F491988

General Info

Members Datasets Scaffolds Average Seq Length
1230 456 2460 372

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0000017|Ga0395901_0000017_85192_86409
Length 405
Sequence MARVACVVLTQRAIRVVVSAYSPYWPLLDCKHTMALEPFINSKPFTFGVELEIQVVNTHDYDLTKAASDLMRLVKDQKIPGNITPEITESMIELSTGICNSHEEALSQLRLLRDTLVAAADQLNVGLAGGGTHAFQQWSERQIFDAPRFQYLSELYGYLAKQFTVFGQHVHIGCPDPDSALFLLHAMSRFIPHFIALSASSPYVQGVDTGFHSARLNSVFAFPLSGRAPFVLTWAGFEEYFSKMVATGVVNSMKDFYWDIRPKPGFGTIEVRVMDTPLSVDRAAAIACYIQTLARHLLVDRPFTPKEDDYLVYTFNRFEACRFGLGGTCINPQTGERRTIFEDILDTLRVIEPHAQALQSSAALREIANIAQGQVNDATWLRGIVAKEKSLHEAVRQQCLRWRGV

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
152 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
157 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
158 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
159 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
160 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
175 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
176 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
195 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
221 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
230 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
275 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
278 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
279 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
288 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
315 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
316 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
317 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
318 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
326 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
327 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
328 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
329 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
330 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
331 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
332 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
333 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
334 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
335 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
336 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
337 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
338 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
339 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
340 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
341 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
345 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
346 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
348 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
349 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
350 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
351 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
352 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
353 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
354 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
355 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
356 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
357 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
358 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
359 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
360 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
361 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
362 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
363 2519103095 Burkholderia sp. KJ006 Isolate Nodule
364 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
