F491933

General Info

Members Datasets Scaffolds Average Seq Length
1226 660 2452 294

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0011741|Ga0496109_0011741_5631_6476
Length 281
Sequence MAEEARSRLGRGLASLIGDVGGEAAHLDRPRAQRKVPIEFLKPNPRNPRREFADNELRELADSIRQHGVIQPIVVRPARGTQDRFEIIAGERRWRSAQIAGLHEVPIVPVDVSDSDALEIAIIEEAQGYHALAGEFKRSADDIAKIVGKSRSHIANMMRLTKLPAEVQRYIALGKLSAGHARALIGVPDPVAAAKRIIEGDLNVRQAEALAHVEGVPERKPHKARGRKTKDADTAALEKRVSDALGLAVSIDHRDSAGTVHIRYRDLDQLDEIVRRLEAST

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
102 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
103 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
104 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
105 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
168 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
169 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
170 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
175 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
180 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
202 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
203 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
240 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
274 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
275 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
276 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
277 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
278 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
305 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
306 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
312 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
313 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
314 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
339 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
340 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
341 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
342 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
343 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
344 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
345 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
348 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
362 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
363 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
366 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
367 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
368 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
369 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
370 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
371 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
377 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
378 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
379 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
380 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
381 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
382 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
389 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
390 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
391 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
392 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
393 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
394 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
395 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
396 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
397 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
398 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
399 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
400 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
401 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
402 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
403 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
404 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
405 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
406 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
407 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
408 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
409 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
410 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
411 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
412 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
413 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
414 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
415 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
416 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
417 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
418 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
419 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
420 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
421 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
422 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
423 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
424 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
425 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
426 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
427 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
428 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
429 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
430 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
431 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
432 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
433 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
434 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
435 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
436 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
438 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
439 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
440 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
441 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
442 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
443 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
444 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
445 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
446 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
447 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
448 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
449 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
450 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
451 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
452 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
453 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
454 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
455 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
456 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
457 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
458 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
459 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
460 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
461 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
462 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
463 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
464 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
465 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
466 2643221651 Afipia sp. Root123D2 Isolate Unclassified
467 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
468 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
469 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
470 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
471 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
472 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
473 2791355199
474 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
475 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
476 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
477 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
478 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
479 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
480 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
481 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
482 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
483 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
484 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
485 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
486 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
487 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
488 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
489 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
490 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
491 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
492 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
493 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
494 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
495 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
496 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
497 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
498 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
499 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
500 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
501 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
502 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
503 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
504 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
505 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
506 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
507 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
508 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
509 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
510 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
511 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
512 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
513 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
514 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
515 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
516 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
517 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
518 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
519 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
520 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
521 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
522 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
523 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
524 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
525 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
526 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
527 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
528 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
529 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
530 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
531 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
532 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
533 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
534 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
535 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
536 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
537 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
538 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
539 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
540 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
541 2904699407
542 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
543 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
544 2906610324
545 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
546 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
547 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
548 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
549 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
550 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
551 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
552 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
553 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
554 2922368715
555 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
556 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
557 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
558 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
559 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
560 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
561 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
562 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
563 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
564 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
565 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
566 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
567 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
568 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
569 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
570 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
571 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
572 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
573 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
574 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
575 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
576 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
577 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
578 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
579 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
580 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
581 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
582 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
583 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
584 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
585 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
586 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
587 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
588 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
589 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
590 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
591 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
592 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
593 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
594 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
