F491933
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1226 | 660 | 2452 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0011741|Ga0496109_0011741_5631_6476 |
| Length | 281 |
| Sequence | MAEEARSRLGRGLASLIGDVGGEAAHLDRPRAQRKVPIEFLKPNPRNPRREFADNELRELADSIRQHGVIQPIVVRPARGTQDRFEIIAGERRWRSAQIAGLHEVPIVPVDVSDSDALEIAIIEEAQGYHALAGEFKRSADDIAKIVGKSRSHIANMMRLTKLPAEVQRYIALGKLSAGHARALIGVPDPVAAAKRIIEGDLNVRQAEALAHVEGVPERKPHKARGRKTKDADTAALEKRVSDALGLAVSIDHRDSAGTVHIRYRDLDQLDEIVRRLEAST |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 102 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 103 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 104 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 105 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 106 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 107 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 108 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 168 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 169 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 180 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 200 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 201 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 202 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 203 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 234 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 235 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 242 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 243 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 246 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 326 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 331 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 339 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 340 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 341 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 342 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 343 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 344 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 345 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 378 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 379 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 381 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 382 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 383 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 391 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 395 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 396 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 397 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 398 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 400 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 402 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 403 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 404 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 405 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 408 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 409 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 410 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 411 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 413 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 414 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 416 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 418 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 419 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 420 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 421 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 422 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 423 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 424 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 426 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 427 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 428 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 429 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 431 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 432 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 433 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 434 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 435 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 437 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 439 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 440 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 441 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 442 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 443 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 444 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 445 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 446 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 447 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 448 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 449 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 450 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 451 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 452 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 453 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 454 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 455 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 456 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 457 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 458 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 459 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 460 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 461 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 462 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 463 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 464 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 465 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 466 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 467 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 468 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 469 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 470 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 471 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 472 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 473 | 2791355199 | |||
| 474 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 475 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 476 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 477 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 478 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 479 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 480 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 481 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 482 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 483 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 484 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 485 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 486 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 487 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 488 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 489 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 490 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 491 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 492 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 493 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 494 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 495 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 496 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 497 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 498 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 499 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 500 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 501 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 502 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 503 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 504 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 505 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 506 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 507 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 508 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 509 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 510 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 511 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 512 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 513 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 514 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 515 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 516 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 517 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 518 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 519 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 520 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 521 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 522 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 523 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 524 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 525 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 526 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 527 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 528 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 529 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 530 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 531 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 532 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 533 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 534 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 535 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 536 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 537 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 538 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 539 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 540 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 541 | 2904699407 | |||
| 542 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 543 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 544 | 2906610324 | |||
| 545 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 546 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 547 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 548 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 549 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 550 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 551 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 552 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 553 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 554 | 2922368715 | |||
| 555 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 556 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 557 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 558 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 559 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 560 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 561 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 562 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 563 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 564 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 565 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 566 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 567 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 568 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 569 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 570 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 571 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 572 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 573 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 574 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 575 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 576 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 577 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 578 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 579 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 580 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 581 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 582 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 583 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 584 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 585 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 586 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 587 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 588 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 589 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 590 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 591 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 592 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 593 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 594 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 595 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 596 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 597 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 598 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 599 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 600 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 601 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 602 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 603 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 604 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 605 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 606 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 607 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 608 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 609 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 610 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 611 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 612 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 613 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 614 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 615 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 616 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 617 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 618 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 619 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 620 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 621 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 622 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 623 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 624 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 625 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 626 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 627 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 628 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 629 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 630 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 631 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 632 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 633 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 634 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 635 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 636 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 637 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 638 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 639 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 640 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 641 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 642 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 643 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 644 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 645 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 646 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 647 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 648 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 649 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 650 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 651 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 652 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 653 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 654 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 655 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 656 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 657 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 658 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 659 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 660 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.91 |
