204 3300049824 Bacteria 3583
1054 Ga0501045_0044326 3300049824 Bacteria 3240
1055 Ga0501045_0157980 3300049824 Bacteria 1687
1056 nmdc:mga03n38_106910_c1 3300050490 Bacteria 1357
1057 nmdc:mga03n38_18585_c1 3300050490 Bacteria 2747
1058 nmdc:mga00v17_294097_c1 3300050491 Bacteria 1055
1059 nmdc:mga00v17_53709_c1 3300050491 Bacteria 2456
1060 nmdc:mga0yw44_12964_c1 3300050492 Bacteria 4368
1061 nmdc:mga0yw44_1576_c1 3300050492 Bacteria 9147
1062 nmdc:mga0yw44_45472_c1 3300050492 Bacteria 2632
1063 nmdc:mga04h51_14036_c1 3300050495 Bacteria 2281
1064 nmdc:mga07m45_19873_c2 3300050496 Bacteria 2299
1065 nmdc:mga07m45_34847_c1 3300050496 Bacteria 2799
1066 nmdc:mga05p37_102271_c1 3300050507 Bacteria 3529
1067 nmdc:mga05p37_150806_c1 3300050507 Bacteria 2843
1068 nmdc:mga05p37_159676_c1 3300050507 Bacteria 2753
1069 nmdc:mga05p37_171477_c1 3300050507 Bacteria 2646
1070 nmdc:mga05p37_17429_c1 3300050507 Bacteria 8669
1071 nmdc:mga05p37_178_c1 3300050507 Bacteria 62028
1072 nmdc:mga05p37_1839_c1 3300050507 Bacteria 24733
1073 nmdc:mga05p37_23475_c1 3300050507 Bacteria 7484
1074 nmdc:mga05p37_300499_c1 3300050507 Bacteria 1907
1075 nmdc:mga05p37_416057_c1 3300050507 Bacteria 1565
1076 nmdc:mga05p37_68693_c1 3300050507 Bacteria 2480
1077 nmdc:mga05p37_73494_c1 3300050507 Bacteria 4208
1078 nmdc:mga05p37_815_c1 3300050507 Bacteria 34870
1079 nmdc:mga09592_14_c2 3300050508 Bacteria 34534
1080 nmdc:mga09592_1518_c1 3300050508 Bacteria 18690
1081 nmdc:mga09592_178469_c1 3300050508 Bacteria 1837
1082 nmdc:mga09592_428140_c1 3300050508 Bacteria 1143
1083 nmdc:mga09592_4353_c1 3300050508 Bacteria 11446
1084 nmdc:mga0qj67_1167_c1 3300050509 Bacteria 18189
1085 nmdc:mga0qj67_17115_c1 3300050509 Bacteria 5509
1086 nmdc:mga0qj67_2703_c1 3300050509 Bacteria 12716
1087 nmdc:mga0qj67_6067_c1 3300050509 Bacteria 8852
1088 nmdc:mga06r32_1482_c1 3300050510 Bacteria 21098
1089 nmdc:mga06r32_175901_c1 3300050510 Bacteria 2125
1090 nmdc:mga06r32_18_c1 3300050510 Bacteria 34210
1091 nmdc:mga06r32_555_c1 3300050510 Bacteria 32486
1092 nmdc:mga06r32_5891_c1 3300050510 Bacteria 11031
1093 nmdc:mga06r32_8942_c1 3300050510 Bacteria 9027
1094 nmdc:mga06r32_92605_c1 3300050510 Bacteria 2955
1095 nmdc:mga08y16_19086_c1 3300050511 Bacteria 7224
1096 nmdc:mga08y16_2869_c1 3300050511 Bacteria 17731
1097 nmdc:mga08y16_3646_c1 3300050511 Bacteria 16009
1098 nmdc:mga08y16_37998_c1 3300050511 Bacteria 5055
1099 nmdc:mga08y16_524995_c1 3300050511 Bacteria 1200
1100 nmdc:mga08y16_677384_c1 3300050511 Bacteria 1033
1101 nmdc:mga08y16_68388_c1 3300050511 Bacteria 3703
1102 nmdc:mga0n895_116339_c1 3300050512 Bacteria 2693
1103 nmdc:mga0n895_30224_c1 3300050512 Bacteria 5175
1104 nmdc:mga0n895_3057_c1 3300050512 Bacteria 13297
1105 nmdc:mga0n895_44096_c1 3300050512 Bacteria 4350
1106 nmdc:mga0n895_70179_c1 3300050512 Bacteria 3473
1107 nmdc:mga0n895_77420_c1 3300050512 Bacteria 3309
1108 nmdc:mga0rr50_17910_c1 3300050513 Bacteria 4744
1109 nmdc:mga0rr50_200138_c1 3300050513 Bacteria 1641
1110 nmdc:mga0rr50_44979_c1 3300050513 Bacteria 3242
1111 nmdc:mga0rr50_79643_c1 3300050513 Bacteria 2524
1112 nmdc:mga0rr50_9865_c1 3300050513 Bacteria 6034
1113 nmdc:mga08x19_26443_c1 3300050514 Bacteria 3622
1114 nmdc:mga08x19_28889_c1 3300050514 Bacteria 3476
1115 nmdc:mga08x19_52676_c1 3300050514 Bacteria 2618
1116 nmdc:mga08x19_60823_c1 3300050514 Bacteria 2447
1117 nmdc:mga0a205_20399_c1 3300050515 Bacteria 6252
1118 nmdc:mga0a205_206535_c1 3300050515 Bacteria 1853
1119 nmdc:mga0a205_21078_c1 3300050515 Bacteria 6163
1120 nmdc:mga0a205_234254_c1 3300050515 Bacteria 1719
1121 nmdc:mga0a205_6162_c1 3300050515 Bacteria 10822
1122 nmdc:mga0a205_65750_c1 3300050515 Bacteria 3504
1123 Ga0495601_0017205 3300053077 Bacteria 4389
1124 Ga0495601_0061885 3300053077 Bacteria 2377
1125 Ga0495612_0002530 3300053078 Bacteria 7542
1126 Ga0495655_0004943 3300053083 Bacteria 2320
1127 Ga0495619_0063268 3300053085 Bacteria 2465
1128 Ga0500644_0030924 3300053088 Bacteria 1698
1129 Ga0500644_0090365 3300053088 Bacteria 1145
1130 Ga0500646_0000167 3300053090 Bacteria 19617
1131 Ga0500646_0000205 3300053090 Bacteria 17753
1132 Ga0500641_0024919 3300053096 Bacteria 2311
1133 Ga0500641_0026240 3300053096 Bacteria 2261
1134 Ga0500553_000116 3300053101 Bacteria 22026
1135 Ga0500556_0004985 3300053104 Bacteria 3757
1136 Ga0500560_008536 3300053107 Bacteria 2473
1137 Ga0500573_0043418 3300053140 Bacteria 2594
1138 Ga0500573_0043889 3300053140 Bacteria 2579
1139 Ga0500577_0018450 3300053142 Bacteria 2243
1140 Ga0500637_0026467 3300053178 Bacteria 3196
1141 Ga0500645_027931 3300053730 Bacteria 1710
1142 Ga0501084_0000567 3300054114 Bacteria 28265
1143 Ga0501084_0003883 3300054114 Bacteria 12160
1144 Ga0501084_0058067 3300054114 Bacteria 3237
1145 Ga0590075_005905 3300059424 Bacteria 2896