595 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
596 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
597 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
598 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
599 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
600 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
601 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
602 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
603 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
604 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
605 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
606 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
607 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
608 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
609 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
610 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
611 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
612 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
613 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
614 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
615 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
616 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
617 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
618 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
619 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
620 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
621 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
622 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
623 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
624 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
625 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
626 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
627 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
628 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
629 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
630 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
631 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
632 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
633 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
634 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
635 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
636 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
637 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
638 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
639 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
640 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
641 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
642 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
643 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
644 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
645 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
646 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
647 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
648 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
649 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
650 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
651 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
652 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
653 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
654 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
655 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
656 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
657 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
658 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
659 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
660 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.91
Metatranscriptomes 0.16
Isolates 17.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.11
Nodule 14.03
Rhizoplane 7.59
Rhizosphere 56.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0011741 3300048912 Bacteria 7537
2 JGI24740J21852_10000946 3300001979 Bacteria 12915
3 JGI24737J22298_10024439 3300001990 Bacteria 1913
4 JGI24735J21928_10009808 3300002067 Bacteria 3067
5 JGI24738J21930_10006735 3300002075 Bacteria 2673
6 JGI25406J46586_10000066 3300003203 Bacteria 48110
7 JGI25406J46586_10002779 3300003203 Bacteria 8224
8 JGI25153J46596_10003450 3300003215 Bacteria 8852
9 JGI25153J46596_10011834 3300003215 Bacteria 3825
10 JGI25160J50197_1003294 3300003354 Bacteria 7271
11 JGI25404J52841_10007684 3300003659 Bacteria 2285
12 Ga0055526_1043009 3300003771 Bacteria 1106
13 Ga0055531_10014489 3300003794 Bacteria 3545
14 Ga0065165_1000365 3300005262 Bacteria 74017
15 Ga0065165_1001495 3300005262 Bacteria 24729
16 Ga0065165_1019115 3300005262 Bacteria 2458
17 Ga0070658_10068227 3300005327 Bacteria 2907
18 Ga0070658_10084002 3300005327 Bacteria 2618
19 Ga0070683_100005996 3300005329 Bacteria 10180
20 Ga0070683_100013328 3300005329 Bacteria 7167
21 Ga0070683_100421203 3300005329 Bacteria 1274
22 Ga0070690_100211041 3300005330 Bacteria 1356
23 Ga0068868_100016797 3300005338 Bacteria 5443
24 Ga0070660_100038981 3300005339 Bacteria 3610
25 Ga0070691_10133269 3300005341 Bacteria 1261
26 Ga0070669_100066355 3300005353 Bacteria 2660
27 Ga0070671_100129955 3300005355 Bacteria 2121
28 Ga0070674_100088993 3300005356 Bacteria 2223
29 Ga0070674_100234639 3300005356 Bacteria 1433
30 Ga0070673_100084349 3300005364 Bacteria 2584
31 Ga0070659_100118955 3300005366 Bacteria 2138
32 Ga0070709_10000584 3300005434 Bacteria 21359
33 Ga0070709_10004682 3300005434 Bacteria 7388
34 Ga0070709_10013026 3300005434 Bacteria 4667
35 Ga0070709_10105903 3300005434 Bacteria 1882
36 Ga0070714_100004568 3300005435 Bacteria 10439
37 Ga0070714_100118625 3300005435 Bacteria 2351
38 Ga0070713_100005959 3300005436 Bacteria 8384
39 Ga0070713_100010327 3300005436 Bacteria 6743
40 Ga0070713_100157380 3300005436 Bacteria 2026
41 Ga0070713_100415359 3300005436 Bacteria 1259
42 Ga0070710_10002351 3300005437 Bacteria 8946
43 Ga0070710_10004995 3300005437 Bacteria 6278
44 Ga0070710_10109270 3300005437 Bacteria 1659
45 Ga0070711_100000660 3300005439 Bacteria 18001
46 Ga0070711_100004456 3300005439 Bacteria 8265
47 Ga0070711_100019254 3300005439 Bacteria 4377
48 Ga0070711_100022461 3300005439 Bacteria 4090
49 Ga0070711_100474025 3300005439 Bacteria 1028
50 Ga0070663_100062897 3300005455 Bacteria 2677
51 Ga0070678_100015808 3300005456 Bacteria 4807
52 Ga0070681_10014969 3300005458 Bacteria 7713
53 Ga0070681_10051117 3300005458 Bacteria 4123
54 Ga0070681_10089577 3300005458 Bacteria 3028
55 Ga0070698_100068842 3300005471 Bacteria 3556
56 Ga0070679_100039226 3300005530 Bacteria 4707
57 Ga0070679_100044969 3300005530 Bacteria 4399
58 Ga0070679_100066868 3300005530 Bacteria 3584
59 Ga0070679_100120755 3300005530 Bacteria 2605
60 Ga0070684_100007764 3300005535 Bacteria 8363
61 Ga0070684_100024903 3300005535 Bacteria 5023
62 Ga0070684_100058502 3300005535 Bacteria 3368
63 Ga0070697_100289134 3300005536 Bacteria 1407
64 Ga0068853_100001705 3300005539 Bacteria 16098
65 Ga0068853_100029265 3300005539 Bacteria 4641
66 Ga0068853_100086417 3300005539 Bacteria 2750
67 Ga0068853_100196525 3300005539 Bacteria 1835
68 Ga0068853_100279593 3300005539 Bacteria 1539
69 Ga0070696_100109075 3300005546 Bacteria 1992
70 Ga0070665_100028170 3300005548 Bacteria 5657
71 Ga0070665_100099215 3300005548 Bacteria 2916
72 Ga0070665_100250510 3300005548 Bacteria 1772
73 Ga0068855_100015846 3300005563 Bacteria 9068
74 Ga0068855_100034493 3300005563 Bacteria 6035
75 Ga0068855_100274067 3300005563 Bacteria 1875
76 Ga0068855_100526603 3300005563 Bacteria 1282
77 Ga0070664_100189725 3300005564 Bacteria 1831
78 Ga0068857_100021030 3300005577 Bacteria 5741
79 Ga0068857_100041204 3300005577 Bacteria 4095
80 Ga0068857_100227058 3300005577 Bacteria 1706
81 Ga0068857_100576858 3300005577 Bacteria 1061
82 Ga0068854_100222019 3300005578 Bacteria 1495
83 Ga0068854_100318805 3300005578 Bacteria 1263
84 Ga0068856_100005093 3300005614 Bacteria 12992
85 Ga0068856_100012875 3300005614 Bacteria 8096
86 Ga0068856_100065061 3300005614 Bacteria 3603
87 Ga0068856_100129808 3300005614 Bacteria 2525
88 Ga0068852_100042806 3300005616 Bacteria 3836
89 Ga0068852_100104346 3300005616 Bacteria 2566
90 Ga0068852_100341968 3300005616 Bacteria 1458
91 Ga0068859_100184572 3300005617 Bacteria 2169
92 Ga0068864_100026520 3300005618 Bacteria 4886
93 Ga0068851_10002645 3300005834 Bacteria 7896
94 Ga0068851_10030239 3300005834 Bacteria 2685
95 Ga0068858_100033778 3300005842 Bacteria 4744
96 Ga0068858_100094168 3300005842 Bacteria 2790
97 Ga0068858_100394178 3300005842 Bacteria 1330
98 Ga0068860_100001450 3300005843 Bacteria 25677
99 Ga0068860_100136751 3300005843 Bacteria 2353
100 Ga0081455_10009536 3300005937 Bacteria 9971
101 Ga0081455_10010204 3300005937 Bacteria 9559
102 Ga0081455_10037390 3300005937 Bacteria 4313
103 Ga0081455_10048211 3300005937 Bacteria 3683
104 Ga0081538_10086299 3300005981 Bacteria 1644
105 Ga0081540_1003875 3300005983 Bacteria 11676
106 Ga0081540_1005299 3300005983 Bacteria 9654
107 Ga0081540_1011061 3300005983 Bacteria 6059
108 Ga0081540_1012813 3300005983 Bacteria 5486
109 Ga0081540_1021192 3300005983 Bacteria 3881
110 Ga0081539_10000064 3300005985 Bacteria 247020
111 Ga0081539_10004737 3300005985 Bacteria 14713
112 Ga0081539_10029435 3300005985 Bacteria 3430
113 Ga0070717_10006989 3300006028 Bacteria 8350
114 Ga0070717_10043262 3300006028 Bacteria 3675
115 Ga0070717_10088445 3300006028 Bacteria 2611
116 Ga0075365_10066092 3300006038 Bacteria 2426
117 Ga0075365_10318386 3300006038 Bacteria 1095
118 Ga0075368_10003158 3300006042 Bacteria 5475
119 Ga0075363_100016306 3300006048 Bacteria 3669
120 Ga0070715_10000108 3300006163 Bacteria 20251
121 Ga0070715_10019602 3300006163 Bacteria 2597
122 Ga0070716_100002138 3300006173 Bacteria 9082
123 Ga0070716_100013388 3300006173 Bacteria 4178
124 Ga0070712_100047535 3300006175 Bacteria 2970
125 Ga0070712_100240873 3300006175 Bacteria 1441
126 Ga0075367_10092235 3300006178 Bacteria 1844
127 Ga0075369_10043758 3300006186 Bacteria 1922
128 Ga0075369_10076719 3300006186 Bacteria 1478
129 Ga0075366_10061029 3300006195 Bacteria 2240
130 Ga0097621_100249243 3300006237 Bacteria 1555
131 Ga0075370_10156285 3300006353 Bacteria 1337
132 Ga0068871_100330798 3300006358 Bacteria 1344
133 Ga0075428_100045101 3300006844 Bacteria 4844
134 Ga0075430_100389813 3300006846 Bacteria 1150
135 Ga0075433_10217483 3300006852 Bacteria 1698
136 Ga0068865_100349271 3300006881 Bacteria 1198
137 Ga0075436_100397440 3300006914 Bacteria 998
138 Ga0097620_100184562 3300006931 Bacteria 2169
139 Ga0099823_1022515 3300006944 Bacteria 5827
140 Ga0099795_10064146 3300007788 Bacteria 1371
141 Ga0105240_10004955 3300009093 Bacteria 20025
142 Ga0105240_10008228 3300009093 Bacteria 14944
143 Ga0105240_10031181 3300009093 Bacteria 6917
144 Ga0105245_10197939 3300009098 Bacteria 1928
145 Ga0105245_10231917 3300009098 Bacteria 1786
146 Ga0105247_10010882 3300009101 Bacteria 5496
147 Ga0114129_10721610 3300009147 Bacteria 1279
148 Ga0105241_10002286 3300009174 Bacteria 14395
149 Ga0105241_10072988 3300009174 Bacteria 2669
150 Ga0105241_10082572 3300009174 Bacteria 2519
151 Ga0105248_10549277 3300009177 Bacteria 1303
152 Ga0105237_10010095 3300009545 Bacteria 10071
153 Ga0105237_10168546 3300009545 Bacteria 2189
154 Ga0105237_10304187 3300009545 Bacteria 1598
155 Ga0105237_10637369 3300009545 Bacteria 1073
156 Ga0105237_10789028 3300009545 Bacteria 957
157 Ga0105238_10000905 3300009551 Bacteria 30512
158 Ga0105238_10015713 3300009551 Bacteria 7663
159 Ga0105238_10030039 3300009551 Bacteria 5531
160 Ga0105238_10050367 3300009551 Bacteria 4193
161 Ga0105238_10074317 3300009551 Bacteria 3392
162 Ga0105238_10597241 3300009551 Bacteria 1111
163 Ga0105249_10164867 3300009553 Bacteria 2144
164 Ga0105249_10269902 3300009553 Bacteria 1694
165 Ga0105239_10002519 3300010375 Bacteria 23275
166 Ga0105239_10024695 3300010375 Bacteria 6620
167 Ga0105239_10064493 3300010375 Bacteria 4021
168 Ga0105239_10080757 3300010375 Bacteria 3578
169 Ga0105239_10199644 3300010375 Bacteria 2240
170 Ga0105239_10211410 3300010375 Bacteria 2174
171 Ga0105239_10279826 3300010375 Bacteria 1878
172 Ga0105239_10356811 3300010375 Bacteria 1651
173 Ga0105246_10081781 3300011119 Bacteria 2303
174 Ga0157373_10053256 3300013100 Bacteria 2877
175 Ga0157370_10129027 3300013104 Bacteria 2359
176 Ga0157370_10402729 3300013104 Bacteria 1259
177 Ga0157369_10071197 3300013105 Bacteria 3733
178 Ga0157369_10684080 3300013105 Bacteria 1057
179 Ga0157374_10228057 3300013296 Bacteria 1829
180 Ga0157378_10743896 3300013297 Bacteria 1003
181 Ga0163162_10277441 3300013306 Bacteria 1808
182 Ga0157372_10271108 3300013307 Bacteria 1972
183 Ga0157375_10028391 3300013308 Bacteria 5244
184 Ga0157375_10293938 3300013308 Bacteria 1788
185 Ga0157375_10410565 3300013308 Bacteria 1520
186 Ga0163163_10002009 3300014325 Bacteria 17183
187 Ga0163163_10033178 3300014325 Bacteria 4992
188 Ga0157380_10127343 3300014326 Bacteria 2167
189 Ga0182008_10159463 3300014497 Bacteria 1135
190 Ga0157377_10178578 3300014745 Bacteria 1333
191 Ga0157379_10179402 3300014968 Bacteria 1913
192 Ga0157376_10010998 3300014969 Bacteria 6649
193 Ga0206353_10148081 3300020082 Bacteria 1075
194 Ga0206353_10567907 3300020082 Bacteria 2027
195 Ga0214544_1000016 3300021320 Bacteria 204278
196 Ga0214542_1000016 3300021321 Bacteria 210332
197 Ga0214545_1000008 3300021324 Bacteria 215190
198 Ga0214543_1001466 3300021327 Bacteria 45567
199 Ga0213873_10024285 3300021358 Bacteria 1453
200 Ga0213872_10015515 3300021361 Bacteria 3540
201 Ga0213876_10002439 3300021384 Bacteria 10933
202 Ga0209563_108642 3300025230 Bacteria 1592
203 Ga0209677_100672 3300025253 Bacteria 17650
204 Ga0209677_105633 3300025253 Bacteria 3210
205 Ga0209148_1000282 3300025254 Bacteria 78016
206 Ga0209233_1005872 3300025261 Bacteria 4028
207 Ga0209455_1002393 3300025272 Bacteria 7284
208 Ga0207673_1005554 3300025290 Bacteria 1542
209 Ga0209564_1000321 3300025295 Bacteria 93331
210 Ga0209564_1003702 3300025295 Bacteria 10062
211 Ga0209758_1000069 3300025297 Bacteria 286161
212 Ga0209758_1000635 3300025297 Bacteria 53736
213 Ga0209758_1001996 3300025297 Bacteria 21984
214 Ga0209758_1002493 3300025297 Bacteria 18700
215 Ga0209758_1011302 3300025297 Bacteria 5193
216 Ga0209758_1017490 3300025297 Bacteria 3566
217 Ga0209256_1015129 3300025299 Bacteria 2720
218 Ga0209256_1032713 3300025299 Bacteria 1407
219 Ga0207426_1002082 3300025302 Bacteria 13833
220 Ga0207426_1004116 3300025302 Bacteria 7310
221 Ga0207426_1020494 3300025302 Bacteria 2297
222 Ga0207426_1024931 3300025302 Bacteria 2021
223 Ga0209257_1000473 3300025304 Bacteria 73323
224 Ga0209257_1017693 3300025304 Bacteria 2792