| Metatranscriptomes | 0.16 |
| Isolates | 17.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.11 |
| Nodule | 14.03 |
| Rhizoplane | 7.59 |
| Rhizosphere | 56.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496109_0011741 | 3300048912 | Bacteria | 7537 |
| 2 | JGI24740J21852_10000946 | 3300001979 | Bacteria | 12915 |
| 3 | JGI24737J22298_10024439 | 3300001990 | Bacteria | 1913 |
| 4 | JGI24735J21928_10009808 | 3300002067 | Bacteria | 3067 |
| 5 | JGI24738J21930_10006735 | 3300002075 | Bacteria | 2673 |
| 6 | JGI25406J46586_10000066 | 3300003203 | Bacteria | 48110 |
| 7 | JGI25406J46586_10002779 | 3300003203 | Bacteria | 8224 |
| 8 | JGI25153J46596_10003450 | 3300003215 | Bacteria | 8852 |
| 9 | JGI25153J46596_10011834 | 3300003215 | Bacteria | 3825 |
| 10 | JGI25160J50197_1003294 | 3300003354 | Bacteria | 7271 |
| 11 | JGI25404J52841_10007684 | 3300003659 | Bacteria | 2285 |
| 12 | Ga0055526_1043009 | 3300003771 | Bacteria | 1106 |
| 13 | Ga0055531_10014489 | 3300003794 | Bacteria | 3545 |
| 14 | Ga0065165_1000365 | 3300005262 | Bacteria | 74017 |
| 15 | Ga0065165_1001495 | 3300005262 | Bacteria | 24729 |
| 16 | Ga0065165_1019115 | 3300005262 | Bacteria | 2458 |
| 17 | Ga0070658_10068227 | 3300005327 | Bacteria | 2907 |
| 18 | Ga0070658_10084002 | 3300005327 | Bacteria | 2618 |
| 19 | Ga0070683_100005996 | 3300005329 | Bacteria | 10180 |
| 20 | Ga0070683_100013328 | 3300005329 | Bacteria | 7167 |
| 21 | Ga0070683_100421203 | 3300005329 | Bacteria | 1274 |
| 22 | Ga0070690_100211041 | 3300005330 | Bacteria | 1356 |
| 23 | Ga0068868_100016797 | 3300005338 | Bacteria | 5443 |
| 24 | Ga0070660_100038981 | 3300005339 | Bacteria | 3610 |
| 25 | Ga0070691_10133269 | 3300005341 | Bacteria | 1261 |
| 26 | Ga0070669_100066355 | 3300005353 | Bacteria | 2660 |
| 27 | Ga0070671_100129955 | 3300005355 | Bacteria | 2121 |
| 28 | Ga0070674_100088993 | 3300005356 | Bacteria | 2223 |
| 29 | Ga0070674_100234639 | 3300005356 | Bacteria | 1433 |
| 30 | Ga0070673_100084349 | 3300005364 | Bacteria | 2584 |
| 31 | Ga0070659_100118955 | 3300005366 | Bacteria | 2138 |
| 32 | Ga0070709_10000584 | 3300005434 | Bacteria | 21359 |
| 33 | Ga0070709_10004682 | 3300005434 | Bacteria | 7388 |
| 34 | Ga0070709_10013026 | 3300005434 | Bacteria | 4667 |
| 35 | Ga0070709_10105903 | 3300005434 | Bacteria | 1882 |
| 36 | Ga0070714_100004568 | 3300005435 | Bacteria | 10439 |
| 37 | Ga0070714_100118625 | 3300005435 | Bacteria | 2351 |
| 38 | Ga0070713_100005959 | 3300005436 | Bacteria | 8384 |
| 39 | Ga0070713_100010327 | 3300005436 | Bacteria | 6743 |
| 40 | Ga0070713_100157380 | 3300005436 | Bacteria | 2026 |
| 41 | Ga0070713_100415359 | 3300005436 | Bacteria | 1259 |
| 42 | Ga0070710_10002351 | 3300005437 | Bacteria | 8946 |
| 43 | Ga0070710_10004995 | 3300005437 | Bacteria | 6278 |
| 44 | Ga0070710_10109270 | 3300005437 | Bacteria | 1659 |
| 45 | Ga0070711_100000660 | 3300005439 | Bacteria | 18001 |
| 46 | Ga0070711_100004456 | 3300005439 | Bacteria | 8265 |
| 47 | Ga0070711_100019254 | 3300005439 | Bacteria | 4377 |
| 48 | Ga0070711_100022461 | 3300005439 | Bacteria | 4090 |
| 49 | Ga0070711_100474025 | 3300005439 | Bacteria | 1028 |
| 50 | Ga0070663_100062897 | 3300005455 | Bacteria | 2677 |
| 51 | Ga0070678_100015808 | 3300005456 | Bacteria | 4807 |
| 52 | Ga0070681_10014969 | 3300005458 | Bacteria | 7713 |
| 53 | Ga0070681_10051117 | 3300005458 | Bacteria | 4123 |
| 54 | Ga0070681_10089577 | 3300005458 | Bacteria | 3028 |
| 55 | Ga0070698_100068842 | 3300005471 | Bacteria | 3556 |
| 56 | Ga0070679_100039226 | 3300005530 | Bacteria | 4707 |
| 57 | Ga0070679_100044969 | 3300005530 | Bacteria | 4399 |
| 58 | Ga0070679_100066868 | 3300005530 | Bacteria | 3584 |
| 59 | Ga0070679_100120755 | 3300005530 | Bacteria | 2605 |
| 60 | Ga0070684_100007764 | 3300005535 | Bacteria | 8363 |
| 61 | Ga0070684_100024903 | 3300005535 | Bacteria | 5023 |
| 62 | Ga0070684_100058502 | 3300005535 | Bacteria | 3368 |
| 63 | Ga0070697_100289134 | 3300005536 | Bacteria | 1407 |
| 64 | Ga0068853_100001705 | 3300005539 | Bacteria | 16098 |
| 65 | Ga0068853_100029265 | 3300005539 | Bacteria | 4641 |
| 66 | Ga0068853_100086417 | 3300005539 | Bacteria | 2750 |
| 67 | Ga0068853_100196525 | 3300005539 | Bacteria | 1835 |
| 68 | Ga0068853_100279593 | 3300005539 | Bacteria | 1539 |
| 69 | Ga0070696_100109075 | 3300005546 | Bacteria | 1992 |
| 70 | Ga0070665_100028170 | 3300005548 | Bacteria | 5657 |
| 71 | Ga0070665_100099215 | 3300005548 | Bacteria | 2916 |
| 72 | Ga0070665_100250510 | 3300005548 | Bacteria | 1772 |
| 73 | Ga0068855_100015846 | 3300005563 | Bacteria | 9068 |
| 74 | Ga0068855_100034493 | 3300005563 | Bacteria | 6035 |
| 75 | Ga0068855_100274067 | 3300005563 | Bacteria | 1875 |
| 76 | Ga0068855_100526603 | 3300005563 | Bacteria | 1282 |
| 77 | Ga0070664_100189725 | 3300005564 | Bacteria | 1831 |
| 78 | Ga0068857_100021030 | 3300005577 | Bacteria | 5741 |
| 79 | Ga0068857_100041204 | 3300005577 | Bacteria | 4095 |
| 80 | Ga0068857_100227058 | 3300005577 | Bacteria | 1706 |
| 81 | Ga0068857_100576858 | 3300005577 | Bacteria | 1061 |
| 82 | Ga0068854_100222019 | 3300005578 | Bacteria | 1495 |
| 83 | Ga0068854_100318805 | 3300005578 | Bacteria | 1263 |
| 84 | Ga0068856_100005093 | 3300005614 | Bacteria | 12992 |
| 85 | Ga0068856_100012875 | 3300005614 | Bacteria | 8096 |
| 86 | Ga0068856_100065061 | 3300005614 | Bacteria | 3603 |
| 87 | Ga0068856_100129808 | 3300005614 | Bacteria | 2525 |
| 88 | Ga0068852_100042806 | 3300005616 | Bacteria | 3836 |
| 89 | Ga0068852_100104346 | 3300005616 | Bacteria | 2566 |
| 90 | Ga0068852_100341968 | 3300005616 | Bacteria | 1458 |
| 91 | Ga0068859_100184572 | 3300005617 | Bacteria | 2169 |
| 92 | Ga0068864_100026520 | 3300005618 | Bacteria | 4886 |
| 93 | Ga0068851_10002645 | 3300005834 | Bacteria | 7896 |
| 94 | Ga0068851_10030239 | 3300005834 | Bacteria | 2685 |
| 95 | Ga0068858_100033778 | 3300005842 | Bacteria | 4744 |
| 96 | Ga0068858_100094168 | 3300005842 | Bacteria | 2790 |
| 97 | Ga0068858_100394178 | 3300005842 | Bacteria | 1330 |
| 98 | Ga0068860_100001450 | 3300005843 | Bacteria | 25677 |
| 99 | Ga0068860_100136751 | 3300005843 | Bacteria | 2353 |
| 100 | Ga0081455_10009536 | 3300005937 | Bacteria | 9971 |
| 101 | Ga0081455_10010204 | 3300005937 | Bacteria | 9559 |
| 102 | Ga0081455_10037390 | 3300005937 | Bacteria | 4313 |
| 103 | Ga0081455_10048211 | 3300005937 | Bacteria | 3683 |
| 104 | Ga0081538_10086299 | 3300005981 | Bacteria | 1644 |
| 105 | Ga0081540_1003875 | 3300005983 | Bacteria | 11676 |
| 106 | Ga0081540_1005299 | 3300005983 | Bacteria | 9654 |
| 107 | Ga0081540_1011061 | 3300005983 | Bacteria | 6059 |
| 108 | Ga0081540_1012813 | 3300005983 | Bacteria | 5486 |
| 109 | Ga0081540_1021192 | 3300005983 | Bacteria | 3881 |
| 110 | Ga0081539_10000064 | 3300005985 | Bacteria | 247020 |
| 111 | Ga0081539_10004737 | 3300005985 | Bacteria | 14713 |
| 112 | Ga0081539_10029435 | 3300005985 | Bacteria | 3430 |
| 113 | Ga0070717_10006989 | 3300006028 | Bacteria | 8350 |
| 114 | Ga0070717_10043262 | 3300006028 | Bacteria | 3675 |
| 115 | Ga0070717_10088445 | 3300006028 | Bacteria | 2611 |
| 116 | Ga0075365_10066092 | 3300006038 | Bacteria | 2426 |
| 117 | Ga0075365_10318386 | 3300006038 | Bacteria | 1095 |
| 118 | Ga0075368_10003158 | 3300006042 | Bacteria | 5475 |
| 119 | Ga0075363_100016306 | 3300006048 | Bacteria | 3669 |
| 120 | Ga0070715_10000108 | 3300006163 | Bacteria | 20251 |
| 121 | Ga0070715_10019602 | 3300006163 | Bacteria | 2597 |
| 122 | Ga0070716_100002138 | 3300006173 | Bacteria | 9082 |
| 123 | Ga0070716_100013388 | 3300006173 | Bacteria | 4178 |
| 124 | Ga0070712_100047535 | 3300006175 | Bacteria | 2970 |
| 125 | Ga0070712_100240873 | 3300006175 | Bacteria | 1441 |
| 126 | Ga0075367_10092235 | 3300006178 | Bacteria | 1844 |
| 127 | Ga0075369_10043758 | 3300006186 | Bacteria | 1922 |
| 128 | Ga0075369_10076719 | 3300006186 | Bacteria | 1478 |
| 129 | Ga0075366_10061029 | 3300006195 | Bacteria | 2240 |
| 130 | Ga0097621_100249243 | 3300006237 | Bacteria | 1555 |
| 131 | Ga0075370_10156285 | 3300006353 | Bacteria | 1337 |
| 132 | Ga0068871_100330798 | 3300006358 | Bacteria | 1344 |
| 133 | Ga0075428_100045101 | 3300006844 | Bacteria | 4844 |
| 134 | Ga0075430_100389813 | 3300006846 | Bacteria | 1150 |
| 135 | Ga0075433_10217483 | 3300006852 | Bacteria | 1698 |
| 136 | Ga0068865_100349271 | 3300006881 | Bacteria | 1198 |
| 137 | Ga0075436_100397440 | 3300006914 | Bacteria | 998 |
| 138 | Ga0097620_100184562 | 3300006931 | Bacteria | 2169 |
| 139 | Ga0099823_1022515 | 3300006944 | Bacteria | 5827 |
| 140 | Ga0099795_10064146 | 3300007788 | Bacteria | 1371 |
| 141 | Ga0105240_10004955 | 3300009093 | Bacteria | 20025 |
| 142 | Ga0105240_10008228 | 3300009093 | Bacteria | 14944 |
| 143 | Ga0105240_10031181 | 3300009093 | Bacteria | 6917 |
| 144 | Ga0105245_10197939 | 3300009098 | Bacteria | 1928 |
| 145 | Ga0105245_10231917 | 3300009098 | Bacteria | 1786 |
| 146 | Ga0105247_10010882 | 3300009101 | Bacteria | 5496 |
| 147 | Ga0114129_10721610 | 3300009147 | Bacteria | 1279 |
| 148 | Ga0105241_10002286 | 3300009174 | Bacteria | 14395 |
| 149 | Ga0105241_10072988 | 3300009174 | Bacteria | 2669 |
| 150 | Ga0105241_10082572 | 3300009174 | Bacteria | 2519 |
| 151 | Ga0105248_10549277 | 3300009177 | Bacteria | 1303 |
| 152 | Ga0105237_10010095 | 3300009545 | Bacteria | 10071 |
| 153 | Ga0105237_10168546 | 3300009545 | Bacteria | 2189 |
| 154 | Ga0105237_10304187 | 3300009545 | Bacteria | 1598 |
| 155 | Ga0105237_10637369 | 3300009545 | Bacteria | 1073 |
| 156 | Ga0105237_10789028 | 3300009545 | Bacteria | 957 |
| 157 | Ga0105238_10000905 | 3300009551 | Bacteria | 30512 |
| 158 | Ga0105238_10015713 | 3300009551 | Bacteria | 7663 |
| 159 | Ga0105238_10030039 | 3300009551 | Bacteria | 5531 |
| 160 | Ga0105238_10050367 | 3300009551 | Bacteria | 4193 |
| 161 | Ga0105238_10074317 | 3300009551 | Bacteria | 3392 |
| 162 | Ga0105238_10597241 | 3300009551 | Bacteria | 1111 |
| 163 | Ga0105249_10164867 | 3300009553 | Bacteria | 2144 |
| 164 | Ga0105249_10269902 | 3300009553 | Bacteria | 1694 |
| 165 | Ga0105239_10002519 | 3300010375 | Bacteria | 23275 |
| 166 | Ga0105239_10024695 | 3300010375 | Bacteria | 6620 |
| 167 | Ga0105239_10064493 | 3300010375 | Bacteria | 4021 |
| 168 | Ga0105239_10080757 | 3300010375 | Bacteria | 3578 |
| 169 | Ga0105239_10199644 | 3300010375 | Bacteria | 2240 |
| 170 | Ga0105239_10211410 | 3300010375 | Bacteria | 2174 |
| 171 | Ga0105239_10279826 | 3300010375 | Bacteria | 1878 |
| 172 | Ga0105239_10356811 | 3300010375 | Bacteria | 1651 |
| 173 | Ga0105246_10081781 | 3300011119 | Bacteria | 2303 |
| 174 | Ga0157373_10053256 | 3300013100 | Bacteria | 2877 |
| 175 | Ga0157370_10129027 | 3300013104 | Bacteria | 2359 |
| 176 | Ga0157370_10402729 | 3300013104 | Bacteria | 1259 |
| 177 | Ga0157369_10071197 | 3300013105 | Bacteria | 3733 |
| 178 | Ga0157369_10684080 | 3300013105 | Bacteria | 1057 |
| 179 | Ga0157374_10228057 | 3300013296 | Bacteria | 1829 |
| 180 | Ga0157378_10743896 | 3300013297 | Bacteria | 1003 |
| 181 | Ga0163162_10277441 | 3300013306 | Bacteria | 1808 |
| 182 | Ga0157372_10271108 | 3300013307 | Bacteria | 1972 |
| 183 | Ga0157375_10028391 | 3300013308 | Bacteria | 5244 |
| 184 | Ga0157375_10293938 | 3300013308 | Bacteria | 1788 |
| 185 | Ga0157375_10410565 | 3300013308 | Bacteria | 1520 |
| 186 | Ga0163163_10002009 | 3300014325 | Bacteria | 17183 |
| 187 | Ga0163163_10033178 | 3300014325 | Bacteria | 4992 |
| 188 | Ga0157380_10127343 | 3300014326 | Bacteria | 2167 |
| 189 | Ga0182008_10159463 | 3300014497 | Bacteria | 1135 |
| 190 | Ga0157377_10178578 | 3300014745 | Bacteria | 1333 |
| 191 | Ga0157379_10179402 | 3300014968 | Bacteria | 1913 |
| 192 | Ga0157376_10010998 | 3300014969 | Bacteria | 6649 |
| 193 | Ga0206353_10148081 | 3300020082 | Bacteria | 1075 |
| 194 | Ga0206353_10567907 | 3300020082 | Bacteria | 2027 |
| 195 | Ga0214544_1000016 | 3300021320 | Bacteria | 204278 |
| 196 | Ga0214542_1000016 | 3300021321 | Bacteria | 210332 |
| 197 | Ga0214545_1000008 | 3300021324 | Bacteria | 215190 |
| 198 | Ga0214543_1001466 | 3300021327 | Bacteria | 45567 |
| 199 | Ga0213873_10024285 | 3300021358 | Bacteria | 1453 |
| 200 | Ga0213872_10015515 | 3300021361 | Bacteria | 3540 |
| 201 | Ga0213876_10002439 | 3300021384 | Bacteria | 10933 |
| 202 | Ga0209563_108642 | 3300025230 | Bacteria | 1592 |
| 203 | Ga0209677_100672 | 3300025253 | Bacteria | 17650 |
| 204 | Ga0209677_105633 | 3300025253 | Bacteria | 3210 |
| 205 | Ga0209148_1000282 | 3300025254 | Bacteria | 78016 |
| 206 | Ga0209233_1005872 | 3300025261 | Bacteria | 4028 |
| 207 | Ga0209455_1002393 | 3300025272 | Bacteria | 7284 |
| 208 | Ga0207673_1005554 | 3300025290 | Bacteria | 1542 |
| 209 | Ga0209564_1000321 | 3300025295 | Bacteria | 93331 |
| 210 | Ga0209564_1003702 | 3300025295 | Bacteria | 10062 |
| 211 | Ga0209758_1000069 | 3300025297 | Bacteria | 286161 |
| 212 | Ga0209758_1000635 | 3300025297 | Bacteria | 53736 |
| 213 | Ga0209758_1001996 | 3300025297 | Bacteria | 21984 |
| 214 | Ga0209758_1002493 | 3300025297 | Bacteria | 18700 |
| 215 | Ga0209758_1011302 | 3300025297 | Bacteria | 5193 |
| 216 | Ga0209758_1017490 | 3300025297 | Bacteria | 3566 |
| 217 | Ga0209256_1015129 | 3300025299 | Bacteria | 2720 |
| 218 | Ga0209256_1032713 | 3300025299 | Bacteria | 1407 |
| 219 | Ga0207426_1002082 | 3300025302 | Bacteria | 13833 |
| 220 | Ga0207426_1004116 | 3300025302 | Bacteria | 7310 |
| 221 | Ga0207426_1020494 | 3300025302 | Bacteria | 2297 |
| 222 | Ga0207426_1024931 | 3300025302 | Bacteria | 2021 |
| 223 | Ga0209257_1000473 | 3300025304 | Bacteria | 73323 |
| 224 | Ga0209257_1017693 | 3300025304 | Bacteria | 2792 |
| 225 | Ga0207697_10065589 | 3300025315 | Bacteria | 1515 |
| 226 | Ga0207656_10008173 | 3300025321 | Bacteria | 3840 |
| 227 | Ga0207692_10002026 | 3300025898 | Bacteria | 7732 |
| 228 | Ga0207692_10012905 | 3300025898 | Bacteria | 3605 |
| 229 | Ga0207647_10014195 | 3300025904 | Bacteria | 5498 |
| 230 | Ga0207647_10168847 | 3300025904 | Bacteria | 1274 |
| 231 | Ga0207685_10016028 | 3300025905 | Bacteria | 2388 |
| 232 | Ga0207685_10035616 | 3300025905 | Bacteria | 1818 |
| 233 | Ga0207699_10003043 | 3300025906 | Bacteria | 7960 |
| 234 | Ga0207699_10007202 | 3300025906 | Bacteria | 5431 |
| 235 | Ga0207699_10038283 | 3300025906 | Bacteria | 2747 |
| 236 | Ga0207699_10245906 | 3300025906 | Bacteria | 1231 |
| 237 | Ga0207699_10323155 | 3300025906 | Bacteria | 1083 |
| 238 | Ga0207645_10179478 | 3300025907 | Bacteria | 1389 |
| 239 | Ga0207684_10077500 | 3300025910 | Bacteria | 2827 |
| 240 | Ga0207654_10000058 | 3300025911 | Bacteria | 75628 |
| 241 | Ga0207654_10006549 | 3300025911 | Bacteria | 5860 |
| 242 | Ga0207654_10011597 | 3300025911 | Bacteria | 4498 |
| 243 | Ga0207654_10089954 | 3300025911 | Bacteria | 1869 |
| 244 | Ga0207707_10004700 | 3300025912 | Bacteria | 11981 |
| 245 | Ga0207707_10035006 | 3300025912 | Bacteria | 4391 |
| 246 | Ga0207707_10054133 | 3300025912 | Bacteria | 3493 |
| 247 | Ga0207707_10104173 | 3300025912 | Bacteria | 2479 |
| 248 | Ga0207707_10158480 | 3300025912 | Bacteria | 1979 |
| 249 | Ga0207695_10000107 | 3300025913 | Bacteria | 252606 |
| 250 | Ga0207695_10000453 | 3300025913 | Bacteria | 89314 |
| 251 | Ga0207695_10115822 | 3300025913 | Bacteria | 2654 |
| 252 | Ga0207695_10254960 | 3300025913 | Bacteria | 1653 |
| 253 | Ga0207695_10318707 | 3300025913 | Bacteria | 1444 |
| 254 | Ga0207671_10018412 | 3300025914 | Bacteria | 5360 |
| 255 | Ga0207671_10042434 | 3300025914 | Bacteria | 3367 |