365 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
366 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
367 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
368 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
369 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
370 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
371 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
372 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
373 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
374 2643221585 Pelomonas sp. Root662 Isolate Unclassified
375 2643221638 Duganella sp. Root336D2 Isolate Unclassified
376 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
377 2643221645 Massilia sp. Root351 Isolate Unclassified
378 2643221656 Pelomonas sp. Root405 Isolate Unclassified
379 2643221664 Massilia sp. Root418 Isolate Unclassified
380 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
381 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
382 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
383 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
384 2738541280 Massilia sp. GV090 Isolate Unclassified
385 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
386 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
387 2738541300 Massilia sp. GV016 Isolate Unclassified
388 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
389 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
390 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
391 2738543018 Massilia sp. GV045 Isolate Unclassified
392 2738543030 Massilia sp. GV097 Isolate Unclassified
393 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
394 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
395 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
396 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
397 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
398 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
399 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
400 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
401 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
402 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
403 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
404 2818991450 Burkholderia sp. 604 Isolate Unclassified
405 2818991452 Burkholderia cepacia 561 Isolate Unclassified
406 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
407 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
408 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
409 2842711865 Duganella sp. R-73148 Isolate Unclassified
410 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
411 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
412 2857553236 Duganella sp. R-74557 Isolate Unclassified
413 2857558681 Duganella sp. R-74565 Isolate Unclassified
414 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
415 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
416 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
417 2885266251 Ralstonia sp. SET104 Isolate Nodule
418 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
419 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
420 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
421 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
422 2904424332 Duganella sp. 1411 Isolate Rhizosphere
423 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
424 2904564687 Burkholderia sp. 571 Isolate Unclassified
425 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
426 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
427 2919476304 Duganella sp. 3397 Isolate Unclassified
428 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
429 2928058823 Ralstonia sp. 1138 Isolate Unclassified