225 Ga0207697_10065589 3300025315 Bacteria 1515
226 Ga0207656_10008173 3300025321 Bacteria 3840
227 Ga0207692_10002026 3300025898 Bacteria 7732
228 Ga0207692_10012905 3300025898 Bacteria 3605
229 Ga0207647_10014195 3300025904 Bacteria 5498
230 Ga0207647_10168847 3300025904 Bacteria 1274
231 Ga0207685_10016028 3300025905 Bacteria 2388
232 Ga0207685_10035616 3300025905 Bacteria 1818
233 Ga0207699_10003043 3300025906 Bacteria 7960
234 Ga0207699_10007202 3300025906 Bacteria 5431
235 Ga0207699_10038283 3300025906 Bacteria 2747
236 Ga0207699_10245906 3300025906 Bacteria 1231
237 Ga0207699_10323155 3300025906 Bacteria 1083
238 Ga0207645_10179478 3300025907 Bacteria 1389
239 Ga0207684_10077500 3300025910 Bacteria 2827
240 Ga0207654_10000058 3300025911 Bacteria 75628
241 Ga0207654_10006549 3300025911 Bacteria 5860
242 Ga0207654_10011597 3300025911 Bacteria 4498
243 Ga0207654_10089954 3300025911 Bacteria 1869
244 Ga0207707_10004700 3300025912 Bacteria 11981
245 Ga0207707_10035006 3300025912 Bacteria 4391
246 Ga0207707_10054133 3300025912 Bacteria 3493
247 Ga0207707_10104173 3300025912 Bacteria 2479
248 Ga0207707_10158480 3300025912 Bacteria 1979
249 Ga0207695_10000107 3300025913 Bacteria 252606
250 Ga0207695_10000453 3300025913 Bacteria 89314
251 Ga0207695_10115822 3300025913 Bacteria 2654
252 Ga0207695_10254960 3300025913 Bacteria 1653
253 Ga0207695_10318707 3300025913 Bacteria 1444
254 Ga0207671_10018412 3300025914 Bacteria 5360
255 Ga0207671_10042434 3300025914 Bacteria 3367
256 Ga0207671_10069130 3300025914 Bacteria 2633
257 Ga0207671_10094158 3300025914 Bacteria 2260
258 Ga0207671_10282289 3300025914 Bacteria 1310
259 Ga0207671_10461891 3300025914 Bacteria 1012
260 Ga0207693_10000310 3300025915 Bacteria 45408
261 Ga0207693_10021450 3300025915 Bacteria 5132
262 Ga0207693_10034078 3300025915 Bacteria 4016
263 Ga0207693_10035714 3300025915 Bacteria 3919
264 Ga0207693_10181848 3300025915 Bacteria 1655
265 Ga0207693_10354295 3300025915 Bacteria 1148
266 Ga0207663_10016715 3300025916 Bacteria 4075
267 Ga0207663_10019867 3300025916 Bacteria 3793
268 Ga0207663_10083697 3300025916 Bacteria 2096
269 Ga0207660_10076914 3300025917 Bacteria 2441
270 Ga0207660_10081275 3300025917 Bacteria 2381
271 Ga0207660_10189160 3300025917 Bacteria 1602
272 Ga0207657_10029294 3300025919 Bacteria 5013
273 Ga0207657_10073517 3300025919 Bacteria 2889
274 Ga0207657_10131985 3300025919 Bacteria 2046
275 Ga0207649_10410030 3300025920 Bacteria 1016
276 Ga0207652_10076915 3300025921 Bacteria 2911
277 Ga0207652_10079219 3300025921 Bacteria 2870
278 Ga0207652_10136044 3300025921 Bacteria 2194
279 Ga0207681_10066644 3300025923 Bacteria 2493
280 Ga0207694_10001009 3300025924 Bacteria 24556
281 Ga0207694_10034117 3300025924 Bacteria 3901
282 Ga0207694_10274993 3300025924 Bacteria 1382
283 Ga0207687_10004089 3300025927 Bacteria 9778
284 Ga0207687_10330306 3300025927 Bacteria 1237
285 Ga0207687_10350902 3300025927 Bacteria 1202
286 Ga0207700_10093504 3300025928 Bacteria 2380
287 Ga0207700_10117026 3300025928 Bacteria 2154
288 Ga0207700_10154584 3300025928 Bacteria 1899
289 Ga0207664_10061778 3300025929 Bacteria 2990
290 Ga0207664_10103518 3300025929 Bacteria 2356
291 Ga0207664_10487302 3300025929 Bacteria 1103
292 Ga0207664_10588483 3300025929 Bacteria 999
293 Ga0207644_10066408 3300025931 Bacteria 2626
294 Ga0207706_10203009 3300025933 Bacteria 1738
295 Ga0207709_10250155 3300025935 Bacteria 1294
296 Ga0207665_10001734 3300025939 Bacteria 14668
297 Ga0207665_10004258 3300025939 Bacteria 9511
298 Ga0207665_10061076 3300025939 Bacteria 2554
299 Ga0207665_10085508 3300025939 Bacteria 2178
300 Ga0207691_10172053 3300025940 Bacteria 1896
301 Ga0207691_10203813 3300025940 Bacteria 1721
302 Ga0207691_10441320 3300025940 Bacteria 1108
303 Ga0207711_10211107 3300025941 Bacteria 1773
304 Ga0207689_10039585 3300025942 Bacteria 3902
305 Ga0207661_10044403 3300025944 Bacteria 3512
306 Ga0207661_10056040 3300025944 Bacteria 3163
307 Ga0207661_10073930 3300025944 Bacteria 2793
308 Ga0207661_10175645 3300025944 Bacteria 1867
309 Ga0207661_10670737 3300025944 Bacteria 953
310 Ga0207679_10390674 3300025945 Bacteria 1222
311 Ga0207667_10006596 3300025949 Bacteria 14034
312 Ga0207667_10088774 3300025949 Bacteria 3196
313 Ga0207667_10109852 3300025949 Bacteria 2844
314 Ga0207667_10160793 3300025949 Bacteria 2310
315 Ga0207667_10281972 3300025949 Bacteria 1698
316 Ga0207640_10047734 3300025981 Bacteria 2764
317 Ga0207640_10186435 3300025981 Bacteria 1560
318 Ga0207658_10306396 3300025986 Bacteria 1370
319 Ga0207677_10024413 3300026023 Bacteria 3756
320 Ga0207677_10198955 3300026023 Bacteria 1591
321 Ga0207703_10078340 3300026035 Bacteria 2746
322 Ga0207703_10281990 3300026035 Bacteria 1509
323 Ga0207639_10013217 3300026041 Bacteria 5772
324 Ga0207639_10123004 3300026041 Bacteria 2135
325 Ga0207678_10003936 3300026067 Bacteria 13364
326 Ga0207678_10046674 3300026067 Bacteria 3746
327 Ga0207678_10096010 3300026067 Bacteria 2533
328 Ga0207678_10422037 3300026067 Bacteria 1157
329 Ga0207708_10085681 3300026075 Bacteria 2424
330 Ga0207702_10000004 3300026078 Bacteria 422182
331 Ga0207702_10001701 3300026078 Bacteria 21732
332 Ga0207702_10337936 3300026078 Bacteria 1438
333 Ga0207641_10327266 3300026088 Bacteria 1455
334 Ga0207648_10060413 3300026089 Bacteria 3305
335 Ga0207648_10238899 3300026089 Bacteria 1617
336 Ga0207676_10095612 3300026095 Bacteria 2450
337 Ga0207676_10114523 3300026095 Bacteria 2262
338 Ga0207674_10000890 3300026116 Bacteria 39065
339 Ga0207674_10002298 3300026116 Bacteria 24210
340 Ga0207674_10007766 3300026116 Bacteria 12478
341 Ga0207674_10052673 3300026116 Bacteria 4150
342 Ga0207674_10299290 3300026116 Bacteria 1558
343 Ga0207675_100122516 3300026118 Bacteria 2461
344 Ga0207675_100389764 3300026118 Bacteria 1371
345 Ga0207683_10016524 3300026121 Bacteria 6283
346 Ga0207683_10169315 3300026121 Bacteria 1978
347 Ga0207698_10031595 3300026142 Bacteria 3824
348 Ga0207698_10183463 3300026142 Bacteria 1856
349 Ga0207698_10350202 3300026142 Bacteria 1395
350 Ga0209389_1000033 3300027296 Bacteria 131516
351 Ga0209389_1000182 3300027296 Bacteria 48705
352 Ga0209589_1000021 3300027357 Bacteria 186431
353 Ga0209589_1000040 3300027357 Bacteria 126550
354 Ga0209489_100028 3300027361 Bacteria 186431
355 Ga0209489_100045 3300027361 Bacteria 158225
356 Ga0209489_100209 3300027361 Bacteria 96349
357 Ga0209700_100011 3300027363 Bacteria 362159
358 Ga0209700_100037 3300027363 Bacteria 186431
359 Ga0209588_1073887 3300027671 Bacteria 1101
360 Ga0268266_10045729 3300028379 Bacteria 3745
361 Ga0268266_10184329 3300028379 Bacteria 1902
362 Ga0268266_10199057 3300028379 Bacteria 1832
363 Ga0268266_10410158 3300028379 Bacteria 1282
364 Ga0268264_10000062 3300028381 Bacteria 302110
365 Ga0265337_1018782 3300028556 Bacteria 2189
366 Ga0265326_10008390 3300028558 Bacteria 3118
367 Ga0265319_1012969 3300028563 Bacteria 3340
368 Ga0265334_10013964 3300028573 Bacteria 3354
369 Ga0265318_10016635 3300028577 Bacteria 3034
370 Ga0265323_10007956 3300028653 Bacteria 4383
371 Ga0265336_10000561 3300028666 Bacteria 21059
372 Ga0307517_10001338 3300028786 Bacteria 41372
373 Ga0307515_10125511 3300028794 Bacteria 2870
374 Ga0307515_10140350 3300028794 Bacteria 2596
375 Ga0265338_10000598 3300028800 Bacteria 63497
376 Ga0265332_10016039 3300031238 Bacteria 3306
377 Ga0265332_10027603 3300031238 Bacteria 2486
378 Ga0265332_10072613 3300031238 Bacteria 1465
379 Ga0265328_10044554 3300031239 Bacteria 1632
380 Ga0265325_10009157 3300031241 Bacteria 5799
381 Ga0265340_10041599 3300031247 Bacteria 2258
382 Ga0265340_10042492 3300031247 Bacteria 2231
383 Ga0265339_10007110 3300031249 Bacteria 7267
384 Ga0265339_10029701 3300031249 Bacteria 3099
385 Ga0265339_10099122 3300031249 Bacteria 1519
386 Ga0265331_10027874 3300031250 Bacteria 2828
387 Ga0265331_10100059 3300031250 Bacteria 1335
388 Ga0307513_10105188 3300031456 Bacteria 2833
389 Ga0307513_10164506 3300031456 Bacteria 2105
390 Ga0307513_10169966 3300031456 Bacteria 2059
391 Ga0307513_10222288 3300031456 Bacteria 1708
392 Ga0307408_100239375 3300031548 Bacteria 1491
393 Ga0265313_10041739 3300031595 Bacteria 2258
394 Ga0307508_10000002 3300031616 Bacteria 407635
395 Ga0307508_10078616 3300031616 Bacteria 2879
396 Ga0265314_10005687 3300031711 Bacteria 11193
397 Ga0265314_10147464 3300031711 Bacteria 1447
398 Ga0265342_10005853 3300031712 Bacteria 9282
399 Ga0307516_10006094 3300031730 Bacteria 14234
400 Ga0307516_10010553 3300031730 Bacteria 10142
401 Ga0307516_10104788 3300031730 Bacteria 2640
402 Ga0307406_10168105 3300031901 Bacteria 1584
403 Ga0307415_100362721 3300032126 Bacteria 1224
404 Ga0307507_10027443 3300033179 Bacteria 6103
405 Ga0307510_10024755 3300033180 Bacteria 6932
406 Ga0307510_10025056 3300033180 Bacteria 6887
407 Ga0315911_1000008 3300033442 Bacteria 381285
408 Ga0316215_1002237 3300033544 Bacteria 1828
409 Ga0373926_0039711 3300035083 Bacteria 1679
410 Ga0373934_0002932 3300035086 Bacteria 6241
411 Ga0373944_0042120 3300035089 Bacteria 1415
412 Ga0373923_0009618 3300035111 Bacteria 3495
413 Ga0373936_0016692 3300035113 Bacteria 2825
414 Ga0373936_0036388 3300035113 Bacteria 1963
415 Ga0373936_0070087 3300035113 Bacteria 1444
416 Ga0373936_0133190 3300035113 Bacteria 1069
417 Ga0373941_0063086 3300035115 Bacteria 1211
418 Ga0373945_0002529 3300035116 Bacteria 5721
419 Ga0373945_0019734 3300035116 Bacteria 2302
420 Ga0373953_0000955 3300035117 Bacteria 8086
421 Ga0373953_0034938 3300035117 Bacteria 1973
422 Ga0373954_0018760 3300035118 Bacteria 3116
423 Ga0373954_0018968 3300035118 Bacteria 3100
424 Ga0373956_0068497 3300035119 Bacteria 1616
425 Ga0373957_0006831 3300035120 Bacteria 3617
426 Ga0373943_0002107 3300035170 Bacteria 9037
427 Ga0373943_0046258 3300035170 Bacteria 2123
428 Ga0373943_0056690 3300035170 Bacteria 1945
429 Ga0373943_0083317 3300035170 Bacteria 1643
430 Ga0373946_0001889 3300035171 Bacteria 7311
431 Ga0373946_0104972 3300035171 Bacteria 1271
432 Ga0373955_0005406 3300035172 Bacteria 5739
433 Ga0373924_0005676 3300035410 Bacteria 4427
434 Ga0373924_0060733 3300035410 Bacteria 1581
435 Ga0373931_0019569 3300035691 Bacteria 3382
436 Ga0373935_0000557 3300035692 Bacteria 19409
437 Ga0373935_0308415 3300035692 Bacteria 1120
438 Ga0373935_0443493 3300035692 Bacteria 937
439 Ga0373927_0003654 3300035695 Bacteria 10968
440 Ga0373927_0010418 3300035695 Bacteria 6199
441 Ga0373927_0021960 3300035695 Bacteria 4182
442 Ga0373927_0027049 3300035695 Bacteria 3748
443 Ga0373927_0036371 3300035695 Bacteria 3202
444 Ga0373927_0235046 3300035695 Bacteria 1204
445 Ga0373933_0000031 3300035724 Bacteria 85038
446 Ga0373933_0003419 3300035724 Bacteria 8846
447 Ga0373933_0082944 3300035724 Bacteria 1968
448 Ga0373947_0000509 3300035725 Bacteria 22579
449 Ga0373947_0049307 3300035725 Bacteria 2528
450 Ga0373947_0151339 3300035725 Bacteria 1495
451 Ga0373947_0346433 3300035725 Bacteria 996
452 Ga0373937_0033982 3300036401 Bacteria 4636
453 Ga0373937_0284966 3300036401 Bacteria 1560
454 Ga0373937_0380292 3300036401 Bacteria 1339
455 Ga0373925_0001713 3300037068 Bacteria 18492
456 Ga0373925_0025981 3300037068 Bacteria 4281
457 Ga0373925_0078993 3300037068 Bacteria 2499
458 Ga0373925_0110677 3300037068 Bacteria 2121
459 Ga0373925_0110804 3300037068 Bacteria 2120
460 Ga0373925_0192510 3300037068 Bacteria 1618
461 Ga0373925_0205586 3300037068 Bacteria 1567
462 Ga0395900_0003383 3300037418 Bacteria 17226
463 Ga0395900_0080281 3300037418 Bacteria 3352
464 Ga0395900_0546461 3300037418 Bacteria 1103
465 Ga0395898_0013386 3300037466 Bacteria 8449
466 Ga0395898_0018463 3300037466 Bacteria 7111
467 Ga0395898_0079473 3300037466 Bacteria 3164
468 Ga0395898_0099077 3300037466 Bacteria 2799
469 Ga0395905_0005856 3300037471 Bacteria 12492
470 Ga0395905_0023254 3300037471 Bacteria 5859
471 Ga0395905_0060606 3300037471 Bacteria 3538
472 Ga0395905_0165060 3300037471 Bacteria 2081
473 Ga0436364_0709114 3300037853 Bacteria 1183
474 Ga0395901_0161395 3300038443 Bacteria 2354
475 Ga0395901_0224667 3300038443 Bacteria 1962
476 Ga0436365_0076766 3300039437 Bacteria 1643
477 Ga0436365_0803057 3300039437 Bacteria 5477
478 Ga0436365_0958057 3300039437 Bacteria 1211
479 Ga0436365_0966323 3300039437 Bacteria 3151
480 Ga0436365_1369931 3300039437 Bacteria 1176
481 Ga0436361_0336324 3300039447 Bacteria 2835
482 Ga0436361_0937863 3300039447 Bacteria 1391
483 Ga0436363_0697337 3300039450 Bacteria 2088
484 Ga0439465_0013621 3300041413 Bacteria 2533
485 Ga0466969_0128100 3300044656 Bacteria 1178
486 Ga0466972_0000119 3300044658 Bacteria 66620
487 Ga0466972_0010560 3300044658 Bacteria 4634
488 Ga0466966_0034959 3300044684 Bacteria 3248
489 Ga0466966_0041766 3300044684 Bacteria 2946
490 Ga0466961_0000139 3300044693 Bacteria 48781
491 Ga0466963_0080797 3300044694 Bacteria 2201
492 Ga0466963_0117349 3300044694 Bacteria 1829
493 Ga0466971_0174557 3300044719 Bacteria 1009
494 Ga0466968_0017207 3300044735 Bacteria 2886
495 Ga0466968_0021266 3300044735 Bacteria 2626
496 Ga0466968_0100658 3300044735 Bacteria 1290
497 Ga0466970_0045604 3300044765 Bacteria 2335
498 Ga0466970_0185989 3300044765 Bacteria 1153
499 Ga0466957_0035033 3300044842 Bacteria 3012
500 Ga0466960_0000848 3300044901 Bacteria 10813
501 Ga0466959_0034008 3300045049 Bacteria 3771
502 Ga0466959_0053472 3300045049 Bacteria 2952
503 Ga0466959_0240101 3300045049 Bacteria 1252
504 Ga0466959_0361912 3300045049 Bacteria 988
505 Ga0466967_0004006 3300045976 Bacteria 9819
506 Ga0466967_0011512 3300045976 Bacteria 6706
507 Ga0466967_0088324 3300045976 Bacteria 2813
508 Ga0466967_0160685 3300045976 Bacteria 2108
509 Ga0495592_0058216 3300046454 Bacteria 2850
510 Ga0495592_0140768 3300046454 Bacteria 1678
511 Ga0495592_0300267 3300046454 Bacteria 1044
512 Ga0495603_0000047 3300046455 Bacteria 53081
513 Ga0495603_0055753 3300046455 Bacteria 2341
514 Ga0495603_0070506 3300046455 Bacteria 2054
515 Ga0495629_0000320 3300046459 Bacteria 41151
516 Ga0495629_0005536 3300046459 Bacteria 9427
517 Ga0495629_0231283 3300046459 Bacteria 1274
518 Ga0495638_0001094 3300046460 Bacteria 26401
519 Ga0495638_0053016 3300046460 Bacteria 2524
520 Ga0495641_0009584 3300046461 Bacteria 5738
521 Ga0495651_0017530 3300046462 Bacteria 5546
522 Ga0495651_0041190 3300046462 Bacteria 3588
523 Ga0495651_0086113 3300046462 Bacteria 2365
524 Ga0495651_0095034 3300046462 Bacteria 2230
525 Ga0495653_0003027 3300046463 Bacteria 13478
526 Ga0495653_0070906 3300046463 Bacteria 2606
527 Ga0495580_0090453 3300046472 Bacteria 2131
528 Ga0495582_0000043 3300046473 Bacteria 63647
529 Ga0495582_0024699 3300046473 Bacteria 3289
530 Ga0495582_0032646 3300046473 Bacteria 2862
531 Ga0495582_0042626 3300046473 Bacteria 2499
532 Ga0495605_0072307 3300046474 Bacteria 1627
533 Ga0495605_0092896 3300046474 Bacteria 1396