1146 Ga0501082_0036924 3300060353 Bacteria 4209
1147 Ga0501082_0054265 3300060353 Bacteria 3454
1148 Ga0501082_0059903 3300060353 Bacteria 3280
1149 Ga0466962_0002637 3300061719 Bacteria 8525
1150 Ga0466962_0003080 3300061719 Bacteria 7936
1151 Ga0466962_0014836 3300061719 Bacteria 3753
1152 Ga0530510_0459877 3300061734 Bacteria 963
1153 2676203048 2675902999 Bacteria 9438463
1154 2501942207 2501939600 Bacteria 6907073
1155 2508674230 2508501039 Bacteria 9978592
1156 2515854319 2515154155 Bacteria 7985436
1157 2524186023 2524023129 Bacteria 6762600
1158 2559428894 2558860280 Bacteria 11429938
1159 2587739664 2585428059 Bacteria 8696589
1160 2616906431 2616644941 Bacteria 8510691
1161 2644232255 2643221641 Bacteria 4490190
1162 2644385626 2643221670 Bacteria 6497041
1163 2644436682 2643221678 Bacteria 9540101
1164 2644445760 2643221679 Bacteria 3839507
1165 2644625506 2643221714 Bacteria 9015452
1166 2671832687 2671180195 Bacteria 9757215
1167 2676476673 2675903058 Bacteria 6822861
1168 2676483434 2675903059 Bacteria 8644972
1169 2686538689 2684623035 Bacteria 8032739
1170 2689990263 2687453743 Bacteria 8361025
1171 2740169335 2739367898 Bacteria 4367674
1172 2753070081 2751185734 Bacteria 8863695
1173 2753272299 2751185782 Bacteria 11227053
1174 2774847624 2773857921 Bacteria 9435764
1175 2774850843 2773857922 Bacteria 9757215
1176 2774903390 2773857933 Bacteria 5818019
1177 2808841580 2808606359 Bacteria 9866990
1178 2816426788 2816332119 Bacteria 8120218
1179 2816505452 2816332139 Bacteria 9138787
1180 2819742617 2818991472 Bacteria 10089953
1181 2848551799 2848551377 Bacteria 3720646
1182 2855686794 2855683550 Bacteria 7134265
1183 2856864585 2856858025 Bacteria 7255264
1184 2857477520 2857472729 Bacteria 6568124
1185 2858873325 2858868258 Bacteria 7683772
1186 2861522952 2861520306 Bacteria 8348283
1187 2861524298 2861520306 Bacteria 8348283
1188 2862293230 2862290372 Bacteria 7471434
1189 2862515013 2862507626 Bacteria 9425308
1190 2867303440 2867302475 Bacteria 7087181
1191 2867316204 2867312974 Bacteria 7058875
1192 2867321070 2867319477 Bacteria 7069771
1193 2867371460 2867369537 Bacteria 6501581
1194 2867481337 2867475112 Bacteria 6909112
1195 2870727427 2870721527 Bacteria 9689237
1196 2887481033 2887478801 Bacteria 8972725
1197 2895887479 2895880812 Bacteria 11255272
1198 2902588080 2902582711 Bacteria 6187705
1199 2904117965 2904113452 Bacteria 7796941
1200 2919473428 2919468124 Bacteria 9133025
1201 2935394703 2935390628 Bacteria 7043367
1202 2946075487 2946072368 Bacteria 8999607
1203 2990048708 2990044586 Bacteria 6603797
1204 2990094265 2990088156 Bacteria 6657676
1205 2995466119 2995463766 Bacteria 8577691
1206 2996227476 2996221748 Bacteria 6799777
1207 2997456788 2997451912 Bacteria 8492419
1208 3003003351 3002998708 Bacteria 11715108
1209 3006321669 3006321560 Bacteria 8247479
1210 3006491704 3006486233 Bacteria 8157040
1211 649813888 649633069 Bacteria 6962533
1212 8002779266 8002775197 Bacteria 10728764
1213 8002788849 8002784119 Bacteria 9788632
1214 8003862066 8003856774 Bacteria 7675274
1215 8008489807 8008485437 Bacteria 7198341
1216 8025527419 8025524527 Bacteria 7197316
1217 8047719384 8047710418 Bacteria 11023148
1218 8053953006 8053945823 Bacteria 8962862
1219 8054161095 8054160619 Bacteria 7783213
1220 8056063567 8056060235 Bacteria 7259403
1221 8056450893 8056447290 Bacteria 7680491
1222 8056668080 8056667051 Bacteria 6953971
1223 8057570939 8057568493 Bacteria 7221719
1224 8057573300 8057568493 Bacteria 7221719
1225 JGI24740J21852_10030120
1226 JGI25406J46586_10008109
1227 Ga0006562J51391_1109263
1228 Ga0065704_10075364
1229 Ga0070658_10002128
1230 Ga0070658_10003610
1231 Ga0070676_10032042
1232 Ga0070676_10170399
1233 Ga0070683_100004647
1234 Ga0070683_100098404
1235 Ga0070670_100301114
1236 Ga0068869_100013851
1237 Ga0068869_100021890
1238 Ga0068869_100023099
1239 Ga0068869_100248774
1240 Ga0068869_100318843
1241 Ga0070680_100023832
1242 Ga0070680_100274494
1243 Ga0070682_100006150
1244 Ga0068868_100006011
1245 Ga0068868_100077093
1246 Ga0068868_100277931
1247 Ga0070660_100029985
1248 Ga0070660_100064245
1249 Ga0070660_100084966
1250 Ga0070691_10003836
1251 Ga0070691_10010580
1252 Ga0070661_100085500
1253 Ga0070661_100176452
1254 Ga0070692_10021226
1255 Ga0070692_10029569
1256 Ga0070668_100020231
1257 Ga0070668_100090532
1258 Ga0070669_100025062
1259 Ga0070675_100004065
1260 Ga0070671_100001993
1261 Ga0070688_100037812
1262 Ga0070659_100006159
1263 Ga0070659_100023614
1264 Ga0070667_100338358
1265 Ga0070714_100003209
1266 Ga0070714_100016998
1267 Ga0070714_100021665
1268 Ga0070714_100332374
1269 Ga0070714_100443245
1270 Ga0070713_100143230
1271 Ga0070710_10000775
1272 Ga0070701_10027921
1273 Ga0070711_100083947
1274 Ga0070705_100011854
1275 Ga0070705_100041044
1276 Ga0070705_100041631
