F491968

General Info

Members Datasets Scaffolds Average Seq Length
1229 640 2458 366

Family's Representative Sequence

Representative Sequence 3300020070|Ga0206356_10862082|Ga0206356_108620822
Length 360
Sequence METTAPLILLAAGGTGGHLFPAEALGVELIKRGLRVRLVTDDRALKYSGLFSKDMIDVVASETARGRNPLQLAYAIFTLATGTLSAFGLMRRLKPAAVVGFGGYPTLPPLIAARIAGIPGVIHDANAVLGRANRFLARHVTAIATSLPCVLDRDPTLSAKATTVGTPRRPAIYTAPETNGPFRLLVVGGSQGARVMSDIVPGAIERLEPALWSRLILTQQVREEDMIRVRAVYDRLKIQAELAPFFTDLPARLASNHLVVSRSGAGTIAELAAIGRPSILVPLPGAIDQDQFANAGVLSEVDGALRIPQAEFTSDRLASEISALAAEPQRLAAMAAAARSAGRLDAAERLADLVVKTAGI

Samples

Sample ID Description Type Environment
1 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
75 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
76 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
77 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
100 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
101 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
102 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
105 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
165 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
166 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
167 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
172 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
308 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
349 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
350 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
351 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
352 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
353 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
376 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
379 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
380 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
381 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
382 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
383 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
384 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
385 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
386 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
387 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
388 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
389 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
390 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
391 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
392 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
393 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
394 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
395 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
396 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
397 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
398 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
399 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
400 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
401 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
402 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
403 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
404 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
405 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
406 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
407 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
408 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
409 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
410 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
411 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
412 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
413 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
414 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
415 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
416 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
417 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
418 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
419 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
420 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
425 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
426 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
427 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
428 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
429 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
430 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
431 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
432 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
433 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
434 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
435 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
436 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
437 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
438 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
439 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
440 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
441 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
442 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
443 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
444 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
445 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
446 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
447 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
448 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
449 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
450 2643221651 Afipia sp. Root123D2 Isolate Unclassified
451 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
452 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
453 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
454 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
455 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
456 2791355199
457 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
458 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
459 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
460 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
461 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
462 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
463 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
464 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
465 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
466 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
467 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
468 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
469 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
470 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
471 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
472 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
473 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
474 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
475 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
476 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
477 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
478 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
479 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
480 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
481 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
482 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
483 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
484 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
485 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
486 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
487 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
488 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
489 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
490 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
491 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
492 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
493 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
494 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
495 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
496 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
497 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
498 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
499 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
500 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
501 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
502 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
503 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
504 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
505 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
506 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
507 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
508 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
509 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
510 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
511 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
512 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
513 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
514 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
515 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
516 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
517 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
518 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
519 2904699407
520 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
521 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
522 2906610324
523 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
524 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
525 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
526 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
527 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
528 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
529 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
530 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
531 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
532 2922368715
533 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
534 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
535 2922425934
536 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
537 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
538 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
539 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
540 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
541 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
542 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
543 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
544 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
545 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
546 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
547 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
548 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
549 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
550 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
551 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
552 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
553 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
554 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
555 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
556 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
557 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
558 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
559 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
560 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
561 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
562 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
563 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
564 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
565 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
566 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
567 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
568 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
569 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
570 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
571 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
572 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
573 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
574 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
575 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
576 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
577 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
578 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
579 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
580 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
581 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
582 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
583 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
584 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
585 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
586 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
587 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
588 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
589 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
590 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
591 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
592 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
593 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
594 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
595 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
596 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
597 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
598 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
599 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
600 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
601 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
602 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
603 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
604 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
605 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
606 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