534 Ga0495639_0000091 3300046475 Bacteria 44027
535 Ga0495662_0000128 3300046476 Bacteria 28645
536 Ga0495664_0009771 3300046477 Bacteria 5377
537 Ga0495664_0016934 3300046477 Bacteria 4162
538 Ga0495664_0053492 3300046477 Bacteria 2401
539 Ga0495584_0016366 3300046491 Bacteria 3782
540 Ga0495584_0036022 3300046491 Bacteria 2500
541 Ga0495585_0027616 3300046492 Bacteria 3239
542 Ga0495594_0002035 3300046499 Bacteria 10525
543 Ga0495594_0137115 3300046499 Bacteria 1387
544 Ga0495596_0056530 3300046500 Bacteria 1532
545 Ga0495607_0012073 3300046501 Bacteria 5715
546 Ga0495583_0020205 3300046506 Bacteria 3457
547 Ga0495606_0000252 3300046507 Bacteria 94511
548 Ga0495606_0037168 3300046507 Bacteria 3308
549 Ga0495606_0048505 3300046507 Bacteria 2792
550 Ga0495606_0082443 3300046507 Bacteria 1996
551 Ga0495606_0194800 3300046507 Bacteria 1159
552 Ga0495608_0017766 3300046511 Bacteria 4918
553 Ga0495610_0055708 3300046512 Bacteria 1904
554 Ga0495616_0025586 3300046513 Bacteria 3151
555 Ga0495616_0134523 3300046513 Bacteria 1130
556 Ga0495618_0010884 3300046514 Bacteria 5507
557 Ga0495620_0014398 3300046515 Bacteria 4020
558 Ga0495628_0057540 3300046516 Bacteria 3058
559 Ga0495628_0108009 3300046516 Bacteria 2142
560 Ga0495628_0261808 3300046516 Bacteria 1289
561 Ga0495628_0314815 3300046516 Bacteria 1156
562 Ga0495630_0014946 3300046517 Bacteria 5661
563 Ga0495631_0025195 3300046518 Bacteria 2741
564 Ga0495631_0081283 3300046518 Bacteria 1398
565 Ga0495637_0028566 3300046520 Bacteria 2490
566 Ga0495643_0063715 3300046522 Bacteria 1949
567 Ga0495644_0031813 3300046523 Bacteria 1994
568 Ga0495648_0000286 3300046524 Bacteria 57430
569 Ga0495648_0024325 3300046524 Bacteria 4127
570 Ga0495648_0044368 3300046524 Bacteria 2776
571 Ga0495648_0072499 3300046524 Bacteria 1992
572 Ga0495648_0125545 3300046524 Bacteria 1372
573 Ga0495666_0015987 3300046526 Bacteria 3737
574 Ga0495666_0192723 3300046526 Bacteria 939
575 Ga0495652_0011857 3300046529 Bacteria 7878
576 Ga0495652_0034268 3300046529 Bacteria 4426
577 Ga0495665_0000051 3300046531 Bacteria 46836
578 Ga0495640_0007555 3300046533 Bacteria 8540
579 Ga0495640_0018565 3300046533 Bacteria 5152
580 Ga0495640_0074727 3300046533 Bacteria 2265
581 Ga0495640_0112835 3300046533 Bacteria 1774
582 Ga0495586_0047218 3300046535 Bacteria 2324
583 Ga0495587_0008144 3300046536 Bacteria 6757
584 Ga0495587_0029650 3300046536 Bacteria 3321
585 Ga0495598_0005762 3300046537 Bacteria 2766
586 Ga0495645_0021133 3300046543 Bacteria 4704
587 Ga0495645_0102551 3300046543 Bacteria 2033
588 Ga0495622_0015099 3300046557 Bacteria 3590
589 Ga0495622_0021698 3300046557 Bacteria 2990
590 Ga0495633_0006412 3300046558 Bacteria 6977
591 Ga0495667_0004751 3300046559 Bacteria 9185
592 Ga0495667_0006502 3300046559 Bacteria 7933
593 Ga0495667_0033150 3300046559 Bacteria 3457
594 Ga0495667_0175879 3300046559 Bacteria 1375
595 Ga0495667_0188219 3300046559 Bacteria 1323
596 Ga0495668_0029459 3300046616 Bacteria 3101
597 Ga0495634_0000400 3300046642 Bacteria 42620
598 Ga0495634_0021637 3300046642 Bacteria 4542
599 Ga0495634_0044581 3300046642 Bacteria 3001
600 Ga0495634_0076053 3300046642 Bacteria 2204
601 Ga0495625_0017905 3300046660 Bacteria 5537
602 Ga0495625_0104162 3300046660 Bacteria 1945
603 Ga0495635_0000620 3300046663 Bacteria 22835
604 Ga0495635_0002202 3300046663 Bacteria 13254
605 Ga0495635_0004059 3300046663 Bacteria 10161
606 Ga0495635_0043268 3300046663 Bacteria 3108
607 Ga0495661_0019545 3300046665 Bacteria 4437
608 Ga0495657_0006604 3300046675 Bacteria 9061
609 Ga0495657_0013678 3300046675 Bacteria 5977
610 Ga0495657_0030794 3300046675 Bacteria 3754
611 Ga0495657_0042749 3300046675 Bacteria 3092
612 Ga0495599_0009906 3300046678 Bacteria 5832
613 Ga0495599_0069977 3300046678 Bacteria 2190
614 Ga0495623_0012518 3300046679 Bacteria 5488
615 Ga0495623_0037441 3300046679 Bacteria 3103
616 Ga0495623_0213500 3300046679 Bacteria 1103
617 Ga0495646_0000643 3300046680 Bacteria 19081
618 Ga0495646_0043973 3300046680 Bacteria 2733
619 Ga0495647_0002769 3300046681 Bacteria 5563
620 Ga0495658_0000499 3300046683 Bacteria 21574
621 Ga0495658_0114457 3300046683 Bacteria 1625
622 Ga0495613_0008984 3300046689 Bacteria 7414
623 Ga0495613_0025117 3300046689 Bacteria 4440
624 Ga0495624_0003704 3300046690 Bacteria 11299
625 Ga0495624_0021704 3300046690 Bacteria 4254
626 Ga0495624_0096046 3300046690 Bacteria 1826
627 Ga0495670_0001762 3300046691 Bacteria 10629
628 Ga0495670_0125248 3300046691 Bacteria 1337
629 Ga0495671_0161834 3300046692 Bacteria 1088
630 Ga0495649_0012129 3300046694 Bacteria 5029
631 Ga0495589_0051700 3300046794 Bacteria 2031
632 Ga0495600_0011578 3300046809 Bacteria 5501
633 Ga0495600_0013331 3300046809 Bacteria 5162
634 Ga0495581_0000486 3300047315 Bacteria 20240
635 Ga0495581_0061415 3300047315 Bacteria 2172
636 Ga0495581_0114111 3300047315 Bacteria 1571
637 Ga0495581_0115928 3300047315 Bacteria 1558
638 Ga0495604_0010785 3300047317 Bacteria 7256
639 Ga0495604_0023859 3300047317 Bacteria 4881
640 Ga0495604_0031639 3300047317 Bacteria 4196
641 Ga0495604_0145351 3300047317 Bacteria 1690
642 Ga0495674_0005428 3300047319 Bacteria 12243
643 Ga0495674_0023537 3300047319 Bacteria 5675
644 Ga0495674_0131189 3300047319 Bacteria 2111
645 Ga0495672_0022435 3300047320 Bacteria 4103
646 Ga0495672_0066467 3300047320 Bacteria 2057
647 Ga0495672_0081560 3300047320 Bacteria 1801
648 Ga0495676_0061706 3300047321 Bacteria 2931
649 Ga0495676_0087102 3300047321 Bacteria 2348
650 Ga0495676_0108612 3300047321 Bacteria 2040
651 Ga0495676_0114727 3300047321 Bacteria 1970
652 Ga0495680_0000689 3300047322 Bacteria 37846
653 Ga0495680_0001909 3300047322 Bacteria 21876
654 Ga0495680_0040967 3300047322 Bacteria 3685
655 Ga0495680_0099424 3300047322 Bacteria 2169
656 Ga0495680_0231698 3300047322 Bacteria 1315
657 Ga0495683_0044814 3300047323 Bacteria 2224
658 Ga0495683_0073135 3300047323 Bacteria 1681
659 Ga0495687_008047 3300047443 Bacteria 6093
660 Ga0495675_0008329 3300047444 Bacteria 6418
661 Ga0495675_0103236 3300047444 Bacteria 1782
662 Ga0495681_0100394 3300047470 Bacteria 1266
663 Ga0495684_0000313 3300047471 Bacteria 39705
664 Ga0495684_0012322 3300047471 Bacteria 6595
665 Ga0495684_0103192 3300047471 Bacteria 2155
666 Ga0495684_0145236 3300047471 Bacteria 1777
667 Ga0495684_0206990 3300047471 Bacteria 1444
668 Ga0495686_0063919 3300047472 Bacteria 2279
669 Ga0495593_0000005 3300047673 Bacteria 93984
670 Ga0495593_0002672 3300047673 Bacteria 10727
671 Ga0495593_0063063 3300047673 Bacteria 1936
672 Ga0495602_0015257 3300048088 Bacteria 7760
673 Ga0495602_0095535 3300048088 Bacteria 2453
674 Ga0495602_0118872 3300048088 Bacteria 2130
675 Ga0495614_0006832 3300048089 Bacteria 5104
676 Ga0495626_0025505 3300048091 Bacteria 2890
677 Ga0495626_0055731 3300048091 Bacteria 1811
678 Ga0495626_0079507 3300048091 Bacteria 1459
679 Ga0496100_0006321 3300048903 Bacteria 6455
680 Ga0496100_0093302 3300048903 Bacteria 2059
681 Ga0496100_0199871 3300048903 Bacteria 1456
682 Ga0496100_0331609 3300048903 Bacteria 1145
683 Ga0496101_0018505 3300048904 Bacteria 4738
684 Ga0496101_0041241 3300048904 Bacteria 3291
685 Ga0496101_0230209 3300048904 Bacteria 1440
686 Ga0496101_0496314 3300048904 Bacteria 964
687 Ga0496102_0001314 3300048905 Bacteria 22298
688 Ga0496102_0009090 3300048905 Bacteria 8527
689 Ga0496102_0542835 3300048905 Bacteria 1085
690 Ga0496102_0554459 3300048905 Bacteria 1072
691 Ga0496103_0025364 3300048906 Bacteria 3582
692 Ga0496103_0047615 3300048906 Bacteria 2649
693 Ga0496103_0250773 3300048906 Bacteria 1139
694 Ga0496104_0002280 3300048907 Bacteria 16544
695 Ga0496104_0003037 3300048907 Bacteria 14457
696 Ga0496104_0007367 3300048907 Bacteria 9720
697 Ga0496104_0018994 3300048907 Bacteria 6280
698 Ga0496104_0030135 3300048907 Bacteria 5040
699 Ga0496104_0159295 3300048907 Bacteria 2165
700 Ga0496104_0272046 3300048907 Bacteria 1607
701 Ga0496105_0000935 3300048908 Bacteria 19915
702 Ga0496105_0003051 3300048908 Bacteria 12313
703 Ga0496105_0027371 3300048908 Bacteria 4657
704 Ga0496105_0040662 3300048908 Bacteria 3834
705 Ga0496105_0126887 3300048908 Bacteria 2103
706 Ga0496106_0000236 3300048909 Bacteria 38678
707 Ga0496106_0014089 3300048909 Bacteria 5908
708 Ga0496106_0060156 3300048909 Bacteria 2879
709 Ga0496106_0126165 3300048909 Bacteria 2004
710 Ga0496106_0264519 3300048909 Bacteria 1376
711 Ga0496107_0003292 3300048910 Bacteria 10781
712 Ga0496107_0091750 3300048910 Bacteria 2220
713 Ga0496107_0110889 3300048910 Bacteria 2016
714 Ga0496107_0130670 3300048910 Bacteria 1854
715 Ga0496107_0152209 3300048910 Bacteria 1711
716 Ga0496107_0171489 3300048910 Bacteria 1610
717 Ga0496107_0239906 3300048910 Bacteria 1349
718 Ga0496107_0244377 3300048910 Bacteria 1335
719 Ga0496107_0265433 3300048910 Bacteria 1277
720 Ga0496108_0000849 3300048911 Bacteria 23796
721 Ga0496108_0016993 3300048911 Bacteria 5947
722 Ga0496108_0047577 3300048911 Bacteria 3585
723 Ga0496108_0053230 3300048911 Bacteria 3394
724 Ga0496108_0304768 3300048911 Bacteria 1388
725 Ga0496108_0360185 3300048911 Bacteria 1269
726 Ga0496108_0372747 3300048911 Bacteria 1246
727 Ga0496109_0000224 3300048912 Bacteria 55854
728 Ga0496109_0010749 3300048912 Bacteria 7835
729 Ga0496109_0073871 3300048912 Bacteria 3134
730 Ga0496109_0148771 3300048912 Bacteria 2192
731 Ga0496110_0004203 3300048913 Bacteria 11133
732 Ga0496110_0008119 3300048913 Bacteria 8433
733 Ga0496110_0027437 3300048913 Bacteria 4882
734 Ga0496110_0056327 3300048913 Bacteria 3459
735 Ga0496110_0132154 3300048913 Bacteria 2254
736 Ga0496110_0151081 3300048913 Bacteria 2103
737 Ga0496110_0197580 3300048913 Bacteria 1827
738 Ga0496111_0008238 3300048914 Bacteria 6892
739 Ga0496111_0010213 3300048914 Bacteria 6290
740 Ga0496111_0043391 3300048914 Bacteria 3232
741 Ga0496111_0057197 3300048914 Bacteria 2823
742 Ga0496111_0196353 3300048914 Bacteria 1500
743 Ga0496111_0352694 3300048914 Bacteria 1089
744 Ga0496112_0000020 3300048915 Bacteria 169373
745 Ga0496112_0001044 3300048915 Bacteria 20400
746 Ga0496112_0014481 3300048915 Bacteria 7321
747 Ga0496112_0032339 3300048915 Bacteria 5079
748 Ga0496112_0036502 3300048915 Bacteria 4795
749 Ga0496112_0128611 3300048915 Bacteria 2503
750 Ga0496112_0218018 3300048915 Bacteria 1865
751 Ga0496112_0462284 3300048915 Bacteria 1206
752 Ga0496113_0006740 3300048916 Bacteria 7319
753 Ga0496113_0037992 3300048916 Bacteria 3537
754 Ga0496113_0043787 3300048916 Bacteria 3314
755 Ga0496113_0051297 3300048916 Bacteria 3078
756 Ga0496113_0059445 3300048916 Bacteria 2879
757 Ga0496113_0076548 3300048916 Bacteria 2556
758 Ga0496114_0009847 3300048917 Bacteria 7598
759 Ga0496114_0079878 3300048917 Bacteria 2762
760 Ga0496114_0306210 3300048917 Bacteria 1403
761 Ga0496115_0023846 3300048918 Bacteria 4751
762 Ga0496115_0029319 3300048918 Bacteria 4321
763 Ga0496115_0087123 3300048918 Bacteria 2548
764 Ga0496115_0087298 3300048918 Bacteria 2545
765 Ga0496115_0100082 3300048918 Bacteria 2376
766 Ga0496115_0140952 3300048918 Bacteria 1989
767 Ga0496115_0286279 3300048918 Bacteria 1352
768 Ga0496115_0372611 3300048918 Bacteria 1162
769 Ga0496117_0021089 3300048920 Bacteria 5288
770 Ga0496117_0036072 3300048920 Bacteria 3704
771 Ga0496117_0120237 3300048920 Bacteria 1615
772 Ga0496117_0153817 3300048920 Bacteria 1357
773 Ga0496118_0003026 3300048921 Bacteria 21707
774 Ga0496118_0027995 3300048921 Bacteria 4757
775 Ga0496118_0048029 3300048921 Bacteria 3302
776 Ga0496118_0064926 3300048921 Bacteria 2674
777 Ga0496118_0090666 3300048921 Bacteria 2105
778 Ga0496118_0154936 3300048921 Bacteria 1427
779 Ga0496119_0006376 3300048922 Bacteria 10964
780 Ga0496119_0038888 3300048922 Bacteria 3066
781 Ga0496119_0072987 3300048922 Bacteria 2003
782 Ga0496121_0000203 3300048924 Bacteria 130984
783 Ga0496121_0000270 3300048924 Bacteria 108787
784 Ga0496121_0001251 3300048924 Bacteria 44033
785 Ga0496121_0002323 3300048924 Bacteria 29460
786 Ga0496121_0015121 3300048924 Bacteria 8119
787 Ga0496121_0042502 3300048924 Bacteria 3951
788 Ga0496121_0045389 3300048924 Bacteria 3777
789 Ga0496121_0130068 3300048924 Bacteria 1886
790 Ga0496121_0133412 3300048924 Bacteria 1854
791 Ga0496121_0171645 3300048924 Bacteria 1574
792 Ga0496121_0267653 3300048924 Bacteria 1176
793 Ga0496122_0032788 3300048925 Bacteria 4287
794 Ga0496122_0052331 3300048925 Bacteria 3092
795 Ga0496123_0010648 3300048926 Bacteria 8093
796 Ga0496123_0101514 3300048926 Bacteria 1672
797 Ga0496124_0011952 3300048927 Bacteria 8637
798 Ga0496124_0048269 3300048927 Bacteria 3639
799 Ga0496124_0070552 3300048927 Bacteria 2898
800 Ga0496124_0114620 3300048927 Bacteria 2164
801 Ga0496125_0000328 3300048928 Bacteria 91806
802 Ga0496125_0000407 3300048928 Bacteria 80570
803 Ga0496125_0003549 3300048928 Bacteria 18787
804 Ga0496125_0024628 3300048928 Bacteria 5529
805 Ga0496125_0043717 3300048928 Bacteria 3797
806 Ga0496125_0059052 3300048928 Bacteria 3093
807 Ga0496125_0070315 3300048928 Bacteria 2741
808 Ga0496125_0087175 3300048928 Bacteria 2358
809 Ga0496126_0010158 3300048929 Bacteria 9910
810 Ga0496126_0016646 3300048929 Bacteria 7347
811 Ga0496126_0025084 3300048929 Bacteria 5744
812 Ga0496126_0027806 3300048929 Bacteria 5395
813 Ga0496126_0035866 3300048929 Bacteria 4642
814 Ga0496126_0065855 3300048929 Bacteria 3240
815 Ga0496126_0086523 3300048929 Bacteria 2762
816 Ga0496126_0088126 3300048929 Bacteria 2735
817 Ga0496126_0142503 3300048929 Bacteria 2061
818 Ga0496126_0174331 3300048929 Bacteria 1830
819 Ga0496126_0208070 3300048929 Bacteria 1648
820 Ga0496126_0286373 3300048929 Bacteria 1363
821 Ga0495682_0011296 3300049460 Bacteria 3437
822 Ga0495682_0055980 3300049460 Bacteria 1430
823 Ga0501031_0012366 3300049568 Bacteria 5566
824 Ga0501031_0142806 3300049568 Bacteria 1565
825 Ga0501032_0000475 3300049569 Bacteria 32423
826 Ga0501032_0042704 3300049569 Bacteria 3074
827 Ga0501033_0000440 3300049570 Bacteria 39822
828 Ga0501033_0001499 3300049570 Bacteria 20673
829 Ga0501033_0012762 3300049570 Bacteria 6406
830 Ga0501033_0117807 3300049570 Bacteria 1929
831 Ga0501033_0119051 3300049570 Bacteria 1917
832 Ga0501033_0345629 3300049570 Bacteria 1042
833 Ga0501034_0000250 3300049571 Bacteria 99407
834 Ga0501034_0028177 3300049571 Bacteria 5714
835 Ga0501036_0000098 3300049572 Bacteria 54252
836 Ga0501036_0044460 3300049572 Bacteria 3762
837 Ga0501036_0061519 3300049572 Bacteria 3180
838 Ga0501036_0115578 3300049572 Bacteria 2266
839 Ga0501036_0150293 3300049572 Bacteria 1964
840 Ga0501037_0000092 3300049573 Bacteria 83924
841 Ga0501037_0016024 3300049573 Bacteria 5515
842 Ga0501037_0105558 3300049573 Bacteria 2030
843 Ga0501037_0106892 3300049573 Bacteria 2016
844 Ga0501038_0000059 3300049574 Bacteria 92319
845 Ga0501038_0000626 3300049574 Bacteria 31388
846 Ga0501038_0042710 3300049574 Bacteria 3947
847 Ga0501038_0199908 3300049574 Bacteria 1604