430 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
431 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
432 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
433 2928163908 Burkholderia sp. 567 Isolate Unclassified
434 2928170801 Burkholderia sp. 572 Isolate Unclassified
435 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
436 2928536128 Burkholderia sola 565 Isolate Unclassified
437 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
438 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
439 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
440 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
441 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
442 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
443 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
444 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
445 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
446 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
447 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
448 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
449 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
450 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
451 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
452 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
453 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
454 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
455 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
456 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.49
Metatranscriptomes 0.65
Isolates 8.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.44
Nodule 1.95
Rhizoplane 3.09
Rhizosphere 74.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0000017 3300038443 Bacteria 345003
2 JGI24741J21665_1001242 3300001915 Bacteria 7507
3 JGI24740J21852_10001764 3300001979 Bacteria 9924
4 JGI24740J21852_10004026 3300001979 Bacteria 6367
5 JGI24739J22299_10003401 3300001989 Bacteria 6071
6 JGI24739J22299_10004196 3300001989 Bacteria 5514
7 JGI24737J22298_10003060 3300001990 Bacteria 5922
8 JGI24737J22298_10014717 3300001990 Bacteria 2538
9 JGI24735J21928_10000065 3300002067 Bacteria 43385
10 JGI24735J21928_10000495 3300002067 Bacteria 13982
11 JGI24735J21928_10000604 3300002067 Bacteria 12630
12 JGI24735J21928_10002748 3300002067 Bacteria 6067
13 JGI24735J21928_10004710 3300002067 Bacteria 4555
14 JGI24735J21928_10006897 3300002067 Bacteria 3719
15 JGI24738J21930_10000758 3300002075 Bacteria 9245
16 JGI25156J39149_1002277 3300002705 Bacteria 7055
17 JGI25156J39149_1005822 3300002705 Bacteria 3483
18 JGI25154J39366_1000553 3300002738 Bacteria 18498
19 JGI25154J39366_1002494 3300002738 Bacteria 4712
20 JGI25158J39367_1000007 3300002739 Bacteria 54539
21 JGI25158J39367_1010914 3300002739 Bacteria 1220
22 JGI25152J39213_1000242 3300002773 Bacteria 36400
23 JGI25152J39213_1011033 3300002773 Bacteria 2022
24 JGI25150J39212_1000487 3300002774 Bacteria 16704
25 JGI25150J39212_1005864 3300002774 Bacteria 2582
26 JGI25159J45721_1000127 3300002987 Bacteria 36369
27 JGI25159J45721_1000340 3300002987 Bacteria 21597
28 JGI25159J45721_1001229 3300002987 Bacteria 10850
29 JGI25153J46596_10014274 3300003215 Bacteria 3311
30 JGI25153J46596_10032011 3300003215 Bacteria 1761
31 rootL2_10049059 3300003322 Bacteria 4562
32 rootL2_10277707 3300003322 Bacteria 1517
33 rootH1_10023956 3300003323 Bacteria 1491
34 JGI25160J50197_1000016 3300003354 Bacteria 247819
35 JGI25160J50197_1000132 3300003354 Bacteria 67285
36 JGI25161J50226_1000105 3300003374 Bacteria 67332
37 Ga0007417J51691_1034284 3300003544 Bacteria 1824
38 Ga0007410J51695_1042566 3300003574 Bacteria 1900
39 Ga0055539_1000541 3300003752 Bacteria 11274