1277 Ga0070700_100012214
1278 Ga0070708_100063505
1279 Ga0070708_100086149
1280 Ga0070708_100092416
1281 Ga0070708_100206017
1282 Ga0070708_100239624
1283 Ga0070708_100400670
1284 Ga0070663_100017361
1285 Ga0070663_100031316
1286 Ga0070663_100208902
1287 Ga0070663_100310180
1288 Ga0070678_100001267
1289 Ga0070678_100068564
1290 Ga0070678_100183110
1291 Ga0070681_10051198
1292 Ga0070681_10052482
1293 Ga0070681_10108742
1294 Ga0070681_10381085
1295 Ga0070685_10251935
1296 Ga0070706_100092923
1297 Ga0070707_100024129
1298 Ga0070707_100047075
1299 Ga0070707_100093846
1300 Ga0070707_100099103
1301 Ga0070707_100151759
1302 Ga0070707_100265591
1303 Ga0070698_100001988
1304 Ga0070698_100014445
1305 Ga0070698_100019295
1306 Ga0070698_100134247
1307 Ga0070698_100256648
1308 Ga0070699_100000014
1309 Ga0070699_100009053
1310 Ga0070699_100011634
1311 Ga0070699_100059992
1312 Ga0070699_100107366
1313 Ga0070699_100380682
1314 Ga0070679_100020925
1315 Ga0070679_100047023
1316 Ga0070679_100065358
1317 Ga0070679_100124012
1318 Ga0070679_100318480
1319 Ga0070679_100346854
1320 Ga0070684_100002845
1321 Ga0070684_100118682
1322 Ga0070684_100142336
1323 Ga0070684_100184394
1324 Ga0070697_100192092
1325 Ga0068853_100017236
1326 Ga0068853_100061176
1327 Ga0068853_100098148
1328 Ga0068853_100125058
1329 Ga0070686_100091295
1330 Ga0070695_100016847
1331 Ga0070696_100168747
1332 Ga0070696_100231302
1333 Ga0070693_100002045
1334 Ga0070665_100001502
1335 Ga0070665_100025806
1336 Ga0070665_100375697
1337 Ga0070704_100116968
1338 Ga0070704_100175124
1339 Ga0068855_100002943
1340 Ga0068855_100003272
1341 Ga0068855_100011259
1342 Ga0068855_100028270
1343 Ga0068855_100261862
1344 Ga0070664_100003004
1345 Ga0070664_100163364
1346 Ga0068857_100005857
1347 Ga0068857_100016349
1348 Ga0068857_100082226
1349 Ga0068857_100150512
1350 Ga0068857_100168509
1351 Ga0068854_100000001
1352 Ga0068854_100006613
1353 Ga0068856_100032941
1354 Ga0068856_100050737
1355 Ga0068856_100058806
1356 Ga0068856_100251915
1357 Ga0068856_100356445
1358 Ga0070702_100002421
1359 Ga0068852_100041338
1360 Ga0068852_100075664
1361 Ga0068852_100093961
1362 Ga0068859_100000054
1363 Ga0068859_100142290
1364 Ga0068859_100157915
1365 Ga0068864_100010703
1366 Ga0068864_100038517
1367 Ga0068864_100180367
1368 Ga0068864_100198574
1369 Ga0068864_100384341
1370 Ga0068861_100083856
1371 Ga0068861_100282245
1372 Ga0068870_10000527
1373 Ga0068870_10075996
1374 Ga0068863_100002724
1375 Ga0068863_100016498
1376 Ga0068863_100073397
1377 Ga0068858_100069663
1378 Ga0068858_100264415
1379 Ga0068858_100314483
1380 Ga0068858_100347344
1381 Ga0068860_100100556
1382 Ga0068862_100000037
1383 Ga0068862_100016913
1384 Ga0068862_100115331
1385 Ga0081455_10002734
1386 Ga0081455_10009950
1387 Ga0081455_10082302
1388 Ga0081538_10134667
1389 Ga0081539_10000364
1390 Ga0081539_10000447
1391 Ga0081539_10004113
1392 Ga0075365_10059063
1393 Ga0075365_10099899
1394 Ga0075365_10170853
1395 Ga0075365_10217726
1396 Ga0075368_10001870
1397 Ga0075363_100004732
1398 Ga0075363_100049348
1399 Ga0075364_10013390
1400 Ga0075364_10116147
1401 Ga0075432_10057297
1402 Ga0070716_100005011
1403 Ga0070716_100239250
1404 Ga0075362_10024379
1405 Ga0097621_100144738
1406 Ga0068871_100025364
1407 Ga0075428_100000006
1408 Ga0075428_100001979
1409 Ga0075428_100009926
1410 Ga0075428_100028992
1411 Ga0075428_100050574
1412 Ga0075428_100113278
1413 Ga0075428_100193527
1414 Ga0075428_100229677
1415 Ga0075428_100317267
1416 Ga0075430_100001233
1417 Ga0075430_100001764
1418 Ga0075430_100018773
1419 Ga0075430_100022712
1420 Ga0075430_100034453
1421 Ga0075430_100364673
1422 Ga0075431_100003806
1423 Ga0075431_100006015
1424 Ga0075431_100018026
1425 Ga0075431_100031642
1426 Ga0075431_100032158
1427 Ga0075431_100093757
1428 Ga0075431_100153717
1429 Ga0075433_10000529
1430 Ga0075433_10003481
1431 Ga0075433_10005330
1432 Ga0075433_10016491
1433 Ga0075433_10098793
1434 Ga0075433_10099415
1435 Ga0075434_100008277
1436 Ga0075434_100021611
1437 Ga0075434_100089201
1438 Ga0075434_100125364
1439 Ga0075434_100176048
1440 Ga0075429_100001818
1441 Ga0075429_100008473
1442 Ga0075429_100008552
1443 Ga0075429_100010603
1444 Ga0075429_100036712
1445 Ga0075429_100061359
1446 Ga0075429_100137690
1447 Ga0075429_100226856
1448 Ga0075429_100399310
1449 Ga0075429_100438320
1450 Ga0068865_100029500
1451 Ga0068865_100406103
1452 Ga0075436_100000719
1453 Ga0075436_100026256
1454 Ga0075436_100122163
1455 Ga0097620_100000054
1456 Ga0097620_100142287
1457 Ga0097620_100157917
1458 Ga0075435_100001179
1459 Ga0075435_100013874
1460 Ga0075435_100034172
1461 Ga0075435_100047646
1462 Ga0075435_100056230
1463 Ga0075435_100191651
1464 Ga0075435_100207584
1465 Ga0075435_100261610
1466 Ga0105240_10005833
1467 Ga0105240_10015490
1468 Ga0105240_10069876
1469 Ga0105240_10165169
1470 Ga0111539_10022401