607 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
608 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
609 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
610 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
611 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
612 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
613 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
614 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
615 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
616 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
617 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
618 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
619 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
620 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
621 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
622 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
623 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
624 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
625 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
626 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
627 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
628 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
629 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
630 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
631 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
632 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
633 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
634 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
635 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
636 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
637 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
638 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
639 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
640 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.52
Metatranscriptomes 0.16
Isolates 17.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.85
Nodule 14.48
Rhizoplane 5.21
Rhizosphere 59.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206356_10862082 3300020070 Bacteria 1760
2 JGI25406J46586_10000068 3300003203 Bacteria 47530
3 JGI25406J46586_10000392 3300003203 Bacteria 20055
4 JGI25406J46586_10003218 3300003203 Bacteria 7680
5 JGI25153J46596_10004141 3300003215 Bacteria 7882
6 JGI25153J46596_10004246 3300003215 Bacteria 7754
7 JGI25153J46596_10008945 3300003215 Bacteria 4723
8 JGI25153J46596_10009956 3300003215 Bacteria 4347
9 JGI25160J50197_1001885 3300003354 Bacteria 10064
10 JGI25160J50197_1003307 3300003354 Bacteria 7256
11 JGI25160J50197_1008344 3300003354 Bacteria 3953
12 Ga0055531_10005281 3300003794 Bacteria 7578
13 Ga0055543_1007542 3300004625 Bacteria 2500
14 Ga0065165_1004626 3300005262 Bacteria 8358
15 Ga0065165_1004931 3300005262 Bacteria 7867
16 Ga0065165_1016843 3300005262 Bacteria 2717
17 Ga0070683_100008367 3300005329 Bacteria 8784
18 Ga0070683_100080340 3300005329 Bacteria 3052
19 Ga0070670_100209197 3300005331 Bacteria 1696
20 Ga0068869_100087262 3300005334 Bacteria 2340
21 Ga0068869_100179707 3300005334 Bacteria 1658
22 Ga0068869_100217902 3300005334 Bacteria 1511
23 Ga0070666_10043956 3300005335 Bacteria 2992
24 Ga0070680_100027612 3300005336 Bacteria 4545
25 Ga0070680_100089896 3300005336 Bacteria 2541
26 Ga0070682_100172374 3300005337 Bacteria 1505
27 Ga0068868_100132236 3300005338 Bacteria 2042
28 Ga0068868_100267873 3300005338 Bacteria 1442
29 Ga0070660_100002003 3300005339 Bacteria 14053
30 Ga0070661_100062206 3300005344 Bacteria 2741
31 Ga0070668_100103950 3300005347 Bacteria 2253
32 Ga0070669_100121573 3300005353 Bacteria 1993
33 Ga0070671_100026137 3300005355 Bacteria 4795
34 Ga0070674_100192865 3300005356 Bacteria 1568
35 Ga0070659_100200993 3300005366 Bacteria 1640
36 Ga0070709_10001417 3300005434 Bacteria 12994
37 Ga0070709_10010289 3300005434 Bacteria 5172
38 Ga0070709_10032218 3300005434 Bacteria 3159
39 Ga0070709_10168899 3300005434 Bacteria 1527
40 Ga0070714_100000678 3300005435 Bacteria 24075
41 Ga0070714_100018262 3300005435 Bacteria 5694
42 Ga0070714_100033934 3300005435 Bacteria 4272
43 Ga0070714_100107626 3300005435 Bacteria 2464
44 Ga0070714_100113747 3300005435 Bacteria 2400
45 Ga0070713_100004076 3300005436 Bacteria 9730
46 Ga0070713_100020815 3300005436 Bacteria 5036
47 Ga0070713_100194184 3300005436 Bacteria 1831
48 Ga0070713_100277773 3300005436 Bacteria 1536
49 Ga0070710_10000633 3300005437 Bacteria 16752
50 Ga0070710_10001070 3300005437 Bacteria 12969
51 Ga0070710_10019478 3300005437 Bacteria 3507
52 Ga0070710_10114774 3300005437 Bacteria 1622
53 Ga0070711_100001478 3300005439 Bacteria 12909
54 Ga0070711_100001837 3300005439 Bacteria 11834
55 Ga0070711_100002216 3300005439 Bacteria 11029
56 Ga0070711_100056360 3300005439 Bacteria 2717
57 Ga0070708_100041592 3300005445 Bacteria 4030
58 Ga0070663_100078956 3300005455 Bacteria 2413
59 Ga0070663_100088728 3300005455 Bacteria 2287
60 Ga0070663_100231032 3300005455 Bacteria 1456
61 Ga0070662_100015684 3300005457 Bacteria 5080
62 Ga0070662_100076417 3300005457 Bacteria 2482
63 Ga0070681_10026780 3300005458 Bacteria 5797
64 Ga0070681_10043509 3300005458 Bacteria 4499
65 Ga0070681_10084030 3300005458 Bacteria 3136
66 Ga0070681_10168938 3300005458 Bacteria 2109
67 Ga0070681_10200047 3300005458 Bacteria 1916
68 Ga0068867_100091974 3300005459 Bacteria 2303
69 Ga0070707_100084934 3300005468 Bacteria 3059
70 Ga0070699_100418958 3300005518 Bacteria 1212
71 Ga0070679_100084687 3300005530 Bacteria 3158
72 Ga0070679_100165930 3300005530 Bacteria 2182
73 Ga0070679_100169165 3300005530 Bacteria 2158
74 Ga0070679_100172326 3300005530 Bacteria 2137
75 Ga0070684_100005206 3300005535 Bacteria 9945
76 Ga0070684_100006273 3300005535 Bacteria 9183
77 Ga0070684_100014119 3300005535 Bacteria 6458
78 Ga0068853_100008362 3300005539 Bacteria 8309
79 Ga0068853_100010311 3300005539 Bacteria 7556
80 Ga0068853_100028252 3300005539 Bacteria 4716
81 Ga0070672_100064626 3300005543 Bacteria 2891
82 Ga0070672_100183381 3300005543 Bacteria 1745
83 Ga0070693_100151182 3300005547 Bacteria 1470
84 Ga0070665_100047437 3300005548 Bacteria 4311
85 Ga0070665_100149380 3300005548 Bacteria 2340
86 Ga0070665_100161240 3300005548 Bacteria 2245
87 Ga0070665_100212428 3300005548 Bacteria 1935
88 Ga0068855_100030914 3300005563 Bacteria 6399
89 Ga0068857_100213706 3300005577 Bacteria 1760
90 Ga0068854_100036841 3300005578 Bacteria 3430
91 Ga0068854_100051460 3300005578 Bacteria 2951
92 Ga0068854_100124665 3300005578 Bacteria 1960
93 Ga0068856_100000091 3300005614 Bacteria 85048
94 Ga0068856_100011262 3300005614 Bacteria 8680
95 Ga0068856_100056546 3300005614 Bacteria 3871
96 Ga0068856_100134819 3300005614 Bacteria 2474
97 Ga0068856_100204413 3300005614 Bacteria 1989
98 Ga0068852_100056055 3300005616 Bacteria 3404
99 Ga0068852_100162382 3300005616 Bacteria 2087
100 Ga0068852_100205706 3300005616 Bacteria 1865
101 Ga0068859_100217615 3300005617 Bacteria 1997
102 Ga0068864_100110233 3300005618 Bacteria 2451
103 Ga0068866_10007748 3300005718 Bacteria 4505
104 Ga0068861_100054122 3300005719 Bacteria 3056
105 Ga0068851_10001608 3300005834 Bacteria 9920
106 Ga0068851_10035213 3300005834 Bacteria 2501
107 Ga0068863_100111545 3300005841 Bacteria 2605
108 Ga0068858_100021103 3300005842 Bacteria 6084
109 Ga0068858_100171542 3300005842 Bacteria 2045
110 Ga0068860_100000254 3300005843 Bacteria 79465
111 Ga0068862_100052468 3300005844 Bacteria 3489
112 Ga0068862_100231871 3300005844 Bacteria 1675
113 Ga0081455_10004793 3300005937 Bacteria 15034
114 Ga0081455_10026261 3300005937 Bacteria 5362
115 Ga0081455_10042135 3300005937 Bacteria 4008
116 Ga0081540_1001143 3300005983 Bacteria 23424
117 Ga0081540_1003272 3300005983 Bacteria 12881
118 Ga0081540_1005484 3300005983 Bacteria 9466
119 Ga0081540_1009836 3300005983 Bacteria 6542
120 Ga0081540_1012663 3300005983 Bacteria 5533
121 Ga0081540_1013469 3300005983 Bacteria 5311
122 Ga0081540_1030172 3300005983 Bacteria 3008
123 Ga0081539_10000191 3300005985 Bacteria 142387
124 Ga0081539_10000321 3300005985 Bacteria 106887
125 Ga0070717_10005443 3300006028 Bacteria 9293
126 Ga0070717_10029235 3300006028 Bacteria 4419
127 Ga0075365_10008079 3300006038 Bacteria 5942
128 Ga0075365_10026332 3300006038 Bacteria 3691
129 Ga0075365_10086379 3300006038 Bacteria 2132
130 Ga0075368_10023834 3300006042 Bacteria 2341
131 Ga0075364_10027354 3300006051 Bacteria 3642
132 Ga0070715_10000078 3300006163 Bacteria 27243
133 Ga0070716_100017445 3300006173 Bacteria 3722
134 Ga0070716_100046221 3300006173 Bacteria 2448
135 Ga0070716_100064152 3300006173 Bacteria 2135
136 Ga0070716_100075084 3300006173 Bacteria 1999
137 Ga0070716_100097833 3300006173 Bacteria 1792
138 Ga0070716_100106129 3300006173 Bacteria 1732
139 Ga0070712_100011086 3300006175 Bacteria 5706
140 Ga0070712_100040056 3300006175 Bacteria 3210
141 Ga0070712_100063527 3300006175 Bacteria 2615
142 Ga0070712_100110148 3300006175 Bacteria 2053
143 Ga0075367_10036274 3300006178 Bacteria 2858
144 Ga0075367_10115214 3300006178 Bacteria 1652
145 Ga0075366_10012258 3300006195 Bacteria 4859
146 Ga0075366_10121287 3300006195 Bacteria 1576
147 Ga0097621_100091612 3300006237 Bacteria 2545
148 Ga0075370_10037250 3300006353 Bacteria 2734
149 Ga0075370_10038133 3300006353 Bacteria 2704
150 Ga0068871_100083324 3300006358 Bacteria 2652
151 Ga0075428_100089794 3300006844 Bacteria 3351
152 Ga0075433_10029509 3300006852 Bacteria 4674
153 Ga0075434_100081100 3300006871 Bacteria 3241
154 Ga0075434_100304415 3300006871 Bacteria 1614
155 Ga0075436_100049564 3300006914 Bacteria 2898
156 Ga0075436_100210447 3300006914 Bacteria 1378
157 Ga0097620_100217615 3300006931 Bacteria 1997
158 Ga0099825_1018997 3300006941 Bacteria 5214
159 Ga0099824_1023697 3300006942 Bacteria 3746
160 Ga0099822_1000022 3300006943 Bacteria 64942
161 Ga0099823_1027652 3300006944 Bacteria 4931
162 Ga0075435_100164113 3300007076 Bacteria 1872
163 Ga0105240_10017201 3300009093 Bacteria 9755
164 Ga0105240_10022325 3300009093 Bacteria 8392
165 Ga0105240_10068093 3300009093 Bacteria 4410
166 Ga0105240_10086587 3300009093 Bacteria 3837
167 Ga0105240_10189377 3300009093 Bacteria 2420
168 Ga0105240_10210308 3300009093 Bacteria 2274
169 Ga0105240_10393406 3300009093 Bacteria 1563
170 Ga0111539_10119503 3300009094 Bacteria 3088
171 Ga0105245_10071520 3300009098 Bacteria 3150
172 Ga0105245_10117886 3300009098 Bacteria 2477
173 Ga0105245_10237372 3300009098 Bacteria 1766
174 Ga0105245_10268214 3300009098 Bacteria 1664
175 Ga0105247_10019830 3300009101 Bacteria 4039
176 Ga0105243_10272915 3300009148 Bacteria 1519
177 Ga0105241_10014950 3300009174 Bacteria 5682
178 Ga0105241_10029800 3300009174 Bacteria 4074
179 Ga0105241_10296841 3300009174 Bacteria 1385
180 Ga0105248_10150640 3300009177 Bacteria 2624
181 Ga0105248_10187065 3300009177 Bacteria 2334
182 Ga0105237_10015378 3300009545 Bacteria 7967
183 Ga0105237_10018494 3300009545 Bacteria 7212
184 Ga0105237_10024176 3300009545 Bacteria 6216
185 Ga0105237_10028922 3300009545 Bacteria 5640
186 Ga0105237_10095800 3300009545 Bacteria 2957
187 Ga0105237_10138023 3300009545 Bacteria 2432
188 Ga0105237_10146881 3300009545 Bacteria 2353
189 Ga0105237_10286821 3300009545 Bacteria 1649
190 Ga0105238_10008134 3300009551 Bacteria 10489
191 Ga0105238_10057140 3300009551 Bacteria 3913
192 Ga0105238_10142835 3300009551 Bacteria 2370
193 Ga0105238_10396014 3300009551 Bacteria 1374
194 Ga0105249_10077171 3300009553 Bacteria 3089
195 Ga0105249_10275370 3300009553 Bacteria 1678
196 Ga0099796_10014701 3300010159 Bacteria 2269
197 Ga0099796_10023589 3300010159 Bacteria 1923
198 Ga0105239_10053854 3300010375 Bacteria 4412
199 Ga0105239_10111365 3300010375 Bacteria 3034
200 Ga0105239_10127689 3300010375 Bacteria 2827
201 Ga0105239_10373523 3300010375 Bacteria 1611
202 Ga0105246_10028278 3300011119 Bacteria 3682
203 Ga0157370_10044331 3300013104 Bacteria 4276
204 Ga0157370_10254099 3300013104 Bacteria 1625
205 Ga0157369_10016060 3300013105 Bacteria 8422
206 Ga0157369_10198242 3300013105 Bacteria 2107
207 Ga0157374_10092378 3300013296 Bacteria 2887
208 Ga0157375_10052552 3300013308 Bacteria 4006
209 Ga0163163_10087824 3300014325 Bacteria 3120
210 Ga0163163_10156308 3300014325 Bacteria 2325
211 Ga0163163_10409709 3300014325 Bacteria 1414
212 Ga0157376_10113676 3300014969 Bacteria 2387
213 Ga0163161_10108692 3300017792 Bacteria 2071
214 Ga0163161_10265622 3300017792 Bacteria 1341
215 Ga0206356_11262758 3300020070 Bacteria 1697
216 Ga0214544_1000001 3300021320 Bacteria 783667
217 Ga0214542_1000005 3300021321 Bacteria 389646
218 Ga0214542_1024229 3300021321 Bacteria 3439
219 Ga0214545_1000003 3300021324 Bacteria 720274
220 Ga0214545_1023657 3300021324 Bacteria 3986
221 Ga0214543_1000002 3300021327 Bacteria 712733
222 Ga0214543_1026030 3300021327 Bacteria 3240
223 Ga0213876_10028489 3300021384 Bacteria 2945
224 Ga0213876_10066492 3300021384 Bacteria 1903
225 Ga0213876_10101694 3300021384 Bacteria 1524
226 Ga0213871_10002263 3300021441 Bacteria 3509
227 Ga0209677_101595 3300025253 Bacteria 9567
228 Ga0209677_108387 3300025253 Bacteria 2012
229 Ga0209148_1000424 3300025254 Bacteria 47087
230 Ga0209233_1004610 3300025261 Bacteria 4661
231 Ga0209233_1006596 3300025261 Bacteria 3730
232 Ga0209455_1009596 3300025272 Bacteria 2528
233 Ga0209455_1012617 3300025272 Bacteria 2010
234 Ga0209673_1037039 3300025273 Bacteria 1438
235 Ga0209564_1000485 3300025295 Bacteria 66032
236 Ga0209564_1006799 3300025295 Bacteria 6048
237 Ga0209758_1000141 3300025297 Bacteria 172481
238 Ga0209758_1002420 3300025297 Bacteria 19114
239 Ga0209758_1005684 3300025297 Bacteria 9427
240 Ga0209758_1006453 3300025297 Bacteria 8414
241 Ga0209758_1031926 3300025297 Bacteria 2149
242 Ga0209758_1032768 3300025297 Bacteria 2102
243 Ga0209758_1059854 3300025297 Bacteria 1264
244 Ga0209256_1010818 3300025299 Bacteria 3754
245 Ga0207426_1000425 3300025302 Bacteria 69088
246 Ga0207426_1003443 3300025302 Bacteria 8598
247 Ga0207426_1004449 3300025302 Bacteria 6833
248 Ga0209257_1000426 3300025304 Bacteria 81095
249 Ga0207656_10008209 3300025321 Bacteria 3831
250 Ga0207656_10016277 3300025321 Bacteria 2893
251 Ga0207692_10001055 3300025898 Bacteria 10067
252 Ga0207692_10005603 3300025898 Bacteria 5039
253 Ga0207692_10034148 3300025898 Bacteria 2461
254 Ga0207692_10083406 3300025898 Bacteria 1715
255 Ga0207642_10006639 3300025899 Bacteria 3859
256 Ga0207680_10141396 3300025903 Bacteria 1596
257 Ga0207685_10002878 3300025905 Bacteria 4057