40 Ga0055532_1000022 3300003758 Bacteria 248737
41 Ga0055532_1000761 3300003758 Bacteria 11499
42 Ga0055532_1000786 3300003758 Bacteria 11029
43 Ga0055525_1001433 3300003759 Bacteria 4363
44 Ga0055527_1000016 3300003760 Bacteria 248736
45 Ga0055527_1000604 3300003760 Bacteria 11562
46 Ga0055527_1000990 3300003760 Bacteria 6904
47 Ga0055535_1000017 3300003761 Bacteria 248735
48 Ga0055535_1001501 3300003761 Bacteria 11618
49 Ga0055535_1001507 3300003761 Bacteria 11562
50 Ga0055535_1001576 3300003761 Bacteria 11029
51 Ga0055542_1000030 3300003762 Bacteria 248717
52 Ga0055542_1001136 3300003762 Bacteria 15773
53 Ga0055542_1001580 3300003762 Bacteria 10591
54 Ga0055542_1002027 3300003762 Bacteria 7756
55 Ga0055542_1007268 3300003762 Bacteria 2267
56 Ga0055529_1000033 3300003763 Bacteria 248734
57 Ga0055529_1000688 3300003763 Bacteria 23075
58 Ga0055529_1001155 3300003763 Bacteria 11029
59 Ga0055526_1000018 3300003771 Bacteria 198838
60 Ga0055526_1000053 3300003771 Bacteria 114820
61 Ga0055526_1000133 3300003771 Bacteria 66252
62 Ga0055526_1000602 3300003771 Bacteria 28135
63 Ga0055526_1001869 3300003771 Bacteria 14583
64 Ga0055526_1015807 3300003771 Bacteria 3003
65 Ga0055537_1000093 3300003773 Bacteria 66252
66 Ga0055537_1000191 3300003773 Bacteria 45803
67 Ga0055537_1004892 3300003773 Bacteria 3710
68 Ga0055524_1000003 3300003775 Bacteria 399748
69 Ga0055524_1000192 3300003775 Bacteria 67279
70 Ga0055524_1000223 3300003775 Bacteria 60211
71 Ga0055524_1006395 3300003775 Bacteria 5111
72 Ga0055524_1006501 3300003775 Bacteria 5062
73 Ga0055534_1000051 3300003784 Bacteria 92183
74 Ga0055534_1000098 3300003784 Bacteria 67094
75 Ga0055534_1006053 3300003784 Bacteria 3115
76 Ga0055528_1000174 3300003790 Bacteria 54435
77 Ga0055528_1009739 3300003790 Bacteria 3988
78 Ga0055530_10000262 3300003791 Bacteria 47466
79 Ga0055531_10009510 3300003794 Bacteria 4962
80 Ga0055541_1001057 3300003841 Bacteria 6363
81 Ga0055541_1012002 3300003841 Bacteria 1253
82 Ga0058692_1000568 3300003856 Bacteria 15736
83 Ga0055543_1000101 3300004625 Bacteria 74568
84 Ga0055543_1000136 3300004625 Bacteria 60943
85 Ga0065165_1000282 3300005262 Bacteria 86839
86 Ga0065165_1000612 3300005262 Bacteria 51854
87 Ga0065165_1000677 3300005262 Bacteria 49085
88 Ga0065165_1000875 3300005262 Bacteria 38986
89 Ga0065165_1001278 3300005262 Bacteria 28419
90 Ga0065715_10101354 3300005293 Bacteria 3213
91 Ga0070658_10002494 3300005327 Bacteria 15370
92 Ga0070658_10033012 3300005327 Bacteria 4162
93 Ga0070658_10035402 3300005327 Bacteria 4021
94 Ga0070658_10264974 3300005327 Bacteria 1460
95 Ga0070682_100061547 3300005337 Bacteria 2376
96 Ga0070660_100000108 3300005339 Bacteria 51014
97 Ga0070660_100002533 3300005339 Bacteria 12521
98 Ga0070660_100068203 3300005339 Bacteria 2772
99 Ga0070661_100000892 3300005344 Bacteria 21428
100 Ga0070661_100049980 3300005344 Bacteria 3061
101 Ga0070659_100000070 3300005366 Bacteria 79815
102 Ga0070659_100002030 3300005366 Bacteria 14474
103 Ga0070659_100033866 3300005366 Bacteria 3971
104 Ga0070667_100009565 3300005367 Bacteria 8036
105 Ga0070663_100000463 3300005455 Bacteria 21428
106 Ga0070663_100000496 3300005455 Bacteria 20757
107 Ga0070663_100003045 3300005455 Bacteria 9576
108 Ga0070678_100105428 3300005456 Bacteria 2194
109 Ga0070672_100092786 3300005543 Bacteria 2438
110 Ga0070665_100178582 3300005548 Bacteria 2124
111 Ga0068855_100002049 3300005563 Bacteria 24988
112 Ga0068855_100029356 3300005563 Bacteria 6576
113 Ga0068855_100109969 3300005563 Bacteria 3164
114 Ga0070664_100002094 3300005564 Bacteria 15946
115 Ga0068857_100014572 3300005577 Bacteria 6858
116 Ga0068854_100000776 3300005578 Bacteria 18959
117 Ga0068856_100003674 3300005614 Bacteria 15391