848 Ga0501039_0000085 3300049575 Bacteria 70306
849 Ga0501039_0021665 3300049575 Bacteria 4930
850 Ga0501039_0137111 3300049575 Bacteria 1921
851 Ga0501039_0142154 3300049575 Bacteria 1885
852 Ga0501042_0035371 3300049578 Bacteria 3543
853 Ga0501042_0060507 3300049578 Bacteria 2705
854 Ga0501043_0011678 3300049579 Bacteria 6875
855 Ga0501043_0289790 3300049579 Bacteria 1253
856 Ga0501043_0313691 3300049579 Bacteria 1196
857 Ga0501046_0000483 3300049580 Bacteria 39806
858 Ga0501046_0013048 3300049580 Bacteria 7052
859 Ga0501046_0028766 3300049580 Bacteria 4523
860 Ga0501046_0050241 3300049580 Bacteria 3295
861 Ga0501046_0235227 3300049580 Bacteria 1352
862 Ga0501047_0000022 3300049581 Bacteria 249062
863 Ga0501047_0010976 3300049581 Bacteria 8572
864 Ga0501047_0020141 3300049581 Bacteria 6404
865 Ga0501047_0142285 3300049581 Bacteria 2276
866 Ga0501047_0244182 3300049581 Bacteria 1645
867 Ga0501047_0428330 3300049581 Bacteria 1154
868 Ga0501048_0002266 3300049582 Bacteria 14670
869 Ga0501067_0000599 3300049583 Bacteria 19412
870 Ga0501067_0114243 3300049583 Bacteria 1501
871 Ga0501068_0004667 3300049584 Bacteria 7459
872 Ga0501068_0056869 3300049584 Bacteria 2371
873 Ga0501068_0065838 3300049584 Bacteria 2206
874 Ga0501069_0055162 3300049585 Bacteria 2213
875 Ga0501070_0006653 3300049586 Bacteria 9842
876 Ga0501070_0062656 3300049586 Bacteria 3080
877 Ga0501070_0180468 3300049586 Bacteria 1737
878 Ga0501071_0039494 3300049587 Bacteria 3377
879 Ga0501071_0073681 3300049587 Bacteria 2491
880 Ga0501072_0001923 3300049588 Bacteria 15457
881 Ga0501072_0226059 3300049588 Bacteria 1491
882 Ga0501073_0000109 3300049589 Bacteria 53094
883 Ga0501073_0056097 3300049589 Bacteria 2756
884 Ga0501073_0104808 3300049589 Bacteria 1962
885 Ga0501074_0036614 3300049590 Bacteria 3554
886 Ga0501074_0100957 3300049590 Bacteria 2065
887 Ga0501076_0021057 3300049592 Bacteria 4997
888 Ga0501077_0060991 3300049593 Bacteria 2393
889 Ga0501079_0002132 3300049741 Bacteria 14228
890 Ga0501079_0091330 3300049741 Bacteria 2359
891 Ga0501080_0005186 3300049742 Bacteria 11611
892 Ga0501080_0031118 3300049742 Bacteria 4972
893 Ga0501080_0181287 3300049742 Bacteria 1937
894 Ga0501080_0186541 3300049742 Bacteria 1907
895 Ga0501083_0001424 3300049744 Bacteria 16301
896 Ga0501035_0001471 3300049822 Bacteria 24145
897 Ga0501035_0035988 3300049822 Bacteria 4490
898 Ga0501035_0082774 3300049822 Bacteria 2832
899 Ga0501044_0000072 3300049823 Bacteria 124143
900 Ga0501044_0001765 3300049823 Bacteria 25275
901 Ga0501044_0009154 3300049823 Bacteria 10815
902 Ga0501044_0547336 3300049823 Bacteria 1055
903 Ga0501045_0370770 3300049824 Bacteria 1065
904 nmdc:mga03n38_4895_c1 3300050490 Bacteria 4491
905 nmdc:mga00v17_162020_c1 3300050491 Bacteria 1440
906 nmdc:mga00v17_55279_c1 3300050491 Bacteria 2424
907 nmdc:mga0yw44_208929_c1 3300050492 Bacteria 1291
908 nmdc:mga0yw44_47348_c1 3300050492 Bacteria 2588
909 nmdc:mga0yw44_83620_c1 3300050492 Bacteria 2005
910 nmdc:mga0k408_58486_c1 3300050493 Bacteria 2239
911 nmdc:mga06z11_120949_c1 3300050494 Bacteria 1461
912 nmdc:mga06z11_255013_c1 3300050494 Bacteria 1034
913 nmdc:mga04h51_4727_c1 3300050495 Bacteria 3414
914 nmdc:mga07m45_112215_c1 3300050496 Bacteria 1571
915 nmdc:mga07m45_113485_c1 3300050496 Bacteria 1562
916 nmdc:mga07m45_226957_c1 3300050496 Bacteria 1087
917 nmdc:mga09592_221455_c1 3300050508 Bacteria 1639
918 nmdc:mga06r32_33397_c1 3300050510 Bacteria 4845
919 nmdc:mga0rr50_314731_c1 3300050513 Bacteria 1311
920 nmdc:mga0a205_223274_c1 3300050515 Bacteria 1769
921 nmdc:mga0sz30_40195_c1 3300050516 Bacteria 1966
922 Ga0495601_0049218 3300053077 Bacteria 2657
923 Ga0495601_0086261 3300053077 Bacteria 2017
924 Ga0495601_0233021 3300053077 Bacteria 1202
925 Ga0500635_0048938 3300053080 Bacteria 1441
926 Ga0500635_0055968 3300053080 Bacteria 1363
927 Ga0495655_0003764 3300053083 Bacteria 2534
928 Ga0495655_0012771 3300053083 Bacteria 1720
929 Ga0495595_0000445 3300053084 Bacteria 15683
930 Ga0495595_0005883 3300053084 Bacteria 4973
931 Ga0495619_0000330 3300053085 Bacteria 33168
932 Ga0500578_0079113 3300053086 Bacteria 2092
933 Ga0500578_0118280 3300053086 Bacteria 1667
934 Ga0500643_000063 3300053087 Bacteria 122135
935 Ga0500643_034093 3300053087 Bacteria 1535
936 Ga0500646_0000839 3300053090 Bacteria 8510
937 Ga0500651_0006769 3300053093 Bacteria 6639
938 Ga0500651_0006892 3300053093 Bacteria 6586
939 Ga0500651_0194034 3300053093 Bacteria 1201
940 Ga0500566_0000247 3300053094 Bacteria 28953
941 Ga0500566_0003076 3300053094 Bacteria 9969
942 Ga0500566_0005190 3300053094 Bacteria 7755
943 Ga0500566_0202460 3300053094 Bacteria 1001
944 Ga0500640_068405 3300053095 Bacteria 1527
945 Ga0500641_0035557 3300053096 Bacteria 1988
946 Ga0500554_003943 3300053102 Bacteria 3090
947 Ga0500556_0000006 3300053104 Bacteria 453982
948 Ga0500557_000037 3300053105 Bacteria 71114
949 Ga0500569_001553 3300053109 Bacteria 4357
950 Ga0500569_002673 3300053109 Bacteria 3551
951 Ga0500572_000191 3300053111 Bacteria 21667
952 Ga0500572_019537 3300053111 Bacteria 1770
953 Ga0500593_065397 3300053117 Bacteria 1590
954 Ga0500595_002654 3300053119 Bacteria 8699
955 Ga0500595_014785 3300053119 Bacteria 2950
956 Ga0500607_020092 3300053121 Bacteria 3774
957 Ga0500608_000959 3300053122 Bacteria 10339
958 Ga0500608_051127 3300053122 Bacteria 1985
959 Ga0500614_019160 3300053123 Bacteria 1565
960 Ga0500618_004575 3300053125 Bacteria 4370
961 Ga0500618_017251 3300053125 Bacteria 1798
962 Ga0500642_0000004 3300053130 Bacteria 433122
963 Ga0500642_0000062 3300053130 Bacteria 58970
964 Ga0500642_0011321 3300053130 Bacteria 3185
965 Ga0500642_0048371 3300053130 Bacteria 1867
966 Ga0500652_000555 3300053131 Bacteria 13010
967 Ga0500658_0074733 3300053134 Bacteria 1437
968 Ga0500658_0075077 3300053134 Bacteria 1434
969 Ga0500559_0000179 3300053136 Bacteria 50232
970 Ga0500559_0000398 3300053136 Bacteria 31511
971 Ga0500559_0042227 3300053136 Bacteria 1989
972 Ga0500559_0139060 3300053136 Bacteria 1136
973 Ga0500564_110823 3300053138 Bacteria 1204
974 Ga0500568_0000790 3300053139 Bacteria 22337
975 Ga0500573_0232028 3300053140 Bacteria 961
976 Ga0500577_0000399 3300053142 Bacteria 11105
977 Ga0500586_007140 3300053145 Bacteria 2960
978 Ga0500588_0031491 3300053146 Bacteria 1531
979 Ga0500603_001290 3300053150 Bacteria 5756
980 Ga0500603_007487 3300053150 Bacteria 2398
981 Ga0500604_0001375 3300053151 Bacteria 6785
982 Ga0500616_0000022 3300053153 Bacteria 460463
983 Ga0500616_0018659 3300053153 Bacteria 3919
984 Ga0500620_001178 3300053155 Bacteria 4665
985 Ga0500622_0015984 3300053156 Bacteria 4015
986 Ga0500622_0026331 3300053156 Bacteria 3071
987 Ga0500622_0044474 3300053156 Bacteria 2301
988 Ga0500630_065807 3300053159 Bacteria 1724
989 Ga0500639_013853 3300053163 Bacteria 4239
990 Ga0500639_022758 3300053163 Bacteria 3311
991 Ga0500636_0000349 3300053177 Bacteria 25486
992 Ga0500636_0060283 3300053177 Bacteria 2216
993 Ga0500637_0017723 3300053178 Bacteria 3817
994 Ga0500637_0215510 3300053178 Bacteria 1087
995 Ga0500570_018767 3300053724 Bacteria 3871
996 Ga0500625_024838 3300053729 Bacteria 2832
997 Ga0500596_004482 3300053735 Bacteria 2554
998 Ga0500596_007212 3300053735 Bacteria 1833
999 Ga0500601_000064 3300053737 Bacteria 22081
1000 Ga0501084_0185546 3300054114 Bacteria 1755
1001 Ga0500661_021525 3300055283 Bacteria 1144
1002 Ga0501082_0000028 3300060353 Bacteria 100580
1003 Ga0501082_0144134 3300060353 Bacteria 2067
1004 2507505246 2507262055 Bacteria 8048963
1005 2508539167 2508501009 Bacteria 7784016
1006 2508695485 2508501042 Bacteria 8719808
1007 2509152633 2508501128 Bacteria 8613869
1008 2511400222 2511231028 Bacteria 8046582
1009 2513625345 2513237092 Bacteria 8341956
1010 2513644164 2513237094 Bacteria 8789602
1011 2513651516 2513237095 Bacteria 8976980
1012 2513658813 2513237096 Bacteria 8722461
1013 2513674587 2513237098 Bacteria 9902361
1014 2513695111 2513237101 Bacteria 7952346
1015 2513705241 2513237102 Bacteria 7703324
1016 2513720304 2513237104 Bacteria 10034502
1017 2513860820 2513237137 Bacteria 9558895
1018 2513873528 2513237139 Bacteria 8737671
1019 2513888766 2513237141 Bacteria 8496279
1020 2513921077 2513237145 Bacteria 8979722
1021 2514012485 2513237161 Bacteria 8871253
1022 2515627442 2515154112 Bacteria 8294334
1023 2517107711 2517093001 Bacteria 9002274
1024 2517888842 2517572143 Bacteria 9484767
1025 2524440890 2524023205 Bacteria 8918781
1026 2524467848 2524023210 Bacteria 9029266
1027 2524537054 2524023228 Bacteria 10118060
1028 2528852938 2528768022 Bacteria 10457665
1029 2603858527 2602042107 Bacteria 6226103
1030 2617352398 2617270735 Bacteria 9163226
1031 2617373761 2617270741 Bacteria 8201522
1032 2644290946 2643221651 Bacteria 4798932
1033 2671119944 2667528175 Bacteria 7532676
1034 2723841642 2721755755 Bacteria 8322773
1035 2728754989 2728368998 Bacteria 8720350
1036 2745081688 2744054633 Bacteria 8678936
1037 2793062042 2791355196 Bacteria 7323613
1038 2793072930 2791355197 Bacteria 8420563
1039 2793082750
1040 2805915612 2802429603 Bacteria 8777136
1041 2818237649 2816332527 Bacteria 8933356
1042 2824604584 2824600985 Bacteria 8488197
1043 2824612325 2824609381 Bacteria 8672835
1044 2824624500 2824617872 Bacteria 8814715
1045 2824633415 2824626560 Bacteria 8813858
1046 2824640288 2824635225 Bacteria 8785348
1047 2824647278 2824644064 Bacteria 8743947
1048 2824655190 2824653114 Bacteria 8493680
1049 2824667559 2824661429 Bacteria 9877870
1050 2824676625 2824671348 Bacteria 8369588
1051 2824684230 2824679649 Bacteria 8248951
1052 2824694701 2824687955 Bacteria 8360029
1053 2824704127 2824696289 Bacteria 8335049
1054 2824708929 2824704595 Bacteria 9667483
1055 2824717406 2824714736 Bacteria 8717648
1056 2824727631 2824723954 Bacteria 8758240
1057 2824737795 2824732956 Bacteria 7810675
1058 2824752227 2824746037 Bacteria 7911610
1059 2824759956 2824753945 Bacteria 9787441
1060 2824770390 2824763712 Bacteria 9792355
1061 2824775522 2824773399 Bacteria 8360218
1062 2838124513 2838122688 Bacteria 8803140
1063 2841945200 2841941048 Bacteria 8688029
1064 2841951981 2841949485 Bacteria 8680857
1065 2841965434 2841957949 Bacteria 8652217
1066 2841970623 2841966195 Bacteria 8673214
1067 2841979972 2841974524 Bacteria 8931498
1068 2841985152 2841983080 Bacteria 8395090
1069 2842043509 2842038055 Bacteria 8002051
1070 2842052501 2842045827 Bacteria 8006841
1071 2844315336 2844315083 Bacteria 8138177
1072 2847931073 2847930680 Bacteria 9342022
1073 2847942155 2847939898 Bacteria 8606328
1074 2849083035 2849076700 Bacteria 7039503
1075 2857511925 2857509624 Bacteria 7472071
1076 2857526351 2857524615 Bacteria 6615449
1077 2874594445 2874590934 Bacteria 8299676
1078 2874608064 2874604998 Bacteria 7834745
1079 2874613436 2874612657 Bacteria 8252029
1080 2874624782 2874620515 Bacteria 8290088
1081 2874628795 2874628541 Bacteria 8630250
1082 2874649818 2874645413 Bacteria 8214782
1083 2876768927 2876761206 Bacteria 10111113
1084 2876773937 2876771140 Bacteria 8287509
1085 2876821817 2876818435 Bacteria 8274608
1086 2879078339 2879074833 Bacteria 8279565
1087 2879085907 2879083081 Bacteria 8587928
1088 2879106022 2879099564 Bacteria 10442239
1089 2879112171 2879110137 Bacteria 8907982
1090 2879130600 2879127579 Bacteria 8294491
1091 2879147123 2879142872 Bacteria 8267021
1092 2881365317 2881364244 Bacteria 7710352
1093 2881668185 2881665667 Bacteria 8175609
1094 2885371028 2885366525 Bacteria 8326213
1095 2885382850 2885374607 Bacteria 8927485
1096 2885388844 2885383462 Bacteria 9473874
1097 2885411662 2885409591 Bacteria 9235467
1098 2888379593 2888378607 Bacteria 9652610
1099 2888390681 2888388044 Bacteria 7304136
1100 2888420306 2888419890 Bacteria 7857137
1101 2889035490 2889033259 Bacteria 9099371
1102 2893067378 2893066018 Bacteria 6158120
1103 2903732197 2903727486 Bacteria 8281579
1104 2903748955 2903748898 Bacteria 9972761
1105 2903770760 2903768456 Bacteria 9749579
1106 2904670263 2904666416 Bacteria 8226587
1107 2904708824
1108 2904713178 2904711408 Bacteria 9771557
1109 2906604274 2906602504 Bacteria 8295279
1110 2906613874
1111 2906628957 2906626472 Bacteria 8826946
1112 2906642332 2906635258 Bacteria 8601019
1113 2906648178 2906643746 Bacteria 8722424
1114 2906667360 2906660503 Bacteria 8595048
1115 2908747444 2908739725 Bacteria 8628932
1116 2908756587 2908756301 Bacteria 8864324
1117 2908776277 2908775508 Bacteria 8092255
1118 2919073802 2919073203 Bacteria 6531949
1119 2922364000 2922361189 Bacteria 7436256
1120 2922368936
1121 2922392566 2922386360 Bacteria 7017218
1122 2922394239 2922393267 Bacteria 8285685
1123 2929618601 2929615660 Bacteria 9193770
1124 2929628714 2929624759 Bacteria 9339455
1125 2932792923 2932784394 Bacteria 9704911
1126 2932794317 2932794094 Bacteria 7915132
1127 2932808089 2932801729 Bacteria 7987968
1128 2932812165 2932809354 Bacteria 9135765
1129 2932823155 2932818245 Bacteria 9955613
1130 2932836072 2932828146 Bacteria 9745859
1131 2933580687 2933577622 Bacteria 9116884
1132 2935615725 2935608549 Bacteria 8203142
1133 2935618521 2935616580 Bacteria 9032984
1134 2935641078 2935638405 Bacteria 10015038
1135 2935653641 2935648319 Bacteria 8801166
1136 2935662390 2935656913 Bacteria 8965014
1137 2935669994 2935665750 Bacteria 9571747
1138 2935679156 2935675223 Bacteria 9928132
1139 2935690025 2935684952 Bacteria 9590419
1140 2935698544 2935694250 Bacteria 9291695
1141 2935711480 2935703347 Bacteria 10242284
1142 2935717544 2935713505 Bacteria 9608509
1143 2935723786 2935722832 Bacteria 9608746
1144 2935739995 2935732158 Bacteria 9706831
1145 2935749258 2935741537 Bacteria 9707219
1146 2935757379 2935750917 Bacteria 9590372
1147 2935763535 2935760218 Bacteria 9817913
1148 2935773042 2935769743 Bacteria 7878163
1149 2935782985 2935777560 Bacteria 8077691
1150 2935787969 2935785616 Bacteria 7962367
1151 2935796455 2935793552 Bacteria 8012592
1152 2935809958 2935801545 Bacteria 9301974
1153 2935816264 2935810662 Bacteria 9401221
1154 2935825477 2935819856 Bacteria 8261050
1155 2935835657 2935827899 Bacteria 10038562
1156 2935844608 2935837841 Bacteria 9454360
1157 2935853266 2935847175 Bacteria 8228321
1158 2935862946 2935855204 Bacteria 9035059
1159 2935866688 2935864058 Bacteria 9784707
1160 2935874995 2935873716 Bacteria 9632195
1161 2935890149 2935883170 Bacteria 7964738
1162 2935914739 2935908558 Bacteria 8568796
1163 2935918715 2935916978 Bacteria 9113783
1164 2935931568 2935926038 Bacteria 8601059
1165 2935940165 2935934488 Bacteria 8602579
1166 2935947488 2935942939 Bacteria 8599779
1167 2935956260 2935951376 Bacteria 8602333
1168 2935962636 2935959822 Bacteria 7869783
1169 2935973053 2935967501 Bacteria 8603075
1170 2935980704 2935975950 Bacteria 8347125
1171 2935985143 2935984226 Bacteria 8302647
1172 2935999729 2935992306 Bacteria 9802711