258 Ga0207699_10000390 3300025906 Bacteria 22928
259 Ga0207699_10012034 3300025906 Bacteria 4390
260 Ga0207699_10030568 3300025906 Bacteria 3015
261 Ga0207699_10202813 3300025906 Bacteria 1345
262 Ga0207645_10145994 3300025907 Bacteria 1542
263 Ga0207684_10339723 3300025910 Bacteria 1293
264 Ga0207654_10000323 3300025911 Bacteria 28628
265 Ga0207654_10067997 3300025911 Bacteria 2107
266 Ga0207707_10000178 3300025912 Bacteria 66057
267 Ga0207707_10030844 3300025912 Bacteria 4690
268 Ga0207707_10069420 3300025912 Bacteria 3071
269 Ga0207707_10082388 3300025912 Bacteria 2809
270 Ga0207695_10000062 3300025913 Bacteria 351979
271 Ga0207695_10000497 3300025913 Bacteria 83894
272 Ga0207695_10088253 3300025913 Bacteria 3122
273 Ga0207671_10004982 3300025914 Bacteria 12436
274 Ga0207671_10154721 3300025914 Bacteria 1773
275 Ga0207671_10188296 3300025914 Bacteria 1608
276 Ga0207693_10003503 3300025915 Bacteria 13399
277 Ga0207693_10018008 3300025915 Bacteria 5629
278 Ga0207693_10027789 3300025915 Bacteria 4471
279 Ga0207693_10051082 3300025915 Bacteria 3246
280 Ga0207693_10083737 3300025915 Bacteria 2499
281 Ga0207693_10109173 3300025915 Bacteria 2170
282 Ga0207663_10001979 3300025916 Bacteria 9717
283 Ga0207663_10006434 3300025916 Bacteria 6008
284 Ga0207663_10015611 3300025916 Bacteria 4194
285 Ga0207663_10043697 3300025916 Bacteria 2746
286 Ga0207660_10014180 3300025917 Bacteria 5233
287 Ga0207660_10179692 3300025917 Bacteria 1643
288 Ga0207657_10002910 3300025919 Bacteria 18383
289 Ga0207657_10029030 3300025919 Bacteria 5040
290 Ga0207657_10076639 3300025919 Bacteria 2820
291 Ga0207657_10186508 3300025919 Bacteria 1675
292 Ga0207652_10057241 3300025921 Bacteria 3357
293 Ga0207652_10099805 3300025921 Bacteria 2562
294 Ga0207646_10095799 3300025922 Bacteria 2659
295 Ga0207681_10253291 3300025923 Bacteria 1375
296 Ga0207694_10000212 3300025924 Bacteria 56506
297 Ga0207694_10020078 3300025924 Bacteria 5053
298 Ga0207694_10078059 3300025924 Bacteria 2595
299 Ga0207694_10143146 3300025924 Bacteria 1923
300 Ga0207659_10054790 3300025926 Bacteria 2849
301 Ga0207700_10001341 3300025928 Bacteria 13962
302 Ga0207700_10038868 3300025928 Bacteria 3458
303 Ga0207700_10073685 3300025928 Bacteria 2638
304 Ga0207700_10292772 3300025928 Bacteria 1404
305 Ga0207664_10033246 3300025929 Bacteria 3961
306 Ga0207664_10036057 3300025929 Bacteria 3821
307 Ga0207664_10038518 3300025929 Bacteria 3708
308 Ga0207664_10075472 3300025929 Bacteria 2726
309 Ga0207664_10140288 3300025929 Bacteria 2044
310 Ga0207644_10151431 3300025931 Bacteria 1795
311 Ga0207644_10254249 3300025931 Bacteria 1403
312 Ga0207706_10023317 3300025933 Bacteria 5559
313 Ga0207706_10087663 3300025933 Bacteria 2737
314 Ga0207706_10133439 3300025933 Bacteria 2184
315 Ga0207709_10013744 3300025935 Bacteria 4467
316 Ga0207669_10050072 3300025937 Bacteria 2494
317 Ga0207704_10052956 3300025938 Bacteria 2463
318 Ga0207704_10133699 3300025938 Bacteria 1723
319 Ga0207665_10000361 3300025939 Bacteria 31561
320 Ga0207665_10005543 3300025939 Bacteria 8419
321 Ga0207665_10096560 3300025939 Bacteria 2056
322 Ga0207665_10097429 3300025939 Bacteria 2047
323 Ga0207691_10154226 3300025940 Bacteria 2018
324 Ga0207711_10040725 3300025941 Bacteria 3953
325 Ga0207689_10140785 3300025942 Bacteria 1987
326 Ga0207661_10004270 3300025944 Bacteria 10004
327 Ga0207661_10040922 3300025944 Bacteria 3646
328 Ga0207667_10007538 3300025949 Bacteria 13058
329 Ga0207667_10020042 3300025949 Bacteria 7447
330 Ga0207667_10020500 3300025949 Bacteria 7349
331 Ga0207667_10096966 3300025949 Bacteria 3043
332 Ga0207667_10183322 3300025949 Bacteria 2149
333 Ga0207667_10339810 3300025949 Bacteria 1532
334 Ga0207712_10070275 3300025961 Bacteria 2515
335 Ga0207712_10124876 3300025961 Bacteria 1953
336 Ga0207668_10080761 3300025972 Bacteria 2356
337 Ga0207668_10274169 3300025972 Bacteria 1380
338 Ga0207640_10054473 3300025981 Bacteria 2615
339 Ga0207677_10240867 3300026023 Bacteria 1463
340 Ga0207703_10190870 3300026035 Bacteria 1814
341 Ga0207703_10242709 3300026035 Bacteria 1620
342 Ga0207639_10002809 3300026041 Bacteria 11682
343 Ga0207639_10009638 3300026041 Bacteria 6672
344 Ga0207639_10142632 3300026041 Bacteria 1997
345 Ga0207639_10190810 3300026041 Bacteria 1750
346 Ga0207639_10350805 3300026041 Bacteria 1318
347 Ga0207678_10087674 3300026067 Bacteria 2660
348 Ga0207678_10092146 3300026067 Bacteria 2590
349 Ga0207678_10096270 3300026067 Bacteria 2529
350 Ga0207678_10142099 3300026067 Bacteria 2049
351 Ga0207702_10000003 3300026078 Bacteria 434196
352 Ga0207702_10000041 3300026078 Bacteria 150754
353 Ga0207702_10080857 3300026078 Bacteria 2820
354 Ga0207702_10183373 3300026078 Bacteria 1929
355 Ga0207702_10302247 3300026078 Bacteria 1519
356 Ga0207641_10119826 3300026088 Bacteria 2346
357 Ga0207648_10013629 3300026089 Bacteria 7547
358 Ga0207676_10045662 3300026095 Bacteria 3386
359 Ga0207676_10212523 3300026095 Bacteria 1717
360 Ga0207676_10305386 3300026095 Bacteria 1454
361 Ga0207674_10004756 3300026116 Bacteria 16280
362 Ga0207674_10026464 3300026116 Bacteria 6159
363 Ga0207674_10186131 3300026116 Bacteria 2027
364 Ga0207674_10445603 3300026116 Bacteria 1251
365 Ga0207675_100058237 3300026118 Bacteria 3606
366 Ga0207683_10096466 3300026121 Bacteria 2636
367 Ga0207698_10021924 3300026142 Bacteria 4427
368 Ga0207698_10313711 3300026142 Bacteria 1465
369 Ga0209389_1000004 3300027296 Bacteria 263759
370 Ga0209389_1000023 3300027296 Bacteria 150730
371 Ga0209589_1000006 3300027357 Bacteria 436292
372 Ga0209589_1000010 3300027357 Bacteria 237657
373 Ga0209489_100007 3300027361 Bacteria 436292
374 Ga0209489_100011 3300027361 Bacteria 244710
375 Ga0209489_100295 3300027361 Bacteria 87273
376 Ga0209700_100008 3300027363 Bacteria 436292
377 Ga0209700_100013 3300027363 Bacteria 341906
378 Ga0268266_10006027 3300028379 Bacteria 11179
379 Ga0268266_10031060 3300028379 Bacteria 4536
380 Ga0268266_10118886 3300028379 Bacteria 2350
381 Ga0268266_10142144 3300028379 Bacteria 2154
382 Ga0268266_10170332 3300028379 Bacteria 1976
383 Ga0268265_10010132 3300028380 Bacteria 6365
384 Ga0268264_10000093 3300028381 Bacteria 232057
385 Ga0265337_1016134 3300028556 Bacteria 2424
386 Ga0265323_10007415 3300028653 Bacteria 4559
387 Ga0307517_10000085 3300028786 Bacteria 131200
388 Ga0307515_10279100 3300028794 Bacteria 1380
389 Ga0265338_10000328 3300028800 Bacteria 86546
390 Ga0265324_10018488 3300029957 Bacteria 2519
391 Ga0307511_10123048 3300030521 Bacteria 1595
392 Ga0265330_10032732 3300031235 Bacteria 2328
393 Ga0265330_10043222 3300031235 Bacteria 1994
394 Ga0265330_10054608 3300031235 Bacteria 1746
395 Ga0265332_10011026 3300031238 Bacteria 4016
396 Ga0265332_10033057 3300031238 Bacteria 2252
397 Ga0265325_10005212 3300031241 Bacteria 8068
398 Ga0265325_10011412 3300031241 Bacteria 5106
399 Ga0265329_10060793 3300031242 Bacteria 1197
400 Ga0265340_10002779 3300031247 Bacteria 9978
401 Ga0265340_10068419 3300031247 Bacteria 1686
402 Ga0265340_10074215 3300031247 Bacteria 1609
403 Ga0265339_10017239 3300031249 Bacteria 4281
404 Ga0265339_10063209 3300031249 Bacteria 1989
405 Ga0265331_10014674 3300031250 Bacteria 4163
406 Ga0265331_10018816 3300031250 Bacteria 3572
407 Ga0265331_10059130 3300031250 Bacteria 1813
408 Ga0265316_10136317 3300031344 Bacteria 1846
409 Ga0307509_10014739 3300031507 Bacteria 9167
410 Ga0307509_10127238 3300031507 Bacteria 2511
411 Ga0307509_10183857 3300031507 Bacteria 1951
412 Ga0265313_10031838 3300031595 Bacteria 2700
413 Ga0265313_10111789 3300031595 Bacteria 1200
414 Ga0307508_10000034 3300031616 Bacteria 160115
415 Ga0265314_10069718 3300031711 Bacteria 2358
416 Ga0265342_10006824 3300031712 Bacteria 8440
417 Ga0265342_10009227 3300031712 Bacteria 6978
418 Ga0307516_10012343 3300031730 Bacteria 9215
419 Ga0307516_10019297 3300031730 Bacteria 7063
420 Ga0307516_10035813 3300031730 Bacteria 4975
421 Ga0307516_10054377 3300031730 Bacteria 3912
422 Ga0307516_10118891 3300031730 Bacteria 2436
423 Ga0307412_10163491 3300031911 Bacteria 1657
424 Ga0307510_10004348 3300033180 Bacteria 16677
425 Ga0307510_10036621 3300033180 Bacteria 5458
426 Ga0315911_1000010 3300033442 Bacteria 322197
427 Ga0373926_0069513 3300035083 Bacteria 1292
428 Ga0373934_0018964 3300035086 Bacteria 2636
429 Ga0373923_0002407 3300035111 Bacteria 5748
430 Ga0373923_0069761 3300035111 Bacteria 1507
431 Ga0373936_0006093 3300035113 Bacteria 4543
432 Ga0373936_0069904 3300035113 Bacteria 1445
433 Ga0373945_0008267 3300035116 Bacteria 3385
434 Ga0373956_0054801 3300035119 Bacteria 1797
435 Ga0373956_0097869 3300035119 Bacteria 1358
436 Ga0373957_0001068 3300035120 Bacteria 7227
437 Ga0373957_0022511 3300035120 Bacteria 2246
438 Ga0373943_0006580 3300035170 Bacteria 5212
439 Ga0373943_0007994 3300035170 Bacteria 4747
440 Ga0373946_0007122 3300035171 Bacteria 4084
441 Ga0373946_0029419 3300035171 Bacteria 2186
442 Ga0373955_0000880 3300035172 Bacteria 12889
443 Ga0373955_0032414 3300035172 Bacteria 2742
444 Ga0373942_0030249 3300035207 Bacteria 1426
445 Ga0373924_0002398 3300035410 Bacteria 6306
446 Ga0373924_0006697 3300035410 Bacteria 4137
447 Ga0373924_0017618 3300035410 Bacteria 2742
448 Ga0373931_0094054 3300035691 Bacteria 1675
449 Ga0373935_0000259 3300035692 Bacteria 26229
450 Ga0373935_0074169 3300035692 Bacteria 2199
451 Ga0373927_0002379 3300035695 Bacteria 13707
452 Ga0373927_0004958 3300035695 Bacteria 9228
453 Ga0373927_0118562 3300035695 Bacteria 1727
454 Ga0373933_0001150 3300035724 Bacteria 15688
455 Ga0373933_0002191 3300035724 Bacteria 11169
456 Ga0373933_0028214 3300035724 Bacteria 3236
457 Ga0373933_0146828 3300035724 Bacteria 1492
458 Ga0373947_0000217 3300035725 Bacteria 32254
459 Ga0373947_0010938 3300035725 Bacteria 5211
460 Ga0373947_0012207 3300035725 Bacteria 4919
461 Ga0373947_0013046 3300035725 Bacteria 4764
462 Ga0373947_0097834 3300035725 Bacteria 1840
463 Ga0373947_0183242 3300035725 Bacteria 1364
464 Ga0373937_0006578 3300036401 Bacteria 10035
465 Ga0373937_0012724 3300036401 Bacteria 7406
466 Ga0373937_0022213 3300036401 Bacteria 5702
467 Ga0373925_0004501 3300037068 Bacteria 10530
468 Ga0373925_0026107 3300037068 Bacteria 4272
469 Ga0373925_0041268 3300037068 Bacteria 3420
470 Ga0373925_0057981 3300037068 Bacteria 2902
471 Ga0373925_0072762 3300037068 Bacteria 2601
472 Ga0373925_0095574 3300037068 Bacteria 2276
473 Ga0395900_0001924 3300037418 Bacteria 23564
474 Ga0395900_0323270 3300037418 Bacteria 1522
475 Ga0395898_0013875 3300037466 Bacteria 8282
476 Ga0395898_0020243 3300037466 Bacteria 6760
477 Ga0395898_0059500 3300037466 Bacteria 3716
478 Ga0395898_0212975 3300037466 Bacteria 1843
479 Ga0395905_0091606 3300037471 Bacteria 2850
480 Ga0395905_0092596 3300037471 Bacteria 2835
481 Ga0436364_0578778 3300037853 Bacteria 5418
482 Ga0395901_0015985 3300038443 Bacteria 7647
483 Ga0395901_0268461 3300038443 Bacteria 1775
484 Ga0395901_0411236 3300038443 Bacteria 1389
485 Ga0436365_0425471 3300039437 Bacteria 2620
486 Ga0436365_0698518 3300039437 Bacteria 1563
487 Ga0436365_1129324 3300039437 Bacteria 1958
488 Ga0436360_0973324 3300039438 Bacteria 3801
489 Ga0436361_1121961 3300039447 Bacteria 4323
490 Ga0436361_1213962 3300039447 Bacteria 1309
491 Ga0436363_0248819 3300039450 Bacteria 3382
492 Ga0436363_1154387 3300039450 Bacteria 1372
493 Ga0436362_0646134 3300039453 Bacteria 7178
494 Ga0436362_0766994 3300039453 Bacteria 1153
495 Ga0439465_0023650 3300041413 Bacteria 1934
496 Ga0466972_0000520 3300044658 Bacteria 19029
497 Ga0466972_0004454 3300044658 Bacteria 7005
498 Ga0466965_0085586 3300044683 Bacteria 1598
499 Ga0466966_0035979 3300044684 Bacteria 3198
500 Ga0466966_0047681 3300044684 Bacteria 2731
501 Ga0466961_0000149 3300044693 Bacteria 47561
502 Ga0466961_0070374 3300044693 Bacteria 2221
503 Ga0466963_0073746 3300044694 Bacteria 2301
504 Ga0466964_0088337 3300044706 Bacteria 1344
505 Ga0466968_0029898 3300044735 Bacteria 2255
506 Ga0466957_0017500 3300044842 Bacteria 4199
507 Ga0466960_0080589 3300044901 Bacteria 1639
508 Ga0466959_0004087 3300045049 Bacteria 9713
509 Ga0466959_0115308 3300045049 Bacteria 1914
510 Ga0466959_0156110 3300045049 Bacteria 1606
511 Ga0466967_0034405 3300045976 Bacteria 4301
512 Ga0466967_0040762 3300045976 Bacteria 3999
513 Ga0466967_0073074 3300045976 Bacteria 3076
514 Ga0495592_0008207 3300046454 Bacteria 7841
515 Ga0495592_0020912 3300046454 Bacteria 4978
516 Ga0495592_0029636 3300046454 Bacteria 4143
517 Ga0495592_0037847 3300046454 Bacteria 3630
518 Ga0495592_0114531 3300046454 Bacteria 1904
519 Ga0495603_0000352 3300046455 Bacteria 24722
520 Ga0495603_0014404 3300046455 Bacteria 4784
521 Ga0495603_0036212 3300046455 Bacteria 2962
522 Ga0495603_0079416 3300046455 Bacteria 1923
523 Ga0495590_0039148 3300046457 Bacteria 1654
524 Ga0495629_0003719 3300046459 Bacteria 11498
525 Ga0495629_0051707 3300046459 Bacteria 2875
526 Ga0495629_0108425 3300046459 Bacteria 1937
527 Ga0495638_0009309 3300046460 Bacteria 6904
528 Ga0495638_0014656 3300046460 Bacteria 5289
529 Ga0495638_0089820 3300046460 Bacteria 1852
530 Ga0495641_0006337 3300046461 Bacteria 7689
531 Ga0495641_0044210 3300046461 Bacteria 2056
532 Ga0495651_0003972 3300046462 Bacteria 11306
533 Ga0495651_0008150 3300046462 Bacteria 8034
534 Ga0495651_0009605 3300046462 Bacteria 7433
535 Ga0495651_0028771 3300046462 Bacteria 4331
536 Ga0495653_0012753 3300046463 Bacteria 6862
537 Ga0495653_0025837 3300046463 Bacteria 4712
538 Ga0495653_0039637 3300046463 Bacteria 3689
539 Ga0495653_0083742 3300046463 Bacteria 2351
540 Ga0495650_0024728 3300046471 Bacteria 2832
541 Ga0495580_0018652 3300046472 Bacteria 5163
542 Ga0495580_0059795 3300046472 Bacteria 2678
543 Ga0495580_0116513 3300046472 Bacteria 1855
544 Ga0495582_0000245 3300046473 Bacteria 30263
545 Ga0495582_0035658 3300046473 Bacteria 2736
546 Ga0495639_0020850 3300046475 Bacteria 2865
547 Ga0495662_0000872 3300046476 Bacteria 14723
548 Ga0495662_0075317 3300046476 Bacteria 1638
549 Ga0495664_0004666 3300046477 Bacteria 7494
550 Ga0495664_0020886 3300046477 Bacteria 3780
551 Ga0495664_0027890 3300046477 Bacteria 3294
552 Ga0495664_0036188 3300046477 Bacteria 2909
553 Ga0495664_0070105 3300046477 Bacteria 2093
554 Ga0495594_0001300 3300046499 Bacteria 13017
555 Ga0495594_0038102 3300046499 Bacteria 2624
556 Ga0495606_0015892 3300046507 Bacteria 5775
557 Ga0495606_0022638 3300046507 Bacteria 4571
558 Ga0495606_0160731 3300046507 Bacteria 1311
559 Ga0495608_0041347 3300046511 Bacteria 3085
560 Ga0495616_0032875 3300046513 Bacteria 2707
561 Ga0495618_0009256 3300046514 Bacteria 5944
562 Ga0495618_0017563 3300046514 Bacteria 4389