| 256 | Ga0207671_10069130 | 3300025914 | Bacteria | 2633 |
| 257 | Ga0207671_10094158 | 3300025914 | Bacteria | 2260 |
| 258 | Ga0207671_10282289 | 3300025914 | Bacteria | 1310 |
| 259 | Ga0207671_10461891 | 3300025914 | Bacteria | 1012 |
| 260 | Ga0207693_10000310 | 3300025915 | Bacteria | 45408 |
| 261 | Ga0207693_10021450 | 3300025915 | Bacteria | 5132 |
| 262 | Ga0207693_10034078 | 3300025915 | Bacteria | 4016 |
| 263 | Ga0207693_10035714 | 3300025915 | Bacteria | 3919 |
| 264 | Ga0207693_10181848 | 3300025915 | Bacteria | 1655 |
| 265 | Ga0207693_10354295 | 3300025915 | Bacteria | 1148 |
| 266 | Ga0207663_10016715 | 3300025916 | Bacteria | 4075 |
| 267 | Ga0207663_10019867 | 3300025916 | Bacteria | 3793 |
| 268 | Ga0207663_10083697 | 3300025916 | Bacteria | 2096 |
| 269 | Ga0207660_10076914 | 3300025917 | Bacteria | 2441 |
| 270 | Ga0207660_10081275 | 3300025917 | Bacteria | 2381 |
| 271 | Ga0207660_10189160 | 3300025917 | Bacteria | 1602 |
| 272 | Ga0207657_10029294 | 3300025919 | Bacteria | 5013 |
| 273 | Ga0207657_10073517 | 3300025919 | Bacteria | 2889 |
| 274 | Ga0207657_10131985 | 3300025919 | Bacteria | 2046 |
| 275 | Ga0207649_10410030 | 3300025920 | Bacteria | 1016 |
| 276 | Ga0207652_10076915 | 3300025921 | Bacteria | 2911 |
| 277 | Ga0207652_10079219 | 3300025921 | Bacteria | 2870 |
| 278 | Ga0207652_10136044 | 3300025921 | Bacteria | 2194 |
| 279 | Ga0207681_10066644 | 3300025923 | Bacteria | 2493 |
| 280 | Ga0207694_10001009 | 3300025924 | Bacteria | 24556 |
| 281 | Ga0207694_10034117 | 3300025924 | Bacteria | 3901 |
| 282 | Ga0207694_10274993 | 3300025924 | Bacteria | 1382 |
| 283 | Ga0207687_10004089 | 3300025927 | Bacteria | 9778 |
| 284 | Ga0207687_10330306 | 3300025927 | Bacteria | 1237 |
| 285 | Ga0207687_10350902 | 3300025927 | Bacteria | 1202 |
| 286 | Ga0207700_10093504 | 3300025928 | Bacteria | 2380 |
| 287 | Ga0207700_10117026 | 3300025928 | Bacteria | 2154 |
| 288 | Ga0207700_10154584 | 3300025928 | Bacteria | 1899 |
| 289 | Ga0207664_10061778 | 3300025929 | Bacteria | 2990 |
| 290 | Ga0207664_10103518 | 3300025929 | Bacteria | 2356 |
| 291 | Ga0207664_10487302 | 3300025929 | Bacteria | 1103 |
| 292 | Ga0207664_10588483 | 3300025929 | Bacteria | 999 |
| 293 | Ga0207644_10066408 | 3300025931 | Bacteria | 2626 |
| 294 | Ga0207706_10203009 | 3300025933 | Bacteria | 1738 |
| 295 | Ga0207709_10250155 | 3300025935 | Bacteria | 1294 |
| 296 | Ga0207665_10001734 | 3300025939 | Bacteria | 14668 |
| 297 | Ga0207665_10004258 | 3300025939 | Bacteria | 9511 |
| 298 | Ga0207665_10061076 | 3300025939 | Bacteria | 2554 |
| 299 | Ga0207665_10085508 | 3300025939 | Bacteria | 2178 |
| 300 | Ga0207691_10172053 | 3300025940 | Bacteria | 1896 |
| 301 | Ga0207691_10203813 | 3300025940 | Bacteria | 1721 |
| 302 | Ga0207691_10441320 | 3300025940 | Bacteria | 1108 |
| 303 | Ga0207711_10211107 | 3300025941 | Bacteria | 1773 |
| 304 | Ga0207689_10039585 | 3300025942 | Bacteria | 3902 |
| 305 | Ga0207661_10044403 | 3300025944 | Bacteria | 3512 |
| 306 | Ga0207661_10056040 | 3300025944 | Bacteria | 3163 |
| 307 | Ga0207661_10073930 | 3300025944 | Bacteria | 2793 |
| 308 | Ga0207661_10175645 | 3300025944 | Bacteria | 1867 |
| 309 | Ga0207661_10670737 | 3300025944 | Bacteria | 953 |
| 310 | Ga0207679_10390674 | 3300025945 | Bacteria | 1222 |
| 311 | Ga0207667_10006596 | 3300025949 | Bacteria | 14034 |
| 312 | Ga0207667_10088774 | 3300025949 | Bacteria | 3196 |
| 313 | Ga0207667_10109852 | 3300025949 | Bacteria | 2844 |
| 314 | Ga0207667_10160793 | 3300025949 | Bacteria | 2310 |
| 315 | Ga0207667_10281972 | 3300025949 | Bacteria | 1698 |
| 316 | Ga0207640_10047734 | 3300025981 | Bacteria | 2764 |
| 317 | Ga0207640_10186435 | 3300025981 | Bacteria | 1560 |
| 318 | Ga0207658_10306396 | 3300025986 | Bacteria | 1370 |
| 319 | Ga0207677_10024413 | 3300026023 | Bacteria | 3756 |
| 320 | Ga0207677_10198955 | 3300026023 | Bacteria | 1591 |
| 321 | Ga0207703_10078340 | 3300026035 | Bacteria | 2746 |
| 322 | Ga0207703_10281990 | 3300026035 | Bacteria | 1509 |
| 323 | Ga0207639_10013217 | 3300026041 | Bacteria | 5772 |
| 324 | Ga0207639_10123004 | 3300026041 | Bacteria | 2135 |
| 325 | Ga0207678_10003936 | 3300026067 | Bacteria | 13364 |
| 326 | Ga0207678_10046674 | 3300026067 | Bacteria | 3746 |
| 327 | Ga0207678_10096010 | 3300026067 | Bacteria | 2533 |
| 328 | Ga0207678_10422037 | 3300026067 | Bacteria | 1157 |
| 329 | Ga0207708_10085681 | 3300026075 | Bacteria | 2424 |
| 330 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 331 | Ga0207702_10001701 | 3300026078 | Bacteria | 21732 |
| 332 | Ga0207702_10337936 | 3300026078 | Bacteria | 1438 |
| 333 | Ga0207641_10327266 | 3300026088 | Bacteria | 1455 |
| 334 | Ga0207648_10060413 | 3300026089 | Bacteria | 3305 |
| 335 | Ga0207648_10238899 | 3300026089 | Bacteria | 1617 |
| 336 | Ga0207676_10095612 | 3300026095 | Bacteria | 2450 |
| 337 | Ga0207676_10114523 | 3300026095 | Bacteria | 2262 |
| 338 | Ga0207674_10000890 | 3300026116 | Bacteria | 39065 |
| 339 | Ga0207674_10002298 | 3300026116 | Bacteria | 24210 |
| 340 | Ga0207674_10007766 | 3300026116 | Bacteria | 12478 |
| 341 | Ga0207674_10052673 | 3300026116 | Bacteria | 4150 |
| 342 | Ga0207674_10299290 | 3300026116 | Bacteria | 1558 |
| 343 | Ga0207675_100122516 | 3300026118 | Bacteria | 2461 |
| 344 | Ga0207675_100389764 | 3300026118 | Bacteria | 1371 |
| 345 | Ga0207683_10016524 | 3300026121 | Bacteria | 6283 |
| 346 | Ga0207683_10169315 | 3300026121 | Bacteria | 1978 |
| 347 | Ga0207698_10031595 | 3300026142 | Bacteria | 3824 |
| 348 | Ga0207698_10183463 | 3300026142 | Bacteria | 1856 |
| 349 | Ga0207698_10350202 | 3300026142 | Bacteria | 1395 |
| 350 | Ga0209389_1000033 | 3300027296 | Bacteria | 131516 |
| 351 | Ga0209389_1000182 | 3300027296 | Bacteria | 48705 |
| 352 | Ga0209589_1000021 | 3300027357 | Bacteria | 186431 |
| 353 | Ga0209589_1000040 | 3300027357 | Bacteria | 126550 |
| 354 | Ga0209489_100028 | 3300027361 | Bacteria | 186431 |
| 355 | Ga0209489_100045 | 3300027361 | Bacteria | 158225 |
| 356 | Ga0209489_100209 | 3300027361 | Bacteria | 96349 |
| 357 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 358 | Ga0209700_100037 | 3300027363 | Bacteria | 186431 |
| 359 | Ga0209588_1073887 | 3300027671 | Bacteria | 1101 |
| 360 | Ga0268266_10045729 | 3300028379 | Bacteria | 3745 |
| 361 | Ga0268266_10184329 | 3300028379 | Bacteria | 1902 |
| 362 | Ga0268266_10199057 | 3300028379 | Bacteria | 1832 |
| 363 | Ga0268266_10410158 | 3300028379 | Bacteria | 1282 |
| 364 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 365 | Ga0265337_1018782 | 3300028556 | Bacteria | 2189 |
| 366 | Ga0265326_10008390 | 3300028558 | Bacteria | 3118 |
| 367 | Ga0265319_1012969 | 3300028563 | Bacteria | 3340 |
| 368 | Ga0265334_10013964 | 3300028573 | Bacteria | 3354 |
| 369 | Ga0265318_10016635 | 3300028577 | Bacteria | 3034 |
| 370 | Ga0265323_10007956 | 3300028653 | Bacteria | 4383 |
| 371 | Ga0265336_10000561 | 3300028666 | Bacteria | 21059 |
| 372 | Ga0307517_10001338 | 3300028786 | Bacteria | 41372 |
| 373 | Ga0307515_10125511 | 3300028794 | Bacteria | 2870 |
| 374 | Ga0307515_10140350 | 3300028794 | Bacteria | 2596 |
| 375 | Ga0265338_10000598 | 3300028800 | Bacteria | 63497 |
| 376 | Ga0265332_10016039 | 3300031238 | Bacteria | 3306 |
| 377 | Ga0265332_10027603 | 3300031238 | Bacteria | 2486 |
| 378 | Ga0265332_10072613 | 3300031238 | Bacteria | 1465 |
| 379 | Ga0265328_10044554 | 3300031239 | Bacteria | 1632 |
| 380 | Ga0265325_10009157 | 3300031241 | Bacteria | 5799 |
| 381 | Ga0265340_10041599 | 3300031247 | Bacteria | 2258 |
| 382 | Ga0265340_10042492 | 3300031247 | Bacteria | 2231 |
| 383 | Ga0265339_10007110 | 3300031249 | Bacteria | 7267 |
| 384 | Ga0265339_10029701 | 3300031249 | Bacteria | 3099 |
| 385 | Ga0265339_10099122 | 3300031249 | Bacteria | 1519 |
| 386 | Ga0265331_10027874 | 3300031250 | Bacteria | 2828 |
| 387 | Ga0265331_10100059 | 3300031250 | Bacteria | 1335 |
| 388 | Ga0307513_10105188 | 3300031456 | Bacteria | 2833 |
| 389 | Ga0307513_10164506 | 3300031456 | Bacteria | 2105 |
| 390 | Ga0307513_10169966 | 3300031456 | Bacteria | 2059 |
| 391 | Ga0307513_10222288 | 3300031456 | Bacteria | 1708 |
| 392 | Ga0307408_100239375 | 3300031548 | Bacteria | 1491 |
| 393 | Ga0265313_10041739 | 3300031595 | Bacteria | 2258 |
| 394 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 395 | Ga0307508_10078616 | 3300031616 | Bacteria | 2879 |
| 396 | Ga0265314_10005687 | 3300031711 | Bacteria | 11193 |
| 397 | Ga0265314_10147464 | 3300031711 | Bacteria | 1447 |
| 398 | Ga0265342_10005853 | 3300031712 | Bacteria | 9282 |
| 399 | Ga0307516_10006094 | 3300031730 | Bacteria | 14234 |
| 400 | Ga0307516_10010553 | 3300031730 | Bacteria | 10142 |
| 401 | Ga0307516_10104788 | 3300031730 | Bacteria | 2640 |
| 402 | Ga0307406_10168105 | 3300031901 | Bacteria | 1584 |
| 403 | Ga0307415_100362721 | 3300032126 | Bacteria | 1224 |
| 404 | Ga0307507_10027443 | 3300033179 | Bacteria | 6103 |
| 405 | Ga0307510_10024755 | 3300033180 | Bacteria | 6932 |
| 406 | Ga0307510_10025056 | 3300033180 | Bacteria | 6887 |
| 407 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 408 | Ga0316215_1002237 | 3300033544 | Bacteria | 1828 |
| 409 | Ga0373926_0039711 | 3300035083 | Bacteria | 1679 |
| 410 | Ga0373934_0002932 | 3300035086 | Bacteria | 6241 |
| 411 | Ga0373944_0042120 | 3300035089 | Bacteria | 1415 |
| 412 | Ga0373923_0009618 | 3300035111 | Bacteria | 3495 |
| 413 | Ga0373936_0016692 | 3300035113 | Bacteria | 2825 |
| 414 | Ga0373936_0036388 | 3300035113 | Bacteria | 1963 |
| 415 | Ga0373936_0070087 | 3300035113 | Bacteria | 1444 |
| 416 | Ga0373936_0133190 | 3300035113 | Bacteria | 1069 |
| 417 | Ga0373941_0063086 | 3300035115 | Bacteria | 1211 |
| 418 | Ga0373945_0002529 | 3300035116 | Bacteria | 5721 |
| 419 | Ga0373945_0019734 | 3300035116 | Bacteria | 2302 |
| 420 | Ga0373953_0000955 | 3300035117 | Bacteria | 8086 |
| 421 | Ga0373953_0034938 | 3300035117 | Bacteria | 1973 |
| 422 | Ga0373954_0018760 | 3300035118 | Bacteria | 3116 |
| 423 | Ga0373954_0018968 | 3300035118 | Bacteria | 3100 |
| 424 | Ga0373956_0068497 | 3300035119 | Bacteria | 1616 |
| 425 | Ga0373957_0006831 | 3300035120 | Bacteria | 3617 |
| 426 | Ga0373943_0002107 | 3300035170 | Bacteria | 9037 |
| 427 | Ga0373943_0046258 | 3300035170 | Bacteria | 2123 |
| 428 | Ga0373943_0056690 | 3300035170 | Bacteria | 1945 |
| 429 | Ga0373943_0083317 | 3300035170 | Bacteria | 1643 |
| 430 | Ga0373946_0001889 | 3300035171 | Bacteria | 7311 |
| 431 | Ga0373946_0104972 | 3300035171 | Bacteria | 1271 |
| 432 | Ga0373955_0005406 | 3300035172 | Bacteria | 5739 |
| 433 | Ga0373924_0005676 | 3300035410 | Bacteria | 4427 |
| 434 | Ga0373924_0060733 | 3300035410 | Bacteria | 1581 |
| 435 | Ga0373931_0019569 | 3300035691 | Bacteria | 3382 |
| 436 | Ga0373935_0000557 | 3300035692 | Bacteria | 19409 |
| 437 | Ga0373935_0308415 | 3300035692 | Bacteria | 1120 |
| 438 | Ga0373935_0443493 | 3300035692 | Bacteria | 937 |
| 439 | Ga0373927_0003654 | 3300035695 | Bacteria | 10968 |
| 440 | Ga0373927_0010418 | 3300035695 | Bacteria | 6199 |
| 441 | Ga0373927_0021960 | 3300035695 | Bacteria | 4182 |
| 442 | Ga0373927_0027049 | 3300035695 | Bacteria | 3748 |
| 443 | Ga0373927_0036371 | 3300035695 | Bacteria | 3202 |
| 444 | Ga0373927_0235046 | 3300035695 | Bacteria | 1204 |
| 445 | Ga0373933_0000031 | 3300035724 | Bacteria | 85038 |
| 446 | Ga0373933_0003419 | 3300035724 | Bacteria | 8846 |
| 447 | Ga0373933_0082944 | 3300035724 | Bacteria | 1968 |
| 448 | Ga0373947_0000509 | 3300035725 | Bacteria | 22579 |
| 449 | Ga0373947_0049307 | 3300035725 | Bacteria | 2528 |
| 450 | Ga0373947_0151339 | 3300035725 | Bacteria | 1495 |
| 451 | Ga0373947_0346433 | 3300035725 | Bacteria | 996 |
| 452 | Ga0373937_0033982 | 3300036401 | Bacteria | 4636 |
| 453 | Ga0373937_0284966 | 3300036401 | Bacteria | 1560 |
| 454 | Ga0373937_0380292 | 3300036401 | Bacteria | 1339 |
| 455 | Ga0373925_0001713 | 3300037068 | Bacteria | 18492 |
| 456 | Ga0373925_0025981 | 3300037068 | Bacteria | 4281 |
| 457 | Ga0373925_0078993 | 3300037068 | Bacteria | 2499 |
| 458 | Ga0373925_0110677 | 3300037068 | Bacteria | 2121 |
| 459 | Ga0373925_0110804 | 3300037068 | Bacteria | 2120 |
| 460 | Ga0373925_0192510 | 3300037068 | Bacteria | 1618 |
| 461 | Ga0373925_0205586 | 3300037068 | Bacteria | 1567 |
| 462 | Ga0395900_0003383 | 3300037418 | Bacteria | 17226 |
| 463 | Ga0395900_0080281 | 3300037418 | Bacteria | 3352 |
| 464 | Ga0395900_0546461 | 3300037418 | Bacteria | 1103 |
| 465 | Ga0395898_0013386 | 3300037466 | Bacteria | 8449 |
| 466 | Ga0395898_0018463 | 3300037466 | Bacteria | 7111 |
| 467 | Ga0395898_0079473 | 3300037466 | Bacteria | 3164 |
| 468 | Ga0395898_0099077 | 3300037466 | Bacteria | 2799 |
| 469 | Ga0395905_0005856 | 3300037471 | Bacteria | 12492 |
| 470 | Ga0395905_0023254 | 3300037471 | Bacteria | 5859 |
| 471 | Ga0395905_0060606 | 3300037471 | Bacteria | 3538 |
| 472 | Ga0395905_0165060 | 3300037471 | Bacteria | 2081 |
| 473 | Ga0436364_0709114 | 3300037853 | Bacteria | 1183 |
| 474 | Ga0395901_0161395 | 3300038443 | Bacteria | 2354 |
| 475 | Ga0395901_0224667 | 3300038443 | Bacteria | 1962 |
| 476 | Ga0436365_0076766 | 3300039437 | Bacteria | 1643 |
| 477 | Ga0436365_0803057 | 3300039437 | Bacteria | 5477 |
| 478 | Ga0436365_0958057 | 3300039437 | Bacteria | 1211 |
| 479 | Ga0436365_0966323 | 3300039437 | Bacteria | 3151 |
| 480 | Ga0436365_1369931 | 3300039437 | Bacteria | 1176 |
| 481 | Ga0436361_0336324 | 3300039447 | Bacteria | 2835 |
| 482 | Ga0436361_0937863 | 3300039447 | Bacteria | 1391 |
| 483 | Ga0436363_0697337 | 3300039450 | Bacteria | 2088 |
| 484 | Ga0439465_0013621 | 3300041413 | Bacteria | 2533 |
| 485 | Ga0466969_0128100 | 3300044656 | Bacteria | 1178 |
| 486 | Ga0466972_0000119 | 3300044658 | Bacteria | 66620 |
| 487 | Ga0466972_0010560 | 3300044658 | Bacteria | 4634 |
| 488 | Ga0466966_0034959 | 3300044684 | Bacteria | 3248 |
| 489 | Ga0466966_0041766 | 3300044684 | Bacteria | 2946 |
| 490 | Ga0466961_0000139 | 3300044693 | Bacteria | 48781 |
| 491 | Ga0466963_0080797 | 3300044694 | Bacteria | 2201 |
| 492 | Ga0466963_0117349 | 3300044694 | Bacteria | 1829 |
| 493 | Ga0466971_0174557 | 3300044719 | Bacteria | 1009 |
| 494 | Ga0466968_0017207 | 3300044735 | Bacteria | 2886 |
| 495 | Ga0466968_0021266 | 3300044735 | Bacteria | 2626 |
| 496 | Ga0466968_0100658 | 3300044735 | Bacteria | 1290 |
| 497 | Ga0466970_0045604 | 3300044765 | Bacteria | 2335 |
| 498 | Ga0466970_0185989 | 3300044765 | Bacteria | 1153 |
| 499 | Ga0466957_0035033 | 3300044842 | Bacteria | 3012 |
| 500 | Ga0466960_0000848 | 3300044901 | Bacteria | 10813 |
| 501 | Ga0466959_0034008 | 3300045049 | Bacteria | 3771 |
| 502 | Ga0466959_0053472 | 3300045049 | Bacteria | 2952 |
| 503 | Ga0466959_0240101 | 3300045049 | Bacteria | 1252 |
| 504 | Ga0466959_0361912 | 3300045049 | Bacteria | 988 |
| 505 | Ga0466967_0004006 | 3300045976 | Bacteria | 9819 |
| 506 | Ga0466967_0011512 | 3300045976 | Bacteria | 6706 |
| 507 | Ga0466967_0088324 | 3300045976 | Bacteria | 2813 |
| 508 | Ga0466967_0160685 | 3300045976 | Bacteria | 2108 |
| 509 | Ga0495592_0058216 | 3300046454 | Bacteria | 2850 |
| 510 | Ga0495592_0140768 | 3300046454 | Bacteria | 1678 |
| 511 | Ga0495592_0300267 | 3300046454 | Bacteria | 1044 |
| 512 | Ga0495603_0000047 | 3300046455 | Bacteria | 53081 |
| 513 | Ga0495603_0055753 | 3300046455 | Bacteria | 2341 |
| 514 | Ga0495603_0070506 | 3300046455 | Bacteria | 2054 |
| 515 | Ga0495629_0000320 | 3300046459 | Bacteria | 41151 |
| 516 | Ga0495629_0005536 | 3300046459 | Bacteria | 9427 |
| 517 | Ga0495629_0231283 | 3300046459 | Bacteria | 1274 |
| 518 | Ga0495638_0001094 | 3300046460 | Bacteria | 26401 |
| 519 | Ga0495638_0053016 | 3300046460 | Bacteria | 2524 |
| 520 | Ga0495641_0009584 | 3300046461 | Bacteria | 5738 |
| 521 | Ga0495651_0017530 | 3300046462 | Bacteria | 5546 |
| 522 | Ga0495651_0041190 | 3300046462 | Bacteria | 3588 |
| 523 | Ga0495651_0086113 | 3300046462 | Bacteria | 2365 |
| 524 | Ga0495651_0095034 | 3300046462 | Bacteria | 2230 |
| 525 | Ga0495653_0003027 | 3300046463 | Bacteria | 13478 |
| 526 | Ga0495653_0070906 | 3300046463 | Bacteria | 2606 |
| 527 | Ga0495580_0090453 | 3300046472 | Bacteria | 2131 |
| 528 | Ga0495582_0000043 | 3300046473 | Bacteria | 63647 |
| 529 | Ga0495582_0024699 | 3300046473 | Bacteria | 3289 |