1471 Ga0111539_10040672
1472 Ga0111539_10062336
1473 Ga0111539_10064998
1474 Ga0111539_10089831
1475 Ga0111539_10157350
1476 Ga0111539_10254320
1477 Ga0111539_10572424
1478 Ga0111539_10830668
1479 Ga0105245_10004191
1480 Ga0105245_10009816
1481 Ga0105245_10034197
1482 Ga0105245_10312155
1483 Ga0105245_10460145
1484 Ga0114129_10000004
1485 Ga0114129_10000050
1486 Ga0114129_10002267
1487 Ga0114129_10004085
1488 Ga0114129_10005032
1489 Ga0114129_10054859
1490 Ga0114129_10077578
1491 Ga0114129_10089605
1492 Ga0114129_10132360
1493 Ga0114129_10139045
1494 Ga0114129_10154146
1495 Ga0114129_10227573
1496 Ga0114129_10270569
1497 Ga0114129_10378608
1498 Ga0114129_10903119
1499 Ga0105243_10142023
1500 Ga0105243_10609529
1501 Ga0105241_10002402
1502 Ga0105241_10006773
1503 Ga0105242_10065950
1504 Ga0105242_10101799
1505 Ga0105248_10000018
1506 Ga0105248_10064419
1507 Ga0105248_10099938
1508 Ga0105248_10227451
1509 Ga0105248_10243325
1510 Ga0105237_10139516
1511 Ga0105237_10338072
1512 Ga0105237_10437115
1513 Ga0105238_10037303
1514 Ga0105249_10005207
1515 Ga0105249_10043006
1516 Ga0105249_10166828
1517 Ga0105249_10358456
1518 Ga0105239_10001401
1519 Ga0105239_10123712
1520 Ga0105239_10247704
1521 Ga0105246_10000043
1522 Ga0105246_10018753
1523 Ga0105246_10226677
1524 Ga0157373_10028008
1525 Ga0157373_10053563
1526 Ga0157371_10004316
1527 Ga0157370_10036631
1528 Ga0157369_10010249
1529 Ga0157369_10019495
1530 Ga0157369_10041192
1531 Ga0157374_10091348
1532 Ga0157374_10324572
1533 Ga0157378_10191578
1534 Ga0163162_10024427
1535 Ga0163162_10083227
1536 Ga0157372_10003488
1537 Ga0157372_10028325
1538 Ga0157372_10263775
1539 Ga0157375_10106921
1540 Ga0157375_10125173
1541 Ga0157375_10382192
1542 Ga0157375_10457802
1543 Ga0163163_10033828
1544 Ga0163163_10091573
1545 Ga0163163_10109199
1546 Ga0163163_10110734
1547 Ga0163163_10153726
1548 Ga0157380_10332990
1549 Ga0157377_10008166
1550 Ga0157377_10052744
1551 Ga0157377_10150666
1552 Ga0157379_10536148
1553 Ga0157376_10462266
1554 Ga0206356_10202247
1555 Ga0213873_10009109
1556 Ga0213873_10015007
1557 Ga0213873_10034310
1558 Ga0213872_10003060
1559 Ga0213872_10094699
1560 Ga0213874_10002416
1561 Ga0213874_10008293
1562 Ga0213874_10030048
1563 Ga0213876_10000392
1564 Ga0213876_10015196
1565 Ga0213876_10041304
1566 Ga0213876_10089653
1567 Ga0213876_10094785
1568 Ga0213875_10000001
1569 Ga0213875_10000563
1570 Ga0213875_10003758
1571 Ga0213875_10004499
1572 Ga0213875_10043724
1573 Ga0213875_10076058
1574 Ga0213871_10003379
1575 Ga0213871_10008924
1576 Ga0213871_10012597
1577 Ga0213871_10026748
1578 Ga0207426_1000811
1579 Ga0207426_1005346
1580 Ga0207692_10126433
1581 Ga0207688_10004787
1582 Ga0207688_10005818
1583 Ga0207688_10024320
1584 Ga0207647_10035183
1585 Ga0207699_10080877
1586 Ga0207645_10028939
1587 Ga0207645_10059072
1588 Ga0207645_10186915
1589 Ga0207643_10000255
1590 Ga0207643_10006057
1591 Ga0207705_10001884
1592 Ga0207705_10005307
1593 Ga0207705_10017368
1594 Ga0207705_10041114
1595 Ga0207705_10050948
1596 Ga0207684_10007467
1597 Ga0207684_10081761
1598 Ga0207684_10133326
1599 Ga0207654_10026303
1600 Ga0207654_10188316
1601 Ga0207707_10065837
1602 Ga0207707_10069855
1603 Ga0207707_10140946
1604 Ga0207695_10002892
1605 Ga0207695_10039707
1606 Ga0207695_10194408
1607 Ga0207671_10000492
1608 Ga0207671_10092368
1609 Ga0207671_10119397
1610 Ga0207693_10313042
1611 Ga0207663_10069250
1612 Ga0207663_10230367
1613 Ga0207660_10191671
1614 Ga0207660_10326112
1615 Ga0207657_10017156
1616 Ga0207657_10017298
1617 Ga0207657_10035544
1618 Ga0207657_10043946
1619 Ga0207649_10014228
1620 Ga0207649_10029333
1621 Ga0207652_10007647
1622 Ga0207652_10030737
1623 Ga0207652_10315662
1624 Ga0207646_10012726
1625 Ga0207646_10029254
1626 Ga0207646_10137222
1627 Ga0207646_10140434
1628 Ga0207646_10250578
1629 Ga0207646_10271504
1630 Ga0207681_10152156
1631 Ga0207694_10002567
1632 Ga0207694_10025522
1633 Ga0207694_10028556
1634 Ga0207650_10018346
1635 Ga0207650_10066617
1636 Ga0207659_10002694
1637 Ga0207659_10310316
1638 Ga0207687_10006625
1639 Ga0207687_10043025
1640 Ga0207687_10222120
1641 Ga0207700_10173293
1642 Ga0207700_10205849
1643 Ga0207700_10485516
1644 Ga0207664_10019225
1645 Ga0207664_10030674
1646 Ga0207664_10076997
1647 Ga0207664_10449181
1648 Ga0207664_10533911
1649 Ga0207644_10033748
1650 Ga0207690_10013870
1651 Ga0207690_10015584
1652 Ga0207690_10180298
1653 Ga0207706_10077313
1654 Ga0207706_10092644
1655 Ga0207686_10164509
1656 Ga0207709_10094864
1657 Ga0207709_10141404
1658 Ga0207669_10352314
1659 Ga0207704_10011020
1660 Ga0207665_10005460
1661 Ga0207691_10035406
1662 Ga0207711_10000313
1663 Ga0207711_10088724
1664 Ga0207689_10005049
1665 Ga0207689_10028236
1666 Ga0207661_10005765
1667 Ga0207661_10023643
1668 Ga0207661_10131900
1669 Ga0207661_10149418
1670 Ga0207661_10220389