563 Ga0495618_0039877 3300046514 Bacteria 2953
564 Ga0495620_0046480 3300046515 Bacteria 1874
565 Ga0495628_0005097 3300046516 Bacteria 11546
566 Ga0495628_0040062 3300046516 Bacteria 3745
567 Ga0495630_0009422 3300046517 Bacteria 7019
568 Ga0495630_0051936 3300046517 Bacteria 3069
569 Ga0495630_0236611 3300046517 Bacteria 1395
570 Ga0495632_0074302 3300046519 Bacteria 1628
571 Ga0495643_0060904 3300046522 Bacteria 2002
572 Ga0495644_0006757 3300046523 Bacteria 4442
573 Ga0495648_0001680 3300046524 Bacteria 21407
574 Ga0495648_0019543 3300046524 Bacteria 4760
575 Ga0495648_0058195 3300046524 Bacteria 2312
576 Ga0495666_0003461 3300046526 Bacteria 7971
577 Ga0495652_0061223 3300046529 Bacteria 3178
578 Ga0495652_0087350 3300046529 Bacteria 2558
579 Ga0495652_0112503 3300046529 Bacteria 2187
580 Ga0495652_0156871 3300046529 Bacteria 1771
581 Ga0495652_0279926 3300046529 Bacteria 1222
582 Ga0495665_0000361 3300046531 Bacteria 22971
583 Ga0495665_0168695 3300046531 Bacteria 1140
584 Ga0495640_0003002 3300046533 Bacteria 13580
585 Ga0495640_0017400 3300046533 Bacteria 5359
586 Ga0495640_0022271 3300046533 Bacteria 4634
587 Ga0495640_0034231 3300046533 Bacteria 3604
588 Ga0495587_0017008 3300046536 Bacteria 4521
589 Ga0495621_0048207 3300046539 Bacteria 1516
590 Ga0495645_0001286 3300046543 Bacteria 17104
591 Ga0495645_0020761 3300046543 Bacteria 4744
592 Ga0495645_0023607 3300046543 Bacteria 4455
593 Ga0495645_0083631 3300046543 Bacteria 2287
594 Ga0495645_0203809 3300046543 Bacteria 1340
595 Ga0495622_0006317 3300046557 Bacteria 5501
596 Ga0495622_0079611 3300046557 Bacteria 1508
597 Ga0495633_0063543 3300046558 Bacteria 1727
598 Ga0495667_0012248 3300046559 Bacteria 5812
599 Ga0495667_0033462 3300046559 Bacteria 3440
600 Ga0495667_0126311 3300046559 Bacteria 1650
601 Ga0495656_0004410 3300046615 Bacteria 4818
602 Ga0495668_0091477 3300046616 Bacteria 1667
603 Ga0495634_0000249 3300046642 Bacteria 50835
604 Ga0495634_0012218 3300046642 Bacteria 6225
605 Ga0495634_0022747 3300046642 Bacteria 4415
606 Ga0495634_0068360 3300046642 Bacteria 2347
607 Ga0495634_0109805 3300046642 Bacteria 1774
608 Ga0495625_0036379 3300046660 Bacteria 3619
609 Ga0495635_0000239 3300046663 Bacteria 34889
610 Ga0495635_0003846 3300046663 Bacteria 10429
611 Ga0495635_0014377 3300046663 Bacteria 5536
612 Ga0495635_0081350 3300046663 Bacteria 2216
613 Ga0495635_0095584 3300046663 Bacteria 2031
614 Ga0495661_0012048 3300046665 Bacteria 5851
615 Ga0495588_0069307 3300046674 Bacteria 1833
616 Ga0495657_0003492 3300046675 Bacteria 12822
617 Ga0495657_0006927 3300046675 Bacteria 8808
618 Ga0495657_0026654 3300046675 Bacteria 4090
619 Ga0495599_0001556 3300046678 Bacteria 13209
620 Ga0495599_0008411 3300046678 Bacteria 6272
621 Ga0495599_0016849 3300046678 Bacteria 4539
622 Ga0495623_0002296 3300046679 Bacteria 12741
623 Ga0495623_0009107 3300046679 Bacteria 6440
624 Ga0495623_0010478 3300046679 Bacteria 6000
625 Ga0495646_0001918 3300046680 Bacteria 12509
626 Ga0495646_0005453 3300046680 Bacteria 8043
627 Ga0495646_0011250 3300046680 Bacteria 5683
628 Ga0495646_0102031 3300046680 Bacteria 1644
629 Ga0495647_0003088 3300046681 Bacteria 5318
630 Ga0495647_0022746 3300046681 Bacteria 2267
631 Ga0495647_0030086 3300046681 Bacteria 2013
632 Ga0495658_0001058 3300046683 Bacteria 14532
633 Ga0495658_0019298 3300046683 Bacteria 3556
634 Ga0495658_0102410 3300046683 Bacteria 1711
635 Ga0495669_0052607 3300046684 Bacteria 1830
636 Ga0495613_0000929 3300046689 Bacteria 22466
637 Ga0495613_0067749 3300046689 Bacteria 2605
638 Ga0495613_0255689 3300046689 Bacteria 1221
639 Ga0495624_0000538 3300046690 Bacteria 29656
640 Ga0495624_0184045 3300046690 Bacteria 1272
641 Ga0495670_0017939 3300046691 Bacteria 3486
642 Ga0495671_0055254 3300046692 Bacteria 1967
643 Ga0495671_0102419 3300046692 Bacteria 1399
644 Ga0495649_0085341 3300046694 Bacteria 1685
645 Ga0495589_0069305 3300046794 Bacteria 1725
646 Ga0495600_0002229 3300046809 Bacteria 11033
647 Ga0495600_0029557 3300046809 Bacteria 3548
648 Ga0495581_0001238 3300047315 Bacteria 14050
649 Ga0495581_0057166 3300047315 Bacteria 2252
650 Ga0495604_0005469 3300047317 Bacteria 10075
651 Ga0495604_0074523 3300047317 Bacteria 2557
652 Ga0495604_0134829 3300047317 Bacteria 1770
653 Ga0495604_0204143 3300047317 Bacteria 1369
654 Ga0495674_0001854 3300047319 Bacteria 20818
655 Ga0495674_0020768 3300047319 Bacteria 6080
656 Ga0495674_0021792 3300047319 Bacteria 5921
657 Ga0495674_0113269 3300047319 Bacteria 2297
658 Ga0495672_0036441 3300047320 Bacteria 3020
659 Ga0495672_0062942 3300047320 Bacteria 2131
660 Ga0495676_0027183 3300047321 Bacteria 4911
661 Ga0495680_0021114 3300047322 Bacteria 5456
662 Ga0495680_0024023 3300047322 Bacteria 5062
663 Ga0495680_0131314 3300047322 Bacteria 1840
664 Ga0495687_043987 3300047443 Bacteria 1943
665 Ga0495675_0062117 3300047444 Bacteria 2365
666 Ga0495677_0080575 3300047445 Bacteria 1220
667 Ga0495673_0010245 3300047469 Bacteria 5114
668 Ga0495681_0039134 3300047470 Bacteria 2318
669 Ga0495684_0000893 3300047471 Bacteria 24119
670 Ga0495684_0003057 3300047471 Bacteria 13153
671 Ga0495593_0000034 3300047673 Bacteria 57993
672 Ga0495593_0005088 3300047673 Bacteria 7774
673 Ga0495593_0030123 3300047673 Bacteria 2971
674 Ga0495602_0025294 3300048088 Bacteria 5747
675 Ga0495602_0045096 3300048088 Bacteria 3992
676 Ga0495614_0012106 3300048089 Bacteria 3788
677 Ga0495615_0022350 3300048090 Bacteria 1438
678 Ga0496100_0024419 3300048903 Bacteria 3687
679 Ga0496100_0035051 3300048903 Bacteria 3154
680 Ga0496100_0221778 3300048903 Bacteria 1388
681 Ga0496101_0005889 3300048904 Bacteria 7849
682 Ga0496101_0022103 3300048904 Bacteria 4376
683 Ga0496101_0075060 3300048904 Bacteria 2488
684 Ga0496101_0086002 3300048904 Bacteria 2331
685 Ga0496102_0041716 3300048905 Bacteria 4157
686 Ga0496102_0085515 3300048905 Bacteria 2912
687 Ga0496102_0129517 3300048905 Bacteria 2360
688 Ga0496102_0169801 3300048905 Bacteria 2053
689 Ga0496103_0148981 3300048906 Bacteria 1498
690 Ga0496104_0044141 3300048907 Bacteria 4188
691 Ga0496104_0078027 3300048907 Bacteria 3156
692 Ga0496104_0085182 3300048907 Bacteria 3016
693 Ga0496104_0176933 3300048907 Bacteria 2044
694 Ga0496104_0198086 3300048907 Bacteria 1920
695 Ga0496105_0017518 3300048908 Bacteria 5746
696 Ga0496105_0082763 3300048908 Bacteria 2651
697 Ga0496105_0085675 3300048908 Bacteria 2603
698 Ga0496106_0000649 3300048909 Bacteria 24884
699 Ga0496106_0001165 3300048909 Bacteria 19535
700 Ga0496106_0082778 3300048909 Bacteria 2467
701 Ga0496106_0281869 3300048909 Bacteria 1331
702 Ga0496106_0377205 3300048909 Bacteria 1140
703 Ga0496107_0025520 3300048910 Bacteria 4185
704 Ga0496107_0028181 3300048910 Bacteria 3990
705 Ga0496107_0043555 3300048910 Bacteria 3225
706 Ga0496107_0048989 3300048910 Bacteria 3044
707 Ga0496107_0202412 3300048910 Bacteria 1476
708 Ga0496108_0000744 3300048911 Bacteria 25343
709 Ga0496108_0247857 3300048911 Bacteria 1549
710 Ga0496109_0001766 3300048912 Bacteria 17962
711 Ga0496109_0048359 3300048912 Bacteria 3870
712 Ga0496109_0303289 3300048912 Bacteria 1506
713 Ga0496109_0309442 3300048912 Bacteria 1490
714 Ga0496109_0356227 3300048912 Bacteria 1382
715 Ga0496110_0006833 3300048913 Bacteria 9070
716 Ga0496110_0018692 3300048913 Bacteria 5814
717 Ga0496110_0056020 3300048913 Bacteria 3469
718 Ga0496110_0085668 3300048913 Bacteria 2812
719 Ga0496110_0112391 3300048913 Bacteria 2449
720 Ga0496110_0114120 3300048913 Bacteria 2431
721 Ga0496110_0161215 3300048913 Bacteria 2033
722 Ga0496111_0031499 3300048914 Bacteria 3778
723 Ga0496111_0121446 3300048914 Bacteria 1929
724 Ga0496111_0184210 3300048914 Bacteria 1552
725 Ga0496112_0000008 3300048915 Bacteria 310323
726 Ga0496112_0050851 3300048915 Bacteria 4064
727 Ga0496112_0157994 3300048915 Bacteria 2234
728 Ga0496112_0181663 3300048915 Bacteria 2067
729 Ga0496112_0226149 3300048915 Bacteria 1826
730 Ga0496114_0089217 3300048917 Bacteria 2616
731 Ga0496114_0098129 3300048917 Bacteria 2497
732 Ga0496114_0174356 3300048917 Bacteria 1876
733 Ga0496114_0259154 3300048917 Bacteria 1531
734 Ga0496115_0007272 3300048918 Bacteria 8144
735 Ga0496115_0015832 3300048918 Bacteria 5728
736 Ga0496115_0073171 3300048918 Bacteria 2781
737 Ga0496115_0096862 3300048918 Bacteria 2416
738 Ga0496115_0117402 3300048918 Bacteria 2188
739 Ga0496115_0140716 3300048918 Bacteria 1991
740 Ga0496116_0007242 3300048919 Bacteria 9890
741 Ga0496117_0021643 3300048920 Bacteria 5193
742 Ga0496117_0153317 3300048920 Bacteria 1360
743 Ga0496118_0013219 3300048921 Bacteria 7828
744 Ga0496118_0051899 3300048921 Bacteria 3133
745 Ga0496118_0071624 3300048921 Bacteria 2494
746 Ga0496119_0053236 3300048922 Bacteria 2474
747 Ga0496119_0068363 3300048922 Bacteria 2092
748 Ga0496119_0068812 3300048922 Bacteria 2083
749 Ga0496119_0076546 3300048922 Bacteria 1941
750 Ga0496120_0103874 3300048923 Bacteria 1496
751 Ga0496121_0000476 3300048924 Bacteria 78015
752 Ga0496121_0001497 3300048924 Bacteria 39336
753 Ga0496121_0001742 3300048924 Bacteria 35564
754 Ga0496121_0003089 3300048924 Bacteria 24095
755 Ga0496121_0015642 3300048924 Bacteria 7916
756 Ga0496121_0017380 3300048924 Bacteria 7352
757 Ga0496121_0025084 3300048924 Bacteria 5674
758 Ga0496121_0036908 3300048924 Bacteria 4348
759 Ga0496121_0038697 3300048924 Bacteria 4216
760 Ga0496121_0049287 3300048924 Bacteria 3572
761 Ga0496121_0053890 3300048924 Bacteria 3366
762 Ga0496121_0082348 3300048924 Bacteria 2544
763 Ga0496121_0083650 3300048924 Bacteria 2519
764 Ga0496121_0099916 3300048924 Bacteria 2241
765 Ga0496122_0055284 3300048925 Bacteria 2971
766 Ga0496122_0060464 3300048925 Bacteria 2790
767 Ga0496122_0089939 3300048925 Bacteria 2097
768 Ga0496123_0090680 3300048926 Bacteria 1816
769 Ga0496123_0096202 3300048926 Bacteria 1739
770 Ga0496124_0001128 3300048927 Bacteria 42017
771 Ga0496124_0090921 3300048927 Bacteria 2488
772 Ga0496124_0153432 3300048927 Bacteria 1804
773 Ga0496124_0165776 3300048927 Bacteria 1717
774 Ga0496124_0173653 3300048927 Bacteria 1666
775 Ga0496125_0000154 3300048928 Bacteria 152240
776 Ga0496125_0015007 3300048928 Bacteria 7523
777 Ga0496125_0044841 3300048928 Bacteria 3731
778 Ga0496125_0153920 3300048928 Bacteria 1574
779 Ga0496126_0002744 3300048929 Bacteria 23267
780 Ga0496126_0006113 3300048929 Bacteria 13500
781 Ga0496126_0009402 3300048929 Bacteria 10385
782 Ga0496126_0015910 3300048929 Bacteria 7552
783 Ga0496126_0020832 3300048929 Bacteria 6418
784 Ga0496126_0032430 3300048929 Bacteria 4920
785 Ga0496126_0053931 3300048929 Bacteria 3645
786 Ga0496126_0079933 3300048929 Bacteria 2893
787 Ga0496126_0089718 3300048929 Bacteria 2705
788 Ga0496126_0094162 3300048929 Bacteria 2629
789 Ga0496126_0188462 3300048929 Bacteria 1748
790 Ga0496126_0191581 3300048929 Bacteria 1731
791 Ga0496126_0202508 3300048929 Bacteria 1675
792 Ga0496126_0319939 3300048929 Bacteria 1275
793 Ga0501031_0012949 3300049568 Bacteria 5445
794 Ga0501031_0064009 3300049568 Bacteria 2395
795 Ga0501032_0003534 3300049569 Bacteria 11926
796 Ga0501032_0012670 3300049569 Bacteria 6012
797 Ga0501032_0020626 3300049569 Bacteria 4587
798 Ga0501032_0082398 3300049569 Bacteria 2140
799 Ga0501032_0119010 3300049569 Bacteria 1746
800 Ga0501032_0208172 3300049569 Bacteria 1275
801 Ga0501033_0000249 3300049570 Bacteria 52045
802 Ga0501033_0000951 3300049570 Bacteria 26299
803 Ga0501033_0229418 3300049570 Bacteria 1319
804 Ga0501034_0000197 3300049571 Bacteria 114088
805 Ga0501034_0001938 3300049571 Bacteria 26206
806 Ga0501034_0136806 3300049571 Bacteria 2431
807 Ga0501034_0183501 3300049571 Bacteria 2056
808 Ga0501034_0286773 3300049571 Bacteria 1585
809 Ga0501034_0290404 3300049571 Bacteria 1573
810 Ga0501034_0348538 3300049571 Bacteria 1409
811 Ga0501036_0004433 3300049572 Bacteria 11343
812 Ga0501036_0026547 3300049572 Bacteria 4889
813 Ga0501036_0050620 3300049572 Bacteria 3517
814 Ga0501036_0095024 3300049572 Bacteria 2519
815 Ga0501037_0000112 3300049573 Bacteria 75698
816 Ga0501037_0067387 3300049573 Bacteria 2607
817 Ga0501037_0101975 3300049573 Bacteria 2070
818 Ga0501037_0130451 3300049573 Bacteria 1802
819 Ga0501038_0000160 3300049574 Bacteria 57443
820 Ga0501038_0002206 3300049574 Bacteria 18110
821 Ga0501038_0036532 3300049574 Bacteria 4311
822 Ga0501038_0038091 3300049574 Bacteria 4211
823 Ga0501038_0082118 3300049574 Bacteria 2714
824 Ga0501038_0145474 3300049574 Bacteria 1935
825 Ga0501038_0168699 3300049574 Bacteria 1773
826 Ga0501038_0233536 3300049574 Bacteria 1462
827 Ga0501038_0341018 3300049574 Bacteria 1168
828 Ga0501039_0000472 3300049575 Bacteria 29218
829 Ga0501039_0001057 3300049575 Bacteria 20191
830 Ga0501039_0017068 3300049575 Bacteria 5566
831 Ga0501039_0142515 3300049575 Bacteria 1882
832 Ga0501042_0015592 3300049578 Bacteria 5205
833 Ga0501042_0071253 3300049578 Bacteria 2486
834 Ga0501043_0000278 3300049579 Bacteria 46214
835 Ga0501043_0008635 3300049579 Bacteria 8029
836 Ga0501043_0022578 3300049579 Bacteria 4933
837 Ga0501043_0073668 3300049579 Bacteria 2682
838 Ga0501043_0096156 3300049579 Bacteria 2328
839 Ga0501043_0150931 3300049579 Bacteria 1818
840 Ga0501043_0215853 3300049579 Bacteria 1485
841 Ga0501046_0000937 3300049580 Bacteria 28581
842 Ga0501046_0008812 3300049580 Bacteria 8763
843 Ga0501046_0012556 3300049580 Bacteria 7204
844 Ga0501046_0021462 3300049580 Bacteria 5328
845 Ga0501046_0065853 3300049580 Bacteria 2825
846 Ga0501047_0000275 3300049581 Bacteria 59536
847 Ga0501047_0009938 3300049581 Bacteria 8998
848 Ga0501047_0073429 3300049581 Bacteria 3293
849 Ga0501047_0089000 3300049581 Bacteria 2964
850 Ga0501047_0122575 3300049581 Bacteria 2480
851 Ga0501047_0217062 3300049581 Bacteria 1769
852 Ga0501047_0336852 3300049581 Bacteria 1347
853 Ga0501048_0001248 3300049582 Bacteria 19253
854 Ga0501048_0011414 3300049582 Bacteria 6626
855 Ga0501048_0022723 3300049582 Bacteria 4584
856 Ga0501048_0036570 3300049582 Bacteria 3529
857 Ga0501067_0000258 3300049583 Bacteria 28937
858 Ga0501067_0013462 3300049583 Bacteria 4533
859 Ga0501067_0084036 3300049583 Bacteria 1766
860 Ga0501067_0092887 3300049583 Bacteria 1675
861 Ga0501068_0004146 3300049584 Bacteria 7852
862 Ga0501068_0015819 3300049584 Bacteria 4341
863 Ga0501068_0026245 3300049584 Bacteria 3431
864 Ga0501068_0064658 3300049584 Bacteria 2226
865 Ga0501068_0140272 3300049584 Bacteria 1515
866 Ga0501069_0013808 3300049585 Bacteria 4310
867 Ga0501069_0043425 3300049585 Bacteria 2488
868 Ga0501069_0115876 3300049585 Bacteria 1528
869 Ga0501070_0002548 3300049586 Bacteria 15964
870 Ga0501070_0006200 3300049586 Bacteria 10187