118 Ga0068852_100016151 3300005616 Bacteria 5812
119 Ga0068859_100457272 3300005617 Bacteria 1373
120 Ga0068860_100001092 3300005843 Bacteria 29866
121 Ga0068860_100084407 3300005843 Bacteria 3021
122 Ga0070717_10013109 3300006028 Bacteria 6336
123 Ga0068865_100015058 3300006881 Bacteria 4927
124 Ga0097620_100457272 3300006931 Bacteria 1373
125 Ga0079104_1008017 3300006946 Bacteria 3751
126 Ga0099826_10000002 3300006948 Bacteria 1125830
127 Ga0105251_10000324 3300009011 Bacteria 47966
128 Ga0105251_10000937 3300009011 Bacteria 26103
129 Ga0105251_10034380 3300009011 Bacteria 2509
130 Ga0105244_10002111 3300009036 Bacteria 15285
131 Ga0105244_10004090 3300009036 Bacteria 10175
132 Ga0105244_10034717 3300009036 Bacteria 2653
133 Ga0105250_10001043 3300009092 Bacteria 15884
134 Ga0105240_10002436 3300009093 Bacteria 29913
135 Ga0105240_10019691 3300009093 Bacteria 9014
136 Ga0105240_10338906 3300009093 Bacteria 1709
137 Ga0105242_10021383 3300009176 Bacteria 5079
138 Ga0105248_10006077 3300009177 Bacteria 13252
139 Ga0105248_10182053 3300009177 Bacteria 2368
140 Ga0105237_10001786 3300009545 Bacteria 27810
141 Ga0105237_10227872 3300009545 Bacteria 1864
142 Ga0105238_10011315 3300009551 Bacteria 8976
143 Ga0105238_10066755 3300009551 Bacteria 3598
144 Ga0105249_10009272 3300009553 Bacteria 8607
145 Ga0105239_10001217 3300010375 Bacteria 35079
146 Ga0105239_10201891 3300010375 Bacteria 2227
147 Ga0157373_10005365 3300013100 Bacteria 9631
148 Ga0157373_10013675 3300013100 Bacteria 5952
149 Ga0157373_10119483 3300013100 Bacteria 1852
150 Ga0157371_10001831 3300013102 Bacteria 21433
151 Ga0157370_10000900 3300013104 Bacteria 37716
152 Ga0157370_10001175 3300013104 Bacteria 32662
153 Ga0157370_10014987 3300013104 Bacteria 7903
154 Ga0157370_10042205 3300013104 Bacteria 4397
155 Ga0157369_10000304 3300013105 Bacteria 65926
156 Ga0157369_10001395 3300013105 Bacteria 29676
157 Ga0157369_10001472 3300013105 Bacteria 28859
158 Ga0157369_10009847 3300013105 Bacteria 10920
159 Ga0157369_10034147 3300013105 Bacteria 5584
160 Ga0157369_10063750 3300013105 Bacteria 3970
161 Ga0157369_10105783 3300013105 Bacteria 2995
162 Ga0157374_10001412 3300013296 Bacteria 20367
163 Ga0157374_10017669 3300013296 Bacteria 6284
164 Ga0157378_10033324 3300013297 Bacteria 4553
165 Ga0163162_10004078 3300013306 Bacteria 14016
166 Ga0163162_10011991 3300013306 Bacteria 8453
167 Ga0163162_10034105 3300013306 Bacteria 5063
168 Ga0157372_10002150 3300013307 Bacteria 21434
169 Ga0157372_10012810 3300013307 Bacteria 8937
170 Ga0182008_10023466 3300014497 Bacteria 3150
171 Ga0182008_10030084 3300014497 Bacteria 2739
172 Ga0157379_10189956 3300014968 Bacteria 1856
173 Ga0157376_10168730 3300014969 Bacteria 1991
174 Ga0182006_1000040 3300015261 Bacteria 209209
175 Ga0182006_1001529 3300015261 Bacteria 13840
176 Ga0182007_10031221 3300015262 Bacteria 1816
177 Ga0183361_10001 3300016635 Bacteria 908583
178 Ga0163161_10012823 3300017792 Bacteria 5823
179 Ga0197907_10873026 3300020069 Bacteria 3292
180 Ga0206356_10848462 3300020070 Bacteria 4741
181 Ga0206351_10868641 3300020077 Bacteria 5218
182 Ga0154015_1236554 3300020610 Bacteria 5931
183 Ga0213872_10000001 3300021361 Bacteria 662532
184 Ga0224712_10000838 3300022467 Bacteria 6537
185 Ga0209435_101584 3300025206 Bacteria 2812
186 Ga0209436_100028 3300025208 Bacteria 86801
187 Ga0209436_100216 3300025208 Bacteria 26447
188 Ga0209784_100006 3300025224 Bacteria 930704
189 Ga0209784_100753 3300025224 Bacteria 8221
190 Ga0209784_101546 3300025224 Bacteria 2917
191 Ga0209566_100002 3300025225 Bacteria 2614868
192 Ga0209566_100244 3300025225 Bacteria 52194
193 Ga0209674_100010 3300025226 Bacteria 1038638
194 Ga0209674_100017 3300025226 Bacteria 689087