1173 2936010573 2936002035 Bacteria 9362176
1174 2936016692 2936011229 Bacteria 8801034
1175 2936025325 2936019824 Bacteria 8804134
1176 2936034167 2936028420 Bacteria 8965941
1177 2936041269 2936037263 Bacteria 9446081
1178 2936052224 2936046547 Bacteria 8903709
1179 2936056315 2936055302 Bacteria 8785755
1180 2940563292 2940556831 Bacteria 9590747
1181 2941535514 2941531003 Bacteria 7653939
1182 2941543207 2941538514 Bacteria 9402094
1183 3005475061 3005474847 Bacteria 9259049
1184 3005489070 3005483717 Bacteria 7877331
1185 3005509160 3005506211 Bacteria 6943378
1186 3005592211 3005587118 Bacteria 7794411
1187 3005595050 3005594810 Bacteria 8716512
1188 3005710998 3005710791 Bacteria 7622528
1189 3005718303 3005718088 Bacteria 8283608
1190 8006927890 8006926726 Bacteria 6749210
1191 8006936235 8006933436 Bacteria 10410654
1192 8006969360 8006964411 Bacteria 8966052
1193 8006976180 8006973647 Bacteria 10679141
1194 8006990922 8006984368 Bacteria 9651211
1195 8006996511 8006994254 Bacteria 8309700
1196 8016518182 8016511872 Bacteria 9921665
1197 8016526139 8016522445 Bacteria 8156687
1198 8016544055 8016539877 Bacteria 8155419
1199 8016557677 8016557553 Bacteria 8154380
1200 8016569460 8016566248 Bacteria 8158151
1201 8016582073 8016575299 Bacteria 8154085
1202 8016586370 8016583857 Bacteria 10421953
1203 8016595710 8016595262 Bacteria 8149947
1204 8016606566 8016603502 Bacteria 8731218
1205 8016618468 8016613128 Bacteria 8794220
1206 8016623160 8016622563 Bacteria 7999408
1207 8017058465 8017057580 Bacteria 10023680
1208 8019531027 8019530166 Bacteria 8155624
1209 8019540553 8019538911 Bacteria 7872763
1210 8019550174 8019547302 Bacteria 7996444
1211 8019577231 8019576017 Bacteria 10049540
1212 8019595311 8019586578 Bacteria 10212056
1213 8019606447 8019597564 Bacteria 10041141
1214 8019622970 8019619141 Bacteria 9218857
1215 8019630136 8019629233 Bacteria 8687553
1216 8019640476 8019638758 Bacteria 9062356
1217 8019652470 8019648815 Bacteria 10014479
1218 8019666970 8019659431 Bacteria 8577854
1219 8019676727 8019668869 Bacteria 8791617
1220 8019679263 8019678201 Bacteria 8863603
1221 8019696240 8019687851 Bacteria 8712826
1222 8055742451 8055742211 Bacteria 9226248
1223 8056675743 8056673599 Bacteria 7871253
1224 8056687394 8056681323 Bacteria 8472857
1225 8056690958 8056689827 Bacteria 6712655
1226 8056971288 8056967851 Bacteria 9038162
1227 Ga0496109_0011741
1228 JGI24740J21852_10000946
1229 JGI24737J22298_10024439
1230 JGI24735J21928_10009808
1231 JGI24738J21930_10006735
1232 JGI25406J46586_10000066
1233 JGI25406J46586_10002779
1234 JGI25153J46596_10003450
1235 JGI25153J46596_10011834
1236 JGI25160J50197_1003294
1237 JGI25404J52841_10007684
1238 Ga0055526_1043009
1239 Ga0055531_10014489
1240 Ga0065165_1000365
1241 Ga0065165_1001495
1242 Ga0065165_1019115
1243 Ga0070658_10068227
1244 Ga0070658_10084002
1245 Ga0070683_100005996
1246 Ga0070683_100013328
1247 Ga0070683_100421203
1248 Ga0070690_100211041
1249 Ga0068868_100016797
1250 Ga0070660_100038981
1251 Ga0070691_10133269
1252 Ga0070669_100066355
1253 Ga0070671_100129955
1254 Ga0070674_100088993
1255 Ga0070674_100234639
1256 Ga0070673_100084349
1257 Ga0070659_100118955
1258 Ga0070709_10000584
1259 Ga0070709_10004682
1260 Ga0070709_10013026
1261 Ga0070709_10105903
1262 Ga0070714_100004568
1263 Ga0070714_100118625
1264 Ga0070713_100005959
1265 Ga0070713_100010327
1266 Ga0070713_100157380
1267 Ga0070713_100415359
1268 Ga0070710_10002351
1269 Ga0070710_10004995
1270 Ga0070710_10109270
1271 Ga0070711_100000660
1272 Ga0070711_100004456
1273 Ga0070711_100019254
1274 Ga0070711_100022461
1275 Ga0070711_100474025
1276 Ga0070663_100062897
1277 Ga0070678_100015808
1278 Ga0070681_10014969
1279 Ga0070681_10051117
1280 Ga0070681_10089577
1281 Ga0070698_100068842
1282 Ga0070679_100039226
1283 Ga0070679_100044969
1284 Ga0070679_100066868
1285 Ga0070679_100120755
1286 Ga0070684_100007764
1287 Ga0070684_100024903
1288 Ga0070684_100058502
1289 Ga0070697_100289134
1290 Ga0068853_100001705
1291 Ga0068853_100029265
1292 Ga0068853_100086417
1293 Ga0068853_100196525
1294 Ga0068853_100279593
1295 Ga0070696_100109075
1296 Ga0070665_100028170
1297 Ga0070665_100099215
1298 Ga0070665_100250510
1299 Ga0068855_100015846
1300 Ga0068855_100034493
1301 Ga0068855_100274067
1302 Ga0068855_100526603
1303 Ga0070664_100189725
1304 Ga0068857_100021030
1305 Ga0068857_100041204
1306 Ga0068857_100227058
1307 Ga0068857_100576858
1308 Ga0068854_100222019
1309 Ga0068854_100318805
1310 Ga0068856_100005093
1311 Ga0068856_100012875
1312 Ga0068856_100065061
1313 Ga0068856_100129808
1314 Ga0068852_100042806
1315 Ga0068852_100104346
1316 Ga0068852_100341968
1317 Ga0068859_100184572
1318 Ga0068864_100026520
1319 Ga0068851_10002645
1320 Ga0068851_10030239
1321 Ga0068858_100033778
1322 Ga0068858_100094168
1323 Ga0068858_100394178
1324 Ga0068860_100001450
1325 Ga0068860_100136751
1326 Ga0081455_10009536
1327 Ga0081455_10010204
1328 Ga0081455_10037390
1329 Ga0081455_10048211
1330 Ga0081538_10086299
1331 Ga0081540_1003875
1332 Ga0081540_1005299
1333 Ga0081540_1011061
1334 Ga0081540_1012813
1335 Ga0081540_1021192
1336 Ga0081539_10000064
1337 Ga0081539_10004737
1338 Ga0081539_10029435
1339 Ga0070717_10006989
1340 Ga0070717_10043262
1341 Ga0070717_10088445
1342 Ga0075365_10066092
1343 Ga0075365_10318386
1344 Ga0075368_10003158
1345 Ga0075363_100016306
1346 Ga0070715_10000108
1347 Ga0070715_10019602
1348 Ga0070716_100002138
1349 Ga0070716_100013388
1350 Ga0070712_100047535
1351 Ga0070712_100240873
1352 Ga0075367_10092235
1353 Ga0075369_10043758
1354 Ga0075369_10076719
1355 Ga0075366_10061029
1356 Ga0097621_100249243
1357 Ga0075370_10156285
1358 Ga0068871_100330798
1359 Ga0075428_100045101
1360 Ga0075430_100389813
1361 Ga0075433_10217483
1362 Ga0068865_100349271
1363 Ga0075436_100397440
1364 Ga0097620_100184562
1365 Ga0099823_1022515
1366 Ga0099795_10064146
1367 Ga0105240_10004955
1368 Ga0105240_10008228
1369 Ga0105240_10031181
1370 Ga0105245_10197939
1371 Ga0105245_10231917
1372 Ga0105247_10010882
1373 Ga0114129_10721610
1374 Ga0105241_10002286
1375 Ga0105241_10072988
1376 Ga0105241_10082572
1377 Ga0105248_10549277
1378 Ga0105237_10010095
1379 Ga0105237_10168546
1380 Ga0105237_10304187
1381 Ga0105237_10637369
1382 Ga0105237_10789028
1383 Ga0105238_10000905
1384 Ga0105238_10015713
1385 Ga0105238_10030039
1386 Ga0105238_10050367
1387 Ga0105238_10074317
1388 Ga0105238_10597241
1389 Ga0105249_10164867
1390 Ga0105249_10269902
1391 Ga0105239_10002519
1392 Ga0105239_10024695
1393 Ga0105239_10064493
1394 Ga0105239_10080757
1395 Ga0105239_10199644
1396 Ga0105239_10211410
1397 Ga0105239_10279826
1398 Ga0105239_10356811
1399 Ga0105246_10081781
1400 Ga0157373_10053256
1401 Ga0157370_10129027
1402 Ga0157370_10402729
1403 Ga0157369_10071197
1404 Ga0157369_10684080
1405 Ga0157374_10228057
1406 Ga0157378_10743896
1407 Ga0163162_10277441
1408 Ga0157372_10271108
1409 Ga0157375_10028391
1410 Ga0157375_10293938
1411 Ga0157375_10410565
1412 Ga0163163_10002009
1413 Ga0163163_10033178
1414 Ga0157380_10127343
1415 Ga0182008_10159463
1416 Ga0157377_10178578
1417 Ga0157379_10179402
1418 Ga0157376_10010998
1419 Ga0206353_10148081
1420 Ga0206353_10567907
1421 Ga0214544_1000016
1422 Ga0214542_1000016
1423 Ga0214545_1000008
1424 Ga0214543_1001466
1425 Ga0213873_10024285
1426 Ga0213872_10015515
1427 Ga0213876_10002439
1428 Ga0209563_108642
1429 Ga0209677_100672
1430 Ga0209677_105633
1431 Ga0209148_1000282
1432 Ga0209233_1005872
1433 Ga0209455_1002393
1434 Ga0207673_1005554
1435 Ga0209564_1000321
1436 Ga0209564_1003702
1437 Ga0209758_1000069
1438 Ga0209758_1000635
1439 Ga0209758_1001996
1440 Ga0209758_1002493
1441 Ga0209758_1011302
1442 Ga0209758_1017490
1443 Ga0209256_1015129
1444 Ga0209256_1032713
1445 Ga0207426_1002082
1446 Ga0207426_1004116
1447 Ga0207426_1020494
1448 Ga0207426_1024931
1449 Ga0209257_1000473
1450 Ga0209257_1017693
1451 Ga0207697_10065589
1452 Ga0207656_10008173
1453 Ga0207692_10002026
1454 Ga0207692_10012905
1455 Ga0207647_10014195
1456 Ga0207647_10168847
1457 Ga0207685_10016028
1458 Ga0207685_10035616
1459 Ga0207699_10003043
1460 Ga0207699_10007202
1461 Ga0207699_10038283
1462 Ga0207699_10245906
1463 Ga0207699_10323155
1464 Ga0207645_10179478
1465 Ga0207684_10077500
1466 Ga0207654_10000058
1467 Ga0207654_10006549
1468 Ga0207654_10011597
1469 Ga0207654_10089954
1470 Ga0207707_10004700
1471 Ga0207707_10035006
1472 Ga0207707_10054133
1473 Ga0207707_10104173
1474 Ga0207707_10158480
1475 Ga0207695_10000107
1476 Ga0207695_10000453
1477 Ga0207695_10115822
1478 Ga0207695_10254960
1479 Ga0207695_10318707
1480 Ga0207671_10018412
1481 Ga0207671_10042434
1482 Ga0207671_10069130
1483 Ga0207671_10094158
1484 Ga0207671_10282289
1485 Ga0207671_10461891
1486 Ga0207693_10000310
1487 Ga0207693_10021450
1488 Ga0207693_10034078
1489 Ga0207693_10035714
1490 Ga0207693_10181848
1491 Ga0207693_10354295
1492 Ga0207663_10016715
1493 Ga0207663_10019867
1494 Ga0207663_10083697
1495 Ga0207660_10076914
1496 Ga0207660_10081275
1497 Ga0207660_10189160
1498 Ga0207657_10029294
1499 Ga0207657_10073517
1500 Ga0207657_10131985
1501 Ga0207649_10410030
1502 Ga0207652_10076915
1503 Ga0207652_10079219
1504 Ga0207652_10136044
1505 Ga0207681_10066644
1506 Ga0207694_10001009
1507 Ga0207694_10034117
1508 Ga0207694_10274993
1509 Ga0207687_10004089
1510 Ga0207687_10330306
1511 Ga0207687_10350902
1512 Ga0207700_10093504
1513 Ga0207700_10117026
1514 Ga0207700_10154584
1515 Ga0207664_10061778
1516 Ga0207664_10103518
1517 Ga0207664_10487302
1518 Ga0207664_10588483
1519 Ga0207644_10066408
1520 Ga0207706_10203009
1521 Ga0207709_10250155
1522 Ga0207665_10001734
1523 Ga0207665_10004258
1524 Ga0207665_10061076
1525 Ga0207665_10085508
1526 Ga0207691_10172053
1527 Ga0207691_10203813
1528 Ga0207691_10441320
1529 Ga0207711_10211107
1530 Ga0207689_10039585
1531 Ga0207661_10044403
1532 Ga0207661_10056040
1533 Ga0207661_10073930
1534 Ga0207661_10175645
1535 Ga0207661_10670737
1536 Ga0207679_10390674
1537 Ga0207667_10006596
1538 Ga0207667_10088774
1539 Ga0207667_10109852
1540 Ga0207667_10160793
1541 Ga0207667_10281972
1542 Ga0207640_10047734
1543 Ga0207640_10186435
1544 Ga0207658_10306396
1545 Ga0207677_10024413
1546 Ga0207677_10198955
1547 Ga0207703_10078340
1548 Ga0207703_10281990
1549 Ga0207639_10013217
1550 Ga0207639_10123004
1551 Ga0207678_10003936
1552 Ga0207678_10046674
1553 Ga0207678_10096010
1554 Ga0207678_10422037
1555 Ga0207708_10085681
1556 Ga0207702_10000004
1557 Ga0207702_10001701
1558 Ga0207702_10337936
1559 Ga0207641_10327266
1560 Ga0207648_10060413
1561 Ga0207648_10238899
1562 Ga0207676_10095612
1563 Ga0207676_10114523
1564 Ga0207674_10000890
1565 Ga0207674_10002298
1566 Ga0207674_10007766
1567 Ga0207674_10052673
1568 Ga0207674_10299290
1569 Ga0207675_100122516
1570 Ga0207675_100389764
1571 Ga0207683_10016524
1572 Ga0207683_10169315
1573 Ga0207698_10031595
1574 Ga0207698_10183463
1575 Ga0207698_10350202
1576 Ga0209389_1000033
1577 Ga0209389_1000182
1578 Ga0209589_1000021
1579 Ga0209589_1000040
1580 Ga0209489_100028
1581 Ga0209489_100045
1582 Ga0209489_100209
1583 Ga0209700_100011
1584 Ga0209700_100037
1585 Ga0209588_1073887
1586 Ga0268266_10045729
1587 Ga0268266_10184329
1588 Ga0268266_10199057
1589 Ga0268266_10410158
1590 Ga0268264_10000062
1591 Ga0265337_1018782
1592 Ga0265326_10008390
1593 Ga0265319_1012969
1594 Ga0265334_10013964
1595 Ga0265318_10016635
1596 Ga0265323_10007956
1597 Ga0265336_10000561
1598 Ga0307517_10001338
1599 Ga0307515_10125511
1600 Ga0307515_10140350
1601 Ga0265338_10000598
1602 Ga0265332_10016039
1603 Ga0265332_10027603
1604 Ga0265332_10072613
1605 Ga0265328_10044554
1606 Ga0265325_10009157
1607 Ga0265340_10041599
1608 Ga0265340_10042492
1609 Ga0265339_10007110
1610 Ga0265339_10029701
1611 Ga0265339_10099122
1612 Ga0265331_10027874
1613 Ga0265331_10100059
1614 Ga0307513_10105188
1615 Ga0307513_10164506
1616 Ga0307513_10169966
1617 Ga0307513_10222288
1618 Ga0307408_100239375
1619 Ga0265313_10041739
1620 Ga0307508_10000002
1621 Ga0307508_10078616
1622 Ga0265314_10005687
1623 Ga0265314_10147464
1624 Ga0265342_10005853
1625 Ga0307516_10006094
1626 Ga0307516_10010553
1627 Ga0307516_10104788
1628 Ga0307406_10168105
1629 Ga0307415_100362721
1630 Ga0307507_10027443
1631 Ga0307510_10024755
1632 Ga0307510_10025056
1633 Ga0315911_1000008
1634 Ga0316215_1002237
1635 Ga0373926_0039711
1636 Ga0373934_0002932
1637 Ga0373944_0042120
1638 Ga0373923_0009618
1639 Ga0373936_0016692
1640 Ga0373936_0036388
1641 Ga0373936_0070087
1642 Ga0373936_0133190
1643 Ga0373941_0063086
1644 Ga0373945_0002529
1645 Ga0373945_0019734
1646 Ga0373953_0000955
1647 Ga0373953_0034938
1648 Ga0373954_0018760
1649 Ga0373954_0018968
1650 Ga0373956_0068497
1651 Ga0373957_0006831
1652 Ga0373943_0002107
1653 Ga0373943_0046258
1654 Ga0373943_0056690
1655 Ga0373943_0083317
1656 Ga0373946_0001889
1657 Ga0373946_0104972
1658 Ga0373955_0005406
1659 Ga0373924_0005676
1660 Ga0373924_0060733
1661 Ga0373931_0019569
1662 Ga0373935_0000557
1663 Ga0373935_0308415
1664 Ga0373935_0443493
1665 Ga0373927_0003654
1666 Ga0373927_0010418
1667 Ga0373927_0021960
1668 Ga0373927_0027049
1669 Ga0373927_0036371
1670 Ga0373927_0235046
1671 Ga0373933_0000031
1672 Ga0373933_0003419
1673 Ga0373933_0082944
1674 Ga0373947_0000509
1675 Ga0373947_0049307
1676 Ga0373947_0151339
1677 Ga0373947_0346433
1678 Ga0373937_0033982
1679 Ga0373937_0284966
1680 Ga0373937_0380292
1681 Ga0373925_0001713
1682 Ga0373925_0025981
1683 Ga0373925_0078993
1684 Ga0373925_0110677
1685 Ga0373925_0110804
1686 Ga0373925_0192510
1687 Ga0373925_0205586
1688 Ga0395900_0003383
1689 Ga0395900_0080281
1690 Ga0395900_0546461
1691 Ga0395898_0013386
1692 Ga0395898_0018463
1693 Ga0395898_0079473
1694 Ga0395898_0099077
1695 Ga0395905_0005856
1696 Ga0395905_0023254
1697 Ga0395905_0060606
1698 Ga0395905_0165060
1699 Ga0436364_0709114
1700 Ga0395901_0161395
1701 Ga0395901_0224667
1702 Ga0436365_0076766
1703 Ga0436365_0803057
1704 Ga0436365_0958057
1705 Ga0436365_0966323
1706 Ga0436365_1369931
1707 Ga0436361_0336324
1708 Ga0436361_0937863
1709 Ga0436363_0697337
1710 Ga0439465_0013621
1711 Ga0466969_0128100
1712 Ga0466972_0000119
1713 Ga0466972_0010560
1714 Ga0466966_0034959
1715 Ga0466966_0041766
1716 Ga0466961_0000139
1717 Ga0466963_0080797
1718 Ga0466963_0117349
1719 Ga0466971_0174557
1720 Ga0466968_0017207
1721 Ga0466968_0021266
1722 Ga0466968_0100658
1723 Ga0466970_0045604
1724 Ga0466970_0185989
1725 Ga0466957_0035033
1726 Ga0466960_0000848
1727 Ga0466959_0034008
1728 Ga0466959_0053472
1729 Ga0466959_0240101
1730 Ga0466959_0361912
1731 Ga0466967_0004006
1732 Ga0466967_0011512
1733 Ga0466967_0088324
1734 Ga0466967_0160685
1735 Ga0495592_0058216
1736 Ga0495592_0140768
1737 Ga0495592_0300267
1738 Ga0495603_0000047
1739 Ga0495603_0055753
1740 Ga0495603_0070506
1741 Ga0495629_0000320
1742 Ga0495629_0005536
1743 Ga0495629_0231283
1744 Ga0495638_0001094