871 Ga0501070_0020554 3300049586 Bacteria 5537
872 Ga0501070_0063929 3300049586 Bacteria 3048
873 Ga0501070_0068502 3300049586 Bacteria 2937
874 Ga0501070_0085330 3300049586 Bacteria 2614
875 Ga0501070_0090347 3300049586 Bacteria 2535
876 Ga0501070_0314854 3300049586 Bacteria 1273
877 Ga0501071_0196477 3300049587 Bacteria 1514
878 Ga0501072_0003198 3300049588 Bacteria 12304
879 Ga0501073_0000103 3300049589 Bacteria 53962
880 Ga0501073_0038356 3300049589 Bacteria 3398
881 Ga0501073_0096064 3300049589 Bacteria 2058
882 Ga0501074_0000456 3300049590 Bacteria 24566
883 Ga0501074_0067246 3300049590 Bacteria 2577
884 Ga0501074_0085067 3300049590 Bacteria 2266
885 Ga0501076_0063997 3300049592 Bacteria 2931
886 Ga0501077_0104803 3300049593 Bacteria 1792
887 Ga0501079_0000451 3300049741 Bacteria 26871
888 Ga0501079_0010445 3300049741 Bacteria 7058
889 Ga0501080_0000082 3300049742 Bacteria 63972
890 Ga0501080_0002998 3300049742 Bacteria 14886
891 Ga0501080_0016338 3300049742 Bacteria 6854
892 Ga0501080_0071776 3300049742 Bacteria 3220
893 Ga0501080_0082435 3300049742 Bacteria 2987
894 Ga0501080_0349960 3300049742 Bacteria 1334
895 Ga0501080_0389057 3300049742 Bacteria 1255
896 Ga0501083_0009193 3300049744 Bacteria 6980
897 Ga0501083_0058731 3300049744 Bacteria 2573
898 Ga0501035_0000766 3300049822 Bacteria 34513
899 Ga0501035_0011386 3300049822 Bacteria 8244
900 Ga0501035_0018251 3300049822 Bacteria 6463
901 Ga0501035_0045134 3300049822 Bacteria 3965
902 Ga0501035_0078488 3300049822 Bacteria 2916
903 Ga0501035_0123726 3300049822 Bacteria 2259
904 Ga0501035_0124942 3300049822 Bacteria 2246
905 Ga0501035_0144301 3300049822 Bacteria 2068
906 Ga0501035_0159477 3300049822 Bacteria 1953
907 Ga0501044_0000418 3300049823 Bacteria 52554
908 Ga0501044_0024381 3300049823 Bacteria 6423
909 Ga0501044_0034063 3300049823 Bacteria 5345
910 Ga0501044_0078546 3300049823 Bacteria 3344
911 Ga0501044_0196236 3300049823 Bacteria 1978
912 Ga0501044_0218611 3300049823 Bacteria 1856
913 Ga0501044_0231316 3300049823 Bacteria 1796
914 Ga0501044_0238631 3300049823 Bacteria 1762
915 Ga0501044_0272344 3300049823 Bacteria 1628
916 Ga0501044_0325483 3300049823 Bacteria 1461
917 Ga0501044_0332956 3300049823 Bacteria 1440
918 Ga0501045_0038807 3300049824 Bacteria 3464
919 Ga0501045_0077486 3300049824 Bacteria 2450
920 nmdc:mga0yw44_1397_c1 3300050492 Bacteria 9573
921 nmdc:mga0yw44_17247_c1 3300050492 Bacteria 3925
922 nmdc:mga0yw44_94319_c1 3300050492 Bacteria 1897
923 nmdc:mga0k408_127339_c1 3300050493 Bacteria 1511
924 nmdc:mga06z11_31082_c1 3300050494 Bacteria 2591
925 nmdc:mga07m45_95447_c1 3300050496 Bacteria 1706
926 nmdc:mga08y16_196743_c1 3300050511 Bacteria 2089
927 nmdc:mga0n895_80110_c1 3300050512 Bacteria 3253
928 nmdc:mga0n895_82170_c1 3300050512 Bacteria 3211
929 nmdc:mga0rr50_152607_c1 3300050513 Bacteria 1868
930 nmdc:mga08x19_192730_c1 3300050514 Bacteria 1395
931 nmdc:mga08x19_24160_c1 3300050514 Bacteria 3773
932 nmdc:mga0a205_311035_c1 3300050515 Bacteria 1447
933 nmdc:mga0a205_3227_c1 3300050515 Bacteria 11031
934 nmdc:mga0sz30_22811_c2 3300050516 Bacteria 1867
935 Ga0495601_0009529 3300053077 Bacteria 5749
936 Ga0495601_0037183 3300053077 Bacteria 3043
937 Ga0495601_0083052 3300053077 Bacteria 2057
938 Ga0495601_0220392 3300053077 Bacteria 1239
939 Ga0495612_0046196 3300053078 Bacteria 1783
940 Ga0500635_0026172 3300053080 Bacteria 1844
941 Ga0495619_0077914 3300053085 Bacteria 2227
942 Ga0500578_0176816 3300053086 Bacteria 1317
943 Ga0500643_000267 3300053087 Bacteria 46005
944 Ga0500643_018509 3300053087 Bacteria 2310
945 Ga0500581_085026 3300053089 Bacteria 1574
946 Ga0500647_0017157 3300053091 Bacteria 3334
947 Ga0500583_0086589 3300053092 Bacteria 1520
948 Ga0500651_0000861 3300053093 Bacteria 14855
949 Ga0500566_0000157 3300053094 Bacteria 34534
950 Ga0500566_0000925 3300053094 Bacteria 16797
951 Ga0500566_0001146 3300053094 Bacteria 15389
952 Ga0500640_038114 3300053095 Bacteria 2111
953 Ga0500641_0058981 3300053096 Bacteria 1595
954 Ga0500650_0001493 3300053098 Bacteria 7107
955 Ga0500554_000718 3300053102 Bacteria 6703
956 Ga0500554_003128 3300053102 Bacteria 3348
957 Ga0500555_002718 3300053103 Bacteria 5083
958 Ga0500556_0000413 3300053104 Bacteria 31142
959 Ga0500557_000041 3300053105 Bacteria 64885
960 Ga0500569_001799 3300053109 Bacteria 4110
961 Ga0500572_001865 3300053111 Bacteria 5335
962 Ga0500592_004170 3300053116 Bacteria 2306
963 Ga0500594_0030081 3300053118 Bacteria 1424
964 Ga0500595_003818 3300053119 Bacteria 6928
965 Ga0500595_006228 3300053119 Bacteria 5095
966 Ga0500608_004754 3300053122 Bacteria 5296
967 Ga0500608_030350 3300053122 Bacteria 2562
968 Ga0500614_001219 3300053123 Bacteria 6263
969 Ga0500626_057934 3300053128 Bacteria 1736
970 Ga0500642_0000005 3300053130 Bacteria 422725
971 Ga0500642_0000140 3300053130 Bacteria 32282
972 Ga0500652_000531 3300053131 Bacteria 13423
973 Ga0500658_0011515 3300053134 Bacteria 3259
974 Ga0500658_0013696 3300053134 Bacteria 2999
975 Ga0500658_0044143 3300053134 Bacteria 1797
976 Ga0500658_0081505 3300053134 Bacteria 1385
977 Ga0500559_0003580 3300053136 Bacteria 7596
978 Ga0500559_0004212 3300053136 Bacteria 6885
979 Ga0500559_0018273 3300053136 Bacteria 2962
980 Ga0500568_0002109 3300053139 Bacteria 12007
981 Ga0500568_0011586 3300053139 Bacteria 4082
982 Ga0500568_0028346 3300053139 Bacteria 2335
983 Ga0500577_0000693 3300053142 Bacteria 8639
984 Ga0500603_000277 3300053150 Bacteria 13486
985 Ga0500603_001226 3300053150 Bacteria 5959
986 Ga0500604_0003539 3300053151 Bacteria 4205
987 Ga0500616_0000166 3300053153 Bacteria 110141
988 Ga0500616_0000180 3300053153 Bacteria 106053
989 Ga0500616_0028432 3300053153 Bacteria 3081
990 Ga0500622_0011079 3300053156 Bacteria 4922
991 Ga0500622_0029561 3300053156 Bacteria 2881
992 Ga0500624_002833 3300053157 Bacteria 2302
993 Ga0500630_014168 3300053159 Bacteria 3925
994 Ga0500634_0031081 3300053161 Bacteria 2911
995 Ga0500638_001014 3300053162 Bacteria 8145
996 Ga0500638_057858 3300053162 Bacteria 1866
997 Ga0500639_000014 3300053163 Bacteria 122926
998 Ga0500639_033548 3300053163 Bacteria 2713
999 Ga0500636_0001916 3300053177 Bacteria 11425
1000 Ga0500636_0011628 3300053177 Bacteria 5151
1001 Ga0500636_0028779 3300053177 Bacteria 3281
1002 Ga0500637_0000121 3300053178 Bacteria 28204
1003 Ga0500637_0002840 3300053178 Bacteria 7802
1004 Ga0500637_0103898 3300053178 Bacteria 1648
1005 Ga0500625_003212 3300053729 Bacteria 6395
1006 Ga0500609_004134 3300053731 Bacteria 2019
1007 Ga0500596_000810 3300053735 Bacteria 6182
1008 Ga0500601_000076 3300053737 Bacteria 20083
1009 Ga0501084_0003972 3300054114 Bacteria 12046
1010 Ga0501084_0222438 3300054114 Bacteria 1593
1011 Ga0500661_000452 3300055283 Bacteria 7586
1012 Ga0501082_0011183 3300060353 Bacteria 7713
1013 2507511012 2507262055 Bacteria 8048963
1014 2508696939 2508501042 Bacteria 8719808
1015 2509148875 2508501128 Bacteria 8613869
1016 2511395187 2511231028 Bacteria 8046582
1017 2513623486 2513237092 Bacteria 8341956
1018 2513637468 2513237094 Bacteria 8789602
1019 2513649682 2513237095 Bacteria 8976980
1020 2513655026 2513237096 Bacteria 8722461
1021 2513677796 2513237098 Bacteria 9902361
1022 2513697433 2513237101 Bacteria 7952346
1023 2513716918 2513237104 Bacteria 10034502
1024 2513861042 2513237137 Bacteria 9558895
1025 2513874652 2513237139 Bacteria 8737671
1026 2513892085 2513237141 Bacteria 8496279
1027 2513915951 2513237145 Bacteria 8979722
1028 2514010632 2513237161 Bacteria 8871253
1029 2515625436 2515154112 Bacteria 8294334
1030 2517100591 2517093001 Bacteria 9002274
1031 2517894744 2517572143 Bacteria 9484767
1032 2524438185 2524023205 Bacteria 8918781
1033 2524464075 2524023210 Bacteria 9029266
1034 2524534493 2524023228 Bacteria 10118060
1035 2528849820 2528768022 Bacteria 10457665
1036 2603862615 2602042107 Bacteria 6226103
1037 2617350776 2617270735 Bacteria 9163226
1038 2617373145 2617270741 Bacteria 8201522
1039 2644287346 2643221651 Bacteria 4798932
1040 2671119158 2667528175 Bacteria 7532676
1041 2723843076 2721755755 Bacteria 8322773
1042 2728747600 2728368998 Bacteria 8720350
1043 2793064664 2791355196 Bacteria 7323613
1044 2793071219 2791355197 Bacteria 8420563
1045 2793079517
1046 2805916649 2802429603 Bacteria 8777136
1047 2818238153 2816332527 Bacteria 8933356
1048 2824607730 2824600985 Bacteria 8488197
1049 2824617132 2824609381 Bacteria 8672835
1050 2824633057 2824626560 Bacteria 8813858
1051 2824641055 2824635225 Bacteria 8785348
1052 2824648775 2824644064 Bacteria 8743947
1053 2824658711 2824653114 Bacteria 8493680
1054 2824668266 2824661429 Bacteria 9877870
1055 2824676178 2824671348 Bacteria 8369588
1056 2824682885 2824679649 Bacteria 8248951
1057 2824692364 2824687955 Bacteria 8360029
1058 2824740138 2824732956 Bacteria 7810675
1059 2824751540 2824746037 Bacteria 7911610
1060 2824761224 2824753945 Bacteria 9787441
1061 2824771851 2824763712 Bacteria 9792355
1062 2824780542 2824773399 Bacteria 8360218
1063 2838127896 2838122688 Bacteria 8803140
1064 2841943189 2841941048 Bacteria 8688029
1065 2841954080 2841949485 Bacteria 8680857
1066 2841960218 2841957949 Bacteria 8652217
1067 2841968170 2841966195 Bacteria 8673214
1068 2841976620 2841974524 Bacteria 8931498
1069 2841987993 2841983080 Bacteria 8395090
1070 2842042704 2842038055 Bacteria 8002051
1071 2842050747 2842045827 Bacteria 8006841
1072 2844316914 2844315083 Bacteria 8138177
1073 2847938563 2847930680 Bacteria 9342022
1074 2847944237 2847939898 Bacteria 8606328
1075 2849081530 2849076700 Bacteria 7039503
1076 2857512189 2857509624 Bacteria 7472071
1077 2857529962 2857524615 Bacteria 6615449
1078 2874597749 2874590934 Bacteria 8299676
1079 2874612593 2874604998 Bacteria 7834745
1080 2874617697 2874612657 Bacteria 8252029
1081 2874623435 2874620515 Bacteria 8290088
1082 2874630655 2874628541 Bacteria 8630250
1083 2874651278 2874645413 Bacteria 8214782
1084 2876762402 2876761206 Bacteria 10111113
1085 2876776349 2876771140 Bacteria 8287509
1086 2876820917 2876818435 Bacteria 8274608
1087 2879081788 2879074833 Bacteria 8279565
1088 2879086192 2879083081 Bacteria 8587928
1089 2879101348 2879099564 Bacteria 10442239
1090 2879118034 2879110137 Bacteria 8907982
1091 2879130503 2879127579 Bacteria 8294491
1092 2879146389 2879142872 Bacteria 8267021
1093 2881370681 2881364244 Bacteria 7710352
1094 2881672684 2881665667 Bacteria 8175609
1095 2885366933 2885366525 Bacteria 8326213
1096 2885378766 2885374607 Bacteria 8927485
1097 2885384490 2885383462 Bacteria 9473874
1098 2888381524 2888378607 Bacteria 9652610
1099 2888389115 2888388044 Bacteria 7304136
1100 2888421927 2888419890 Bacteria 7857137
1101 2889033623 2889033259 Bacteria 9099371
1102 2893069395 2893066018 Bacteria 6158120
1103 2903733964 2903727486 Bacteria 8281579
1104 2903751426 2903748898 Bacteria 9972761
1105 2903773626 2903768456 Bacteria 9749579
1106 2904667334 2904666416 Bacteria 8226587
1107 2904697727 2904690495 Bacteria 9412302
1108 2904705791
1109 2904719228 2904711408 Bacteria 9771557
1110 2906604580 2906602504 Bacteria 8295279
1111 2906611464
1112 2906635179 2906626472 Bacteria 8826946
1113 2906641699 2906635258 Bacteria 8601019
1114 2906651200 2906643746 Bacteria 8722424
1115 2906660801 2906660503 Bacteria 8595048
1116 2908745056 2908739725 Bacteria 8628932
1117 2908757176 2908756301 Bacteria 8864324
1118 2908781600 2908775508 Bacteria 8092255
1119 2919077185 2919073203 Bacteria 6531949
1120 2922366991 2922361189 Bacteria 7436256
1121 2922371192
1122 2922390227 2922386360 Bacteria 7017218
1123 2922393564 2922393267 Bacteria 8285685
1124 2922427893
1125 2929619576 2929615660 Bacteria 9193770
1126 2929627954 2929624759 Bacteria 9339455
1127 2932785906 2932784394 Bacteria 9704911
1128 2932798314 2932794094 Bacteria 7915132
1129 2932804110 2932801729 Bacteria 7987968
1130 2932817276 2932809354 Bacteria 9135765
1131 2932826873 2932818245 Bacteria 9955613
1132 2932830950 2932828146 Bacteria 9745859
1133 2933581496 2933577622 Bacteria 9116884
1134 2935612751 2935608549 Bacteria 8203142
1135 2935621015 2935616580 Bacteria 9032984
1136 2935632179 2935630451 Bacteria 8169952
1137 2935640091 2935638405 Bacteria 10015038
1138 2935656721 2935648319 Bacteria 8801166
1139 2935665540 2935656913 Bacteria 8965014
1140 2935667070 2935665750 Bacteria 9571747
1141 2935690202 2935684952 Bacteria 9590419
1142 2935699712 2935694250 Bacteria 9291695
1143 2935704826 2935703347 Bacteria 10242284
1144 2935718101 2935713505 Bacteria 9608509
1145 2935726749 2935722832 Bacteria 9608746
1146 2935735518 2935732158 Bacteria 9706831
1147 2935745211 2935741537 Bacteria 9707219
1148 2935755213 2935750917 Bacteria 9590372
1149 2935762269 2935760218 Bacteria 9817913
1150 2935773657 2935769743 Bacteria 7878163
1151 2935780212 2935777560 Bacteria 8077691
1152 2935788438 2935785616 Bacteria 7962367
1153 2935796594 2935793552 Bacteria 8012592
1154 2935803772 2935801545 Bacteria 9301974
1155 2935811687 2935810662 Bacteria 9401221
1156 2935824240 2935819856 Bacteria 8261050
1157 2935829574 2935827899 Bacteria 10038562
1158 2935843092 2935837841 Bacteria 9454360
1159 2935852613 2935847175 Bacteria 8228321
1160 2935858822 2935855204 Bacteria 9035059
1161 2935866780 2935864058 Bacteria 9784707
1162 2935876911 2935873716 Bacteria 9632195
1163 2935884084 2935883170 Bacteria 7964738
1164 2935912241 2935908558 Bacteria 8568796
1165 2935924085 2935916978 Bacteria 9113783
1166 2935929270 2935926038 Bacteria 8601059
1167 2935935901 2935934488 Bacteria 8602579
1168 2935950409 2935942939 Bacteria 8599779
1169 2935957433 2935951376 Bacteria 8602333
1170 2935962044 2935959822 Bacteria 7869783
1171 2935968464 2935967501 Bacteria 8603075
1172 2935976653 2935975950 Bacteria 8347125
1173 2935990723 2935984226 Bacteria 8302647
1174 2935993452 2935992306 Bacteria 9802711
1175 2936004347 2936002035 Bacteria 9362176
1176 2936019584 2936011229 Bacteria 8801034
1177 2936028200 2936019824 Bacteria 8804134
1178 2936037073 2936028420 Bacteria 8965941
1179 2936038269 2936037263 Bacteria 9446081
1180 2936055057 2936046547 Bacteria 8903709
1181 2936058607 2936055302 Bacteria 8785755
1182 2940561506 2940556831 Bacteria 9590747
1183 2941508127 2941507105 Bacteria 8166816
1184 2941515368 2941515067 Bacteria 8166720
1185 2941524057 2941523033 Bacteria 8169134
1186 2941533696 2941531003 Bacteria 7653939
1187 2941544316 2941538514 Bacteria 9402094
1188 3005477604 3005474847 Bacteria 9259049
1189 3005486183 3005483717 Bacteria 7877331
1190 3005507124 3005506211 Bacteria 6943378
1191 3005588498 3005587118 Bacteria 7794411