| 530 | Ga0495582_0032646 | 3300046473 | Bacteria | 2862 |
| 531 | Ga0495582_0042626 | 3300046473 | Bacteria | 2499 |
| 532 | Ga0495605_0072307 | 3300046474 | Bacteria | 1627 |
| 533 | Ga0495605_0092896 | 3300046474 | Bacteria | 1396 |
| 534 | Ga0495639_0000091 | 3300046475 | Bacteria | 44027 |
| 535 | Ga0495662_0000128 | 3300046476 | Bacteria | 28645 |
| 536 | Ga0495664_0009771 | 3300046477 | Bacteria | 5377 |
| 537 | Ga0495664_0016934 | 3300046477 | Bacteria | 4162 |
| 538 | Ga0495664_0053492 | 3300046477 | Bacteria | 2401 |
| 539 | Ga0495584_0016366 | 3300046491 | Bacteria | 3782 |
| 540 | Ga0495584_0036022 | 3300046491 | Bacteria | 2500 |
| 541 | Ga0495585_0027616 | 3300046492 | Bacteria | 3239 |
| 542 | Ga0495594_0002035 | 3300046499 | Bacteria | 10525 |
| 543 | Ga0495594_0137115 | 3300046499 | Bacteria | 1387 |
| 544 | Ga0495596_0056530 | 3300046500 | Bacteria | 1532 |
| 545 | Ga0495607_0012073 | 3300046501 | Bacteria | 5715 |
| 546 | Ga0495583_0020205 | 3300046506 | Bacteria | 3457 |
| 547 | Ga0495606_0000252 | 3300046507 | Bacteria | 94511 |
| 548 | Ga0495606_0037168 | 3300046507 | Bacteria | 3308 |
| 549 | Ga0495606_0048505 | 3300046507 | Bacteria | 2792 |
| 550 | Ga0495606_0082443 | 3300046507 | Bacteria | 1996 |
| 551 | Ga0495606_0194800 | 3300046507 | Bacteria | 1159 |
| 552 | Ga0495608_0017766 | 3300046511 | Bacteria | 4918 |
| 553 | Ga0495610_0055708 | 3300046512 | Bacteria | 1904 |
| 554 | Ga0495616_0025586 | 3300046513 | Bacteria | 3151 |
| 555 | Ga0495616_0134523 | 3300046513 | Bacteria | 1130 |
| 556 | Ga0495618_0010884 | 3300046514 | Bacteria | 5507 |
| 557 | Ga0495620_0014398 | 3300046515 | Bacteria | 4020 |
| 558 | Ga0495628_0057540 | 3300046516 | Bacteria | 3058 |
| 559 | Ga0495628_0108009 | 3300046516 | Bacteria | 2142 |
| 560 | Ga0495628_0261808 | 3300046516 | Bacteria | 1289 |
| 561 | Ga0495628_0314815 | 3300046516 | Bacteria | 1156 |
| 562 | Ga0495630_0014946 | 3300046517 | Bacteria | 5661 |
| 563 | Ga0495631_0025195 | 3300046518 | Bacteria | 2741 |
| 564 | Ga0495631_0081283 | 3300046518 | Bacteria | 1398 |
| 565 | Ga0495637_0028566 | 3300046520 | Bacteria | 2490 |
| 566 | Ga0495643_0063715 | 3300046522 | Bacteria | 1949 |
| 567 | Ga0495644_0031813 | 3300046523 | Bacteria | 1994 |
| 568 | Ga0495648_0000286 | 3300046524 | Bacteria | 57430 |
| 569 | Ga0495648_0024325 | 3300046524 | Bacteria | 4127 |
| 570 | Ga0495648_0044368 | 3300046524 | Bacteria | 2776 |
| 571 | Ga0495648_0072499 | 3300046524 | Bacteria | 1992 |
| 572 | Ga0495648_0125545 | 3300046524 | Bacteria | 1372 |
| 573 | Ga0495666_0015987 | 3300046526 | Bacteria | 3737 |
| 574 | Ga0495666_0192723 | 3300046526 | Bacteria | 939 |
| 575 | Ga0495652_0011857 | 3300046529 | Bacteria | 7878 |
| 576 | Ga0495652_0034268 | 3300046529 | Bacteria | 4426 |
| 577 | Ga0495665_0000051 | 3300046531 | Bacteria | 46836 |
| 578 | Ga0495640_0007555 | 3300046533 | Bacteria | 8540 |
| 579 | Ga0495640_0018565 | 3300046533 | Bacteria | 5152 |
| 580 | Ga0495640_0074727 | 3300046533 | Bacteria | 2265 |
| 581 | Ga0495640_0112835 | 3300046533 | Bacteria | 1774 |
| 582 | Ga0495586_0047218 | 3300046535 | Bacteria | 2324 |
| 583 | Ga0495587_0008144 | 3300046536 | Bacteria | 6757 |
| 584 | Ga0495587_0029650 | 3300046536 | Bacteria | 3321 |
| 585 | Ga0495598_0005762 | 3300046537 | Bacteria | 2766 |
| 586 | Ga0495645_0021133 | 3300046543 | Bacteria | 4704 |
| 587 | Ga0495645_0102551 | 3300046543 | Bacteria | 2033 |
| 588 | Ga0495622_0015099 | 3300046557 | Bacteria | 3590 |
| 589 | Ga0495622_0021698 | 3300046557 | Bacteria | 2990 |
| 590 | Ga0495633_0006412 | 3300046558 | Bacteria | 6977 |
| 591 | Ga0495667_0004751 | 3300046559 | Bacteria | 9185 |
| 592 | Ga0495667_0006502 | 3300046559 | Bacteria | 7933 |
| 593 | Ga0495667_0033150 | 3300046559 | Bacteria | 3457 |
| 594 | Ga0495667_0175879 | 3300046559 | Bacteria | 1375 |
| 595 | Ga0495667_0188219 | 3300046559 | Bacteria | 1323 |
| 596 | Ga0495668_0029459 | 3300046616 | Bacteria | 3101 |
| 597 | Ga0495634_0000400 | 3300046642 | Bacteria | 42620 |
| 598 | Ga0495634_0021637 | 3300046642 | Bacteria | 4542 |
| 599 | Ga0495634_0044581 | 3300046642 | Bacteria | 3001 |
| 600 | Ga0495634_0076053 | 3300046642 | Bacteria | 2204 |
| 601 | Ga0495625_0017905 | 3300046660 | Bacteria | 5537 |
| 602 | Ga0495625_0104162 | 3300046660 | Bacteria | 1945 |
| 603 | Ga0495635_0000620 | 3300046663 | Bacteria | 22835 |
| 604 | Ga0495635_0002202 | 3300046663 | Bacteria | 13254 |
| 605 | Ga0495635_0004059 | 3300046663 | Bacteria | 10161 |
| 606 | Ga0495635_0043268 | 3300046663 | Bacteria | 3108 |
| 607 | Ga0495661_0019545 | 3300046665 | Bacteria | 4437 |
| 608 | Ga0495657_0006604 | 3300046675 | Bacteria | 9061 |
| 609 | Ga0495657_0013678 | 3300046675 | Bacteria | 5977 |
| 610 | Ga0495657_0030794 | 3300046675 | Bacteria | 3754 |
| 611 | Ga0495657_0042749 | 3300046675 | Bacteria | 3092 |
| 612 | Ga0495599_0009906 | 3300046678 | Bacteria | 5832 |
| 613 | Ga0495599_0069977 | 3300046678 | Bacteria | 2190 |
| 614 | Ga0495623_0012518 | 3300046679 | Bacteria | 5488 |
| 615 | Ga0495623_0037441 | 3300046679 | Bacteria | 3103 |
| 616 | Ga0495623_0213500 | 3300046679 | Bacteria | 1103 |
| 617 | Ga0495646_0000643 | 3300046680 | Bacteria | 19081 |
| 618 | Ga0495646_0043973 | 3300046680 | Bacteria | 2733 |
| 619 | Ga0495647_0002769 | 3300046681 | Bacteria | 5563 |
| 620 | Ga0495658_0000499 | 3300046683 | Bacteria | 21574 |
| 621 | Ga0495658_0114457 | 3300046683 | Bacteria | 1625 |
| 622 | Ga0495613_0008984 | 3300046689 | Bacteria | 7414 |
| 623 | Ga0495613_0025117 | 3300046689 | Bacteria | 4440 |
| 624 | Ga0495624_0003704 | 3300046690 | Bacteria | 11299 |
| 625 | Ga0495624_0021704 | 3300046690 | Bacteria | 4254 |
| 626 | Ga0495624_0096046 | 3300046690 | Bacteria | 1826 |
| 627 | Ga0495670_0001762 | 3300046691 | Bacteria | 10629 |
| 628 | Ga0495670_0125248 | 3300046691 | Bacteria | 1337 |
| 629 | Ga0495671_0161834 | 3300046692 | Bacteria | 1088 |
| 630 | Ga0495649_0012129 | 3300046694 | Bacteria | 5029 |
| 631 | Ga0495589_0051700 | 3300046794 | Bacteria | 2031 |
| 632 | Ga0495600_0011578 | 3300046809 | Bacteria | 5501 |
| 633 | Ga0495600_0013331 | 3300046809 | Bacteria | 5162 |
| 634 | Ga0495581_0000486 | 3300047315 | Bacteria | 20240 |
| 635 | Ga0495581_0061415 | 3300047315 | Bacteria | 2172 |
| 636 | Ga0495581_0114111 | 3300047315 | Bacteria | 1571 |
| 637 | Ga0495581_0115928 | 3300047315 | Bacteria | 1558 |
| 638 | Ga0495604_0010785 | 3300047317 | Bacteria | 7256 |
| 639 | Ga0495604_0023859 | 3300047317 | Bacteria | 4881 |
| 640 | Ga0495604_0031639 | 3300047317 | Bacteria | 4196 |
| 641 | Ga0495604_0145351 | 3300047317 | Bacteria | 1690 |
| 642 | Ga0495674_0005428 | 3300047319 | Bacteria | 12243 |
| 643 | Ga0495674_0023537 | 3300047319 | Bacteria | 5675 |
| 644 | Ga0495674_0131189 | 3300047319 | Bacteria | 2111 |
| 645 | Ga0495672_0022435 | 3300047320 | Bacteria | 4103 |
| 646 | Ga0495672_0066467 | 3300047320 | Bacteria | 2057 |
| 647 | Ga0495672_0081560 | 3300047320 | Bacteria | 1801 |
| 648 | Ga0495676_0061706 | 3300047321 | Bacteria | 2931 |
| 649 | Ga0495676_0087102 | 3300047321 | Bacteria | 2348 |
| 650 | Ga0495676_0108612 | 3300047321 | Bacteria | 2040 |
| 651 | Ga0495676_0114727 | 3300047321 | Bacteria | 1970 |
| 652 | Ga0495680_0000689 | 3300047322 | Bacteria | 37846 |
| 653 | Ga0495680_0001909 | 3300047322 | Bacteria | 21876 |
| 654 | Ga0495680_0040967 | 3300047322 | Bacteria | 3685 |
| 655 | Ga0495680_0099424 | 3300047322 | Bacteria | 2169 |
| 656 | Ga0495680_0231698 | 3300047322 | Bacteria | 1315 |
| 657 | Ga0495683_0044814 | 3300047323 | Bacteria | 2224 |
| 658 | Ga0495683_0073135 | 3300047323 | Bacteria | 1681 |
| 659 | Ga0495687_008047 | 3300047443 | Bacteria | 6093 |
| 660 | Ga0495675_0008329 | 3300047444 | Bacteria | 6418 |
| 661 | Ga0495675_0103236 | 3300047444 | Bacteria | 1782 |
| 662 | Ga0495681_0100394 | 3300047470 | Bacteria | 1266 |
| 663 | Ga0495684_0000313 | 3300047471 | Bacteria | 39705 |
| 664 | Ga0495684_0012322 | 3300047471 | Bacteria | 6595 |
| 665 | Ga0495684_0103192 | 3300047471 | Bacteria | 2155 |
| 666 | Ga0495684_0145236 | 3300047471 | Bacteria | 1777 |
| 667 | Ga0495684_0206990 | 3300047471 | Bacteria | 1444 |
| 668 | Ga0495686_0063919 | 3300047472 | Bacteria | 2279 |
| 669 | Ga0495593_0000005 | 3300047673 | Bacteria | 93984 |
| 670 | Ga0495593_0002672 | 3300047673 | Bacteria | 10727 |
| 671 | Ga0495593_0063063 | 3300047673 | Bacteria | 1936 |
| 672 | Ga0495602_0015257 | 3300048088 | Bacteria | 7760 |
| 673 | Ga0495602_0095535 | 3300048088 | Bacteria | 2453 |
| 674 | Ga0495602_0118872 | 3300048088 | Bacteria | 2130 |
| 675 | Ga0495614_0006832 | 3300048089 | Bacteria | 5104 |
| 676 | Ga0495626_0025505 | 3300048091 | Bacteria | 2890 |
| 677 | Ga0495626_0055731 | 3300048091 | Bacteria | 1811 |
| 678 | Ga0495626_0079507 | 3300048091 | Bacteria | 1459 |
| 679 | Ga0496100_0006321 | 3300048903 | Bacteria | 6455 |
| 680 | Ga0496100_0093302 | 3300048903 | Bacteria | 2059 |
| 681 | Ga0496100_0199871 | 3300048903 | Bacteria | 1456 |
| 682 | Ga0496100_0331609 | 3300048903 | Bacteria | 1145 |
| 683 | Ga0496101_0018505 | 3300048904 | Bacteria | 4738 |
| 684 | Ga0496101_0041241 | 3300048904 | Bacteria | 3291 |
| 685 | Ga0496101_0230209 | 3300048904 | Bacteria | 1440 |
| 686 | Ga0496101_0496314 | 3300048904 | Bacteria | 964 |
| 687 | Ga0496102_0001314 | 3300048905 | Bacteria | 22298 |
| 688 | Ga0496102_0009090 | 3300048905 | Bacteria | 8527 |
| 689 | Ga0496102_0542835 | 3300048905 | Bacteria | 1085 |
| 690 | Ga0496102_0554459 | 3300048905 | Bacteria | 1072 |
| 691 | Ga0496103_0025364 | 3300048906 | Bacteria | 3582 |
| 692 | Ga0496103_0047615 | 3300048906 | Bacteria | 2649 |
| 693 | Ga0496103_0250773 | 3300048906 | Bacteria | 1139 |
| 694 | Ga0496104_0002280 | 3300048907 | Bacteria | 16544 |
| 695 | Ga0496104_0003037 | 3300048907 | Bacteria | 14457 |
| 696 | Ga0496104_0007367 | 3300048907 | Bacteria | 9720 |
| 697 | Ga0496104_0018994 | 3300048907 | Bacteria | 6280 |
| 698 | Ga0496104_0030135 | 3300048907 | Bacteria | 5040 |
| 699 | Ga0496104_0159295 | 3300048907 | Bacteria | 2165 |
| 700 | Ga0496104_0272046 | 3300048907 | Bacteria | 1607 |
| 701 | Ga0496105_0000935 | 3300048908 | Bacteria | 19915 |
| 702 | Ga0496105_0003051 | 3300048908 | Bacteria | 12313 |
| 703 | Ga0496105_0027371 | 3300048908 | Bacteria | 4657 |
| 704 | Ga0496105_0040662 | 3300048908 | Bacteria | 3834 |
| 705 | Ga0496105_0126887 | 3300048908 | Bacteria | 2103 |
| 706 | Ga0496106_0000236 | 3300048909 | Bacteria | 38678 |
| 707 | Ga0496106_0014089 | 3300048909 | Bacteria | 5908 |
| 708 | Ga0496106_0060156 | 3300048909 | Bacteria | 2879 |
| 709 | Ga0496106_0126165 | 3300048909 | Bacteria | 2004 |
| 710 | Ga0496106_0264519 | 3300048909 | Bacteria | 1376 |
| 711 | Ga0496107_0003292 | 3300048910 | Bacteria | 10781 |
| 712 | Ga0496107_0091750 | 3300048910 | Bacteria | 2220 |
| 713 | Ga0496107_0110889 | 3300048910 | Bacteria | 2016 |
| 714 | Ga0496107_0130670 | 3300048910 | Bacteria | 1854 |
| 715 | Ga0496107_0152209 | 3300048910 | Bacteria | 1711 |
| 716 | Ga0496107_0171489 | 3300048910 | Bacteria | 1610 |
| 717 | Ga0496107_0239906 | 3300048910 | Bacteria | 1349 |
| 718 | Ga0496107_0244377 | 3300048910 | Bacteria | 1335 |
| 719 | Ga0496107_0265433 | 3300048910 | Bacteria | 1277 |
| 720 | Ga0496108_0000849 | 3300048911 | Bacteria | 23796 |
| 721 | Ga0496108_0016993 | 3300048911 | Bacteria | 5947 |
| 722 | Ga0496108_0047577 | 3300048911 | Bacteria | 3585 |
| 723 | Ga0496108_0053230 | 3300048911 | Bacteria | 3394 |
| 724 | Ga0496108_0304768 | 3300048911 | Bacteria | 1388 |
| 725 | Ga0496108_0360185 | 3300048911 | Bacteria | 1269 |
| 726 | Ga0496108_0372747 | 3300048911 | Bacteria | 1246 |
| 727 | Ga0496109_0000224 | 3300048912 | Bacteria | 55854 |
| 728 | Ga0496109_0010749 | 3300048912 | Bacteria | 7835 |
| 729 | Ga0496109_0073871 | 3300048912 | Bacteria | 3134 |
| 730 | Ga0496109_0148771 | 3300048912 | Bacteria | 2192 |
| 731 | Ga0496110_0004203 | 3300048913 | Bacteria | 11133 |
| 732 | Ga0496110_0008119 | 3300048913 | Bacteria | 8433 |
| 733 | Ga0496110_0027437 | 3300048913 | Bacteria | 4882 |
| 734 | Ga0496110_0056327 | 3300048913 | Bacteria | 3459 |
| 735 | Ga0496110_0132154 | 3300048913 | Bacteria | 2254 |
| 736 | Ga0496110_0151081 | 3300048913 | Bacteria | 2103 |
| 737 | Ga0496110_0197580 | 3300048913 | Bacteria | 1827 |
| 738 | Ga0496111_0008238 | 3300048914 | Bacteria | 6892 |
| 739 | Ga0496111_0010213 | 3300048914 | Bacteria | 6290 |
| 740 | Ga0496111_0043391 | 3300048914 | Bacteria | 3232 |
| 741 | Ga0496111_0057197 | 3300048914 | Bacteria | 2823 |
| 742 | Ga0496111_0196353 | 3300048914 | Bacteria | 1500 |
| 743 | Ga0496111_0352694 | 3300048914 | Bacteria | 1089 |
| 744 | Ga0496112_0000020 | 3300048915 | Bacteria | 169373 |
| 745 | Ga0496112_0001044 | 3300048915 | Bacteria | 20400 |
| 746 | Ga0496112_0014481 | 3300048915 | Bacteria | 7321 |
| 747 | Ga0496112_0032339 | 3300048915 | Bacteria | 5079 |
| 748 | Ga0496112_0036502 | 3300048915 | Bacteria | 4795 |
| 749 | Ga0496112_0128611 | 3300048915 | Bacteria | 2503 |
| 750 | Ga0496112_0218018 | 3300048915 | Bacteria | 1865 |
| 751 | Ga0496112_0462284 | 3300048915 | Bacteria | 1206 |
| 752 | Ga0496113_0006740 | 3300048916 | Bacteria | 7319 |
| 753 | Ga0496113_0037992 | 3300048916 | Bacteria | 3537 |
| 754 | Ga0496113_0043787 | 3300048916 | Bacteria | 3314 |
| 755 | Ga0496113_0051297 | 3300048916 | Bacteria | 3078 |
| 756 | Ga0496113_0059445 | 3300048916 | Bacteria | 2879 |
| 757 | Ga0496113_0076548 | 3300048916 | Bacteria | 2556 |
| 758 | Ga0496114_0009847 | 3300048917 | Bacteria | 7598 |
| 759 | Ga0496114_0079878 | 3300048917 | Bacteria | 2762 |
| 760 | Ga0496114_0306210 | 3300048917 | Bacteria | 1403 |
| 761 | Ga0496115_0023846 | 3300048918 | Bacteria | 4751 |
| 762 | Ga0496115_0029319 | 3300048918 | Bacteria | 4321 |
| 763 | Ga0496115_0087123 | 3300048918 | Bacteria | 2548 |
| 764 | Ga0496115_0087298 | 3300048918 | Bacteria | 2545 |
| 765 | Ga0496115_0100082 | 3300048918 | Bacteria | 2376 |
| 766 | Ga0496115_0140952 | 3300048918 | Bacteria | 1989 |
| 767 | Ga0496115_0286279 | 3300048918 | Bacteria | 1352 |
| 768 | Ga0496115_0372611 | 3300048918 | Bacteria | 1162 |
| 769 | Ga0496117_0021089 | 3300048920 | Bacteria | 5288 |
| 770 | Ga0496117_0036072 | 3300048920 | Bacteria | 3704 |
| 771 | Ga0496117_0120237 | 3300048920 | Bacteria | 1615 |
| 772 | Ga0496117_0153817 | 3300048920 | Bacteria | 1357 |
| 773 | Ga0496118_0003026 | 3300048921 | Bacteria | 21707 |
| 774 | Ga0496118_0027995 | 3300048921 | Bacteria | 4757 |
| 775 | Ga0496118_0048029 | 3300048921 | Bacteria | 3302 |
| 776 | Ga0496118_0064926 | 3300048921 | Bacteria | 2674 |
| 777 | Ga0496118_0090666 | 3300048921 | Bacteria | 2105 |
| 778 | Ga0496118_0154936 | 3300048921 | Bacteria | 1427 |
| 779 | Ga0496119_0006376 | 3300048922 | Bacteria | 10964 |
| 780 | Ga0496119_0038888 | 3300048922 | Bacteria | 3066 |
| 781 | Ga0496119_0072987 | 3300048922 | Bacteria | 2003 |
| 782 | Ga0496121_0000203 | 3300048924 | Bacteria | 130984 |
| 783 | Ga0496121_0000270 | 3300048924 | Bacteria | 108787 |
| 784 | Ga0496121_0001251 | 3300048924 | Bacteria | 44033 |
| 785 | Ga0496121_0002323 | 3300048924 | Bacteria | 29460 |
| 786 | Ga0496121_0015121 | 3300048924 | Bacteria | 8119 |
| 787 | Ga0496121_0042502 | 3300048924 | Bacteria | 3951 |
| 788 | Ga0496121_0045389 | 3300048924 | Bacteria | 3777 |
| 789 | Ga0496121_0130068 | 3300048924 | Bacteria | 1886 |
| 790 | Ga0496121_0133412 | 3300048924 | Bacteria | 1854 |
| 791 | Ga0496121_0171645 | 3300048924 | Bacteria | 1574 |
| 792 | Ga0496121_0267653 | 3300048924 | Bacteria | 1176 |
| 793 | Ga0496122_0032788 | 3300048925 | Bacteria | 4287 |
| 794 | Ga0496122_0052331 | 3300048925 | Bacteria | 3092 |
| 795 | Ga0496123_0010648 | 3300048926 | Bacteria | 8093 |
| 796 | Ga0496123_0101514 | 3300048926 | Bacteria | 1672 |
| 797 | Ga0496124_0011952 | 3300048927 | Bacteria | 8637 |
| 798 | Ga0496124_0048269 | 3300048927 | Bacteria | 3639 |
| 799 | Ga0496124_0070552 | 3300048927 | Bacteria | 2898 |
| 800 | Ga0496124_0114620 | 3300048927 | Bacteria | 2164 |
| 801 | Ga0496125_0000328 | 3300048928 | Bacteria | 91806 |
| 802 | Ga0496125_0000407 | 3300048928 | Bacteria | 80570 |
| 803 | Ga0496125_0003549 | 3300048928 | Bacteria | 18787 |
| 804 | Ga0496125_0024628 | 3300048928 | Bacteria | 5529 |
| 805 | Ga0496125_0043717 | 3300048928 | Bacteria | 3797 |
| 806 | Ga0496125_0059052 | 3300048928 | Bacteria | 3093 |