1671 Ga0207661_10401432
1672 Ga0207679_10058656
1673 Ga0207679_10085332
1674 Ga0207679_10368156
1675 Ga0207667_10000018
1676 Ga0207667_10007907
1677 Ga0207667_10009879
1678 Ga0207667_10032464
1679 Ga0207667_10146658
1680 Ga0207667_10167382
1681 Ga0207667_10351792
1682 Ga0207712_10003342
1683 Ga0207712_10042746
1684 Ga0207712_10058717
1685 Ga0207712_10102291
1686 Ga0207668_10003497
1687 Ga0207640_10000003
1688 Ga0207640_10028362
1689 Ga0207677_10055756
1690 Ga0207703_10081605
1691 Ga0207703_10164053
1692 Ga0207639_10012194
1693 Ga0207678_10000346
1694 Ga0207678_10006802
1695 Ga0207678_10031327
1696 Ga0207708_10005711
1697 Ga0207708_10034322
1698 Ga0207708_10221244
1699 Ga0207702_10000631
1700 Ga0207702_10054568
1701 Ga0207702_10061875
1702 Ga0207702_10224978
1703 Ga0207641_10004672
1704 Ga0207641_10008384
1705 Ga0207641_10042093
1706 Ga0207648_10022678
1707 Ga0207648_10116813
1708 Ga0207648_10206407
1709 Ga0207648_10417569
1710 Ga0207676_10025873
1711 Ga0207676_10193310
1712 Ga0207676_10552279
1713 Ga0207674_10001502
1714 Ga0207674_10021127
1715 Ga0207674_10049528
1716 Ga0207674_10062455
1717 Ga0207674_10079185
1718 Ga0207674_10176858
1719 Ga0207675_100029374
1720 Ga0207683_10000342
1721 Ga0207683_10094863
1722 Ga0207698_10025503
1723 Ga0207698_10066856
1724 Ga0207698_10071393
1725 Ga0207698_10120705
1726 Ga0209813_10006654
1727 Ga0207428_10000213
1728 Ga0207428_10013436
1729 Ga0207428_10028679
1730 Ga0265356_1000276
1731 Ga0268266_10030662
1732 Ga0268266_10173281
1733 Ga0268266_10350945
1734 Ga0268265_10000008
1735 Ga0268265_10010617
1736 Ga0268265_10057623
1737 Ga0268265_10061613
1738 Ga0268265_10067603
1739 Ga0268265_10184166
1740 Ga0268264_10434152
1741 Ga0265334_10026764
1742 Ga0307515_10004662
1743 Ga0307515_10004732
1744 Ga0307515_10021895
1745 Ga0307515_10030848
1746 Ga0307515_10078253
1747 Ga0307515_10080122
1748 Ga0307515_10102556
1749 Ga0265338_10000157
1750 Ga0265338_10023339
1751 Ga0265338_10027991
1752 Ga0265338_10073751
1753 Ga0265324_10077017
1754 Ga0237817_10142
1755 Ga0307511_10000068
1756 Ga0307512_10002870
1757 Ga0307512_10007686
1758 Ga0307512_10020139
1759 Ga0307512_10037274
1760 Ga0307512_10117234
1761 Ga0316177_1163023
1762 Ga0314311_1152082
1763 Ga0316178_1125740
1764 Ga0316180_1088936
1765 Ga0265760_10032833
1766 Ga0265332_10016284
1767 Ga0265328_10034544
1768 Ga0265325_10000121
1769 Ga0265325_10020563
1770 Ga0265340_10024843
1771 Ga0265339_10033397
1772 Ga0265339_10087508
1773 Ga0265316_10003591
1774 Ga0307513_10001964
1775 Ga0307513_10046888
1776 Ga0307509_10080709
1777 Ga0307509_10100779
1778 Ga0265313_10000136
1779 Ga0307508_10002257
1780 Ga0307508_10003547
1781 Ga0307508_10006649
1782 Ga0307508_10083289
1783 Ga0307514_10028499
1784 Ga0265342_10002122
1785 Ga0265342_10005561
1786 Ga0307516_10005035
1787 Ga0307516_10006276
1788 Ga0307516_10012708
1789 Ga0307516_10015935
1790 Ga0307516_10017555
1791 Ga0307516_10026185
1792 Ga0307516_10048379
1793 Ga0307413_10046724
1794 Ga0307413_10050002
1795 Ga0307410_10021650
1796 Ga0307410_10034314
1797 Ga0307406_10031439
1798 Ga0307406_10116453
1799 Ga0307407_10097222
1800 Ga0307409_100012482
1801 Ga0307409_100029090
1802 Ga0307409_100091047
1803 Ga0307409_100297883
1804 Ga0307416_100073061
1805 Ga0307411_10076178
1806 Ga0307415_100008771
1807 Ga0307415_100023226
1808 Ga0307415_100042054
1809 Ga0307415_100057450
1810 Ga0307415_100114205
1811 Ga0307507_10072905
1812 Ga0307510_10159385
1813 Ga0307510_10164335
1814 Ga0373940_0028742
1815 Ga0373951_0000228
1816 Ga0373932_0071632
1817 Ga0373942_0000477
1818 Ga0373931_0023595
1819 Ga0373935_0019960
1820 Ga0373927_0000164
1821 Ga0373937_0101745
1822 Ga0373925_0020290
1823 Ga0395899_0016934
1824 Ga0395899_0037324
1825 Ga0395900_0029675
1826 Ga0395900_0121557
1827 Ga0395900_0194038
1828 Ga0395900_0267543
1829 Ga0395900_0914544
1830 Ga0395898_0009560
1831 Ga0395898_0075347
1832 Ga0395898_0090014
1833 Ga0395898_0290461
1834 Ga0395905_0030937
1835 Ga0395905_0535822
1836 Ga0436364_0031147
1837 Ga0436364_0056800
1838 Ga0436364_0130866
1839 Ga0436364_0258512
1840 Ga0436364_0273345
1841 Ga0436364_0306718
1842 Ga0436364_0381375
1843 Ga0436364_0817615
1844 Ga0436364_0830434
1845 Ga0436364_1286690
1846 Ga0436364_1436469
1847 Ga0436364_1499753
1848 Ga0436364_1550326
1849 Ga0395901_0005476
1850 Ga0395901_0010309
1851 Ga0395901_0066823
1852 Ga0395901_0102002
1853 Ga0395901_0121835
1854 Ga0395901_0309463
1855 Ga0400485_01398
1856 Ga0400483_051011
1857 Ga0400483_146421
1858 Ga0400483_281577
1859 Ga0436365_0196318
1860 Ga0436365_0853215
1861 Ga0436365_0934173
1862 Ga0436365_0980504
1863 Ga0436365_1206342
1864 Ga0436365_1493597
1865 Ga0436365_1589201
1866 Ga0436365_1607019
1867 Ga0436360_0009449
1868 Ga0436360_0037933
1869 Ga0436360_0098126
1870 Ga0436360_0141554
1871 Ga0436360_0153847
1872 Ga0436360_0412872
1873 Ga0436360_0581232