1192 3005596548 3005594810 Bacteria 8716512
1193 3005712616 3005710791 Bacteria 7622528
1194 3005719677 3005718088 Bacteria 8283608
1195 8006930905 8006926726 Bacteria 6749210
1196 8006933615 8006933436 Bacteria 10410654
1197 8006966527 8006964411 Bacteria 8966052
1198 8006983288 8006973647 Bacteria 10679141
1199 8006989355 8006984368 Bacteria 9651211
1200 8006997837 8006994254 Bacteria 8309700
1201 8016516435 8016511872 Bacteria 9921665
1202 8016523835 8016522445 Bacteria 8156687
1203 8016541636 8016539877 Bacteria 8155419
1204 8016551632 8016548790 Bacteria 8155074
1205 8016560018 8016557553 Bacteria 8154380
1206 8016567022 8016566248 Bacteria 8158151
1207 8016589131 8016583857 Bacteria 10421953
1208 8016597943 8016595262 Bacteria 8149947
1209 8016604083 8016603502 Bacteria 8731218
1210 8016620665 8016613128 Bacteria 8794220
1211 8016629333 8016622563 Bacteria 7999408
1212 8016633848 8016630954 Bacteria 9217207
1213 8017060102 8017057580 Bacteria 10023680
1214 8019537050 8019530166 Bacteria 8155624
1215 8019542490 8019538911 Bacteria 7872763
1216 8019548265 8019547302 Bacteria 7996444
1217 8019559553 8019555841 Bacteria 9642137
1218 8019569655 8019565922 Bacteria 9639779
1219 8019579612 8019576017 Bacteria 10049540
1220 8019604018 8019597564 Bacteria 10041141
1221 8019637044 8019629233 Bacteria 8687553
1222 8019650025 8019648815 Bacteria 10014479
1223 8019681658 8019678201 Bacteria 8863603
1224 8019694113 8019687851 Bacteria 8712826
1225 8055749166 8055742211 Bacteria 9226248
1226 8056674871 8056673599 Bacteria 7871253
1227 8056682382 8056681323 Bacteria 8472857
1228 8056695171 8056689827 Bacteria 6712655
1229 8056969721 8056967851 Bacteria 9038162
1230 Ga0206356_10862082
1231 JGI25406J46586_10000068
1232 JGI25406J46586_10000392
1233 JGI25406J46586_10003218
1234 JGI25153J46596_10004141
1235 JGI25153J46596_10004246
1236 JGI25153J46596_10008945
1237 JGI25153J46596_10009956
1238 JGI25160J50197_1001885
1239 JGI25160J50197_1003307
1240 JGI25160J50197_1008344
1241 Ga0055531_10005281
1242 Ga0055543_1007542
1243 Ga0065165_1004626
1244 Ga0065165_1004931
1245 Ga0065165_1016843
1246 Ga0070683_100008367
1247 Ga0070683_100080340
1248 Ga0070670_100209197
1249 Ga0068869_100087262
1250 Ga0068869_100179707
1251 Ga0068869_100217902
1252 Ga0070666_10043956
1253 Ga0070680_100027612
1254 Ga0070680_100089896
1255 Ga0070682_100172374
1256 Ga0068868_100132236
1257 Ga0068868_100267873
1258 Ga0070660_100002003
1259 Ga0070661_100062206
1260 Ga0070668_100103950
1261 Ga0070669_100121573
1262 Ga0070671_100026137
1263 Ga0070674_100192865
1264 Ga0070659_100200993
1265 Ga0070709_10001417
1266 Ga0070709_10010289
1267 Ga0070709_10032218
1268 Ga0070709_10168899
1269 Ga0070714_100000678
1270 Ga0070714_100018262
1271 Ga0070714_100033934
1272 Ga0070714_100107626
1273 Ga0070714_100113747
1274 Ga0070713_100004076
1275 Ga0070713_100020815
1276 Ga0070713_100194184
1277 Ga0070713_100277773
1278 Ga0070710_10000633
1279 Ga0070710_10001070
1280 Ga0070710_10019478
1281 Ga0070710_10114774
1282 Ga0070711_100001478
1283 Ga0070711_100001837
1284 Ga0070711_100002216
1285 Ga0070711_100056360
1286 Ga0070708_100041592
1287 Ga0070663_100078956
1288 Ga0070663_100088728
1289 Ga0070663_100231032
1290 Ga0070662_100015684
1291 Ga0070662_100076417
1292 Ga0070681_10026780
1293 Ga0070681_10043509
1294 Ga0070681_10084030
1295 Ga0070681_10168938
1296 Ga0070681_10200047
1297 Ga0068867_100091974
1298 Ga0070707_100084934
1299 Ga0070699_100418958
1300 Ga0070679_100084687
1301 Ga0070679_100165930
1302 Ga0070679_100169165
1303 Ga0070679_100172326
1304 Ga0070684_100005206
1305 Ga0070684_100006273
1306 Ga0070684_100014119
1307 Ga0068853_100008362
1308 Ga0068853_100010311
1309 Ga0068853_100028252
1310 Ga0070672_100064626
1311 Ga0070672_100183381
1312 Ga0070693_100151182
1313 Ga0070665_100047437
1314 Ga0070665_100149380
1315 Ga0070665_100161240
1316 Ga0070665_100212428
1317 Ga0068855_100030914
1318 Ga0068857_100213706
1319 Ga0068854_100036841
1320 Ga0068854_100051460
1321 Ga0068854_100124665
1322 Ga0068856_100000091
1323 Ga0068856_100011262
1324 Ga0068856_100056546
1325 Ga0068856_100134819
1326 Ga0068856_100204413
1327 Ga0068852_100056055
1328 Ga0068852_100162382
1329 Ga0068852_100205706
1330 Ga0068859_100217615
1331 Ga0068864_100110233
1332 Ga0068866_10007748
1333 Ga0068861_100054122
1334 Ga0068851_10001608
1335 Ga0068851_10035213
1336 Ga0068863_100111545
1337 Ga0068858_100021103
1338 Ga0068858_100171542
1339 Ga0068860_100000254
1340 Ga0068862_100052468
1341 Ga0068862_100231871
1342 Ga0081455_10004793
1343 Ga0081455_10026261
1344 Ga0081455_10042135
1345 Ga0081540_1001143
1346 Ga0081540_1003272
1347 Ga0081540_1005484
1348 Ga0081540_1009836
1349 Ga0081540_1012663
1350 Ga0081540_1013469
1351 Ga0081540_1030172
1352 Ga0081539_10000191
1353 Ga0081539_10000321
1354 Ga0070717_10005443
1355 Ga0070717_10029235
1356 Ga0075365_10008079
1357 Ga0075365_10026332
1358 Ga0075365_10086379
1359 Ga0075368_10023834
1360 Ga0075364_10027354
1361 Ga0070715_10000078
1362 Ga0070716_100017445
1363 Ga0070716_100046221
1364 Ga0070716_100064152
1365 Ga0070716_100075084
1366 Ga0070716_100097833
1367 Ga0070716_100106129
1368 Ga0070712_100011086
1369 Ga0070712_100040056
1370 Ga0070712_100063527
1371 Ga0070712_100110148
1372 Ga0075367_10036274
1373 Ga0075367_10115214
1374 Ga0075366_10012258
1375 Ga0075366_10121287
1376 Ga0097621_100091612
1377 Ga0075370_10037250
1378 Ga0075370_10038133
1379 Ga0068871_100083324
1380 Ga0075428_100089794
1381 Ga0075433_10029509
1382 Ga0075434_100081100
1383 Ga0075434_100304415
1384 Ga0075436_100049564
1385 Ga0075436_100210447
1386 Ga0097620_100217615
1387 Ga0099825_1018997
1388 Ga0099824_1023697
1389 Ga0099822_1000022
1390 Ga0099823_1027652
1391 Ga0075435_100164113
1392 Ga0105240_10017201
1393 Ga0105240_10022325
1394 Ga0105240_10068093
1395 Ga0105240_10086587
1396 Ga0105240_10189377
1397 Ga0105240_10210308
1398 Ga0105240_10393406
1399 Ga0111539_10119503
1400 Ga0105245_10071520
1401 Ga0105245_10117886
1402 Ga0105245_10237372
1403 Ga0105245_10268214
1404 Ga0105247_10019830
1405 Ga0105243_10272915
1406 Ga0105241_10014950
1407 Ga0105241_10029800
1408 Ga0105241_10296841
1409 Ga0105248_10150640
1410 Ga0105248_10187065
1411 Ga0105237_10015378
1412 Ga0105237_10018494
1413 Ga0105237_10024176
1414 Ga0105237_10028922
1415 Ga0105237_10095800
1416 Ga0105237_10138023
1417 Ga0105237_10146881
1418 Ga0105237_10286821
1419 Ga0105238_10008134
1420 Ga0105238_10057140
1421 Ga0105238_10142835
1422 Ga0105238_10396014
1423 Ga0105249_10077171
1424 Ga0105249_10275370
1425 Ga0099796_10014701
1426 Ga0099796_10023589
1427 Ga0105239_10053854
1428 Ga0105239_10111365
1429 Ga0105239_10127689
1430 Ga0105239_10373523
1431 Ga0105246_10028278
1432 Ga0157370_10044331
1433 Ga0157370_10254099
1434 Ga0157369_10016060
1435 Ga0157369_10198242
1436 Ga0157374_10092378
1437 Ga0157375_10052552
1438 Ga0163163_10087824
1439 Ga0163163_10156308
1440 Ga0163163_10409709
1441 Ga0157376_10113676
1442 Ga0163161_10108692
1443 Ga0163161_10265622
1444 Ga0206356_11262758
1445 Ga0214544_1000001
1446 Ga0214542_1000005
1447 Ga0214542_1024229
1448 Ga0214545_1000003
1449 Ga0214545_1023657
1450 Ga0214543_1000002
1451 Ga0214543_1026030
1452 Ga0213876_10028489
1453 Ga0213876_10066492
1454 Ga0213876_10101694
1455 Ga0213871_10002263
1456 Ga0209677_101595
1457 Ga0209677_108387
1458 Ga0209148_1000424
1459 Ga0209233_1004610
1460 Ga0209233_1006596
1461 Ga0209455_1009596
1462 Ga0209455_1012617
1463 Ga0209673_1037039
1464 Ga0209564_1000485
1465 Ga0209564_1006799
1466 Ga0209758_1000141
1467 Ga0209758_1002420
1468 Ga0209758_1005684
1469 Ga0209758_1006453
1470 Ga0209758_1031926
1471 Ga0209758_1032768
1472 Ga0209758_1059854
1473 Ga0209256_1010818
1474 Ga0207426_1000425
1475 Ga0207426_1003443
1476 Ga0207426_1004449
1477 Ga0209257_1000426
1478 Ga0207656_10008209
1479 Ga0207656_10016277
1480 Ga0207692_10001055
1481 Ga0207692_10005603
1482 Ga0207692_10034148
1483 Ga0207692_10083406
1484 Ga0207642_10006639
1485 Ga0207680_10141396
1486 Ga0207685_10002878
1487 Ga0207699_10000390
1488 Ga0207699_10012034
1489 Ga0207699_10030568
1490 Ga0207699_10202813
1491 Ga0207645_10145994
1492 Ga0207684_10339723
1493 Ga0207654_10000323
1494 Ga0207654_10067997
1495 Ga0207707_10000178
1496 Ga0207707_10030844
1497 Ga0207707_10069420
1498 Ga0207707_10082388
1499 Ga0207695_10000062
1500 Ga0207695_10000497
1501 Ga0207695_10088253
1502 Ga0207671_10004982
1503 Ga0207671_10154721
1504 Ga0207671_10188296
1505 Ga0207693_10003503
1506 Ga0207693_10018008
1507 Ga0207693_10027789
1508 Ga0207693_10051082
1509 Ga0207693_10083737
1510 Ga0207693_10109173
1511 Ga0207663_10001979
1512 Ga0207663_10006434
1513 Ga0207663_10015611
1514 Ga0207663_10043697
1515 Ga0207660_10014180
1516 Ga0207660_10179692
1517 Ga0207657_10002910
1518 Ga0207657_10029030
1519 Ga0207657_10076639
1520 Ga0207657_10186508
1521 Ga0207652_10057241
1522 Ga0207652_10099805
1523 Ga0207646_10095799
1524 Ga0207681_10253291
1525 Ga0207694_10000212
1526 Ga0207694_10020078
1527 Ga0207694_10078059
1528 Ga0207694_10143146
1529 Ga0207659_10054790
1530 Ga0207700_10001341
1531 Ga0207700_10038868
1532 Ga0207700_10073685
1533 Ga0207700_10292772
1534 Ga0207664_10033246
1535 Ga0207664_10036057
1536 Ga0207664_10038518
1537 Ga0207664_10075472
1538 Ga0207664_10140288
1539 Ga0207644_10151431
1540 Ga0207644_10254249
1541 Ga0207706_10023317
1542 Ga0207706_10087663
1543 Ga0207706_10133439
1544 Ga0207709_10013744
1545 Ga0207669_10050072
1546 Ga0207704_10052956
1547 Ga0207704_10133699
1548 Ga0207665_10000361
1549 Ga0207665_10005543
1550 Ga0207665_10096560
1551 Ga0207665_10097429
1552 Ga0207691_10154226
1553 Ga0207711_10040725
1554 Ga0207689_10140785
1555 Ga0207661_10004270
1556 Ga0207661_10040922
1557 Ga0207667_10007538
1558 Ga0207667_10020042
1559 Ga0207667_10020500
1560 Ga0207667_10096966
1561 Ga0207667_10183322
1562 Ga0207667_10339810
1563 Ga0207712_10070275
1564 Ga0207712_10124876
1565 Ga0207668_10080761
1566 Ga0207668_10274169
1567 Ga0207640_10054473
1568 Ga0207677_10240867
1569 Ga0207703_10190870
1570 Ga0207703_10242709
1571 Ga0207639_10002809
1572 Ga0207639_10009638
1573 Ga0207639_10142632
1574 Ga0207639_10190810
1575 Ga0207639_10350805
1576 Ga0207678_10087674
1577 Ga0207678_10092146
1578 Ga0207678_10096270
1579 Ga0207678_10142099
1580 Ga0207702_10000003
1581 Ga0207702_10000041
1582 Ga0207702_10080857
1583 Ga0207702_10183373
1584 Ga0207702_10302247
1585 Ga0207641_10119826
1586 Ga0207648_10013629
1587 Ga0207676_10045662
1588 Ga0207676_10212523
1589 Ga0207676_10305386
1590 Ga0207674_10004756
1591 Ga0207674_10026464
1592 Ga0207674_10186131
1593 Ga0207674_10445603
1594 Ga0207675_100058237
1595 Ga0207683_10096466
1596 Ga0207698_10021924
1597 Ga0207698_10313711
1598 Ga0209389_1000004
1599 Ga0209389_1000023
1600 Ga0209589_1000006
1601 Ga0209589_1000010
1602 Ga0209489_100007
1603 Ga0209489_100011
1604 Ga0209489_100295
1605 Ga0209700_100008
1606 Ga0209700_100013
1607 Ga0268266_10006027
1608 Ga0268266_10031060
1609 Ga0268266_10118886
1610 Ga0268266_10142144
1611 Ga0268266_10170332
1612 Ga0268265_10010132
1613 Ga0268264_10000093
1614 Ga0265337_1016134
1615 Ga0265323_10007415
1616 Ga0307517_10000085
1617 Ga0307515_10279100
1618 Ga0265338_10000328
1619 Ga0265324_10018488
1620 Ga0307511_10123048
1621 Ga0265330_10032732
1622 Ga0265330_10043222
1623 Ga0265330_10054608
1624 Ga0265332_10011026
1625 Ga0265332_10033057
1626 Ga0265325_10005212
1627 Ga0265325_10011412
1628 Ga0265329_10060793
1629 Ga0265340_10002779
1630 Ga0265340_10068419
1631 Ga0265340_10074215
1632 Ga0265339_10017239
1633 Ga0265339_10063209
1634 Ga0265331_10014674
1635 Ga0265331_10018816
1636 Ga0265331_10059130
1637 Ga0265316_10136317
1638 Ga0307509_10014739
1639 Ga0307509_10127238
1640 Ga0307509_10183857
1641 Ga0265313_10031838
1642 Ga0265313_10111789
1643 Ga0307508_10000034
1644 Ga0265314_10069718
1645 Ga0265342_10006824
1646 Ga0265342_10009227
1647 Ga0307516_10012343
1648 Ga0307516_10019297
1649 Ga0307516_10035813
1650 Ga0307516_10054377
1651 Ga0307516_10118891
1652 Ga0307412_10163491
1653 Ga0307510_10004348
1654 Ga0307510_10036621
1655 Ga0315911_1000010
1656 Ga0373926_0069513
1657 Ga0373934_0018964
1658 Ga0373923_0002407
1659 Ga0373923_0069761
1660 Ga0373936_0006093
1661 Ga0373936_0069904
1662 Ga0373945_0008267
1663 Ga0373956_0054801
1664 Ga0373956_0097869
1665 Ga0373957_0001068
1666 Ga0373957_0022511
1667 Ga0373943_0006580
1668 Ga0373943_0007994
1669 Ga0373946_0007122
1670 Ga0373946_0029419
1671 Ga0373955_0000880
1672 Ga0373955_0032414
1673 Ga0373942_0030249
1674 Ga0373924_0002398
1675 Ga0373924_0006697
1676 Ga0373924_0017618
1677 Ga0373931_0094054
1678 Ga0373935_0000259
1679 Ga0373935_0074169
1680 Ga0373927_0002379
1681 Ga0373927_0004958
1682 Ga0373927_0118562
1683 Ga0373933_0001150
1684 Ga0373933_0002191
1685 Ga0373933_0028214
1686 Ga0373933_0146828
1687 Ga0373947_0000217
1688 Ga0373947_0010938
1689 Ga0373947_0012207
1690 Ga0373947_0013046
1691 Ga0373947_0097834
1692 Ga0373947_0183242
1693 Ga0373937_0006578
1694 Ga0373937_0012724
1695 Ga0373937_0022213
1696 Ga0373925_0004501
1697 Ga0373925_0026107
1698 Ga0373925_0041268
1699 Ga0373925_0057981
1700 Ga0373925_0072762
1701 Ga0373925_0095574
1702 Ga0395900_0001924
1703 Ga0395900_0323270
1704 Ga0395898_0013875
1705 Ga0395898_0020243
1706 Ga0395898_0059500
1707 Ga0395898_0212975
1708 Ga0395905_0091606
1709 Ga0395905_0092596
1710 Ga0436364_0578778
1711 Ga0395901_0015985
1712 Ga0395901_0268461
1713 Ga0395901_0411236
1714 Ga0436365_0425471
1715 Ga0436365_0698518
1716 Ga0436365_1129324
1717 Ga0436360_0973324
1718 Ga0436361_1121961
1719 Ga0436361_1213962
1720 Ga0436363_0248819
1721 Ga0436363_1154387
1722 Ga0436362_0646134
1723 Ga0436362_0766994
1724 Ga0439465_0023650
1725 Ga0466972_0000520
1726 Ga0466972_0004454
1727 Ga0466965_0085586
1728 Ga0466966_0035979
1729 Ga0466966_0047681
1730 Ga0466961_0000149
1731 Ga0466961_0070374
1732 Ga0466963_0073746
1733 Ga0466964_0088337
1734 Ga0466968_0029898
1735 Ga0466957_0017500
1736 Ga0466960_0080589
1737 Ga0466959_0004087
1738 Ga0466959_0115308
1739 Ga0466959_0156110
1740 Ga0466967_0034405
1741 Ga0466967_0040762
1742 Ga0466967_0073074
1743 Ga0495592_0008207
1744 Ga0495592_0020912
1745 Ga0495592_0029636
1746 Ga0495592_0037847
1747 Ga0495592_0114531
1748 Ga0495603_0000352
1749 Ga0495603_0014404
1750 Ga0495603_0036212
1751 Ga0495603_0079416
1752 Ga0495590_0039148
1753 Ga0495629_0003719
1754 Ga0495629_0051707
1755 Ga0495629_0108425
1756 Ga0495638_0009309
1757 Ga0495638_0014656
1758 Ga0495638_0089820
1759 Ga0495641_0006337
1760 Ga0495641_0044210
1761 Ga0495651_0003972
1762 Ga0495651_0008150
1763 Ga0495651_0009605
1764 Ga0495651_0028771
1765 Ga0495653_0012753