| 807 | Ga0496125_0070315 | 3300048928 | Bacteria | 2741 |
| 808 | Ga0496125_0087175 | 3300048928 | Bacteria | 2358 |
| 809 | Ga0496126_0010158 | 3300048929 | Bacteria | 9910 |
| 810 | Ga0496126_0016646 | 3300048929 | Bacteria | 7347 |
| 811 | Ga0496126_0025084 | 3300048929 | Bacteria | 5744 |
| 812 | Ga0496126_0027806 | 3300048929 | Bacteria | 5395 |
| 813 | Ga0496126_0035866 | 3300048929 | Bacteria | 4642 |
| 814 | Ga0496126_0065855 | 3300048929 | Bacteria | 3240 |
| 815 | Ga0496126_0086523 | 3300048929 | Bacteria | 2762 |
| 816 | Ga0496126_0088126 | 3300048929 | Bacteria | 2735 |
| 817 | Ga0496126_0142503 | 3300048929 | Bacteria | 2061 |
| 818 | Ga0496126_0174331 | 3300048929 | Bacteria | 1830 |
| 819 | Ga0496126_0208070 | 3300048929 | Bacteria | 1648 |
| 820 | Ga0496126_0286373 | 3300048929 | Bacteria | 1363 |
| 821 | Ga0495682_0011296 | 3300049460 | Bacteria | 3437 |
| 822 | Ga0495682_0055980 | 3300049460 | Bacteria | 1430 |
| 823 | Ga0501031_0012366 | 3300049568 | Bacteria | 5566 |
| 824 | Ga0501031_0142806 | 3300049568 | Bacteria | 1565 |
| 825 | Ga0501032_0000475 | 3300049569 | Bacteria | 32423 |
| 826 | Ga0501032_0042704 | 3300049569 | Bacteria | 3074 |
| 827 | Ga0501033_0000440 | 3300049570 | Bacteria | 39822 |
| 828 | Ga0501033_0001499 | 3300049570 | Bacteria | 20673 |
| 829 | Ga0501033_0012762 | 3300049570 | Bacteria | 6406 |
| 830 | Ga0501033_0117807 | 3300049570 | Bacteria | 1929 |
| 831 | Ga0501033_0119051 | 3300049570 | Bacteria | 1917 |
| 832 | Ga0501033_0345629 | 3300049570 | Bacteria | 1042 |
| 833 | Ga0501034_0000250 | 3300049571 | Bacteria | 99407 |
| 834 | Ga0501034_0028177 | 3300049571 | Bacteria | 5714 |
| 835 | Ga0501036_0000098 | 3300049572 | Bacteria | 54252 |
| 836 | Ga0501036_0044460 | 3300049572 | Bacteria | 3762 |
| 837 | Ga0501036_0061519 | 3300049572 | Bacteria | 3180 |
| 838 | Ga0501036_0115578 | 3300049572 | Bacteria | 2266 |
| 839 | Ga0501036_0150293 | 3300049572 | Bacteria | 1964 |
| 840 | Ga0501037_0000092 | 3300049573 | Bacteria | 83924 |
| 841 | Ga0501037_0016024 | 3300049573 | Bacteria | 5515 |
| 842 | Ga0501037_0105558 | 3300049573 | Bacteria | 2030 |
| 843 | Ga0501037_0106892 | 3300049573 | Bacteria | 2016 |
| 844 | Ga0501038_0000059 | 3300049574 | Bacteria | 92319 |
| 845 | Ga0501038_0000626 | 3300049574 | Bacteria | 31388 |
| 846 | Ga0501038_0042710 | 3300049574 | Bacteria | 3947 |
| 847 | Ga0501038_0199908 | 3300049574 | Bacteria | 1604 |
| 848 | Ga0501039_0000085 | 3300049575 | Bacteria | 70306 |
| 849 | Ga0501039_0021665 | 3300049575 | Bacteria | 4930 |
| 850 | Ga0501039_0137111 | 3300049575 | Bacteria | 1921 |
| 851 | Ga0501039_0142154 | 3300049575 | Bacteria | 1885 |
| 852 | Ga0501042_0035371 | 3300049578 | Bacteria | 3543 |
| 853 | Ga0501042_0060507 | 3300049578 | Bacteria | 2705 |
| 854 | Ga0501043_0011678 | 3300049579 | Bacteria | 6875 |
| 855 | Ga0501043_0289790 | 3300049579 | Bacteria | 1253 |
| 856 | Ga0501043_0313691 | 3300049579 | Bacteria | 1196 |
| 857 | Ga0501046_0000483 | 3300049580 | Bacteria | 39806 |
| 858 | Ga0501046_0013048 | 3300049580 | Bacteria | 7052 |
| 859 | Ga0501046_0028766 | 3300049580 | Bacteria | 4523 |
| 860 | Ga0501046_0050241 | 3300049580 | Bacteria | 3295 |
| 861 | Ga0501046_0235227 | 3300049580 | Bacteria | 1352 |
| 862 | Ga0501047_0000022 | 3300049581 | Bacteria | 249062 |
| 863 | Ga0501047_0010976 | 3300049581 | Bacteria | 8572 |
| 864 | Ga0501047_0020141 | 3300049581 | Bacteria | 6404 |
| 865 | Ga0501047_0142285 | 3300049581 | Bacteria | 2276 |
| 866 | Ga0501047_0244182 | 3300049581 | Bacteria | 1645 |
| 867 | Ga0501047_0428330 | 3300049581 | Bacteria | 1154 |
| 868 | Ga0501048_0002266 | 3300049582 | Bacteria | 14670 |
| 869 | Ga0501067_0000599 | 3300049583 | Bacteria | 19412 |
| 870 | Ga0501067_0114243 | 3300049583 | Bacteria | 1501 |
| 871 | Ga0501068_0004667 | 3300049584 | Bacteria | 7459 |
| 872 | Ga0501068_0056869 | 3300049584 | Bacteria | 2371 |
| 873 | Ga0501068_0065838 | 3300049584 | Bacteria | 2206 |
| 874 | Ga0501069_0055162 | 3300049585 | Bacteria | 2213 |
| 875 | Ga0501070_0006653 | 3300049586 | Bacteria | 9842 |
| 876 | Ga0501070_0062656 | 3300049586 | Bacteria | 3080 |
| 877 | Ga0501070_0180468 | 3300049586 | Bacteria | 1737 |
| 878 | Ga0501071_0039494 | 3300049587 | Bacteria | 3377 |
| 879 | Ga0501071_0073681 | 3300049587 | Bacteria | 2491 |
| 880 | Ga0501072_0001923 | 3300049588 | Bacteria | 15457 |
| 881 | Ga0501072_0226059 | 3300049588 | Bacteria | 1491 |
| 882 | Ga0501073_0000109 | 3300049589 | Bacteria | 53094 |
| 883 | Ga0501073_0056097 | 3300049589 | Bacteria | 2756 |
| 884 | Ga0501073_0104808 | 3300049589 | Bacteria | 1962 |
| 885 | Ga0501074_0036614 | 3300049590 | Bacteria | 3554 |
| 886 | Ga0501074_0100957 | 3300049590 | Bacteria | 2065 |
| 887 | Ga0501076_0021057 | 3300049592 | Bacteria | 4997 |
| 888 | Ga0501077_0060991 | 3300049593 | Bacteria | 2393 |
| 889 | Ga0501079_0002132 | 3300049741 | Bacteria | 14228 |
| 890 | Ga0501079_0091330 | 3300049741 | Bacteria | 2359 |
| 891 | Ga0501080_0005186 | 3300049742 | Bacteria | 11611 |
| 892 | Ga0501080_0031118 | 3300049742 | Bacteria | 4972 |
| 893 | Ga0501080_0181287 | 3300049742 | Bacteria | 1937 |
| 894 | Ga0501080_0186541 | 3300049742 | Bacteria | 1907 |
| 895 | Ga0501083_0001424 | 3300049744 | Bacteria | 16301 |
| 896 | Ga0501035_0001471 | 3300049822 | Bacteria | 24145 |
| 897 | Ga0501035_0035988 | 3300049822 | Bacteria | 4490 |
| 898 | Ga0501035_0082774 | 3300049822 | Bacteria | 2832 |
| 899 | Ga0501044_0000072 | 3300049823 | Bacteria | 124143 |
| 900 | Ga0501044_0001765 | 3300049823 | Bacteria | 25275 |
| 901 | Ga0501044_0009154 | 3300049823 | Bacteria | 10815 |
| 902 | Ga0501044_0547336 | 3300049823 | Bacteria | 1055 |
| 903 | Ga0501045_0370770 | 3300049824 | Bacteria | 1065 |
| 904 | nmdc:mga03n38_4895_c1 | 3300050490 | Bacteria | 4491 |
| 905 | nmdc:mga00v17_162020_c1 | 3300050491 | Bacteria | 1440 |
| 906 | nmdc:mga00v17_55279_c1 | 3300050491 | Bacteria | 2424 |
| 907 | nmdc:mga0yw44_208929_c1 | 3300050492 | Bacteria | 1291 |
| 908 | nmdc:mga0yw44_47348_c1 | 3300050492 | Bacteria | 2588 |
| 909 | nmdc:mga0yw44_83620_c1 | 3300050492 | Bacteria | 2005 |
| 910 | nmdc:mga0k408_58486_c1 | 3300050493 | Bacteria | 2239 |
| 911 | nmdc:mga06z11_120949_c1 | 3300050494 | Bacteria | 1461 |
| 912 | nmdc:mga06z11_255013_c1 | 3300050494 | Bacteria | 1034 |
| 913 | nmdc:mga04h51_4727_c1 | 3300050495 | Bacteria | 3414 |
| 914 | nmdc:mga07m45_112215_c1 | 3300050496 | Bacteria | 1571 |
| 915 | nmdc:mga07m45_113485_c1 | 3300050496 | Bacteria | 1562 |
| 916 | nmdc:mga07m45_226957_c1 | 3300050496 | Bacteria | 1087 |
| 917 | nmdc:mga09592_221455_c1 | 3300050508 | Bacteria | 1639 |
| 918 | nmdc:mga06r32_33397_c1 | 3300050510 | Bacteria | 4845 |
| 919 | nmdc:mga0rr50_314731_c1 | 3300050513 | Bacteria | 1311 |
| 920 | nmdc:mga0a205_223274_c1 | 3300050515 | Bacteria | 1769 |
| 921 | nmdc:mga0sz30_40195_c1 | 3300050516 | Bacteria | 1966 |
| 922 | Ga0495601_0049218 | 3300053077 | Bacteria | 2657 |
| 923 | Ga0495601_0086261 | 3300053077 | Bacteria | 2017 |
| 924 | Ga0495601_0233021 | 3300053077 | Bacteria | 1202 |
| 925 | Ga0500635_0048938 | 3300053080 | Bacteria | 1441 |
| 926 | Ga0500635_0055968 | 3300053080 | Bacteria | 1363 |
| 927 | Ga0495655_0003764 | 3300053083 | Bacteria | 2534 |
| 928 | Ga0495655_0012771 | 3300053083 | Bacteria | 1720 |
| 929 | Ga0495595_0000445 | 3300053084 | Bacteria | 15683 |
| 930 | Ga0495595_0005883 | 3300053084 | Bacteria | 4973 |
| 931 | Ga0495619_0000330 | 3300053085 | Bacteria | 33168 |
| 932 | Ga0500578_0079113 | 3300053086 | Bacteria | 2092 |
| 933 | Ga0500578_0118280 | 3300053086 | Bacteria | 1667 |
| 934 | Ga0500643_000063 | 3300053087 | Bacteria | 122135 |
| 935 | Ga0500643_034093 | 3300053087 | Bacteria | 1535 |
| 936 | Ga0500646_0000839 | 3300053090 | Bacteria | 8510 |
| 937 | Ga0500651_0006769 | 3300053093 | Bacteria | 6639 |
| 938 | Ga0500651_0006892 | 3300053093 | Bacteria | 6586 |
| 939 | Ga0500651_0194034 | 3300053093 | Bacteria | 1201 |
| 940 | Ga0500566_0000247 | 3300053094 | Bacteria | 28953 |
| 941 | Ga0500566_0003076 | 3300053094 | Bacteria | 9969 |
| 942 | Ga0500566_0005190 | 3300053094 | Bacteria | 7755 |
| 943 | Ga0500566_0202460 | 3300053094 | Bacteria | 1001 |
| 944 | Ga0500640_068405 | 3300053095 | Bacteria | 1527 |
| 945 | Ga0500641_0035557 | 3300053096 | Bacteria | 1988 |
| 946 | Ga0500554_003943 | 3300053102 | Bacteria | 3090 |
| 947 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 948 | Ga0500557_000037 | 3300053105 | Bacteria | 71114 |
| 949 | Ga0500569_001553 | 3300053109 | Bacteria | 4357 |
| 950 | Ga0500569_002673 | 3300053109 | Bacteria | 3551 |
| 951 | Ga0500572_000191 | 3300053111 | Bacteria | 21667 |
| 952 | Ga0500572_019537 | 3300053111 | Bacteria | 1770 |
| 953 | Ga0500593_065397 | 3300053117 | Bacteria | 1590 |
| 954 | Ga0500595_002654 | 3300053119 | Bacteria | 8699 |
| 955 | Ga0500595_014785 | 3300053119 | Bacteria | 2950 |
| 956 | Ga0500607_020092 | 3300053121 | Bacteria | 3774 |
| 957 | Ga0500608_000959 | 3300053122 | Bacteria | 10339 |
| 958 | Ga0500608_051127 | 3300053122 | Bacteria | 1985 |
| 959 | Ga0500614_019160 | 3300053123 | Bacteria | 1565 |
| 960 | Ga0500618_004575 | 3300053125 | Bacteria | 4370 |
| 961 | Ga0500618_017251 | 3300053125 | Bacteria | 1798 |
| 962 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 963 | Ga0500642_0000062 | 3300053130 | Bacteria | 58970 |
| 964 | Ga0500642_0011321 | 3300053130 | Bacteria | 3185 |
| 965 | Ga0500642_0048371 | 3300053130 | Bacteria | 1867 |
| 966 | Ga0500652_000555 | 3300053131 | Bacteria | 13010 |
| 967 | Ga0500658_0074733 | 3300053134 | Bacteria | 1437 |
| 968 | Ga0500658_0075077 | 3300053134 | Bacteria | 1434 |
| 969 | Ga0500559_0000179 | 3300053136 | Bacteria | 50232 |
| 970 | Ga0500559_0000398 | 3300053136 | Bacteria | 31511 |
| 971 | Ga0500559_0042227 | 3300053136 | Bacteria | 1989 |
| 972 | Ga0500559_0139060 | 3300053136 | Bacteria | 1136 |
| 973 | Ga0500564_110823 | 3300053138 | Bacteria | 1204 |
| 974 | Ga0500568_0000790 | 3300053139 | Bacteria | 22337 |
| 975 | Ga0500573_0232028 | 3300053140 | Bacteria | 961 |
| 976 | Ga0500577_0000399 | 3300053142 | Bacteria | 11105 |
| 977 | Ga0500586_007140 | 3300053145 | Bacteria | 2960 |
| 978 | Ga0500588_0031491 | 3300053146 | Bacteria | 1531 |
| 979 | Ga0500603_001290 | 3300053150 | Bacteria | 5756 |
| 980 | Ga0500603_007487 | 3300053150 | Bacteria | 2398 |
| 981 | Ga0500604_0001375 | 3300053151 | Bacteria | 6785 |
| 982 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 983 | Ga0500616_0018659 | 3300053153 | Bacteria | 3919 |
| 984 | Ga0500620_001178 | 3300053155 | Bacteria | 4665 |
| 985 | Ga0500622_0015984 | 3300053156 | Bacteria | 4015 |
| 986 | Ga0500622_0026331 | 3300053156 | Bacteria | 3071 |
| 987 | Ga0500622_0044474 | 3300053156 | Bacteria | 2301 |
| 988 | Ga0500630_065807 | 3300053159 | Bacteria | 1724 |
| 989 | Ga0500639_013853 | 3300053163 | Bacteria | 4239 |
| 990 | Ga0500639_022758 | 3300053163 | Bacteria | 3311 |
| 991 | Ga0500636_0000349 | 3300053177 | Bacteria | 25486 |
| 992 | Ga0500636_0060283 | 3300053177 | Bacteria | 2216 |
| 993 | Ga0500637_0017723 | 3300053178 | Bacteria | 3817 |
| 994 | Ga0500637_0215510 | 3300053178 | Bacteria | 1087 |
| 995 | Ga0500570_018767 | 3300053724 | Bacteria | 3871 |
| 996 | Ga0500625_024838 | 3300053729 | Bacteria | 2832 |
| 997 | Ga0500596_004482 | 3300053735 | Bacteria | 2554 |
| 998 | Ga0500596_007212 | 3300053735 | Bacteria | 1833 |
| 999 | Ga0500601_000064 | 3300053737 | Bacteria | 22081 |
| 1000 | Ga0501084_0185546 | 3300054114 | Bacteria | 1755 |
| 1001 | Ga0500661_021525 | 3300055283 | Bacteria | 1144 |
| 1002 | Ga0501082_0000028 | 3300060353 | Bacteria | 100580 |
| 1003 | Ga0501082_0144134 | 3300060353 | Bacteria | 2067 |
| 1004 | 2507505246 | 2507262055 | Bacteria | 8048963 |
| 1005 | 2508539167 | 2508501009 | Bacteria | 7784016 |
| 1006 | 2508695485 | 2508501042 | Bacteria | 8719808 |
| 1007 | 2509152633 | 2508501128 | Bacteria | 8613869 |
| 1008 | 2511400222 | 2511231028 | Bacteria | 8046582 |
| 1009 | 2513625345 | 2513237092 | Bacteria | 8341956 |
| 1010 | 2513644164 | 2513237094 | Bacteria | 8789602 |
| 1011 | 2513651516 | 2513237095 | Bacteria | 8976980 |
| 1012 | 2513658813 | 2513237096 | Bacteria | 8722461 |
| 1013 | 2513674587 | 2513237098 | Bacteria | 9902361 |
| 1014 | 2513695111 | 2513237101 | Bacteria | 7952346 |
| 1015 | 2513705241 | 2513237102 | Bacteria | 7703324 |
| 1016 | 2513720304 | 2513237104 | Bacteria | 10034502 |
| 1017 | 2513860820 | 2513237137 | Bacteria | 9558895 |
| 1018 | 2513873528 | 2513237139 | Bacteria | 8737671 |
| 1019 | 2513888766 | 2513237141 | Bacteria | 8496279 |
| 1020 | 2513921077 | 2513237145 | Bacteria | 8979722 |
| 1021 | 2514012485 | 2513237161 | Bacteria | 8871253 |
| 1022 | 2515627442 | 2515154112 | Bacteria | 8294334 |
| 1023 | 2517107711 | 2517093001 | Bacteria | 9002274 |
| 1024 | 2517888842 | 2517572143 | Bacteria | 9484767 |
| 1025 | 2524440890 | 2524023205 | Bacteria | 8918781 |
| 1026 | 2524467848 | 2524023210 | Bacteria | 9029266 |
| 1027 | 2524537054 | 2524023228 | Bacteria | 10118060 |
| 1028 | 2528852938 | 2528768022 | Bacteria | 10457665 |
| 1029 | 2603858527 | 2602042107 | Bacteria | 6226103 |
| 1030 | 2617352398 | 2617270735 | Bacteria | 9163226 |
| 1031 | 2617373761 | 2617270741 | Bacteria | 8201522 |
| 1032 | 2644290946 | 2643221651 | Bacteria | 4798932 |
| 1033 | 2671119944 | 2667528175 | Bacteria | 7532676 |
| 1034 | 2723841642 | 2721755755 | Bacteria | 8322773 |
| 1035 | 2728754989 | 2728368998 | Bacteria | 8720350 |
| 1036 | 2745081688 | 2744054633 | Bacteria | 8678936 |
| 1037 | 2793062042 | 2791355196 | Bacteria | 7323613 |
| 1038 | 2793072930 | 2791355197 | Bacteria | 8420563 |
| 1039 | 2793082750 | |||
| 1040 | 2805915612 | 2802429603 | Bacteria | 8777136 |
| 1041 | 2818237649 | 2816332527 | Bacteria | 8933356 |
| 1042 | 2824604584 | 2824600985 | Bacteria | 8488197 |
| 1043 | 2824612325 | 2824609381 | Bacteria | 8672835 |
| 1044 | 2824624500 | 2824617872 | Bacteria | 8814715 |
| 1045 | 2824633415 | 2824626560 | Bacteria | 8813858 |
| 1046 | 2824640288 | 2824635225 | Bacteria | 8785348 |
| 1047 | 2824647278 | 2824644064 | Bacteria | 8743947 |
| 1048 | 2824655190 | 2824653114 | Bacteria | 8493680 |
| 1049 | 2824667559 | 2824661429 | Bacteria | 9877870 |
| 1050 | 2824676625 | 2824671348 | Bacteria | 8369588 |
| 1051 | 2824684230 | 2824679649 | Bacteria | 8248951 |
| 1052 | 2824694701 | 2824687955 | Bacteria | 8360029 |
| 1053 | 2824704127 | 2824696289 | Bacteria | 8335049 |
| 1054 | 2824708929 | 2824704595 | Bacteria | 9667483 |
| 1055 | 2824717406 | 2824714736 | Bacteria | 8717648 |
| 1056 | 2824727631 | 2824723954 | Bacteria | 8758240 |
| 1057 | 2824737795 | 2824732956 | Bacteria | 7810675 |
| 1058 | 2824752227 | 2824746037 | Bacteria | 7911610 |
| 1059 | 2824759956 | 2824753945 | Bacteria | 9787441 |
| 1060 | 2824770390 | 2824763712 | Bacteria | 9792355 |
| 1061 | 2824775522 | 2824773399 | Bacteria | 8360218 |
| 1062 | 2838124513 | 2838122688 | Bacteria | 8803140 |
| 1063 | 2841945200 | 2841941048 | Bacteria | 8688029 |
| 1064 | 2841951981 | 2841949485 | Bacteria | 8680857 |
| 1065 | 2841965434 | 2841957949 | Bacteria | 8652217 |
| 1066 | 2841970623 | 2841966195 | Bacteria | 8673214 |
| 1067 | 2841979972 | 2841974524 | Bacteria | 8931498 |
| 1068 | 2841985152 | 2841983080 | Bacteria | 8395090 |
| 1069 | 2842043509 | 2842038055 | Bacteria | 8002051 |
| 1070 | 2842052501 | 2842045827 | Bacteria | 8006841 |
| 1071 | 2844315336 | 2844315083 | Bacteria | 8138177 |
| 1072 | 2847931073 | 2847930680 | Bacteria | 9342022 |
| 1073 | 2847942155 | 2847939898 | Bacteria | 8606328 |
| 1074 | 2849083035 | 2849076700 | Bacteria | 7039503 |
| 1075 | 2857511925 | 2857509624 | Bacteria | 7472071 |
| 1076 | 2857526351 | 2857524615 | Bacteria | 6615449 |
| 1077 | 2874594445 | 2874590934 | Bacteria | 8299676 |
| 1078 | 2874608064 | 2874604998 | Bacteria | 7834745 |
| 1079 | 2874613436 | 2874612657 | Bacteria | 8252029 |
| 1080 | 2874624782 | 2874620515 | Bacteria | 8290088 |
| 1081 | 2874628795 | 2874628541 | Bacteria | 8630250 |
| 1082 | 2874649818 | 2874645413 | Bacteria | 8214782 |
| 1083 | 2876768927 | 2876761206 | Bacteria | 10111113 |
| 1084 | 2876773937 | 2876771140 | Bacteria | 8287509 |
| 1085 | 2876821817 | 2876818435 | Bacteria | 8274608 |
| 1086 | 2879078339 | 2879074833 | Bacteria | 8279565 |