1874 Ga0436360_0930976
1875 Ga0436360_1004013
1876 Ga0436360_1038089
1877 Ga0436360_1093826
1878 Ga0436360_1197386
1879 Ga0436360_1228528
1880 Ga0436361_0303992
1881 Ga0436361_0353974
1882 Ga0436361_0493910
1883 Ga0436361_0571302
1884 Ga0436361_0684318
1885 Ga0436361_0787384
1886 Ga0436361_0790320
1887 Ga0436361_0913090
1888 Ga0436361_1210671
1889 Ga0436363_0032621
1890 Ga0436363_0082939
1891 Ga0436363_0170474
1892 Ga0436363_0356929
1893 Ga0436363_0452825
1894 Ga0436363_0629336
1895 Ga0436363_0776175
1896 Ga0436363_1465945
1897 Ga0436363_1620918
1898 Ga0436362_0027826
1899 Ga0436362_0051025
1900 Ga0436362_0406634
1901 Ga0436362_0483944
1902 Ga0436362_0486730
1903 Ga0436362_0540144
1904 Ga0436362_0653197
1905 Ga0436362_0767395
1906 Ga0436362_0853964
1907 Ga0436362_1003461
1908 Ga0436362_1013653
1909 Ga0436362_1187126
1910 Ga0439439_0003999
1911 Ga0451853_1738478
1912 Ga0439433_0013204
1913 Ga0439448_0064010
1914 Ga0439449_0000392
1915 Ga0439449_0000447
1916 Ga0439462_0000062
1917 Ga0439462_0006819
1918 Ga0439459_0015659
1919 Ga0451577_0024855
1920 Ga0451577_0105966
1921 Ga0466969_0000414
1922 Ga0466969_0010863
1923 Ga0466969_0025286
1924 Ga0466969_0026364
1925 Ga0466969_0083340
1926 Ga0466969_0105166
1927 Ga0466969_0118489
1928 Ga0466972_0003966
1929 Ga0466972_0008316
1930 Ga0466972_0009638
1931 Ga0466972_0012940
1932 Ga0466972_0038777
1933 Ga0453683_0007388
1934 Ga0466965_0005786
1935 Ga0466965_0009509
1936 Ga0466965_0009647
1937 Ga0466965_0013094
1938 Ga0466965_0014434
1939 Ga0466965_0101240
1940 Ga0466965_0275215
1941 Ga0466966_0000993
1942 Ga0466966_0003994
1943 Ga0466966_0006867
1944 Ga0466966_0020631
1945 Ga0466966_0049959
1946 Ga0466966_0056067
1947 Ga0466961_0002381
1948 Ga0466961_0002837
1949 Ga0466961_0007163
1950 Ga0466961_0023862
1951 Ga0466961_0025553
1952 Ga0466961_0044420
1953 Ga0466961_0089856
1954 Ga0466963_0006200
1955 Ga0466963_0196031
1956 Ga0466964_0012379
1957 Ga0453684_0008665
1958 Ga0453684_0336544
1959 Ga0466971_0027309
1960 Ga0466971_0046671
1961 Ga0466968_0003347
1962 Ga0466968_0009274
1963 Ga0466970_0006945
1964 Ga0466970_0014160
1965 Ga0466970_0033316
1966 Ga0466957_0003558
1967 Ga0466957_0023274
1968 Ga0466960_0044927
1969 Ga0466960_0083661
1970 Ga0466959_0001670
1971 Ga0466959_0004585
1972 Ga0466959_0043109
1973 Ga0466959_0070827
1974 Ga0466959_0073006
1975 Ga0466959_0107447
1976 Ga0451576_0001906
1977 Ga0466958_0009229
1978 Ga0466958_0011075
1979 Ga0466958_0059455
1980 Ga0466967_0008264
1981 Ga0466967_0032142
1982 Ga0466967_0064210
1983 Ga0466967_0080908
1984 Ga0466967_0109693
1985 Ga0466967_0191553
1986 Ga0466967_0255721
1987 Ga0466967_0271137
1988 Ga0495592_0096768
1989 Ga0495592_0187586
1990 Ga0495603_0086793
1991 Ga0495603_0168564
1992 Ga0495629_0001390
1993 Ga0495629_0024512
1994 Ga0495629_0044251
1995 Ga0495629_0172944
1996 Ga0495638_0239700
1997 Ga0495651_0000128
1998 Ga0495651_0004211
1999 Ga0495580_0283533
2000 Ga0495582_0238703
2001 Ga0495662_0002245
2002 Ga0495664_0003058
2003 Ga0495664_0090208
2004 Ga0495583_0035582
2005 Ga0495618_0156474
2006 Ga0495628_0002560
2007 Ga0495628_0286339
2008 Ga0495630_0321145
2009 Ga0495632_0118850
2010 Ga0495666_0000540
2011 Ga0495652_0000358
2012 Ga0495652_0120869
2013 Ga0495652_0129573
2014 Ga0495665_0015774
2015 Ga0495640_0011237
2016 Ga0495640_0011357
2017 Ga0495640_0065157
2018 Ga0495586_0034545
2019 Ga0495587_0020875
2020 Ga0495587_0055764
2021 Ga0495587_0164379
2022 Ga0495645_0010190
2023 Ga0495645_0114620
2024 Ga0495622_0074017
2025 Ga0495634_0002087
2026 Ga0495634_0017275
2027 Ga0495635_0009480
2028 Ga0495635_0016699
2029 Ga0495588_0124167
2030 Ga0495657_0001170
2031 Ga0495657_0102885
2032 Ga0495599_0012543
2033 Ga0495599_0231129
2034 Ga0495623_0007760
2035 Ga0495623_0041368
2036 Ga0495646_0001835
2037 Ga0495658_0193481
2038 Ga0495613_0000357
2039 Ga0495613_0002729
2040 Ga0495613_0033173
2041 Ga0495613_0292466
2042 Ga0495624_0090964
2043 Ga0495600_0000178
2044 Ga0495600_0002662
2045 Ga0495600_0097979
2046 Ga0495600_0113106
2047 Ga0495581_0000040
2048 Ga0495581_0009314
2049 Ga0495604_0000800
2050 Ga0495604_0005570
2051 Ga0495604_0009368
2052 Ga0495604_0012191
2053 Ga0495604_0104554
2054 Ga0495604_0124391
2055 Ga0495604_0223930
2056 Ga0495636_0044974
2057 Ga0495674_0022744
2058 Ga0495674_0151193
2059 Ga0495674_0207709
2060 Ga0495680_0282145
2061 Ga0495675_0006373
2062 Ga0495675_0016735
2063 Ga0495675_0030131
2064 Ga0495685_044655
2065 Ga0495684_0282577
2066 Ga0495593_0019143
2067 Ga0495602_0023816
2068 Ga0495614_0021518
2069 Ga0496101_0009664
2070 Ga0496101_0065876
2071 Ga0496102_0020974
2072 Ga0496102_0081411
2073 Ga0496102_0108764
2074 Ga0496102_0171722
2075 Ga0496102_0377527
2076 Ga0496102_0425535
2077 Ga0496102_0452945
2078 Ga0496103_0036480
2079 Ga0496103_0203300
2080 Ga0496104_0124350
2081 Ga0496105_0043333