195 Ga0209674_100176 3300025226 Bacteria 79399
196 Ga0209674_100291 3300025226 Bacteria 35684
197 Ga0209674_100320 3300025226 Bacteria 30743
198 Ga0209674_102227 3300025226 Bacteria 4300
199 Ga0209672_100001 3300025228 Bacteria 2828210
200 Ga0209672_100110 3300025228 Bacteria 95441
201 Ga0209672_100115 3300025228 Bacteria 89213
202 Ga0209672_100136 3300025228 Bacteria 72753
203 Ga0209672_101102 3300025228 Bacteria 11427
204 Ga0209147_100018 3300025229 Bacteria 515719
205 Ga0209147_100022 3300025229 Bacteria 443906
206 Ga0209147_100164 3300025229 Bacteria 90422
207 Ga0209147_100215 3300025229 Bacteria 60346
208 Ga0209563_100041 3300025230 Bacteria 407467
209 Ga0209563_100603 3300025230 Bacteria 11745
210 Ga0207427_102931 3300025231 Bacteria 4008
211 Ga0209258_100028 3300025242 Bacteria 515719
212 Ga0209258_100033 3300025242 Bacteria 443845
213 Ga0209258_100261 3300025242 Bacteria 90726
214 Ga0209258_100271 3300025242 Bacteria 89095
215 Ga0207425_1000001 3300025245 Bacteria 2525432
216 Ga0207425_1000039 3300025245 Bacteria 219078
217 Ga0209646_1000043 3300025246 Bacteria 343652
218 Ga0209026_1003044 3300025250 Bacteria 5762
219 Ga0209677_100007 3300025253 Bacteria 1021332
220 Ga0209677_103393 3300025253 Bacteria 5209
221 Ga0209148_1000046 3300025254 Bacteria 443881
222 Ga0209148_1000104 3300025254 Bacteria 214254
223 Ga0209148_1000151 3300025254 Bacteria 156553
224 Ga0209148_1000609 3300025254 Bacteria 32035
225 Ga0209148_1001656 3300025254 Bacteria 10082
226 Ga0209759_1000180 3300025256 Bacteria 103458
227 Ga0209759_1000231 3300025256 Bacteria 83320
228 Ga0209759_1000568 3300025256 Bacteria 37118
229 Ga0209759_1001163 3300025256 Bacteria 16645
230 Ga0209759_1001504 3300025256 Bacteria 12856
231 Ga0209759_1001749 3300025256 Bacteria 11148
232 Ga0209759_1002276 3300025256 Bacteria 8678
233 Ga0209759_1026497 3300025256 Bacteria 1214
234 Ga0209129_1000001 3300025258 Bacteria 1452436
235 Ga0209129_1001725 3300025258 Bacteria 11783
236 Ga0209233_1000050 3300025261 Bacteria 450736
237 Ga0209565_1000017 3300025263 Bacteria 462438
238 Ga0209565_1000157 3300025263 Bacteria 90679
239 Ga0209565_1000901 3300025263 Bacteria 16057
240 Ga0209565_1002806 3300025263 Bacteria 6029
241 Ga0209565_1004699 3300025263 Bacteria 4103
242 Ga0209565_1004992 3300025263 Bacteria 3930
243 Ga0209455_1000038 3300025272 Bacteria 443899
244 Ga0209455_1000065 3300025272 Bacteria 321272
245 Ga0209455_1000097 3300025272 Bacteria 214136
246 Ga0209455_1001610 3300025272 Bacteria 9902
247 Ga0209673_1000007 3300025273 Bacteria 634477
248 Ga0209673_1000124 3300025273 Bacteria 169015
249 Ga0209673_1028792 3300025273 Bacteria 1781
250 Ga0209673_1030592 3300025273 Bacteria 1693
251 Ga0209130_1000078 3300025284 Bacteria 169374
252 Ga0209130_1000189 3300025284 Bacteria 86853
253 Ga0209130_1001043 3300025284 Bacteria 21026
254 Ga0209130_1003615 3300025284 Bacteria 6428
255 Ga0209675_1000009 3300025291 Bacteria 562872
256 Ga0209675_1000158 3300025291 Bacteria 87345
257 Ga0209675_1001665 3300025291 Bacteria 12372
258 Ga0209675_1002349 3300025291 Bacteria 9767
259 Ga0209564_1000036 3300025295 Bacteria 423455
260 Ga0209564_1000055 3300025295 Bacteria 343782
261 Ga0209564_1000068 3300025295 Bacteria 311171
262 Ga0209564_1000109 3300025295 Bacteria 212912
263 Ga0209564_1000342 3300025295 Bacteria 89220
264 Ga0209564_1004204 3300025295 Bacteria 8975
265 Ga0209564_1006074 3300025295 Bacteria 6651
266 Ga0209564_1008762 3300025295 Bacteria 4933
267 Ga0209758_1000020 3300025297 Bacteria 734220
268 Ga0209050_1000074 3300025298 Bacteria 289334
269 Ga0209050_1006726 3300025298 Bacteria 6716
270 Ga0209050_1007129 3300025298 Bacteria 6381
271 Ga0209256_1000007 3300025299 Bacteria 1136599
272 Ga0209256_1000028 3300025299 Bacteria 420213