| 1087 | 2879085907 | 2879083081 | Bacteria | 8587928 |
| 1088 | 2879106022 | 2879099564 | Bacteria | 10442239 |
| 1089 | 2879112171 | 2879110137 | Bacteria | 8907982 |
| 1090 | 2879130600 | 2879127579 | Bacteria | 8294491 |
| 1091 | 2879147123 | 2879142872 | Bacteria | 8267021 |
| 1092 | 2881365317 | 2881364244 | Bacteria | 7710352 |
| 1093 | 2881668185 | 2881665667 | Bacteria | 8175609 |
| 1094 | 2885371028 | 2885366525 | Bacteria | 8326213 |
| 1095 | 2885382850 | 2885374607 | Bacteria | 8927485 |
| 1096 | 2885388844 | 2885383462 | Bacteria | 9473874 |
| 1097 | 2885411662 | 2885409591 | Bacteria | 9235467 |
| 1098 | 2888379593 | 2888378607 | Bacteria | 9652610 |
| 1099 | 2888390681 | 2888388044 | Bacteria | 7304136 |
| 1100 | 2888420306 | 2888419890 | Bacteria | 7857137 |
| 1101 | 2889035490 | 2889033259 | Bacteria | 9099371 |
| 1102 | 2893067378 | 2893066018 | Bacteria | 6158120 |
| 1103 | 2903732197 | 2903727486 | Bacteria | 8281579 |
| 1104 | 2903748955 | 2903748898 | Bacteria | 9972761 |
| 1105 | 2903770760 | 2903768456 | Bacteria | 9749579 |
| 1106 | 2904670263 | 2904666416 | Bacteria | 8226587 |
| 1107 | 2904708824 | |||
| 1108 | 2904713178 | 2904711408 | Bacteria | 9771557 |
| 1109 | 2906604274 | 2906602504 | Bacteria | 8295279 |
| 1110 | 2906613874 | |||
| 1111 | 2906628957 | 2906626472 | Bacteria | 8826946 |
| 1112 | 2906642332 | 2906635258 | Bacteria | 8601019 |
| 1113 | 2906648178 | 2906643746 | Bacteria | 8722424 |
| 1114 | 2906667360 | 2906660503 | Bacteria | 8595048 |
| 1115 | 2908747444 | 2908739725 | Bacteria | 8628932 |
| 1116 | 2908756587 | 2908756301 | Bacteria | 8864324 |
| 1117 | 2908776277 | 2908775508 | Bacteria | 8092255 |
| 1118 | 2919073802 | 2919073203 | Bacteria | 6531949 |
| 1119 | 2922364000 | 2922361189 | Bacteria | 7436256 |
| 1120 | 2922368936 | |||
| 1121 | 2922392566 | 2922386360 | Bacteria | 7017218 |
| 1122 | 2922394239 | 2922393267 | Bacteria | 8285685 |
| 1123 | 2929618601 | 2929615660 | Bacteria | 9193770 |
| 1124 | 2929628714 | 2929624759 | Bacteria | 9339455 |
| 1125 | 2932792923 | 2932784394 | Bacteria | 9704911 |
| 1126 | 2932794317 | 2932794094 | Bacteria | 7915132 |
| 1127 | 2932808089 | 2932801729 | Bacteria | 7987968 |
| 1128 | 2932812165 | 2932809354 | Bacteria | 9135765 |
| 1129 | 2932823155 | 2932818245 | Bacteria | 9955613 |
| 1130 | 2932836072 | 2932828146 | Bacteria | 9745859 |
| 1131 | 2933580687 | 2933577622 | Bacteria | 9116884 |
| 1132 | 2935615725 | 2935608549 | Bacteria | 8203142 |
| 1133 | 2935618521 | 2935616580 | Bacteria | 9032984 |
| 1134 | 2935641078 | 2935638405 | Bacteria | 10015038 |
| 1135 | 2935653641 | 2935648319 | Bacteria | 8801166 |
| 1136 | 2935662390 | 2935656913 | Bacteria | 8965014 |
| 1137 | 2935669994 | 2935665750 | Bacteria | 9571747 |
| 1138 | 2935679156 | 2935675223 | Bacteria | 9928132 |
| 1139 | 2935690025 | 2935684952 | Bacteria | 9590419 |
| 1140 | 2935698544 | 2935694250 | Bacteria | 9291695 |
| 1141 | 2935711480 | 2935703347 | Bacteria | 10242284 |
| 1142 | 2935717544 | 2935713505 | Bacteria | 9608509 |
| 1143 | 2935723786 | 2935722832 | Bacteria | 9608746 |
| 1144 | 2935739995 | 2935732158 | Bacteria | 9706831 |
| 1145 | 2935749258 | 2935741537 | Bacteria | 9707219 |
| 1146 | 2935757379 | 2935750917 | Bacteria | 9590372 |
| 1147 | 2935763535 | 2935760218 | Bacteria | 9817913 |
| 1148 | 2935773042 | 2935769743 | Bacteria | 7878163 |
| 1149 | 2935782985 | 2935777560 | Bacteria | 8077691 |
| 1150 | 2935787969 | 2935785616 | Bacteria | 7962367 |
| 1151 | 2935796455 | 2935793552 | Bacteria | 8012592 |
| 1152 | 2935809958 | 2935801545 | Bacteria | 9301974 |
| 1153 | 2935816264 | 2935810662 | Bacteria | 9401221 |
| 1154 | 2935825477 | 2935819856 | Bacteria | 8261050 |
| 1155 | 2935835657 | 2935827899 | Bacteria | 10038562 |
| 1156 | 2935844608 | 2935837841 | Bacteria | 9454360 |
| 1157 | 2935853266 | 2935847175 | Bacteria | 8228321 |
| 1158 | 2935862946 | 2935855204 | Bacteria | 9035059 |
| 1159 | 2935866688 | 2935864058 | Bacteria | 9784707 |
| 1160 | 2935874995 | 2935873716 | Bacteria | 9632195 |
| 1161 | 2935890149 | 2935883170 | Bacteria | 7964738 |
| 1162 | 2935914739 | 2935908558 | Bacteria | 8568796 |
| 1163 | 2935918715 | 2935916978 | Bacteria | 9113783 |
| 1164 | 2935931568 | 2935926038 | Bacteria | 8601059 |
| 1165 | 2935940165 | 2935934488 | Bacteria | 8602579 |
| 1166 | 2935947488 | 2935942939 | Bacteria | 8599779 |
| 1167 | 2935956260 | 2935951376 | Bacteria | 8602333 |
| 1168 | 2935962636 | 2935959822 | Bacteria | 7869783 |
| 1169 | 2935973053 | 2935967501 | Bacteria | 8603075 |
| 1170 | 2935980704 | 2935975950 | Bacteria | 8347125 |
| 1171 | 2935985143 | 2935984226 | Bacteria | 8302647 |
| 1172 | 2935999729 | 2935992306 | Bacteria | 9802711 |
| 1173 | 2936010573 | 2936002035 | Bacteria | 9362176 |
| 1174 | 2936016692 | 2936011229 | Bacteria | 8801034 |
| 1175 | 2936025325 | 2936019824 | Bacteria | 8804134 |
| 1176 | 2936034167 | 2936028420 | Bacteria | 8965941 |
| 1177 | 2936041269 | 2936037263 | Bacteria | 9446081 |
| 1178 | 2936052224 | 2936046547 | Bacteria | 8903709 |
| 1179 | 2936056315 | 2936055302 | Bacteria | 8785755 |
| 1180 | 2940563292 | 2940556831 | Bacteria | 9590747 |
| 1181 | 2941535514 | 2941531003 | Bacteria | 7653939 |
| 1182 | 2941543207 | 2941538514 | Bacteria | 9402094 |
| 1183 | 3005475061 | 3005474847 | Bacteria | 9259049 |
| 1184 | 3005489070 | 3005483717 | Bacteria | 7877331 |
| 1185 | 3005509160 | 3005506211 | Bacteria | 6943378 |
| 1186 | 3005592211 | 3005587118 | Bacteria | 7794411 |
| 1187 | 3005595050 | 3005594810 | Bacteria | 8716512 |
| 1188 | 3005710998 | 3005710791 | Bacteria | 7622528 |
| 1189 | 3005718303 | 3005718088 | Bacteria | 8283608 |
| 1190 | 8006927890 | 8006926726 | Bacteria | 6749210 |
| 1191 | 8006936235 | 8006933436 | Bacteria | 10410654 |
| 1192 | 8006969360 | 8006964411 | Bacteria | 8966052 |
| 1193 | 8006976180 | 8006973647 | Bacteria | 10679141 |
| 1194 | 8006990922 | 8006984368 | Bacteria | 9651211 |
| 1195 | 8006996511 | 8006994254 | Bacteria | 8309700 |
| 1196 | 8016518182 | 8016511872 | Bacteria | 9921665 |
| 1197 | 8016526139 | 8016522445 | Bacteria | 8156687 |
| 1198 | 8016544055 | 8016539877 | Bacteria | 8155419 |
| 1199 | 8016557677 | 8016557553 | Bacteria | 8154380 |
| 1200 | 8016569460 | 8016566248 | Bacteria | 8158151 |
| 1201 | 8016582073 | 8016575299 | Bacteria | 8154085 |
| 1202 | 8016586370 | 8016583857 | Bacteria | 10421953 |
| 1203 | 8016595710 | 8016595262 | Bacteria | 8149947 |
| 1204 | 8016606566 | 8016603502 | Bacteria | 8731218 |
| 1205 | 8016618468 | 8016613128 | Bacteria | 8794220 |
| 1206 | 8016623160 | 8016622563 | Bacteria | 7999408 |
| 1207 | 8017058465 | 8017057580 | Bacteria | 10023680 |
| 1208 | 8019531027 | 8019530166 | Bacteria | 8155624 |
| 1209 | 8019540553 | 8019538911 | Bacteria | 7872763 |
| 1210 | 8019550174 | 8019547302 | Bacteria | 7996444 |
| 1211 | 8019577231 | 8019576017 | Bacteria | 10049540 |
| 1212 | 8019595311 | 8019586578 | Bacteria | 10212056 |
| 1213 | 8019606447 | 8019597564 | Bacteria | 10041141 |
| 1214 | 8019622970 | 8019619141 | Bacteria | 9218857 |
| 1215 | 8019630136 | 8019629233 | Bacteria | 8687553 |
| 1216 | 8019640476 | 8019638758 | Bacteria | 9062356 |
| 1217 | 8019652470 | 8019648815 | Bacteria | 10014479 |
| 1218 | 8019666970 | 8019659431 | Bacteria | 8577854 |
| 1219 | 8019676727 | 8019668869 | Bacteria | 8791617 |
| 1220 | 8019679263 | 8019678201 | Bacteria | 8863603 |
| 1221 | 8019696240 | 8019687851 | Bacteria | 8712826 |
| 1222 | 8055742451 | 8055742211 | Bacteria | 9226248 |
| 1223 | 8056675743 | 8056673599 | Bacteria | 7871253 |
| 1224 | 8056687394 | 8056681323 | Bacteria | 8472857 |
| 1225 | 8056690958 | 8056689827 | Bacteria | 6712655 |
| 1226 | 8056971288 | 8056967851 | Bacteria | 9038162 |
| 1227 | Ga0496109_0011741 | |||
| 1228 | JGI24740J21852_10000946 | |||
| 1229 | JGI24737J22298_10024439 | |||
| 1230 | JGI24735J21928_10009808 | |||
| 1231 | JGI24738J21930_10006735 | |||
| 1232 | JGI25406J46586_10000066 | |||
| 1233 | JGI25406J46586_10002779 | |||
| 1234 | JGI25153J46596_10003450 | |||
| 1235 | JGI25153J46596_10011834 | |||
| 1236 | JGI25160J50197_1003294 | |||
| 1237 | JGI25404J52841_10007684 | |||
| 1238 | Ga0055526_1043009 | |||
| 1239 | Ga0055531_10014489 | |||
| 1240 | Ga0065165_1000365 | |||
| 1241 | Ga0065165_1001495 | |||
| 1242 | Ga0065165_1019115 | |||
| 1243 | Ga0070658_10068227 | |||
| 1244 | Ga0070658_10084002 | |||
| 1245 | Ga0070683_100005996 | |||
| 1246 | Ga0070683_100013328 | |||
| 1247 | Ga0070683_100421203 | |||
| 1248 | Ga0070690_100211041 | |||
| 1249 | Ga0068868_100016797 | |||
| 1250 | Ga0070660_100038981 | |||
| 1251 | Ga0070691_10133269 | |||
| 1252 | Ga0070669_100066355 | |||
| 1253 | Ga0070671_100129955 | |||
| 1254 | Ga0070674_100088993 | |||
| 1255 | Ga0070674_100234639 | |||
| 1256 | Ga0070673_100084349 | |||
| 1257 | Ga0070659_100118955 | |||
| 1258 | Ga0070709_10000584 | |||
| 1259 | Ga0070709_10004682 | |||
| 1260 | Ga0070709_10013026 | |||
| 1261 | Ga0070709_10105903 | |||
| 1262 | Ga0070714_100004568 | |||
| 1263 | Ga0070714_100118625 | |||
| 1264 | Ga0070713_100005959 | |||
| 1265 | Ga0070713_100010327 | |||
| 1266 | Ga0070713_100157380 | |||
| 1267 | Ga0070713_100415359 | |||
| 1268 | Ga0070710_10002351 | |||
| 1269 | Ga0070710_10004995 | |||
| 1270 | Ga0070710_10109270 | |||
| 1271 | Ga0070711_100000660 | |||
| 1272 | Ga0070711_100004456 | |||
| 1273 | Ga0070711_100019254 | |||
| 1274 | Ga0070711_100022461 | |||
| 1275 | Ga0070711_100474025 | |||
| 1276 | Ga0070663_100062897 | |||
| 1277 | Ga0070678_100015808 | |||
| 1278 | Ga0070681_10014969 | |||
| 1279 | Ga0070681_10051117 | |||
| 1280 | Ga0070681_10089577 | |||
| 1281 | Ga0070698_100068842 | |||
| 1282 | Ga0070679_100039226 | |||
| 1283 | Ga0070679_100044969 | |||
| 1284 | Ga0070679_100066868 | |||
| 1285 | Ga0070679_100120755 | |||
| 1286 | Ga0070684_100007764 | |||
| 1287 | Ga0070684_100024903 | |||
| 1288 | Ga0070684_100058502 | |||
| 1289 | Ga0070697_100289134 | |||
| 1290 | Ga0068853_100001705 | |||
| 1291 | Ga0068853_100029265 | |||
| 1292 | Ga0068853_100086417 | |||
| 1293 | Ga0068853_100196525 | |||
| 1294 | Ga0068853_100279593 | |||
| 1295 | Ga0070696_100109075 | |||
| 1296 | Ga0070665_100028170 | |||
| 1297 | Ga0070665_100099215 | |||
| 1298 | Ga0070665_100250510 | |||
| 1299 | Ga0068855_100015846 | |||
| 1300 | Ga0068855_100034493 | |||
| 1301 | Ga0068855_100274067 | |||
| 1302 | Ga0068855_100526603 | |||
| 1303 | Ga0070664_100189725 | |||
| 1304 | Ga0068857_100021030 | |||
| 1305 | Ga0068857_100041204 | |||
| 1306 | Ga0068857_100227058 | |||
| 1307 | Ga0068857_100576858 | |||
| 1308 | Ga0068854_100222019 | |||
| 1309 | Ga0068854_100318805 | |||
| 1310 | Ga0068856_100005093 | |||
| 1311 | Ga0068856_100012875 | |||
| 1312 | Ga0068856_100065061 | |||
| 1313 | Ga0068856_100129808 | |||
| 1314 | Ga0068852_100042806 | |||
| 1315 | Ga0068852_100104346 | |||
| 1316 | Ga0068852_100341968 | |||
| 1317 | Ga0068859_100184572 | |||
| 1318 | Ga0068864_100026520 | |||
| 1319 | Ga0068851_10002645 | |||
| 1320 | Ga0068851_10030239 | |||
| 1321 | Ga0068858_100033778 | |||
| 1322 | Ga0068858_100094168 | |||
| 1323 | Ga0068858_100394178 | |||
| 1324 | Ga0068860_100001450 | |||
| 1325 | Ga0068860_100136751 | |||
| 1326 | Ga0081455_10009536 | |||
| 1327 | Ga0081455_10010204 | |||
| 1328 | Ga0081455_10037390 | |||
| 1329 | Ga0081455_10048211 | |||
| 1330 | Ga0081538_10086299 | |||
| 1331 | Ga0081540_1003875 | |||
| 1332 | Ga0081540_1005299 | |||
| 1333 | Ga0081540_1011061 | |||
| 1334 | Ga0081540_1012813 | |||
| 1335 | Ga0081540_1021192 | |||
| 1336 | Ga0081539_10000064 | |||
| 1337 | Ga0081539_10004737 | |||
| 1338 | Ga0081539_10029435 | |||
| 1339 | Ga0070717_10006989 | |||
| 1340 | Ga0070717_10043262 | |||
| 1341 | Ga0070717_10088445 | |||
| 1342 | Ga0075365_10066092 | |||
| 1343 | Ga0075365_10318386 | |||
| 1344 | Ga0075368_10003158 | |||
| 1345 | Ga0075363_100016306 | |||
| 1346 | Ga0070715_10000108 | |||
| 1347 | Ga0070715_10019602 | |||
| 1348 | Ga0070716_100002138 | |||
| 1349 | Ga0070716_100013388 | |||
| 1350 | Ga0070712_100047535 | |||
| 1351 | Ga0070712_100240873 | |||
| 1352 | Ga0075367_10092235 | |||
| 1353 | Ga0075369_10043758 | |||
| 1354 | Ga0075369_10076719 | |||
| 1355 | Ga0075366_10061029 | |||
| 1356 | Ga0097621_100249243 | |||
| 1357 | Ga0075370_10156285 | |||
| 1358 | Ga0068871_100330798 | |||
| 1359 | Ga0075428_100045101 | |||
| 1360 | Ga0075430_100389813 | |||
| 1361 | Ga0075433_10217483 | |||
| 1362 | Ga0068865_100349271 | |||
| 1363 | Ga0075436_100397440 | |||
| 1364 | Ga0097620_100184562 | |||
| 1365 | Ga0099823_1022515 | |||
| 1366 | Ga0099795_10064146 | |||
| 1367 | Ga0105240_10004955 | |||
| 1368 | Ga0105240_10008228 | |||
| 1369 | Ga0105240_10031181 | |||
| 1370 | Ga0105245_10197939 | |||
| 1371 | Ga0105245_10231917 | |||
| 1372 | Ga0105247_10010882 | |||
| 1373 | Ga0114129_10721610 | |||
| 1374 | Ga0105241_10002286 | |||
| 1375 | Ga0105241_10072988 | |||
| 1376 | Ga0105241_10082572 | |||
| 1377 | Ga0105248_10549277 | |||
| 1378 | Ga0105237_10010095 | |||
| 1379 | Ga0105237_10168546 | |||
| 1380 | Ga0105237_10304187 | |||
| 1381 | Ga0105237_10637369 | |||
| 1382 | Ga0105237_10789028 | |||
| 1383 | Ga0105238_10000905 | |||
| 1384 | Ga0105238_10015713 | |||
| 1385 | Ga0105238_10030039 | |||
| 1386 | Ga0105238_10050367 | |||
| 1387 | Ga0105238_10074317 | |||
| 1388 | Ga0105238_10597241 | |||
| 1389 | Ga0105249_10164867 | |||
| 1390 | Ga0105249_10269902 | |||
| 1391 | Ga0105239_10002519 | |||
| 1392 | Ga0105239_10024695 | |||
| 1393 | Ga0105239_10064493 | |||
| 1394 | Ga0105239_10080757 | |||
| 1395 | Ga0105239_10199644 | |||
| 1396 | Ga0105239_10211410 | |||
| 1397 | Ga0105239_10279826 | |||
| 1398 | Ga0105239_10356811 | |||
| 1399 | Ga0105246_10081781 | |||
| 1400 | Ga0157373_10053256 | |||
| 1401 | Ga0157370_10129027 | |||
| 1402 | Ga0157370_10402729 | |||
| 1403 | Ga0157369_10071197 | |||
| 1404 | Ga0157369_10684080 | |||
| 1405 | Ga0157374_10228057 | |||
| 1406 | Ga0157378_10743896 | |||
| 1407 | Ga0163162_10277441 | |||
| 1408 | Ga0157372_10271108 | |||
| 1409 | Ga0157375_10028391 | |||
| 1410 | Ga0157375_10293938 | |||
| 1411 | Ga0157375_10410565 | |||
| 1412 | Ga0163163_10002009 | |||
| 1413 | Ga0163163_10033178 | |||
| 1414 | Ga0157380_10127343 | |||
| 1415 | Ga0182008_10159463 | |||
| 1416 | Ga0157377_10178578 | |||
| 1417 | Ga0157379_10179402 | |||
| 1418 | Ga0157376_10010998 | |||
| 1419 | Ga0206353_10148081 | |||
| 1420 | Ga0206353_10567907 | |||
| 1421 | Ga0214544_1000016 | |||
| 1422 | Ga0214542_1000016 | |||
| 1423 | Ga0214545_1000008 | |||
| 1424 | Ga0214543_1001466 | |||
| 1425 | Ga0213873_10024285 | |||
| 1426 | Ga0213872_10015515 | |||
| 1427 | Ga0213876_10002439 | |||
| 1428 | Ga0209563_108642 | |||
| 1429 | Ga0209677_100672 | |||
| 1430 | Ga0209677_105633 | |||
| 1431 | Ga0209148_1000282 | |||
| 1432 | Ga0209233_1005872 | |||
| 1433 | Ga0209455_1002393 | |||
| 1434 | Ga0207673_1005554 | |||
| 1435 | Ga0209564_1000321 | |||
| 1436 | Ga0209564_1003702 | |||
| 1437 | Ga0209758_1000069 | |||
| 1438 | Ga0209758_1000635 | |||
| 1439 | Ga0209758_1001996 | |||
| 1440 | Ga0209758_1002493 | |||
| 1441 | Ga0209758_1011302 | |||
| 1442 | Ga0209758_1017490 | |||
| 1443 | Ga0209256_1015129 | |||
| 1444 | Ga0209256_1032713 | |||
| 1445 | Ga0207426_1002082 | |||
| 1446 | Ga0207426_1004116 | |||
| 1447 | Ga0207426_1020494 | |||
| 1448 | Ga0207426_1024931 | |||
| 1449 | Ga0209257_1000473 | |||
| 1450 | Ga0209257_1017693 | |||
| 1451 | Ga0207697_10065589 | |||
| 1452 | Ga0207656_10008173 | |||
| 1453 | Ga0207692_10002026 | |||
| 1454 | Ga0207692_10012905 | |||
| 1455 | Ga0207647_10014195 | |||
| 1456 | Ga0207647_10168847 | |||
| 1457 | Ga0207685_10016028 | |||
| 1458 | Ga0207685_10035616 | |||
| 1459 | Ga0207699_10003043 | |||
| 1460 | Ga0207699_10007202 | |||
| 1461 | Ga0207699_10038283 | |||
| 1462 | Ga0207699_10245906 | |||
| 1463 | Ga0207699_10323155 | |||
| 1464 | Ga0207645_10179478 | |||
| 1465 | Ga0207684_10077500 | |||
| 1466 | Ga0207654_10000058 | |||
| 1467 | Ga0207654_10006549 | |||
| 1468 | Ga0207654_10011597 | |||
| 1469 | Ga0207654_10089954 | |||
| 1470 | Ga0207707_10004700 | |||
| 1471 | Ga0207707_10035006 | |||
| 1472 | Ga0207707_10054133 | |||
| 1473 | Ga0207707_10104173 | |||
| 1474 | Ga0207707_10158480 | |||
| 1475 | Ga0207695_10000107 | |||