2082 Ga0496106_0023913
2083 Ga0496106_0042183
2084 Ga0496107_0038771
2085 Ga0496107_0188677
2086 Ga0496107_0246964
2087 Ga0496108_0019388
2088 Ga0496108_0250093
2089 Ga0496109_0010941
2090 Ga0496109_0023913
2091 Ga0496109_0054068
2092 Ga0496109_0231233
2093 Ga0496109_0285405
2094 Ga0496110_0020699
2095 Ga0496110_0366249
2096 Ga0496111_0047594
2097 Ga0496111_0048162
2098 Ga0496111_0071541
2099 Ga0496112_0017869
2100 Ga0496112_0072606
2101 Ga0496112_0141254
2102 Ga0496112_0311991
2103 Ga0496112_0315552
2104 Ga0496113_0010420
2105 Ga0496113_0056230
2106 Ga0496113_0268552
2107 Ga0496114_0044500
2108 Ga0496114_0058815
2109 Ga0496114_0135324
2110 Ga0496114_0177331
2111 Ga0496115_0013221
2112 Ga0496115_0079915
2113 Ga0496116_0000474
2114 Ga0496117_0010797
2115 Ga0496117_0034548
2116 Ga0496118_0000781
2117 Ga0496118_0015570
2118 Ga0496119_0004505
2119 Ga0496124_0101651
2120 Ga0501291_016764
2121 Ga0501031_0000115
2122 Ga0501031_0007958
2123 Ga0501031_0041878
2124 Ga0501031_0072043
2125 Ga0501031_0148899
2126 Ga0501031_0193384
2127 Ga0501032_0000052
2128 Ga0501032_0000872
2129 Ga0501032_0060474
2130 Ga0501032_0114967
2131 Ga0501032_0125585
2132 Ga0501032_0128804
2133 Ga0501033_0001762
2134 Ga0501033_0005593
2135 Ga0501033_0009214
2136 Ga0501033_0010098
2137 Ga0501033_0020037
2138 Ga0501033_0096484
2139 Ga0501034_0002674
2140 Ga0501034_0003126
2141 Ga0501034_0003912
2142 Ga0501034_0042386
2143 Ga0501034_0058411
2144 Ga0501034_0099515
2145 Ga0501036_0001596
2146 Ga0501036_0001835
2147 Ga0501036_0002136
2148 Ga0501036_0004954
2149 Ga0501036_0007977
2150 Ga0501036_0011181
2151 Ga0501036_0017286
2152 Ga0501036_0022220
2153 Ga0501036_0267546
2154 Ga0501036_0285553
2155 Ga0501037_0000046
2156 Ga0501037_0001427
2157 Ga0501037_0016043
2158 Ga0501037_0021174
2159 Ga0501037_0104384
2160 Ga0501038_0000068
2161 Ga0501038_0010363
2162 Ga0501038_0014618
2163 Ga0501038_0056014
2164 Ga0501038_0068510
2165 Ga0501038_0072376
2166 Ga0501038_0169816
2167 Ga0501039_0000362
2168 Ga0501039_0002635
2169 Ga0501039_0011902
2170 Ga0501039_0014225
2171 Ga0501039_0161714
2172 Ga0501041_0003245
2173 Ga0501041_0010412
2174 Ga0501042_0005655
2175 Ga0501042_0010326
2176 Ga0501042_0018124
2177 Ga0501043_0000783
2178 Ga0501043_0000785
2179 Ga0501043_0002726
2180 Ga0501043_0009599
2181 Ga0501043_0033694
2182 Ga0501043_0036588
2183 Ga0501043_0150790
2184 Ga0501046_0000102
2185 Ga0501046_0003286
2186 Ga0501046_0011973
2187 Ga0501046_0036275
2188 Ga0501047_0000327
2189 Ga0501047_0002504
2190 Ga0501047_0003586
2191 Ga0501047_0005305
2192 Ga0501047_0020357
2193 Ga0501047_0027822
2194 Ga0501047_0100599
2195 Ga0501047_0118040
2196 Ga0501047_0119289
2197 Ga0501047_0151207
2198 Ga0501047_0337040
2199 Ga0501048_0000006
2200 Ga0501048_0004360
2201 Ga0501048_0007307
2202 Ga0501048_0144963
2203 Ga0501048_0227848
2204 Ga0501067_0002695
2205 Ga0501067_0003477
2206 Ga0501067_0005126
2207 Ga0501067_0025636
2208 Ga0501067_0069808
2209 Ga0501068_0003083
2210 Ga0501068_0021718
2211 Ga0501068_0022413
2212 Ga0501068_0035562
2213 Ga0501068_0049650
2214 Ga0501068_0067976
2215 Ga0501069_0000146
2216 Ga0501069_0002076
2217 Ga0501069_0055070
2218 Ga0501069_0065550
2219 Ga0501069_0066183
2220 Ga0501070_0002259
2221 Ga0501070_0010017
2222 Ga0501070_0010181
2223 Ga0501070_0014063
2224 Ga0501070_0041514
2225 Ga0501070_0069932
2226 Ga0501070_0257476
2227 Ga0501071_0001127
2228 Ga0501071_0023497
2229 Ga0501071_0197455
2230 Ga0501071_0202623
2231 Ga0501072_0008503
2232 Ga0501072_0025371
2233 Ga0501072_0027313
2234 Ga0501072_0091904
2235 Ga0501073_0001270
2236 Ga0501073_0015148
2237 Ga0501073_0030252
2238 Ga0501073_0034575
2239 Ga0501073_0040903
2240 Ga0501073_0071130
2241 Ga0501073_0151222
2242 Ga0501074_0000916
2243 Ga0501074_0002190
2244 Ga0501074_0005053
2245 Ga0501074_0009089
2246 Ga0501074_0013626
2247 Ga0501074_0018664
2248 Ga0501076_0003910
2249 Ga0501077_0014193
2250 Ga0501077_0019104
2251 Ga0501079_0010413
2252 Ga0501080_0000051
2253 Ga0501080_0011811
2254 Ga0501080_0037882
2255 Ga0501080_0233186
2256 Ga0501081_0005680
2257 Ga0501083_0005707
2258 Ga0501083_0020112
2259 Ga0501035_0001405
2260 Ga0501035_0007893
2261 Ga0501035_0008657
2262 Ga0501035_0020910
2263 Ga0501035_0036021
2264 Ga0501035_0045589
2265 Ga0501035_0052798
2266 Ga0501035_0060821
2267 Ga0501044_0000137
2268 Ga0501044_0000976
2269 Ga0501044_0015778
2270 Ga0501044_0017207
2271 Ga0501044_0029117
2272 Ga0501044_0031288
2273 Ga0501044_0034459
2274 Ga0501044_0102587
2275 Ga0501044_0103308
2276 Ga0501044_0307019
2277 Ga0501045_0036204
2278 Ga0501045_0044326
2279 Ga0501045_0157980
2280 nmdc:mga03n38_106910_c1
2281 nmdc:mga03n38_18585_c1
2282 nmdc:mga00v17_294097_c1
2283 nmdc:mga00v17_53709_c1
2284 nmdc:mga0yw44_12964_c1
2285 nmdc:mga0yw44_1576_c1
2286 nmdc:mga0yw44_45472_c1
2287 nmdc:mga04h51_14036_c1
2288 nmdc:mga07m45_19873_c2