1766 Ga0495653_0025837
1767 Ga0495653_0039637
1768 Ga0495653_0083742
1769 Ga0495650_0024728
1770 Ga0495580_0018652
1771 Ga0495580_0059795
1772 Ga0495580_0116513
1773 Ga0495582_0000245
1774 Ga0495582_0035658
1775 Ga0495639_0020850
1776 Ga0495662_0000872
1777 Ga0495662_0075317
1778 Ga0495664_0004666
1779 Ga0495664_0020886
1780 Ga0495664_0027890
1781 Ga0495664_0036188
1782 Ga0495664_0070105
1783 Ga0495594_0001300
1784 Ga0495594_0038102
1785 Ga0495606_0015892
1786 Ga0495606_0022638
1787 Ga0495606_0160731
1788 Ga0495608_0041347
1789 Ga0495616_0032875
1790 Ga0495618_0009256
1791 Ga0495618_0017563
1792 Ga0495618_0039877
1793 Ga0495620_0046480
1794 Ga0495628_0005097
1795 Ga0495628_0040062
1796 Ga0495630_0009422
1797 Ga0495630_0051936
1798 Ga0495630_0236611
1799 Ga0495632_0074302
1800 Ga0495643_0060904
1801 Ga0495644_0006757
1802 Ga0495648_0001680
1803 Ga0495648_0019543
1804 Ga0495648_0058195
1805 Ga0495666_0003461
1806 Ga0495652_0061223
1807 Ga0495652_0087350
1808 Ga0495652_0112503
1809 Ga0495652_0156871
1810 Ga0495652_0279926
1811 Ga0495665_0000361
1812 Ga0495665_0168695
1813 Ga0495640_0003002
1814 Ga0495640_0017400
1815 Ga0495640_0022271
1816 Ga0495640_0034231
1817 Ga0495587_0017008
1818 Ga0495621_0048207
1819 Ga0495645_0001286
1820 Ga0495645_0020761
1821 Ga0495645_0023607
1822 Ga0495645_0083631
1823 Ga0495645_0203809
1824 Ga0495622_0006317
1825 Ga0495622_0079611
1826 Ga0495633_0063543
1827 Ga0495667_0012248
1828 Ga0495667_0033462
1829 Ga0495667_0126311
1830 Ga0495656_0004410
1831 Ga0495668_0091477
1832 Ga0495634_0000249
1833 Ga0495634_0012218
1834 Ga0495634_0022747
1835 Ga0495634_0068360
1836 Ga0495634_0109805
1837 Ga0495625_0036379
1838 Ga0495635_0000239
1839 Ga0495635_0003846
1840 Ga0495635_0014377
1841 Ga0495635_0081350
1842 Ga0495635_0095584
1843 Ga0495661_0012048
1844 Ga0495588_0069307
1845 Ga0495657_0003492
1846 Ga0495657_0006927
1847 Ga0495657_0026654
1848 Ga0495599_0001556
1849 Ga0495599_0008411
1850 Ga0495599_0016849
1851 Ga0495623_0002296
1852 Ga0495623_0009107
1853 Ga0495623_0010478
1854 Ga0495646_0001918
1855 Ga0495646_0005453
1856 Ga0495646_0011250
1857 Ga0495646_0102031
1858 Ga0495647_0003088
1859 Ga0495647_0022746
1860 Ga0495647_0030086
1861 Ga0495658_0001058
1862 Ga0495658_0019298
1863 Ga0495658_0102410
1864 Ga0495669_0052607
1865 Ga0495613_0000929
1866 Ga0495613_0067749
1867 Ga0495613_0255689
1868 Ga0495624_0000538
1869 Ga0495624_0184045
1870 Ga0495670_0017939
1871 Ga0495671_0055254
1872 Ga0495671_0102419
1873 Ga0495649_0085341
1874 Ga0495589_0069305
1875 Ga0495600_0002229
1876 Ga0495600_0029557
1877 Ga0495581_0001238
1878 Ga0495581_0057166
1879 Ga0495604_0005469
1880 Ga0495604_0074523
1881 Ga0495604_0134829
1882 Ga0495604_0204143
1883 Ga0495674_0001854
1884 Ga0495674_0020768
1885 Ga0495674_0021792
1886 Ga0495674_0113269
1887 Ga0495672_0036441
1888 Ga0495672_0062942
1889 Ga0495676_0027183
1890 Ga0495680_0021114
1891 Ga0495680_0024023
1892 Ga0495680_0131314
1893 Ga0495687_043987
1894 Ga0495675_0062117
1895 Ga0495677_0080575
1896 Ga0495673_0010245
1897 Ga0495681_0039134
1898 Ga0495684_0000893
1899 Ga0495684_0003057
1900 Ga0495593_0000034
1901 Ga0495593_0005088
1902 Ga0495593_0030123
1903 Ga0495602_0025294
1904 Ga0495602_0045096
1905 Ga0495614_0012106
1906 Ga0495615_0022350
1907 Ga0496100_0024419
1908 Ga0496100_0035051
1909 Ga0496100_0221778
1910 Ga0496101_0005889
1911 Ga0496101_0022103
1912 Ga0496101_0075060
1913 Ga0496101_0086002
1914 Ga0496102_0041716
1915 Ga0496102_0085515
1916 Ga0496102_0129517
1917 Ga0496102_0169801
1918 Ga0496103_0148981
1919 Ga0496104_0044141
1920 Ga0496104_0078027
1921 Ga0496104_0085182
1922 Ga0496104_0176933
1923 Ga0496104_0198086
1924 Ga0496105_0017518
1925 Ga0496105_0082763
1926 Ga0496105_0085675
1927 Ga0496106_0000649
1928 Ga0496106_0001165
1929 Ga0496106_0082778
1930 Ga0496106_0281869
1931 Ga0496106_0377205
1932 Ga0496107_0025520
1933 Ga0496107_0028181
1934 Ga0496107_0043555
1935 Ga0496107_0048989
1936 Ga0496107_0202412
1937 Ga0496108_0000744
1938 Ga0496108_0247857
1939 Ga0496109_0001766
1940 Ga0496109_0048359
1941 Ga0496109_0303289
1942 Ga0496109_0309442
1943 Ga0496109_0356227
1944 Ga0496110_0006833
1945 Ga0496110_0018692
1946 Ga0496110_0056020
1947 Ga0496110_0085668
1948 Ga0496110_0112391
1949 Ga0496110_0114120
1950 Ga0496110_0161215
1951 Ga0496111_0031499
1952 Ga0496111_0121446
1953 Ga0496111_0184210
1954 Ga0496112_0000008
1955 Ga0496112_0050851
1956 Ga0496112_0157994
1957 Ga0496112_0181663
1958 Ga0496112_0226149
1959 Ga0496114_0089217
1960 Ga0496114_0098129
1961 Ga0496114_0174356
1962 Ga0496114_0259154
1963 Ga0496115_0007272
1964 Ga0496115_0015832
1965 Ga0496115_0073171
1966 Ga0496115_0096862
1967 Ga0496115_0117402
1968 Ga0496115_0140716
1969 Ga0496116_0007242
1970 Ga0496117_0021643
1971 Ga0496117_0153317
1972 Ga0496118_0013219
1973 Ga0496118_0051899
1974 Ga0496118_0071624
1975 Ga0496119_0053236
1976 Ga0496119_0068363
1977 Ga0496119_0068812
1978 Ga0496119_0076546
1979 Ga0496120_0103874
1980 Ga0496121_0000476
1981 Ga0496121_0001497
1982 Ga0496121_0001742
1983 Ga0496121_0003089
1984 Ga0496121_0015642
1985 Ga0496121_0017380
1986 Ga0496121_0025084
1987 Ga0496121_0036908
1988 Ga0496121_0038697
1989 Ga0496121_0049287
1990 Ga0496121_0053890
1991 Ga0496121_0082348
1992 Ga0496121_0083650
1993 Ga0496121_0099916
1994 Ga0496122_0055284
1995 Ga0496122_0060464
1996 Ga0496122_0089939
1997 Ga0496123_0090680
1998 Ga0496123_0096202
1999 Ga0496124_0001128
2000 Ga0496124_0090921
2001 Ga0496124_0153432
2002 Ga0496124_0165776
2003 Ga0496124_0173653
2004 Ga0496125_0000154
2005 Ga0496125_0015007
2006 Ga0496125_0044841
2007 Ga0496125_0153920
2008 Ga0496126_0002744
2009 Ga0496126_0006113
2010 Ga0496126_0009402
2011 Ga0496126_0015910
2012 Ga0496126_0020832
2013 Ga0496126_0032430
2014 Ga0496126_0053931
2015 Ga0496126_0079933
2016 Ga0496126_0089718
2017 Ga0496126_0094162
2018 Ga0496126_0188462
2019 Ga0496126_0191581
2020 Ga0496126_0202508
2021 Ga0496126_0319939
2022 Ga0501031_0012949
2023 Ga0501031_0064009
2024 Ga0501032_0003534
2025 Ga0501032_0012670
2026 Ga0501032_0020626
2027 Ga0501032_0082398
2028 Ga0501032_0119010
2029 Ga0501032_0208172
2030 Ga0501033_0000249
2031 Ga0501033_0000951
2032 Ga0501033_0229418
2033 Ga0501034_0000197
2034 Ga0501034_0001938
2035 Ga0501034_0136806
2036 Ga0501034_0183501
2037 Ga0501034_0286773
2038 Ga0501034_0290404
2039 Ga0501034_0348538
2040 Ga0501036_0004433
2041 Ga0501036_0026547
2042 Ga0501036_0050620
2043 Ga0501036_0095024
2044 Ga0501037_0000112
2045 Ga0501037_0067387
2046 Ga0501037_0101975
2047 Ga0501037_0130451
2048 Ga0501038_0000160
2049 Ga0501038_0002206
2050 Ga0501038_0036532
2051 Ga0501038_0038091
2052 Ga0501038_0082118
2053 Ga0501038_0145474
2054 Ga0501038_0168699
2055 Ga0501038_0233536
2056 Ga0501038_0341018
2057 Ga0501039_0000472
2058 Ga0501039_0001057
2059 Ga0501039_0017068
2060 Ga0501039_0142515
2061 Ga0501042_0015592
2062 Ga0501042_0071253
2063 Ga0501043_0000278
2064 Ga0501043_0008635
2065 Ga0501043_0022578
2066 Ga0501043_0073668
2067 Ga0501043_0096156
2068 Ga0501043_0150931
2069 Ga0501043_0215853
2070 Ga0501046_0000937
2071 Ga0501046_0008812
2072 Ga0501046_0012556
2073 Ga0501046_0021462
2074 Ga0501046_0065853
2075 Ga0501047_0000275
2076 Ga0501047_0009938
2077 Ga0501047_0073429
2078 Ga0501047_0089000
2079 Ga0501047_0122575
2080 Ga0501047_0217062
2081 Ga0501047_0336852
2082 Ga0501048_0001248
2083 Ga0501048_0011414
2084 Ga0501048_0022723
2085 Ga0501048_0036570
2086 Ga0501067_0000258
2087 Ga0501067_0013462
2088 Ga0501067_0084036
2089 Ga0501067_0092887
2090 Ga0501068_0004146
2091 Ga0501068_0015819
2092 Ga0501068_0026245
2093 Ga0501068_0064658
2094 Ga0501068_0140272
2095 Ga0501069_0013808
2096 Ga0501069_0043425
2097 Ga0501069_0115876
2098 Ga0501070_0002548
2099 Ga0501070_0006200
2100 Ga0501070_0020554
2101 Ga0501070_0063929
2102 Ga0501070_0068502
2103 Ga0501070_0085330
2104 Ga0501070_0090347
2105 Ga0501070_0314854
2106 Ga0501071_0196477
2107 Ga0501072_0003198
2108 Ga0501073_0000103
2109 Ga0501073_0038356
2110 Ga0501073_0096064
2111 Ga0501074_0000456
2112 Ga0501074_0067246
2113 Ga0501074_0085067
2114 Ga0501076_0063997
2115 Ga0501077_0104803
2116 Ga0501079_0000451
2117 Ga0501079_0010445
2118 Ga0501080_0000082
2119 Ga0501080_0002998
2120 Ga0501080_0016338
2121 Ga0501080_0071776
2122 Ga0501080_0082435
2123 Ga0501080_0349960
2124 Ga0501080_0389057
2125 Ga0501083_0009193
2126 Ga0501083_0058731
2127 Ga0501035_0000766
2128 Ga0501035_0011386
2129 Ga0501035_0018251
2130 Ga0501035_0045134
2131 Ga0501035_0078488
2132 Ga0501035_0123726
2133 Ga0501035_0124942
2134 Ga0501035_0144301
2135 Ga0501035_0159477
2136 Ga0501044_0000418
2137 Ga0501044_0024381
2138 Ga0501044_0034063
2139 Ga0501044_0078546
2140 Ga0501044_0196236
2141 Ga0501044_0218611
2142 Ga0501044_0231316
2143 Ga0501044_0238631
2144 Ga0501044_0272344
2145 Ga0501044_0325483
2146 Ga0501044_0332956
2147 Ga0501045_0038807
2148 Ga0501045_0077486
2149 nmdc:mga0yw44_1397_c1
2150 nmdc:mga0yw44_17247_c1
2151 nmdc:mga0yw44_94319_c1
2152 nmdc:mga0k408_127339_c1
2153 nmdc:mga06z11_31082_c1
2154 nmdc:mga07m45_95447_c1
2155 nmdc:mga08y16_196743_c1
2156 nmdc:mga0n895_80110_c1
2157 nmdc:mga0n895_82170_c1
2158 nmdc:mga0rr50_152607_c1
2159 nmdc:mga08x19_192730_c1
2160 nmdc:mga08x19_24160_c1
2161 nmdc:mga0a205_311035_c1
2162 nmdc:mga0a205_3227_c1
2163 nmdc:mga0sz30_22811_c2
2164 Ga0495601_0009529
2165 Ga0495601_0037183
2166 Ga0495601_0083052
2167 Ga0495601_0220392
2168 Ga0495612_0046196
2169 Ga0500635_0026172
2170 Ga0495619_0077914
2171 Ga0500578_0176816
2172 Ga0500643_000267
2173 Ga0500643_018509
2174 Ga0500581_085026
2175 Ga0500647_0017157
2176 Ga0500583_0086589
2177 Ga0500651_0000861
2178 Ga0500566_0000157
2179 Ga0500566_0000925
2180 Ga0500566_0001146
2181 Ga0500640_038114
2182 Ga0500641_0058981
2183 Ga0500650_0001493
2184 Ga0500554_000718
2185 Ga0500554_003128
2186 Ga0500555_002718
2187 Ga0500556_0000413
2188 Ga0500557_000041
2189 Ga0500569_001799
2190 Ga0500572_001865
2191 Ga0500592_004170
2192 Ga0500594_0030081
2193 Ga0500595_003818
2194 Ga0500595_006228
2195 Ga0500608_004754
2196 Ga0500608_030350
2197 Ga0500614_001219
2198 Ga0500626_057934
2199 Ga0500642_0000005
2200 Ga0500642_0000140
2201 Ga0500652_000531
2202 Ga0500658_0011515
2203 Ga0500658_0013696
2204 Ga0500658_0044143
2205 Ga0500658_0081505
2206 Ga0500559_0003580
2207 Ga0500559_0004212
2208 Ga0500559_0018273
2209 Ga0500568_0002109
2210 Ga0500568_0011586
2211 Ga0500568_0028346
2212 Ga0500577_0000693
2213 Ga0500603_000277
2214 Ga0500603_001226
2215 Ga0500604_0003539
2216 Ga0500616_0000166
2217 Ga0500616_0000180
2218 Ga0500616_0028432
2219 Ga0500622_0011079
2220 Ga0500622_0029561
2221 Ga0500624_002833
2222 Ga0500630_014168
2223 Ga0500634_0031081
2224 Ga0500638_001014
2225 Ga0500638_057858
2226 Ga0500639_000014
2227 Ga0500639_033548
2228 Ga0500636_0001916
2229 Ga0500636_0011628
2230 Ga0500636_0028779
2231 Ga0500637_0000121
2232 Ga0500637_0002840
2233 Ga0500637_0103898
2234 Ga0500625_003212
2235 Ga0500609_004134
2236 Ga0500596_000810
2237 Ga0500601_000076
2238 Ga0501084_0003972
2239 Ga0501084_0222438
2240 Ga0500661_000452
2241 Ga0501082_0011183
2242 2507511012
2243 2508696939
2244 2509148875
2245 2511395187
2246 2513623486
2247 2513637468
2248 2513649682
2249 2513655026
2250 2513677796
2251 2513697433
2252 2513716918
2253 2513861042
2254 2513874652
2255 2513892085
2256 2513915951
2257 2514010632
2258 2515625436
2259 2517100591
2260 2517894744
2261 2524438185
2262 2524464075
2263 2524534493
2264 2528849820
2265 2603862615
2266 2617350776
2267 2617373145
2268 2644287346
2269 2671119158
2270 2723843076
2271 2728747600
2272 2793064664
2273 2793071219
2274 2793079517
2275 2805916649
2276 2818238153
2277 2824607730
2278 2824617132
2279 2824633057
2280 2824641055
2281 2824648775
2282 2824658711
2283 2824668266
2284 2824676178
2285 2824682885
2286 2824692364
2287 2824740138
2288 2824751540
2289 2824761224
2290 2824771851
2291 2824780542
2292 2838127896
2293 2841943189
2294 2841954080
2295 2841960218
2296 2841968170
2297 2841976620
2298 2841987993
2299 2842042704
2300 2842050747
2301 2844316914
2302 2847938563
2303 2847944237
2304 2849081530
2305 2857512189
2306 2857529962
2307 2874597749
2308 2874612593
2309 2874617697
2310 2874623435
2311 2874630655
2312 2874651278
2313 2876762402
2314 2876776349
2315 2876820917
2316 2879081788
2317 2879086192
2318 2879101348
2319 2879118034
2320 2879130503
2321 2879146389
2322 2881370681
2323 2881672684
2324 2885366933
2325 2885378766
2326 2885384490
2327 2888381524
2328 2888389115
2329 2888421927
2330 2889033623
2331 2893069395
2332 2903733964
2333 2903751426
2334 2903773626
2335 2904667334
2336 2904697727
2337 2904705791
2338 2904719228
2339 2906604580
2340 2906611464
2341 2906635179
2342 2906641699
2343 2906651200
2344 2906660801
2345 2908745056
2346 2908757176
2347 2908781600
2348 2919077185
2349 2922366991
2350 2922371192
2351 2922390227
2352 2922393564
2353 2922427893
2354 2929619576
2355 2929627954
2356 2932785906
2357 2932798314
2358 2932804110
2359 2932817276
2360 2932826873
2361 2932830950
2362 2933581496
2363 2935612751
2364 2935621015
2365 2935632179
2366 2935640091
2367 2935656721
2368 2935665540
2369 2935667070
2370 2935690202
2371 2935699712
2372 2935704826
2373 2935718101
2374 2935726749
2375 2935735518
2376 2935745211
2377 2935755213
2378 2935762269
2379 2935773657
2380 2935780212
2381 2935788438
2382 2935796594
2383 2935803772
2384 2935811687
2385 2935824240
2386 2935829574
2387 2935843092
2388 2935852613
2389 2935858822
2390 2935866780
2391 2935876911
2392 2935884084
2393 2935912241
2394 2935924085
2395 2935929270
2396 2935935901
2397 2935950409
2398 2935957433
2399 2935962044
2400 2935968464
2401 2935976653
2402 2935990723
2403 2935993452
2404 2936004347
2405 2936019584
2406 2936028200
2407 2936037073
2408 2936038269
2409 2936055057
2410 2936058607
2411 2940561506
2412 2941508127
2413 2941515368
2414 2941524057
2415 2941533696
2416 2941544316
2417 3005477604
2418 3005486183
2419 3005507124
2420 3005588498
2421 3005596548
2422 3005712616
2423 3005719677
2424 8006930905
2425 8006933615
2426 8006966527
2427 8006983288
2428 8006989355
2429 8006997837
2430 8016516435
2431 8016523835
2432 8016541636
2433 8016551632
2434 8016560018
2435 8016567022
2436 8016589131
2437 8016597943
2438 8016604083
2439 8016620665
2440 8016629333
2441 8016633848
2442 8017060102
2443 8019537050
2444 8019542490
2445 8019548265
2446 8019559553
2447 8019569655
2448 8019579612
2449 8019604018
2450 8019637044
2451 8019650025
2452 8019681658
2453 8019694113
2454 8055749166
2455 8056674871
2456 8056682382
2457 8056695171
2458 8056969721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04101