| 1476 | Ga0207695_10000453 | |||
| 1477 | Ga0207695_10115822 | |||
| 1478 | Ga0207695_10254960 | |||
| 1479 | Ga0207695_10318707 | |||
| 1480 | Ga0207671_10018412 | |||
| 1481 | Ga0207671_10042434 | |||
| 1482 | Ga0207671_10069130 | |||
| 1483 | Ga0207671_10094158 | |||
| 1484 | Ga0207671_10282289 | |||
| 1485 | Ga0207671_10461891 | |||
| 1486 | Ga0207693_10000310 | |||
| 1487 | Ga0207693_10021450 | |||
| 1488 | Ga0207693_10034078 | |||
| 1489 | Ga0207693_10035714 | |||
| 1490 | Ga0207693_10181848 | |||
| 1491 | Ga0207693_10354295 | |||
| 1492 | Ga0207663_10016715 | |||
| 1493 | Ga0207663_10019867 | |||
| 1494 | Ga0207663_10083697 | |||
| 1495 | Ga0207660_10076914 | |||
| 1496 | Ga0207660_10081275 | |||
| 1497 | Ga0207660_10189160 | |||
| 1498 | Ga0207657_10029294 | |||
| 1499 | Ga0207657_10073517 | |||
| 1500 | Ga0207657_10131985 | |||
| 1501 | Ga0207649_10410030 | |||
| 1502 | Ga0207652_10076915 | |||
| 1503 | Ga0207652_10079219 | |||
| 1504 | Ga0207652_10136044 | |||
| 1505 | Ga0207681_10066644 | |||
| 1506 | Ga0207694_10001009 | |||
| 1507 | Ga0207694_10034117 | |||
| 1508 | Ga0207694_10274993 | |||
| 1509 | Ga0207687_10004089 | |||
| 1510 | Ga0207687_10330306 | |||
| 1511 | Ga0207687_10350902 | |||
| 1512 | Ga0207700_10093504 | |||
| 1513 | Ga0207700_10117026 | |||
| 1514 | Ga0207700_10154584 | |||
| 1515 | Ga0207664_10061778 | |||
| 1516 | Ga0207664_10103518 | |||
| 1517 | Ga0207664_10487302 | |||
| 1518 | Ga0207664_10588483 | |||
| 1519 | Ga0207644_10066408 | |||
| 1520 | Ga0207706_10203009 | |||
| 1521 | Ga0207709_10250155 | |||
| 1522 | Ga0207665_10001734 | |||
| 1523 | Ga0207665_10004258 | |||
| 1524 | Ga0207665_10061076 | |||
| 1525 | Ga0207665_10085508 | |||
| 1526 | Ga0207691_10172053 | |||
| 1527 | Ga0207691_10203813 | |||
| 1528 | Ga0207691_10441320 | |||
| 1529 | Ga0207711_10211107 | |||
| 1530 | Ga0207689_10039585 | |||
| 1531 | Ga0207661_10044403 | |||
| 1532 | Ga0207661_10056040 | |||
| 1533 | Ga0207661_10073930 | |||
| 1534 | Ga0207661_10175645 | |||
| 1535 | Ga0207661_10670737 | |||
| 1536 | Ga0207679_10390674 | |||
| 1537 | Ga0207667_10006596 | |||
| 1538 | Ga0207667_10088774 | |||
| 1539 | Ga0207667_10109852 | |||
| 1540 | Ga0207667_10160793 | |||
| 1541 | Ga0207667_10281972 | |||
| 1542 | Ga0207640_10047734 | |||
| 1543 | Ga0207640_10186435 | |||
| 1544 | Ga0207658_10306396 | |||
| 1545 | Ga0207677_10024413 | |||
| 1546 | Ga0207677_10198955 | |||
| 1547 | Ga0207703_10078340 | |||
| 1548 | Ga0207703_10281990 | |||
| 1549 | Ga0207639_10013217 | |||
| 1550 | Ga0207639_10123004 | |||
| 1551 | Ga0207678_10003936 | |||
| 1552 | Ga0207678_10046674 | |||
| 1553 | Ga0207678_10096010 | |||
| 1554 | Ga0207678_10422037 | |||
| 1555 | Ga0207708_10085681 | |||
| 1556 | Ga0207702_10000004 | |||
| 1557 | Ga0207702_10001701 | |||
| 1558 | Ga0207702_10337936 | |||
| 1559 | Ga0207641_10327266 | |||
| 1560 | Ga0207648_10060413 | |||
| 1561 | Ga0207648_10238899 | |||
| 1562 | Ga0207676_10095612 | |||
| 1563 | Ga0207676_10114523 | |||
| 1564 | Ga0207674_10000890 | |||
| 1565 | Ga0207674_10002298 | |||
| 1566 | Ga0207674_10007766 | |||
| 1567 | Ga0207674_10052673 | |||
| 1568 | Ga0207674_10299290 | |||
| 1569 | Ga0207675_100122516 | |||
| 1570 | Ga0207675_100389764 | |||
| 1571 | Ga0207683_10016524 | |||
| 1572 | Ga0207683_10169315 | |||
| 1573 | Ga0207698_10031595 | |||
| 1574 | Ga0207698_10183463 | |||
| 1575 | Ga0207698_10350202 | |||
| 1576 | Ga0209389_1000033 | |||
| 1577 | Ga0209389_1000182 | |||
| 1578 | Ga0209589_1000021 | |||
| 1579 | Ga0209589_1000040 | |||
| 1580 | Ga0209489_100028 | |||
| 1581 | Ga0209489_100045 | |||
| 1582 | Ga0209489_100209 | |||
| 1583 | Ga0209700_100011 | |||
| 1584 | Ga0209700_100037 | |||
| 1585 | Ga0209588_1073887 | |||
| 1586 | Ga0268266_10045729 | |||
| 1587 | Ga0268266_10184329 | |||
| 1588 | Ga0268266_10199057 | |||
| 1589 | Ga0268266_10410158 | |||
| 1590 | Ga0268264_10000062 | |||
| 1591 | Ga0265337_1018782 | |||
| 1592 | Ga0265326_10008390 | |||
| 1593 | Ga0265319_1012969 | |||
| 1594 | Ga0265334_10013964 | |||
| 1595 | Ga0265318_10016635 | |||
| 1596 | Ga0265323_10007956 | |||
| 1597 | Ga0265336_10000561 | |||
| 1598 | Ga0307517_10001338 | |||
| 1599 | Ga0307515_10125511 | |||
| 1600 | Ga0307515_10140350 | |||
| 1601 | Ga0265338_10000598 | |||
| 1602 | Ga0265332_10016039 | |||
| 1603 | Ga0265332_10027603 | |||
| 1604 | Ga0265332_10072613 | |||
| 1605 | Ga0265328_10044554 | |||
| 1606 | Ga0265325_10009157 | |||
| 1607 | Ga0265340_10041599 | |||
| 1608 | Ga0265340_10042492 | |||
| 1609 | Ga0265339_10007110 | |||
| 1610 | Ga0265339_10029701 | |||
| 1611 | Ga0265339_10099122 | |||
| 1612 | Ga0265331_10027874 | |||
| 1613 | Ga0265331_10100059 | |||
| 1614 | Ga0307513_10105188 | |||
| 1615 | Ga0307513_10164506 | |||
| 1616 | Ga0307513_10169966 | |||
| 1617 | Ga0307513_10222288 | |||
| 1618 | Ga0307408_100239375 | |||
| 1619 | Ga0265313_10041739 | |||
| 1620 | Ga0307508_10000002 | |||
| 1621 | Ga0307508_10078616 | |||
| 1622 | Ga0265314_10005687 | |||
| 1623 | Ga0265314_10147464 | |||
| 1624 | Ga0265342_10005853 | |||
| 1625 | Ga0307516_10006094 | |||
| 1626 | Ga0307516_10010553 | |||
| 1627 | Ga0307516_10104788 | |||
| 1628 | Ga0307406_10168105 | |||
| 1629 | Ga0307415_100362721 | |||
| 1630 | Ga0307507_10027443 | |||
| 1631 | Ga0307510_10024755 | |||
| 1632 | Ga0307510_10025056 | |||
| 1633 | Ga0315911_1000008 | |||
| 1634 | Ga0316215_1002237 | |||
| 1635 | Ga0373926_0039711 | |||
| 1636 | Ga0373934_0002932 | |||
| 1637 | Ga0373944_0042120 | |||
| 1638 | Ga0373923_0009618 | |||
| 1639 | Ga0373936_0016692 | |||
| 1640 | Ga0373936_0036388 | |||
| 1641 | Ga0373936_0070087 | |||
| 1642 | Ga0373936_0133190 | |||
| 1643 | Ga0373941_0063086 | |||
| 1644 | Ga0373945_0002529 | |||
| 1645 | Ga0373945_0019734 | |||
| 1646 | Ga0373953_0000955 | |||
| 1647 | Ga0373953_0034938 | |||
| 1648 | Ga0373954_0018760 | |||
| 1649 | Ga0373954_0018968 | |||
| 1650 | Ga0373956_0068497 | |||
| 1651 | Ga0373957_0006831 | |||
| 1652 | Ga0373943_0002107 | |||
| 1653 | Ga0373943_0046258 | |||
| 1654 | Ga0373943_0056690 | |||
| 1655 | Ga0373943_0083317 | |||
| 1656 | Ga0373946_0001889 | |||
| 1657 | Ga0373946_0104972 | |||
| 1658 | Ga0373955_0005406 | |||
| 1659 | Ga0373924_0005676 | |||
| 1660 | Ga0373924_0060733 | |||
| 1661 | Ga0373931_0019569 | |||
| 1662 | Ga0373935_0000557 | |||
| 1663 | Ga0373935_0308415 | |||
| 1664 | Ga0373935_0443493 | |||
| 1665 | Ga0373927_0003654 | |||
| 1666 | Ga0373927_0010418 | |||
| 1667 | Ga0373927_0021960 | |||
| 1668 | Ga0373927_0027049 | |||
| 1669 | Ga0373927_0036371 | |||
| 1670 | Ga0373927_0235046 | |||
| 1671 | Ga0373933_0000031 | |||
| 1672 | Ga0373933_0003419 | |||
| 1673 | Ga0373933_0082944 | |||
| 1674 | Ga0373947_0000509 | |||
| 1675 | Ga0373947_0049307 | |||
| 1676 | Ga0373947_0151339 | |||
| 1677 | Ga0373947_0346433 | |||
| 1678 | Ga0373937_0033982 | |||
| 1679 | Ga0373937_0284966 | |||
| 1680 | Ga0373937_0380292 | |||
| 1681 | Ga0373925_0001713 | |||
| 1682 | Ga0373925_0025981 | |||
| 1683 | Ga0373925_0078993 | |||
| 1684 | Ga0373925_0110677 | |||
| 1685 | Ga0373925_0110804 | |||
| 1686 | Ga0373925_0192510 | |||
| 1687 | Ga0373925_0205586 | |||
| 1688 | Ga0395900_0003383 | |||
| 1689 | Ga0395900_0080281 | |||
| 1690 | Ga0395900_0546461 | |||
| 1691 | Ga0395898_0013386 | |||
| 1692 | Ga0395898_0018463 | |||
| 1693 | Ga0395898_0079473 | |||
| 1694 | Ga0395898_0099077 | |||
| 1695 | Ga0395905_0005856 | |||
| 1696 | Ga0395905_0023254 | |||
| 1697 | Ga0395905_0060606 | |||
| 1698 | Ga0395905_0165060 | |||
| 1699 | Ga0436364_0709114 | |||
| 1700 | Ga0395901_0161395 | |||
| 1701 | Ga0395901_0224667 | |||
| 1702 | Ga0436365_0076766 | |||
| 1703 | Ga0436365_0803057 | |||
| 1704 | Ga0436365_0958057 | |||
| 1705 | Ga0436365_0966323 | |||
| 1706 | Ga0436365_1369931 | |||
| 1707 | Ga0436361_0336324 | |||
| 1708 | Ga0436361_0937863 | |||
| 1709 | Ga0436363_0697337 | |||
| 1710 | Ga0439465_0013621 | |||
| 1711 | Ga0466969_0128100 | |||
| 1712 | Ga0466972_0000119 | |||
| 1713 | Ga0466972_0010560 | |||
| 1714 | Ga0466966_0034959 | |||
| 1715 | Ga0466966_0041766 | |||
| 1716 | Ga0466961_0000139 | |||
| 1717 | Ga0466963_0080797 | |||
| 1718 | Ga0466963_0117349 | |||
| 1719 | Ga0466971_0174557 | |||
| 1720 | Ga0466968_0017207 | |||
| 1721 | Ga0466968_0021266 | |||
| 1722 | Ga0466968_0100658 | |||
| 1723 | Ga0466970_0045604 | |||
| 1724 | Ga0466970_0185989 | |||
| 1725 | Ga0466957_0035033 | |||
| 1726 | Ga0466960_0000848 | |||
| 1727 | Ga0466959_0034008 | |||
| 1728 | Ga0466959_0053472 | |||
| 1729 | Ga0466959_0240101 | |||
| 1730 | Ga0466959_0361912 | |||
| 1731 | Ga0466967_0004006 | |||
| 1732 | Ga0466967_0011512 | |||
| 1733 | Ga0466967_0088324 | |||
| 1734 | Ga0466967_0160685 | |||
| 1735 | Ga0495592_0058216 | |||
| 1736 | Ga0495592_0140768 | |||
| 1737 | Ga0495592_0300267 | |||
| 1738 | Ga0495603_0000047 | |||
| 1739 | Ga0495603_0055753 | |||
| 1740 | Ga0495603_0070506 | |||
| 1741 | Ga0495629_0000320 | |||
| 1742 | Ga0495629_0005536 | |||
| 1743 | Ga0495629_0231283 | |||
| 1744 | Ga0495638_0001094 | |||
| 1745 | Ga0495638_0053016 | |||
| 1746 | Ga0495641_0009584 | |||
| 1747 | Ga0495651_0017530 | |||
| 1748 | Ga0495651_0041190 | |||
| 1749 | Ga0495651_0086113 | |||
| 1750 | Ga0495651_0095034 | |||
| 1751 | Ga0495653_0003027 | |||
| 1752 | Ga0495653_0070906 | |||
| 1753 | Ga0495580_0090453 | |||
| 1754 | Ga0495582_0000043 | |||
| 1755 | Ga0495582_0024699 | |||
| 1756 | Ga0495582_0032646 | |||
| 1757 | Ga0495582_0042626 | |||
| 1758 | Ga0495605_0072307 | |||
| 1759 | Ga0495605_0092896 | |||
| 1760 | Ga0495639_0000091 | |||
| 1761 | Ga0495662_0000128 | |||
| 1762 | Ga0495664_0009771 | |||
| 1763 | Ga0495664_0016934 | |||
| 1764 | Ga0495664_0053492 | |||
| 1765 | Ga0495584_0016366 | |||
| 1766 | Ga0495584_0036022 | |||
| 1767 | Ga0495585_0027616 | |||
| 1768 | Ga0495594_0002035 | |||
| 1769 | Ga0495594_0137115 | |||
| 1770 | Ga0495596_0056530 | |||
| 1771 | Ga0495607_0012073 | |||
| 1772 | Ga0495583_0020205 | |||
| 1773 | Ga0495606_0000252 | |||
| 1774 | Ga0495606_0037168 | |||
| 1775 | Ga0495606_0048505 | |||
| 1776 | Ga0495606_0082443 | |||
| 1777 | Ga0495606_0194800 | |||
| 1778 | Ga0495608_0017766 | |||
| 1779 | Ga0495610_0055708 | |||
| 1780 | Ga0495616_0025586 | |||
| 1781 | Ga0495616_0134523 | |||
| 1782 | Ga0495618_0010884 | |||
| 1783 | Ga0495620_0014398 | |||
| 1784 | Ga0495628_0057540 | |||
| 1785 | Ga0495628_0108009 | |||
| 1786 | Ga0495628_0261808 | |||
| 1787 | Ga0495628_0314815 | |||
| 1788 | Ga0495630_0014946 | |||
| 1789 | Ga0495631_0025195 | |||
| 1790 | Ga0495631_0081283 | |||
| 1791 | Ga0495637_0028566 | |||
| 1792 | Ga0495643_0063715 | |||
| 1793 | Ga0495644_0031813 | |||
| 1794 | Ga0495648_0000286 | |||
| 1795 | Ga0495648_0024325 | |||
| 1796 | Ga0495648_0044368 | |||
| 1797 | Ga0495648_0072499 | |||
| 1798 | Ga0495648_0125545 | |||
| 1799 | Ga0495666_0015987 | |||
| 1800 | Ga0495666_0192723 | |||
| 1801 | Ga0495652_0011857 | |||
| 1802 | Ga0495652_0034268 | |||
| 1803 | Ga0495665_0000051 | |||
| 1804 | Ga0495640_0007555 | |||
| 1805 | Ga0495640_0018565 | |||
| 1806 | Ga0495640_0074727 | |||
| 1807 | Ga0495640_0112835 | |||
| 1808 | Ga0495586_0047218 | |||
| 1809 | Ga0495587_0008144 | |||
| 1810 | Ga0495587_0029650 | |||
| 1811 | Ga0495598_0005762 | |||
| 1812 | Ga0495645_0021133 | |||
| 1813 | Ga0495645_0102551 | |||
| 1814 | Ga0495622_0015099 | |||
| 1815 | Ga0495622_0021698 | |||
| 1816 | Ga0495633_0006412 | |||
| 1817 | Ga0495667_0004751 | |||
| 1818 | Ga0495667_0006502 | |||
| 1819 | Ga0495667_0033150 | |||
| 1820 | Ga0495667_0175879 | |||
| 1821 | Ga0495667_0188219 | |||
| 1822 | Ga0495668_0029459 | |||
| 1823 | Ga0495634_0000400 | |||
| 1824 | Ga0495634_0021637 | |||
| 1825 | Ga0495634_0044581 | |||
| 1826 | Ga0495634_0076053 | |||
| 1827 | Ga0495625_0017905 | |||
| 1828 | Ga0495625_0104162 | |||
| 1829 | Ga0495635_0000620 | |||
| 1830 | Ga0495635_0002202 | |||
| 1831 | Ga0495635_0004059 | |||
| 1832 | Ga0495635_0043268 | |||
| 1833 | Ga0495661_0019545 | |||
| 1834 | Ga0495657_0006604 | |||
| 1835 | Ga0495657_0013678 | |||
| 1836 | Ga0495657_0030794 | |||
| 1837 | Ga0495657_0042749 | |||
| 1838 | Ga0495599_0009906 | |||
| 1839 | Ga0495599_0069977 | |||
| 1840 | Ga0495623_0012518 | |||
| 1841 | Ga0495623_0037441 | |||
| 1842 | Ga0495623_0213500 | |||
| 1843 | Ga0495646_0000643 | |||
| 1844 | Ga0495646_0043973 | |||
| 1845 | Ga0495647_0002769 | |||
| 1846 | Ga0495658_0000499 | |||
| 1847 | Ga0495658_0114457 | |||
| 1848 | Ga0495613_0008984 | |||
| 1849 | Ga0495613_0025117 | |||
| 1850 | Ga0495624_0003704 | |||
| 1851 | Ga0495624_0021704 | |||
| 1852 | Ga0495624_0096046 | |||
| 1853 | Ga0495670_0001762 | |||
| 1854 | Ga0495670_0125248 | |||
| 1855 | Ga0495671_0161834 | |||
| 1856 | Ga0495649_0012129 | |||
| 1857 | Ga0495589_0051700 | |||
| 1858 | Ga0495600_0011578 | |||
| 1859 | Ga0495600_0013331 | |||
| 1860 | Ga0495581_0000486 | |||
| 1861 | Ga0495581_0061415 | |||
| 1862 | Ga0495581_0114111 | |||
| 1863 | Ga0495581_0115928 | |||
| 1864 | Ga0495604_0010785 | |||
| 1865 | Ga0495604_0023859 | |||
| 1866 | Ga0495604_0031639 | |||
| 1867 | Ga0495604_0145351 | |||
| 1868 | Ga0495674_0005428 | |||
| 1869 | Ga0495674_0023537 | |||
| 1870 | Ga0495674_0131189 | |||
| 1871 | Ga0495672_0022435 | |||
| 1872 | Ga0495672_0066467 | |||
| 1873 | Ga0495672_0081560 | |||
| 1874 | Ga0495676_0061706 | |||
| 1875 | Ga0495676_0087102 | |||
| 1876 | Ga0495676_0108612 | |||
| 1877 | Ga0495676_0114727 | |||
| 1878 | Ga0495680_0000689 | |||
| 1879 | Ga0495680_0001909 | |||
| 1880 | Ga0495680_0040967 | |||
| 1881 | Ga0495680_0099424 | |||
| 1882 | Ga0495680_0231698 | |||
| 1883 | Ga0495683_0044814 | |||
| 1884 | Ga0495683_0073135 | |||
| 1885 | Ga0495687_008047 | |||
| 1886 | Ga0495675_0008329 | |||
| 1887 | Ga0495675_0103236 | |||
| 1888 | Ga0495681_0100394 | |||
| 1889 | Ga0495684_0000313 | |||
| 1890 | Ga0495684_0012322 | |||
| 1891 | Ga0495684_0103192 | |||
| 1892 | Ga0495684_0145236 | |||
| 1893 | Ga0495684_0206990 | |||
| 1894 | Ga0495686_0063919 | |||
| 1895 | Ga0495593_0000005 | |||
| 1896 | Ga0495593_0002672 | |||
| 1897 | Ga0495593_0063063 | |||
| 1898 | Ga0495602_0015257 | |||
| 1899 | Ga0495602_0095535 | |||
| 1900 | Ga0495602_0118872 | |||
| 1901 | Ga0495614_0006832 | |||
| 1902 | Ga0495626_0025505 | |||
| 1903 | Ga0495626_0055731 | |||
| 1904 | Ga0495626_0079507 | |||
| 1905 | Ga0496100_0006321 | |||
| 1906 | Ga0496100_0093302 | |||
| 1907 | Ga0496100_0199871 | |||
| 1908 | Ga0496100_0331609 | |||
| 1909 | Ga0496101_0018505 | |||
| 1910 | Ga0496101_0041241 | |||
| 1911 | Ga0496101_0230209 | |||
| 1912 | Ga0496101_0496314 | |||
| 1913 | Ga0496102_0001314 | |||
| 1914 | Ga0496102_0009090 | |||
| 1915 | Ga0496102_0542835 | |||
| 1916 | Ga0496102_0554459 | |||
| 1917 | Ga0496103_0025364 | |||
| 1918 | Ga0496103_0047615 | |||
| 1919 | Ga0496103_0250773 | |||
| 1920 | Ga0496104_0002280 | |||
| 1921 | Ga0496104_0003037 | |||
| 1922 | Ga0496104_0007367 | |||
| 1923 | Ga0496104_0018994 | |||
| 1924 | Ga0496104_0030135 | |||
| 1925 | Ga0496104_0159295 | |||
| 1926 | Ga0496104_0272046 | |||
| 1927 | Ga0496105_0000935 | |||
| 1928 | Ga0496105_0003051 | |||
| 1929 | Ga0496105_0027371 | |||
| 1930 | Ga0496105_0040662 | |||
| 1931 | Ga0496105_0126887 | |||
| 1932 | Ga0496106_0000236 | |||
| 1933 | Ga0496106_0014089 | |||
| 1934 | Ga0496106_0060156 | |||
| 1935 | Ga0496106_0126165 | |||
| 1936 | Ga0496106_0264519 | |||
| 1937 | Ga0496107_0003292 | |||
| 1938 | Ga0496107_0091750 | |||
| 1939 | Ga0496107_0110889 | |||
| 1940 | Ga0496107_0130670 | |||
| 1941 | Ga0496107_0152209 | |||
| 1942 | Ga0496107_0171489 | |||
| 1943 | Ga0496107_0239906 | |||
| 1944 | Ga0496107_0244377 | |||
| 1945 | Ga0496107_0265433 | |||
| 1946 | Ga0496108_0000849 | |||
| 1947 | Ga0496108_0016993 | |||
| 1948 | Ga0496108_0047577 | |||
| 1949 | Ga0496108_0053230 | |||
| 1950 | Ga0496108_0304768 | |||
| 1951 | Ga0496108_0360185 | |||
| 1952 | Ga0496108_0372747 | |||
| 1953 | Ga0496109_0000224 | |||
| 1954 | Ga0496109_0010749 | |||
| 1955 | Ga0496109_0073871 | |||
| 1956 | Ga0496109_0148771 | |||
| 1957 | Ga0496110_0004203 | |||
| 1958 | Ga0496110_0008119 | |||
| 1959 | Ga0496110_0027437 | |||
| 1960 | Ga0496110_0056327 | |||
| 1961 | Ga0496110_0132154 | |||
| 1962 | Ga0496110_0151081 | |||
| 1963 | Ga0496110_0197580 | |||
| 1964 | Ga0496111_0008238 | |||
| 1965 | Ga0496111_0010213 | |||
| 1966 | Ga0496111_0043391 | |||