1745 Ga0495638_0053016
1746 Ga0495641_0009584
1747 Ga0495651_0017530
1748 Ga0495651_0041190
1749 Ga0495651_0086113
1750 Ga0495651_0095034
1751 Ga0495653_0003027
1752 Ga0495653_0070906
1753 Ga0495580_0090453
1754 Ga0495582_0000043
1755 Ga0495582_0024699
1756 Ga0495582_0032646
1757 Ga0495582_0042626
1758 Ga0495605_0072307
1759 Ga0495605_0092896
1760 Ga0495639_0000091
1761 Ga0495662_0000128
1762 Ga0495664_0009771
1763 Ga0495664_0016934
1764 Ga0495664_0053492
1765 Ga0495584_0016366
1766 Ga0495584_0036022
1767 Ga0495585_0027616
1768 Ga0495594_0002035
1769 Ga0495594_0137115
1770 Ga0495596_0056530
1771 Ga0495607_0012073
1772 Ga0495583_0020205
1773 Ga0495606_0000252
1774 Ga0495606_0037168
1775 Ga0495606_0048505
1776 Ga0495606_0082443
1777 Ga0495606_0194800
1778 Ga0495608_0017766
1779 Ga0495610_0055708
1780 Ga0495616_0025586
1781 Ga0495616_0134523
1782 Ga0495618_0010884
1783 Ga0495620_0014398
1784 Ga0495628_0057540
1785 Ga0495628_0108009
1786 Ga0495628_0261808
1787 Ga0495628_0314815
1788 Ga0495630_0014946
1789 Ga0495631_0025195
1790 Ga0495631_0081283
1791 Ga0495637_0028566
1792 Ga0495643_0063715
1793 Ga0495644_0031813
1794 Ga0495648_0000286
1795 Ga0495648_0024325
1796 Ga0495648_0044368
1797 Ga0495648_0072499
1798 Ga0495648_0125545
1799 Ga0495666_0015987
1800 Ga0495666_0192723
1801 Ga0495652_0011857
1802 Ga0495652_0034268
1803 Ga0495665_0000051
1804 Ga0495640_0007555
1805 Ga0495640_0018565
1806 Ga0495640_0074727
1807 Ga0495640_0112835
1808 Ga0495586_0047218
1809 Ga0495587_0008144
1810 Ga0495587_0029650
1811 Ga0495598_0005762
1812 Ga0495645_0021133
1813 Ga0495645_0102551
1814 Ga0495622_0015099
1815 Ga0495622_0021698
1816 Ga0495633_0006412
1817 Ga0495667_0004751
1818 Ga0495667_0006502
1819 Ga0495667_0033150
1820 Ga0495667_0175879
1821 Ga0495667_0188219
1822 Ga0495668_0029459
1823 Ga0495634_0000400
1824 Ga0495634_0021637
1825 Ga0495634_0044581
1826 Ga0495634_0076053
1827 Ga0495625_0017905
1828 Ga0495625_0104162
1829 Ga0495635_0000620
1830 Ga0495635_0002202
1831 Ga0495635_0004059
1832 Ga0495635_0043268
1833 Ga0495661_0019545
1834 Ga0495657_0006604
1835 Ga0495657_0013678
1836 Ga0495657_0030794
1837 Ga0495657_0042749
1838 Ga0495599_0009906
1839 Ga0495599_0069977
1840 Ga0495623_0012518
1841 Ga0495623_0037441
1842 Ga0495623_0213500
1843 Ga0495646_0000643
1844 Ga0495646_0043973
1845 Ga0495647_0002769
1846 Ga0495658_0000499
1847 Ga0495658_0114457
1848 Ga0495613_0008984
1849 Ga0495613_0025117
1850 Ga0495624_0003704
1851 Ga0495624_0021704
1852 Ga0495624_0096046
1853 Ga0495670_0001762
1854 Ga0495670_0125248
1855 Ga0495671_0161834
1856 Ga0495649_0012129
1857 Ga0495589_0051700
1858 Ga0495600_0011578
1859 Ga0495600_0013331
1860 Ga0495581_0000486
1861 Ga0495581_0061415
1862 Ga0495581_0114111
1863 Ga0495581_0115928
1864 Ga0495604_0010785
1865 Ga0495604_0023859
1866 Ga0495604_0031639
1867 Ga0495604_0145351
1868 Ga0495674_0005428
1869 Ga0495674_0023537
1870 Ga0495674_0131189
1871 Ga0495672_0022435
1872 Ga0495672_0066467
1873 Ga0495672_0081560
1874 Ga0495676_0061706
1875 Ga0495676_0087102
1876 Ga0495676_0108612
1877 Ga0495676_0114727
1878 Ga0495680_0000689
1879 Ga0495680_0001909
1880 Ga0495680_0040967
1881 Ga0495680_0099424
1882 Ga0495680_0231698
1883 Ga0495683_0044814
1884 Ga0495683_0073135
1885 Ga0495687_008047
1886 Ga0495675_0008329
1887 Ga0495675_0103236
1888 Ga0495681_0100394
1889 Ga0495684_0000313
1890 Ga0495684_0012322
1891 Ga0495684_0103192
1892 Ga0495684_0145236
1893 Ga0495684_0206990
1894 Ga0495686_0063919
1895 Ga0495593_0000005
1896 Ga0495593_0002672
1897 Ga0495593_0063063
1898 Ga0495602_0015257
1899 Ga0495602_0095535
1900 Ga0495602_0118872
1901 Ga0495614_0006832
1902 Ga0495626_0025505
1903 Ga0495626_0055731
1904 Ga0495626_0079507
1905 Ga0496100_0006321
1906 Ga0496100_0093302
1907 Ga0496100_0199871
1908 Ga0496100_0331609
1909 Ga0496101_0018505
1910 Ga0496101_0041241
1911 Ga0496101_0230209
1912 Ga0496101_0496314
1913 Ga0496102_0001314
1914 Ga0496102_0009090
1915 Ga0496102_0542835
1916 Ga0496102_0554459
1917 Ga0496103_0025364
1918 Ga0496103_0047615
1919 Ga0496103_0250773
1920 Ga0496104_0002280
1921 Ga0496104_0003037
1922 Ga0496104_0007367
1923 Ga0496104_0018994
1924 Ga0496104_0030135
1925 Ga0496104_0159295
1926 Ga0496104_0272046
1927 Ga0496105_0000935
1928 Ga0496105_0003051
1929 Ga0496105_0027371
1930 Ga0496105_0040662
1931 Ga0496105_0126887
1932 Ga0496106_0000236
1933 Ga0496106_0014089
1934 Ga0496106_0060156
1935 Ga0496106_0126165
1936 Ga0496106_0264519
1937 Ga0496107_0003292
1938 Ga0496107_0091750
1939 Ga0496107_0110889
1940 Ga0496107_0130670
1941 Ga0496107_0152209
1942 Ga0496107_0171489
1943 Ga0496107_0239906
1944 Ga0496107_0244377
1945 Ga0496107_0265433
1946 Ga0496108_0000849
1947 Ga0496108_0016993
1948 Ga0496108_0047577
1949 Ga0496108_0053230
1950 Ga0496108_0304768
1951 Ga0496108_0360185
1952 Ga0496108_0372747
1953 Ga0496109_0000224
1954 Ga0496109_0010749
1955 Ga0496109_0073871
1956 Ga0496109_0148771
1957 Ga0496110_0004203
1958 Ga0496110_0008119
1959 Ga0496110_0027437
1960 Ga0496110_0056327
1961 Ga0496110_0132154
1962 Ga0496110_0151081
1963 Ga0496110_0197580
1964 Ga0496111_0008238
1965 Ga0496111_0010213
1966 Ga0496111_0043391
1967 Ga0496111_0057197
1968 Ga0496111_0196353
1969 Ga0496111_0352694
1970 Ga0496112_0000020
1971 Ga0496112_0001044
1972 Ga0496112_0014481
1973 Ga0496112_0032339
1974 Ga0496112_0036502
1975 Ga0496112_0128611
1976 Ga0496112_0218018
1977 Ga0496112_0462284
1978 Ga0496113_0006740
1979 Ga0496113_0037992
1980 Ga0496113_0043787
1981 Ga0496113_0051297
1982 Ga0496113_0059445
1983 Ga0496113_0076548
1984 Ga0496114_0009847
1985 Ga0496114_0079878
1986 Ga0496114_0306210
1987 Ga0496115_0023846
1988 Ga0496115_0029319
1989 Ga0496115_0087123
1990 Ga0496115_0087298
1991 Ga0496115_0100082
1992 Ga0496115_0140952
1993 Ga0496115_0286279
1994 Ga0496115_0372611
1995 Ga0496117_0021089
1996 Ga0496117_0036072
1997 Ga0496117_0120237
1998 Ga0496117_0153817
1999 Ga0496118_0003026
2000 Ga0496118_0027995
2001 Ga0496118_0048029
2002 Ga0496118_0064926
2003 Ga0496118_0090666
2004 Ga0496118_0154936
2005 Ga0496119_0006376
2006 Ga0496119_0038888
2007 Ga0496119_0072987
2008 Ga0496121_0000203
2009 Ga0496121_0000270
2010 Ga0496121_0001251
2011 Ga0496121_0002323
2012 Ga0496121_0015121
2013 Ga0496121_0042502
2014 Ga0496121_0045389
2015 Ga0496121_0130068
2016 Ga0496121_0133412
2017 Ga0496121_0171645
2018 Ga0496121_0267653
2019 Ga0496122_0032788
2020 Ga0496122_0052331
2021 Ga0496123_0010648
2022 Ga0496123_0101514
2023 Ga0496124_0011952
2024 Ga0496124_0048269
2025 Ga0496124_0070552
2026 Ga0496124_0114620
2027 Ga0496125_0000328
2028 Ga0496125_0000407
2029 Ga0496125_0003549
2030 Ga0496125_0024628
2031 Ga0496125_0043717
2032 Ga0496125_0059052
2033 Ga0496125_0070315
2034 Ga0496125_0087175
2035 Ga0496126_0010158
2036 Ga0496126_0016646
2037 Ga0496126_0025084
2038 Ga0496126_0027806
2039 Ga0496126_0035866
2040 Ga0496126_0065855
2041 Ga0496126_0086523
2042 Ga0496126_0088126
2043 Ga0496126_0142503
2044 Ga0496126_0174331
2045 Ga0496126_0208070
2046 Ga0496126_0286373
2047 Ga0495682_0011296
2048 Ga0495682_0055980
2049 Ga0501031_0012366
2050 Ga0501031_0142806
2051 Ga0501032_0000475
2052 Ga0501032_0042704
2053 Ga0501033_0000440
2054 Ga0501033_0001499
2055 Ga0501033_0012762
2056 Ga0501033_0117807
2057 Ga0501033_0119051
2058 Ga0501033_0345629
2059 Ga0501034_0000250
2060 Ga0501034_0028177
2061 Ga0501036_0000098
2062 Ga0501036_0044460
2063 Ga0501036_0061519
2064 Ga0501036_0115578
2065 Ga0501036_0150293
2066 Ga0501037_0000092
2067 Ga0501037_0016024
2068 Ga0501037_0105558
2069 Ga0501037_0106892
2070 Ga0501038_0000059
2071 Ga0501038_0000626
2072 Ga0501038_0042710
2073 Ga0501038_0199908
2074 Ga0501039_0000085
2075 Ga0501039_0021665
2076 Ga0501039_0137111
2077 Ga0501039_0142154
2078 Ga0501042_0035371
2079 Ga0501042_0060507
2080 Ga0501043_0011678
2081 Ga0501043_0289790
2082 Ga0501043_0313691
2083 Ga0501046_0000483
2084 Ga0501046_0013048
2085 Ga0501046_0028766
2086 Ga0501046_0050241
2087 Ga0501046_0235227
2088 Ga0501047_0000022
2089 Ga0501047_0010976
2090 Ga0501047_0020141
2091 Ga0501047_0142285
2092 Ga0501047_0244182
2093 Ga0501047_0428330
2094 Ga0501048_0002266
2095 Ga0501067_0000599
2096 Ga0501067_0114243
2097 Ga0501068_0004667
2098 Ga0501068_0056869
2099 Ga0501068_0065838
2100 Ga0501069_0055162
2101 Ga0501070_0006653
2102 Ga0501070_0062656
2103 Ga0501070_0180468
2104 Ga0501071_0039494
2105 Ga0501071_0073681
2106 Ga0501072_0001923
2107 Ga0501072_0226059
2108 Ga0501073_0000109
2109 Ga0501073_0056097
2110 Ga0501073_0104808
2111 Ga0501074_0036614
2112 Ga0501074_0100957
2113 Ga0501076_0021057
2114 Ga0501077_0060991
2115 Ga0501079_0002132
2116 Ga0501079_0091330
2117 Ga0501080_0005186
2118 Ga0501080_0031118
2119 Ga0501080_0181287
2120 Ga0501080_0186541
2121 Ga0501083_0001424
2122 Ga0501035_0001471
2123 Ga0501035_0035988
2124 Ga0501035_0082774
2125 Ga0501044_0000072
2126 Ga0501044_0001765
2127 Ga0501044_0009154
2128 Ga0501044_0547336
2129 Ga0501045_0370770
2130 nmdc:mga03n38_4895_c1
2131 nmdc:mga00v17_162020_c1
2132 nmdc:mga00v17_55279_c1
2133 nmdc:mga0yw44_208929_c1
2134 nmdc:mga0yw44_47348_c1
2135 nmdc:mga0yw44_83620_c1
2136 nmdc:mga0k408_58486_c1
2137 nmdc:mga06z11_120949_c1
2138 nmdc:mga06z11_255013_c1
2139 nmdc:mga04h51_4727_c1
2140 nmdc:mga07m45_112215_c1
2141 nmdc:mga07m45_113485_c1
2142 nmdc:mga07m45_226957_c1
2143 nmdc:mga09592_221455_c1
2144 nmdc:mga06r32_33397_c1
2145 nmdc:mga0rr50_314731_c1
2146 nmdc:mga0a205_223274_c1
2147 nmdc:mga0sz30_40195_c1
2148 Ga0495601_0049218
2149 Ga0495601_0086261
2150 Ga0495601_0233021
2151 Ga0500635_0048938
2152 Ga0500635_0055968
2153 Ga0495655_0003764
2154 Ga0495655_0012771
2155 Ga0495595_0000445
2156 Ga0495595_0005883
2157 Ga0495619_0000330
2158 Ga0500578_0079113
2159 Ga0500578_0118280
2160 Ga0500643_000063
2161 Ga0500643_034093
2162 Ga0500646_0000839
2163 Ga0500651_0006769
2164 Ga0500651_0006892
2165 Ga0500651_0194034
2166 Ga0500566_0000247
2167 Ga0500566_0003076
2168 Ga0500566_0005190
2169 Ga0500566_0202460
2170 Ga0500640_068405
2171 Ga0500641_0035557
2172 Ga0500554_003943
2173 Ga0500556_0000006
2174 Ga0500557_000037
2175 Ga0500569_001553
2176 Ga0500569_002673
2177 Ga0500572_000191
2178 Ga0500572_019537
2179 Ga0500593_065397
2180 Ga0500595_002654
2181 Ga0500595_014785
2182 Ga0500607_020092
2183 Ga0500608_000959
2184 Ga0500608_051127
2185 Ga0500614_019160
2186 Ga0500618_004575
2187 Ga0500618_017251
2188 Ga0500642_0000004
2189 Ga0500642_0000062
2190 Ga0500642_0011321
2191 Ga0500642_0048371
2192 Ga0500652_000555
2193 Ga0500658_0074733
2194 Ga0500658_0075077
2195 Ga0500559_0000179
2196 Ga0500559_0000398
2197 Ga0500559_0042227
2198 Ga0500559_0139060
2199 Ga0500564_110823
2200 Ga0500568_0000790
2201 Ga0500573_0232028
2202 Ga0500577_0000399
2203 Ga0500586_007140
2204 Ga0500588_0031491
2205 Ga0500603_001290
2206 Ga0500603_007487
2207 Ga0500604_0001375
2208 Ga0500616_0000022
2209 Ga0500616_0018659
2210 Ga0500620_001178
2211 Ga0500622_0015984
2212 Ga0500622_0026331
2213 Ga0500622_0044474
2214 Ga0500630_065807
2215 Ga0500639_013853
2216 Ga0500639_022758
2217 Ga0500636_0000349
2218 Ga0500636_0060283
2219 Ga0500637_0017723
2220 Ga0500637_0215510
2221 Ga0500570_018767
2222 Ga0500625_024838
2223 Ga0500596_004482
2224 Ga0500596_007212
2225 Ga0500601_000064
2226 Ga0501084_0185546
2227 Ga0500661_021525
2228 Ga0501082_0000028
2229 Ga0501082_0144134
2230 2507505246
2231 2508539167
2232 2508695485
2233 2509152633
2234 2511400222
2235 2513625345
2236 2513644164
2237 2513651516
2238 2513658813
2239 2513674587
2240 2513695111
2241 2513705241
2242 2513720304
2243 2513860820
2244 2513873528
2245 2513888766
2246 2513921077
2247 2514012485
2248 2515627442
2249 2517107711
2250 2517888842
2251 2524440890
2252 2524467848
2253 2524537054
2254 2528852938
2255 2603858527
2256 2617352398
2257 2617373761
2258 2644290946
2259 2671119944
2260 2723841642
2261 2728754989
2262 2745081688
2263 2793062042
2264 2793072930
2265 2793082750
2266 2805915612
2267 2818237649
2268 2824604584
2269 2824612325
2270 2824624500
2271 2824633415
2272 2824640288
2273 2824647278
2274 2824655190
2275 2824667559
2276 2824676625
2277 2824684230
2278 2824694701
2279 2824704127
2280 2824708929
2281 2824717406
2282 2824727631
2283 2824737795
2284 2824752227
2285 2824759956
2286 2824770390
2287 2824775522
2288 2838124513
2289 2841945200
2290 2841951981
2291 2841965434
2292 2841970623
2293 2841979972
2294 2841985152
2295 2842043509
2296 2842052501
2297 2844315336
2298 2847931073
2299 2847942155
2300 2849083035
2301 2857511925
2302 2857526351
2303 2874594445
2304 2874608064
2305 2874613436
2306 2874624782
2307 2874628795
2308 2874649818
2309 2876768927
2310 2876773937
2311 2876821817
2312 2879078339
2313 2879085907
2314 2879106022
2315 2879112171
2316 2879130600
2317 2879147123
2318 2881365317
2319 2881668185
2320 2885371028
2321 2885382850
2322 2885388844
2323 2885411662
2324 2888379593
2325 2888390681
2326 2888420306
2327 2889035490
2328 2893067378
2329 2903732197
2330 2903748955
2331 2903770760
2332 2904670263
2333 2904708824
2334 2904713178
2335 2906604274
2336 2906613874
2337 2906628957
2338 2906642332
2339 2906648178
2340 2906667360
2341 2908747444
2342 2908756587
2343 2908776277
2344 2919073802
2345 2922364000
2346 2922368936
2347 2922392566
2348 2922394239
2349 2929618601
2350 2929628714
2351 2932792923
2352 2932794317
2353 2932808089
2354 2932812165
2355 2932823155
2356 2932836072
2357 2933580687
2358 2935615725
2359 2935618521
2360 2935641078
2361 2935653641
2362 2935662390
2363 2935669994
2364 2935679156
2365 2935690025
2366 2935698544
2367 2935711480
2368 2935717544
2369 2935723786
2370 2935739995
2371 2935749258
2372 2935757379
2373 2935763535
2374 2935773042
2375 2935782985
2376 2935787969
2377 2935796455
2378 2935809958
2379 2935816264
2380 2935825477
2381 2935835657
2382 2935844608
2383 2935853266
2384 2935862946
2385 2935866688
2386 2935874995
2387 2935890149
2388 2935914739
2389 2935918715
2390 2935931568
2391 2935940165
2392 2935947488
2393 2935956260
2394 2935962636
2395 2935973053
2396 2935980704
2397 2935985143
2398 2935999729
2399 2936010573
2400 2936016692
2401 2936025325
2402 2936034167
2403 2936041269
2404 2936052224
2405 2936056315
2406 2940563292
2407 2941535514
2408 2941543207
2409 3005475061
2410 3005489070
2411 3005509160
2412 3005592211
2413 3005595050
2414 3005710998
2415 3005718303
2416 8006927890
2417 8006936235
2418 8006969360
2419 8006976180
2420 8006990922
2421 8006996511
2422 8016518182
2423 8016526139
2424 8016544055
2425 8016557677
2426 8016569460
2427 8016582073
2428 8016586370
2429 8016595710
2430 8016606566
2431 8016618468
2432 8016623160
2433 8017058465
2434 8019531027
2435 8019540553
2436 8019550174
2437 8019577231
2438 8019595311
2439 8019606447
2440 8019622970
2441 8019630136
2442 8019640476
2443 8019652470
2444 8019666970
2445 8019676727
2446 8019679263
2447 8019696240
2448 8055742451
2449 8056675743
2450 8056687394
2451 8056690958
2452 8056971288