2289 nmdc:mga07m45_34847_c1
2290 nmdc:mga05p37_102271_c1
2291 nmdc:mga05p37_150806_c1
2292 nmdc:mga05p37_159676_c1
2293 nmdc:mga05p37_171477_c1
2294 nmdc:mga05p37_17429_c1
2295 nmdc:mga05p37_178_c1
2296 nmdc:mga05p37_1839_c1
2297 nmdc:mga05p37_23475_c1
2298 nmdc:mga05p37_300499_c1
2299 nmdc:mga05p37_416057_c1
2300 nmdc:mga05p37_68693_c1
2301 nmdc:mga05p37_73494_c1
2302 nmdc:mga05p37_815_c1
2303 nmdc:mga09592_14_c2
2304 nmdc:mga09592_1518_c1
2305 nmdc:mga09592_178469_c1
2306 nmdc:mga09592_428140_c1
2307 nmdc:mga09592_4353_c1
2308 nmdc:mga0qj67_1167_c1
2309 nmdc:mga0qj67_17115_c1
2310 nmdc:mga0qj67_2703_c1
2311 nmdc:mga0qj67_6067_c1
2312 nmdc:mga06r32_1482_c1
2313 nmdc:mga06r32_175901_c1
2314 nmdc:mga06r32_18_c1
2315 nmdc:mga06r32_555_c1
2316 nmdc:mga06r32_5891_c1
2317 nmdc:mga06r32_8942_c1
2318 nmdc:mga06r32_92605_c1
2319 nmdc:mga08y16_19086_c1
2320 nmdc:mga08y16_2869_c1
2321 nmdc:mga08y16_3646_c1
2322 nmdc:mga08y16_37998_c1
2323 nmdc:mga08y16_524995_c1
2324 nmdc:mga08y16_677384_c1
2325 nmdc:mga08y16_68388_c1
2326 nmdc:mga0n895_116339_c1
2327 nmdc:mga0n895_30224_c1
2328 nmdc:mga0n895_3057_c1
2329 nmdc:mga0n895_44096_c1
2330 nmdc:mga0n895_70179_c1
2331 nmdc:mga0n895_77420_c1
2332 nmdc:mga0rr50_17910_c1
2333 nmdc:mga0rr50_200138_c1
2334 nmdc:mga0rr50_44979_c1
2335 nmdc:mga0rr50_79643_c1
2336 nmdc:mga0rr50_9865_c1
2337 nmdc:mga08x19_26443_c1
2338 nmdc:mga08x19_28889_c1
2339 nmdc:mga08x19_52676_c1
2340 nmdc:mga08x19_60823_c1
2341 nmdc:mga0a205_20399_c1
2342 nmdc:mga0a205_206535_c1
2343 nmdc:mga0a205_21078_c1
2344 nmdc:mga0a205_234254_c1
2345 nmdc:mga0a205_6162_c1
2346 nmdc:mga0a205_65750_c1
2347 Ga0495601_0017205
2348 Ga0495601_0061885
2349 Ga0495612_0002530
2350 Ga0495655_0004943
2351 Ga0495619_0063268
2352 Ga0500644_0030924
2353 Ga0500644_0090365
2354 Ga0500646_0000167
2355 Ga0500646_0000205
2356 Ga0500641_0024919
2357 Ga0500641_0026240
2358 Ga0500553_000116
2359 Ga0500556_0004985
2360 Ga0500560_008536
2361 Ga0500573_0043418
2362 Ga0500573_0043889
2363 Ga0500577_0018450
2364 Ga0500637_0026467
2365 Ga0500645_027931
2366 Ga0501084_0000567
2367 Ga0501084_0003883
2368 Ga0501084_0058067
2369 Ga0590075_005905
2370 Ga0501082_0036924
2371 Ga0501082_0054265
2372 Ga0501082_0059903
2373 Ga0466962_0002637
2374 Ga0466962_0003080
2375 Ga0466962_0014836
2376 Ga0530510_0459877
2377 2676203048
2378 2501942207
2379 2508674230
2380 2515854319
2381 2524186023
2382 2559428894
2383 2587739664
2384 2616906431
2385 2644232255
2386 2644385626
2387 2644436682
2388 2644445760
2389 2644625506
2390 2671832687
2391 2676476673
2392 2676483434
2393 2686538689
2394 2689990263
2395 2740169335
2396 2753070081
2397 2753272299
2398 2774847624
2399 2774850843
2400 2774903390
2401 2808841580
2402 2816426788
2403 2816505452
2404 2819742617
2405 2848551799
2406 2855686794
2407 2856864585
2408 2857477520
2409 2858873325
2410 2861522952
2411 2861524298
2412 2862293230
2413 2862515013
2414 2867303440
2415 2867316204
2416 2867321070
2417 2867371460
2418 2867481337
2419 2870727427
2420 2887481033
2421 2895887479
2422 2902588080
2423 2904117965
2424 2919473428
2425 2935394703
2426 2946075487
2427 2990048708
2428 2990094265
2429 2995466119
2430 2996227476
2431 2997456788
2432 3003003351
2433 3006321669
2434 3006491704
2435 649813888
2436 8002779266
2437 8002788849
2438 8003862066
2439 8008489807
2440 8025527419
2441 8047719384
2442 8053953006
2443 8054161095
2444 8056063567
2445 8056450893
2446 8056668080
2447 8057570939
2448 8057573300

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

84

229

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9058 2 248
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.8943 2 234
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.8938 3 248
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.8897 3 248
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.8896 1 240
ID Description Score Start End Superfamily
af_Q1RS86_918_1157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9325 1 231 3.40.50.300
af_A4HV32_726_961_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9301 2 247 3.40.50.300
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9281 1 247 3.40.50.300
af_Q9XW49_440_685_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9268 1 248 3.40.50.300
af_A1ZBS3_470_698_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9244 2 247 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0D1P4L1-F1-model_v4 deleted 0.9553 1 248
AF-A0A0R0D0B4-F1-model_v4 ABC transporter domain-containing protein 0.9473 4 245 GO:0005524
GO:0016887
AF-A0A2D4CKI9-F1-model_v4 deleted 0.9397 2 249
AF-A0A0C5C8U0-F1-model_v4 deleted 0.9321 108 247
AF-A0A382TRQ1-F1-model_v4 Branched-chain amino acid ATP-binding cassette transporter C-terminal domain-containing protein 0.9301 139 245 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Map