| 1967 | Ga0496111_0057197 | |||
| 1968 | Ga0496111_0196353 | |||
| 1969 | Ga0496111_0352694 | |||
| 1970 | Ga0496112_0000020 | |||
| 1971 | Ga0496112_0001044 | |||
| 1972 | Ga0496112_0014481 | |||
| 1973 | Ga0496112_0032339 | |||
| 1974 | Ga0496112_0036502 | |||
| 1975 | Ga0496112_0128611 | |||
| 1976 | Ga0496112_0218018 | |||
| 1977 | Ga0496112_0462284 | |||
| 1978 | Ga0496113_0006740 | |||
| 1979 | Ga0496113_0037992 | |||
| 1980 | Ga0496113_0043787 | |||
| 1981 | Ga0496113_0051297 | |||
| 1982 | Ga0496113_0059445 | |||
| 1983 | Ga0496113_0076548 | |||
| 1984 | Ga0496114_0009847 | |||
| 1985 | Ga0496114_0079878 | |||
| 1986 | Ga0496114_0306210 | |||
| 1987 | Ga0496115_0023846 | |||
| 1988 | Ga0496115_0029319 | |||
| 1989 | Ga0496115_0087123 | |||
| 1990 | Ga0496115_0087298 | |||
| 1991 | Ga0496115_0100082 | |||
| 1992 | Ga0496115_0140952 | |||
| 1993 | Ga0496115_0286279 | |||
| 1994 | Ga0496115_0372611 | |||
| 1995 | Ga0496117_0021089 | |||
| 1996 | Ga0496117_0036072 | |||
| 1997 | Ga0496117_0120237 | |||
| 1998 | Ga0496117_0153817 | |||
| 1999 | Ga0496118_0003026 | |||
| 2000 | Ga0496118_0027995 | |||
| 2001 | Ga0496118_0048029 | |||
| 2002 | Ga0496118_0064926 | |||
| 2003 | Ga0496118_0090666 | |||
| 2004 | Ga0496118_0154936 | |||
| 2005 | Ga0496119_0006376 | |||
| 2006 | Ga0496119_0038888 | |||
| 2007 | Ga0496119_0072987 | |||
| 2008 | Ga0496121_0000203 | |||
| 2009 | Ga0496121_0000270 | |||
| 2010 | Ga0496121_0001251 | |||
| 2011 | Ga0496121_0002323 | |||
| 2012 | Ga0496121_0015121 | |||
| 2013 | Ga0496121_0042502 | |||
| 2014 | Ga0496121_0045389 | |||
| 2015 | Ga0496121_0130068 | |||
| 2016 | Ga0496121_0133412 | |||
| 2017 | Ga0496121_0171645 | |||
| 2018 | Ga0496121_0267653 | |||
| 2019 | Ga0496122_0032788 | |||
| 2020 | Ga0496122_0052331 | |||
| 2021 | Ga0496123_0010648 | |||
| 2022 | Ga0496123_0101514 | |||
| 2023 | Ga0496124_0011952 | |||
| 2024 | Ga0496124_0048269 | |||
| 2025 | Ga0496124_0070552 | |||
| 2026 | Ga0496124_0114620 | |||
| 2027 | Ga0496125_0000328 | |||
| 2028 | Ga0496125_0000407 | |||
| 2029 | Ga0496125_0003549 | |||
| 2030 | Ga0496125_0024628 | |||
| 2031 | Ga0496125_0043717 | |||
| 2032 | Ga0496125_0059052 | |||
| 2033 | Ga0496125_0070315 | |||
| 2034 | Ga0496125_0087175 | |||
| 2035 | Ga0496126_0010158 | |||
| 2036 | Ga0496126_0016646 | |||
| 2037 | Ga0496126_0025084 | |||
| 2038 | Ga0496126_0027806 | |||
| 2039 | Ga0496126_0035866 | |||
| 2040 | Ga0496126_0065855 | |||
| 2041 | Ga0496126_0086523 | |||
| 2042 | Ga0496126_0088126 | |||
| 2043 | Ga0496126_0142503 | |||
| 2044 | Ga0496126_0174331 | |||
| 2045 | Ga0496126_0208070 | |||
| 2046 | Ga0496126_0286373 | |||
| 2047 | Ga0495682_0011296 | |||
| 2048 | Ga0495682_0055980 | |||
| 2049 | Ga0501031_0012366 | |||
| 2050 | Ga0501031_0142806 | |||
| 2051 | Ga0501032_0000475 | |||
| 2052 | Ga0501032_0042704 | |||
| 2053 | Ga0501033_0000440 | |||
| 2054 | Ga0501033_0001499 | |||
| 2055 | Ga0501033_0012762 | |||
| 2056 | Ga0501033_0117807 | |||
| 2057 | Ga0501033_0119051 | |||
| 2058 | Ga0501033_0345629 | |||
| 2059 | Ga0501034_0000250 | |||
| 2060 | Ga0501034_0028177 | |||
| 2061 | Ga0501036_0000098 | |||
| 2062 | Ga0501036_0044460 | |||
| 2063 | Ga0501036_0061519 | |||
| 2064 | Ga0501036_0115578 | |||
| 2065 | Ga0501036_0150293 | |||
| 2066 | Ga0501037_0000092 | |||
| 2067 | Ga0501037_0016024 | |||
| 2068 | Ga0501037_0105558 | |||
| 2069 | Ga0501037_0106892 | |||
| 2070 | Ga0501038_0000059 | |||
| 2071 | Ga0501038_0000626 | |||
| 2072 | Ga0501038_0042710 | |||
| 2073 | Ga0501038_0199908 | |||
| 2074 | Ga0501039_0000085 | |||
| 2075 | Ga0501039_0021665 | |||
| 2076 | Ga0501039_0137111 | |||
| 2077 | Ga0501039_0142154 | |||
| 2078 | Ga0501042_0035371 | |||
| 2079 | Ga0501042_0060507 | |||
| 2080 | Ga0501043_0011678 | |||
| 2081 | Ga0501043_0289790 | |||
| 2082 | Ga0501043_0313691 | |||
| 2083 | Ga0501046_0000483 | |||
| 2084 | Ga0501046_0013048 | |||
| 2085 | Ga0501046_0028766 | |||
| 2086 | Ga0501046_0050241 | |||
| 2087 | Ga0501046_0235227 | |||
| 2088 | Ga0501047_0000022 | |||
| 2089 | Ga0501047_0010976 | |||
| 2090 | Ga0501047_0020141 | |||
| 2091 | Ga0501047_0142285 | |||
| 2092 | Ga0501047_0244182 | |||
| 2093 | Ga0501047_0428330 | |||
| 2094 | Ga0501048_0002266 | |||
| 2095 | Ga0501067_0000599 | |||
| 2096 | Ga0501067_0114243 | |||
| 2097 | Ga0501068_0004667 | |||
| 2098 | Ga0501068_0056869 | |||
| 2099 | Ga0501068_0065838 | |||
| 2100 | Ga0501069_0055162 | |||
| 2101 | Ga0501070_0006653 | |||
| 2102 | Ga0501070_0062656 | |||
| 2103 | Ga0501070_0180468 | |||
| 2104 | Ga0501071_0039494 | |||
| 2105 | Ga0501071_0073681 | |||
| 2106 | Ga0501072_0001923 | |||
| 2107 | Ga0501072_0226059 | |||
| 2108 | Ga0501073_0000109 | |||
| 2109 | Ga0501073_0056097 | |||
| 2110 | Ga0501073_0104808 | |||
| 2111 | Ga0501074_0036614 | |||
| 2112 | Ga0501074_0100957 | |||
| 2113 | Ga0501076_0021057 | |||
| 2114 | Ga0501077_0060991 | |||
| 2115 | Ga0501079_0002132 | |||
| 2116 | Ga0501079_0091330 | |||
| 2117 | Ga0501080_0005186 | |||
| 2118 | Ga0501080_0031118 | |||
| 2119 | Ga0501080_0181287 | |||
| 2120 | Ga0501080_0186541 | |||
| 2121 | Ga0501083_0001424 | |||
| 2122 | Ga0501035_0001471 | |||
| 2123 | Ga0501035_0035988 | |||
| 2124 | Ga0501035_0082774 | |||
| 2125 | Ga0501044_0000072 | |||
| 2126 | Ga0501044_0001765 | |||
| 2127 | Ga0501044_0009154 | |||
| 2128 | Ga0501044_0547336 | |||
| 2129 | Ga0501045_0370770 | |||
| 2130 | nmdc:mga03n38_4895_c1 | |||
| 2131 | nmdc:mga00v17_162020_c1 | |||
| 2132 | nmdc:mga00v17_55279_c1 | |||
| 2133 | nmdc:mga0yw44_208929_c1 | |||
| 2134 | nmdc:mga0yw44_47348_c1 | |||
| 2135 | nmdc:mga0yw44_83620_c1 | |||
| 2136 | nmdc:mga0k408_58486_c1 | |||
| 2137 | nmdc:mga06z11_120949_c1 | |||
| 2138 | nmdc:mga06z11_255013_c1 | |||
| 2139 | nmdc:mga04h51_4727_c1 | |||
| 2140 | nmdc:mga07m45_112215_c1 | |||
| 2141 | nmdc:mga07m45_113485_c1 | |||
| 2142 | nmdc:mga07m45_226957_c1 | |||
| 2143 | nmdc:mga09592_221455_c1 | |||
| 2144 | nmdc:mga06r32_33397_c1 | |||
| 2145 | nmdc:mga0rr50_314731_c1 | |||
| 2146 | nmdc:mga0a205_223274_c1 | |||
| 2147 | nmdc:mga0sz30_40195_c1 | |||
| 2148 | Ga0495601_0049218 | |||
| 2149 | Ga0495601_0086261 | |||
| 2150 | Ga0495601_0233021 | |||
| 2151 | Ga0500635_0048938 | |||
| 2152 | Ga0500635_0055968 | |||
| 2153 | Ga0495655_0003764 | |||
| 2154 | Ga0495655_0012771 | |||
| 2155 | Ga0495595_0000445 | |||
| 2156 | Ga0495595_0005883 | |||
| 2157 | Ga0495619_0000330 | |||
| 2158 | Ga0500578_0079113 | |||
| 2159 | Ga0500578_0118280 | |||
| 2160 | Ga0500643_000063 | |||
| 2161 | Ga0500643_034093 | |||
| 2162 | Ga0500646_0000839 | |||
| 2163 | Ga0500651_0006769 | |||
| 2164 | Ga0500651_0006892 | |||
| 2165 | Ga0500651_0194034 | |||
| 2166 | Ga0500566_0000247 | |||
| 2167 | Ga0500566_0003076 | |||
| 2168 | Ga0500566_0005190 | |||
| 2169 | Ga0500566_0202460 | |||
| 2170 | Ga0500640_068405 | |||
| 2171 | Ga0500641_0035557 | |||
| 2172 | Ga0500554_003943 | |||
| 2173 | Ga0500556_0000006 | |||
| 2174 | Ga0500557_000037 | |||
| 2175 | Ga0500569_001553 | |||
| 2176 | Ga0500569_002673 | |||
| 2177 | Ga0500572_000191 | |||
| 2178 | Ga0500572_019537 | |||
| 2179 | Ga0500593_065397 | |||
| 2180 | Ga0500595_002654 | |||
| 2181 | Ga0500595_014785 | |||
| 2182 | Ga0500607_020092 | |||
| 2183 | Ga0500608_000959 | |||
| 2184 | Ga0500608_051127 | |||
| 2185 | Ga0500614_019160 | |||
| 2186 | Ga0500618_004575 | |||
| 2187 | Ga0500618_017251 | |||
| 2188 | Ga0500642_0000004 | |||
| 2189 | Ga0500642_0000062 | |||
| 2190 | Ga0500642_0011321 | |||
| 2191 | Ga0500642_0048371 | |||
| 2192 | Ga0500652_000555 | |||
| 2193 | Ga0500658_0074733 | |||
| 2194 | Ga0500658_0075077 | |||
| 2195 | Ga0500559_0000179 | |||
| 2196 | Ga0500559_0000398 | |||
| 2197 | Ga0500559_0042227 | |||
| 2198 | Ga0500559_0139060 | |||
| 2199 | Ga0500564_110823 | |||
| 2200 | Ga0500568_0000790 | |||
| 2201 | Ga0500573_0232028 | |||
| 2202 | Ga0500577_0000399 | |||
| 2203 | Ga0500586_007140 | |||
| 2204 | Ga0500588_0031491 | |||
| 2205 | Ga0500603_001290 | |||
| 2206 | Ga0500603_007487 | |||
| 2207 | Ga0500604_0001375 | |||
| 2208 | Ga0500616_0000022 | |||
| 2209 | Ga0500616_0018659 | |||
| 2210 | Ga0500620_001178 | |||
| 2211 | Ga0500622_0015984 | |||
| 2212 | Ga0500622_0026331 | |||
| 2213 | Ga0500622_0044474 | |||
| 2214 | Ga0500630_065807 | |||
| 2215 | Ga0500639_013853 | |||
| 2216 | Ga0500639_022758 | |||
| 2217 | Ga0500636_0000349 | |||
| 2218 | Ga0500636_0060283 | |||
| 2219 | Ga0500637_0017723 | |||
| 2220 | Ga0500637_0215510 | |||
| 2221 | Ga0500570_018767 | |||
| 2222 | Ga0500625_024838 | |||
| 2223 | Ga0500596_004482 | |||
| 2224 | Ga0500596_007212 | |||
| 2225 | Ga0500601_000064 | |||
| 2226 | Ga0501084_0185546 | |||
| 2227 | Ga0500661_021525 | |||
| 2228 | Ga0501082_0000028 | |||
| 2229 | Ga0501082_0144134 | |||
| 2230 | 2507505246 | |||
| 2231 | 2508539167 | |||
| 2232 | 2508695485 | |||
| 2233 | 2509152633 | |||
| 2234 | 2511400222 | |||
| 2235 | 2513625345 | |||
| 2236 | 2513644164 | |||
| 2237 | 2513651516 | |||
| 2238 | 2513658813 | |||
| 2239 | 2513674587 | |||
| 2240 | 2513695111 | |||
| 2241 | 2513705241 | |||
| 2242 | 2513720304 | |||
| 2243 | 2513860820 | |||
| 2244 | 2513873528 | |||
| 2245 | 2513888766 | |||
| 2246 | 2513921077 | |||
| 2247 | 2514012485 | |||
| 2248 | 2515627442 | |||
| 2249 | 2517107711 | |||
| 2250 | 2517888842 | |||
| 2251 | 2524440890 | |||
| 2252 | 2524467848 | |||
| 2253 | 2524537054 | |||
| 2254 | 2528852938 | |||
| 2255 | 2603858527 | |||
| 2256 | 2617352398 | |||
| 2257 | 2617373761 | |||
| 2258 | 2644290946 | |||
| 2259 | 2671119944 | |||
| 2260 | 2723841642 | |||
| 2261 | 2728754989 | |||
| 2262 | 2745081688 | |||
| 2263 | 2793062042 | |||
| 2264 | 2793072930 | |||
| 2265 | 2793082750 | |||
| 2266 | 2805915612 | |||
| 2267 | 2818237649 | |||
| 2268 | 2824604584 | |||
| 2269 | 2824612325 | |||
| 2270 | 2824624500 | |||
| 2271 | 2824633415 | |||
| 2272 | 2824640288 | |||
| 2273 | 2824647278 | |||
| 2274 | 2824655190 | |||
| 2275 | 2824667559 | |||
| 2276 | 2824676625 | |||
| 2277 | 2824684230 | |||
| 2278 | 2824694701 | |||
| 2279 | 2824704127 | |||
| 2280 | 2824708929 | |||
| 2281 | 2824717406 | |||
| 2282 | 2824727631 | |||
| 2283 | 2824737795 | |||
| 2284 | 2824752227 | |||
| 2285 | 2824759956 | |||
| 2286 | 2824770390 | |||
| 2287 | 2824775522 | |||
| 2288 | 2838124513 | |||
| 2289 | 2841945200 | |||
| 2290 | 2841951981 | |||
| 2291 | 2841965434 | |||
| 2292 | 2841970623 | |||
| 2293 | 2841979972 | |||
| 2294 | 2841985152 | |||
| 2295 | 2842043509 | |||
| 2296 | 2842052501 | |||
| 2297 | 2844315336 | |||
| 2298 | 2847931073 | |||
| 2299 | 2847942155 | |||
| 2300 | 2849083035 | |||
| 2301 | 2857511925 | |||
| 2302 | 2857526351 | |||
| 2303 | 2874594445 | |||
| 2304 | 2874608064 | |||
| 2305 | 2874613436 | |||
| 2306 | 2874624782 | |||
| 2307 | 2874628795 | |||
| 2308 | 2874649818 | |||
| 2309 | 2876768927 | |||
| 2310 | 2876773937 | |||
| 2311 | 2876821817 | |||
| 2312 | 2879078339 | |||
| 2313 | 2879085907 | |||
| 2314 | 2879106022 | |||
| 2315 | 2879112171 | |||
| 2316 | 2879130600 | |||
| 2317 | 2879147123 | |||
| 2318 | 2881365317 | |||
| 2319 | 2881668185 | |||
| 2320 | 2885371028 | |||
| 2321 | 2885382850 | |||
| 2322 | 2885388844 | |||
| 2323 | 2885411662 | |||
| 2324 | 2888379593 | |||
| 2325 | 2888390681 | |||
| 2326 | 2888420306 | |||
| 2327 | 2889035490 | |||
| 2328 | 2893067378 | |||
| 2329 | 2903732197 | |||
| 2330 | 2903748955 | |||
| 2331 | 2903770760 | |||
| 2332 | 2904670263 | |||
| 2333 | 2904708824 | |||
| 2334 | 2904713178 | |||
| 2335 | 2906604274 | |||
| 2336 | 2906613874 | |||
| 2337 | 2906628957 | |||
| 2338 | 2906642332 | |||
| 2339 | 2906648178 | |||
| 2340 | 2906667360 | |||
| 2341 | 2908747444 | |||
| 2342 | 2908756587 | |||
| 2343 | 2908776277 | |||
| 2344 | 2919073802 | |||
| 2345 | 2922364000 | |||
| 2346 | 2922368936 | |||
| 2347 | 2922392566 | |||
| 2348 | 2922394239 | |||
| 2349 | 2929618601 | |||
| 2350 | 2929628714 | |||
| 2351 | 2932792923 | |||
| 2352 | 2932794317 | |||
| 2353 | 2932808089 | |||
| 2354 | 2932812165 | |||
| 2355 | 2932823155 | |||
| 2356 | 2932836072 | |||
| 2357 | 2933580687 | |||
| 2358 | 2935615725 | |||
| 2359 | 2935618521 | |||
| 2360 | 2935641078 | |||
| 2361 | 2935653641 | |||
| 2362 | 2935662390 | |||
| 2363 | 2935669994 | |||
| 2364 | 2935679156 | |||
| 2365 | 2935690025 | |||
| 2366 | 2935698544 | |||
| 2367 | 2935711480 | |||
| 2368 | 2935717544 | |||
| 2369 | 2935723786 | |||
| 2370 | 2935739995 | |||
| 2371 | 2935749258 | |||
| 2372 | 2935757379 | |||
| 2373 | 2935763535 | |||
| 2374 | 2935773042 | |||
| 2375 | 2935782985 | |||
| 2376 | 2935787969 | |||
| 2377 | 2935796455 | |||
| 2378 | 2935809958 | |||
| 2379 | 2935816264 | |||
| 2380 | 2935825477 | |||
| 2381 | 2935835657 | |||
| 2382 | 2935844608 | |||
| 2383 | 2935853266 | |||
| 2384 | 2935862946 | |||
| 2385 | 2935866688 | |||
| 2386 | 2935874995 | |||
| 2387 | 2935890149 | |||
| 2388 | 2935914739 | |||
| 2389 | 2935918715 | |||
| 2390 | 2935931568 | |||
| 2391 | 2935940165 | |||
| 2392 | 2935947488 | |||
| 2393 | 2935956260 | |||
| 2394 | 2935962636 | |||
| 2395 | 2935973053 | |||
| 2396 | 2935980704 | |||
| 2397 | 2935985143 | |||
| 2398 | 2935999729 | |||
| 2399 | 2936010573 | |||
| 2400 | 2936016692 | |||
| 2401 | 2936025325 | |||
| 2402 | 2936034167 | |||
| 2403 | 2936041269 | |||
| 2404 | 2936052224 | |||
| 2405 | 2936056315 | |||
| 2406 | 2940563292 | |||
| 2407 | 2941535514 | |||
| 2408 | 2941543207 | |||
| 2409 | 3005475061 | |||
| 2410 | 3005489070 | |||
| 2411 | 3005509160 | |||
| 2412 | 3005592211 | |||
| 2413 | 3005595050 | |||
| 2414 | 3005710998 | |||
| 2415 | 3005718303 | |||
| 2416 | 8006927890 | |||
| 2417 | 8006936235 | |||
| 2418 | 8006969360 | |||
| 2419 | 8006976180 | |||
| 2420 | 8006990922 | |||
| 2421 | 8006996511 | |||
| 2422 | 8016518182 | |||
| 2423 | 8016526139 | |||
| 2424 | 8016544055 | |||
| 2425 | 8016557677 | |||
| 2426 | 8016569460 | |||
| 2427 | 8016582073 | |||
| 2428 | 8016586370 | |||
| 2429 | 8016595710 | |||
| 2430 | 8016606566 | |||
| 2431 | 8016618468 | |||
| 2432 | 8016623160 | |||
| 2433 | 8017058465 | |||
| 2434 | 8019531027 | |||
| 2435 | 8019540553 | |||
| 2436 | 8019550174 | |||
| 2437 | 8019577231 | |||
| 2438 | 8019595311 | |||
| 2439 | 8019606447 | |||
| 2440 | 8019622970 | |||
| 2441 | 8019630136 | |||
| 2442 | 8019640476 | |||
| 2443 | 8019652470 | |||
| 2444 | 8019666970 | |||
| 2445 | 8019676727 | |||
| 2446 | 8019679263 | |||
| 2447 | 8019696240 | |||
| 2448 | 8055742451 | |||
| 2449 | 8056675743 | |||
| 2450 | 8056687394 | |||
| 2451 | 8056690958 | |||
| 2452 | 8056971288 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6y93-assembly1.cif.gz_A | crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) | 0.9508 | 137 | 231 |
| 6y93-assembly1.cif.gz_B | crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) | 0.9249 | 128 | 231 |
| 7bhy-assembly1.cif.gz_B | dna-binding domain of deor in complex with the dna operator | 0.8998 | 144 | 180 |
| 6t1f-assembly2.cif.gz_D | crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site | 0.893 | 41 | 231 |
| 6t1f-assembly2.cif.gz_D | crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site | 0.8799 | 41 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G118_97_208_1.10.10.2830 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9468 | 120 | 227 | 1.10.10.2830 |
| af_Q2FUQ5_107_218_1.10.10.2830 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9464 | 120 | 228 | 1.10.10.2830 |
| af_Q2FUQ5_43_106_3.90.1530.30 | Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; | 0.9392 | 55 | 119 | 3.90.1530.30 |
| af_P9WIJ9_142_255_1.10.10.2830 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9322 | 120 | 228 | 1.10.10.2830 |
| 1vz0A01 | Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; | 0.9192 | 61 | 119 | 3.90.1530.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T4RMR3-F1-model_v4 | deleted | 0.955 | 123 | 231 |
|
| AF-A0A838M0W9-F1-model_v4 | ParB/RepB/Spo0J family partition protein | 0.8631 | 117 | 231 |
GO:0003677
GO:0005694 GO:0007059 |
| AF-A0A2R7S9F1-F1-model_v4 | ParB/Sulfiredoxin domain-containing protein | 0.8614 | 41 | 232 |
GO:0003677
GO:0005694 GO:0007059 GO:0045881 |
| AF-N6Y954-F1-model_v4 | ParB family protein | 0.8519 | 41 | 227 |
GO:0003677
GO:0005694 GO:0007059 |
| AF-A0A1F8VSX0-F1-model_v4 | ParB/Sulfiredoxin domain-containing protein | 0.8478 | 41 | 231 |
GO:0003677
GO:0005694 GO:0007059 |