Glyco_tran_28_C

Glycosyltransferase family 28 C-terminal domain

183

350

0.97

PF03033

Glyco_transf_28

Glycosyltransferase family 28 N-terminal domain

8

145

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.8981 6 363
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.8904 6 363
8dp7-assembly1.cif.gz_A structure of helicobacter pylori egtu bound to egt 0.8668 7 39
7d1i-assembly1.cif.gz_B-2 crystal structure of acinetobacter baumannii murg 0.8416 4 362
7d1i-assembly1.cif.gz_B-2 crystal structure of acinetobacter baumannii murg 0.8346 4 362
ID Description Score Start End Superfamily
af_Q2FYL5_1_178_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9013 5 169 3.40.50.2000
af_K7L509_198_322_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8951 222 346 3.40.50.2000
3s2uA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8789 167 348 3.40.50.2000
3s2uA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8763 6 166 3.40.50.2000
af_K7KRG7_37_209_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8761 6 171 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A436LCT7-F1-model_v4 deleted 0.9837 161 365
AF-A0A060BN88-F1-model_v4 Glyco_tran_28_C 0.98 176 307 GO:0050511
AF-A0A519JEV0-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9736 220 362 GO:0050511
AF-A0A435JI80-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9714 183 365 GO:0050511
AF-A5EPK4-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) 0.9713 3 366 GO:0005886
GO:0005975
GO:0008360
GO:0009252
GO:0030259
GO:0050511
GO:0051301
GO:0051991
GO:0071555

Map