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02195

ParBc

ParB/Sulfiredoxin domain

34

126

0.98

PF17762

HTH_ParB

HTH domain found in ParB protein

165

212

0.97

PF23552

230

278

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y93-assembly1.cif.gz_A crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) 0.9508 137 231
6y93-assembly1.cif.gz_B crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) 0.9249 128 231
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.8998 144 180
6t1f-assembly2.cif.gz_D crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site 0.893 41 231
6t1f-assembly2.cif.gz_D crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site 0.8799 41 231
ID Description Score Start End Superfamily
af_Q2G118_97_208_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9468 120 227 1.10.10.2830
af_Q2FUQ5_107_218_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9464 120 228 1.10.10.2830
af_Q2FUQ5_43_106_3.90.1530.30 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; 0.9392 55 119 3.90.1530.30
af_P9WIJ9_142_255_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9322 120 228 1.10.10.2830
1vz0A01 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; 0.9192 61 119 3.90.1530.30
ID Description Score Start End GO Terms
AF-A0A2T4RMR3-F1-model_v4 deleted 0.955 123 231
AF-A0A838M0W9-F1-model_v4 ParB/RepB/Spo0J family partition protein 0.8631 117 231 GO:0003677
GO:0005694
GO:0007059
AF-A0A2R7S9F1-F1-model_v4 ParB/Sulfiredoxin domain-containing protein 0.8614 41 232 GO:0003677
GO:0005694
GO:0007059
GO:0045881
AF-N6Y954-F1-model_v4 ParB family protein 0.8519 41 227 GO:0003677
GO:0005694
GO:0007059
AF-A0A1F8VSX0-F1-model_v4 ParB/Sulfiredoxin domain-containing protein 0.8478 41 231 GO:0003677
GO:0005694
GO:0007059

Map