273 Ga0209256_1000167 3300025299 Bacteria 133419
274 Ga0209256_1000214 3300025299 Bacteria 107799
275 Ga0209256_1002827 3300025299 Bacteria 13252
276 Ga0209256_1008481 3300025299 Bacteria 4755
277 Ga0207426_1000007 3300025302 Bacteria 971011
278 Ga0207426_1000343 3300025302 Bacteria 86853
279 Ga0207426_1002201 3300025302 Bacteria 13112
280 Ga0207426_1002710 3300025302 Bacteria 10785
281 Ga0207426_1012629 3300025302 Bacteria 3166
282 Ga0209257_1000003 3300025304 Bacteria 1702593
283 Ga0207696_1002613 3300025711 Bacteria 8731
284 Ga0207655_1005932 3300025728 Bacteria 8182
285 Ga0207713_1000064 3300025735 Bacteria 200324
286 Ga0207713_1010707 3300025735 Bacteria 5051
287 Ga0207688_10130275 3300025901 Bacteria 1474
288 Ga0207647_10000160 3300025904 Bacteria 53192
289 Ga0207647_10001680 3300025904 Bacteria 17038
290 Ga0207647_10002319 3300025904 Bacteria 14476
291 Ga0207647_10011447 3300025904 Bacteria 6221
292 Ga0207647_10011897 3300025904 Bacteria 6080
293 Ga0207705_10000377 3300025909 Bacteria 40143
294 Ga0207705_10028057 3300025909 Bacteria 4013
295 Ga0207705_10133170 3300025909 Bacteria 1851
296 Ga0207695_10000872 3300025913 Bacteria 54945
297 Ga0207695_10008234 3300025913 Bacteria 13088
298 Ga0207695_10009754 3300025913 Bacteria 11815
299 Ga0207695_10011993 3300025913 Bacteria 10428
300 Ga0207695_10047753 3300025913 Bacteria 4526
301 Ga0207657_10000183 3300025919 Bacteria 64955
302 Ga0207657_10024202 3300025919 Bacteria 5634
303 Ga0207649_10002344 3300025920 Bacteria 10614
304 Ga0207649_10129405 3300025920 Bacteria 1713
305 Ga0207694_10019921 3300025924 Bacteria 5075
306 Ga0207694_10027835 3300025924 Bacteria 4307
307 Ga0207690_10000012 3300025932 Bacteria 269610
308 Ga0207690_10007640 3300025932 Bacteria 6413
309 Ga0207690_10018067 3300025932 Bacteria 4319
310 Ga0207669_10008954 3300025937 Bacteria 4733
311 Ga0207704_10005345 3300025938 Bacteria 5917
312 Ga0207691_10106253 3300025940 Bacteria 2500
313 Ga0207711_10063159 3300025941 Bacteria 3196
314 Ga0207679_10000012 3300025945 Bacteria 339773
315 Ga0207679_10153330 3300025945 Bacteria 1878
316 Ga0207667_10000889 3300025949 Bacteria 38091
317 Ga0207667_10003325 3300025949 Bacteria 19847
318 Ga0207712_10038851 3300025961 Bacteria 3257
319 Ga0207640_10000047 3300025981 Bacteria 98563
320 Ga0207658_10039833 3300025986 Bacteria 3392
321 Ga0207658_10173798 3300025986 Bacteria 1777
322 Ga0207703_10032912 3300026035 Bacteria 4106
323 Ga0207678_10000076 3300026067 Bacteria 78938
324 Ga0207678_10001558 3300026067 Bacteria 21044
325 Ga0207678_10004352 3300026067 Bacteria 12716
326 Ga0207678_10008226 3300026067 Bacteria 9191
327 Ga0207678_10032652 3300026067 Bacteria 4537
328 Ga0207702_10001737 3300026078 Bacteria 21442
329 Ga0207702_10052435 3300026078 Bacteria 3451
330 Ga0207648_10001123 3300026089 Bacteria 30040
331 Ga0207674_10020244 3300026116 Bacteria 7194
332 Ga0207674_10073877 3300026116 Bacteria 3422
333 Ga0207675_100166478 3300026118 Bacteria 2105
334 Ga0207683_10147890 3300026121 Bacteria 2120
335 Ga0207698_10031168 3300026142 Bacteria 3845
336 Ga0209281_1002903 3300027111 Bacteria 6199
337 Ga0209371_1000185 3300027312 Bacteria 90613
338 Ga0209371_1008576 3300027312 Bacteria 3369
339 Ga0209282_1000001 3300027666 Bacteria 2450367
340 Ga0268264_10007100 3300028381 Bacteria 9387
341 Ga0265338_10000187 3300028800 Bacteria 116160
342 Ga0265338_10000590 3300028800 Bacteria 64098
343 Ga0268256_1000211 3300030500 Bacteria 65693
344 Ga0268256_1005547 3300030500 Bacteria 4921
345 Ga0316177_1084301 3300030731 Bacteria 2571
346 Ga0316180_1145736 3300030736 Bacteria 2217
347 Ga0316181_1071815 3300030744 Bacteria 3973
348 Ga0316182_1005578 3300030745 Bacteria 2782
349 Ga0307408_100000126 3300031548 Bacteria 84345
350 Ga0307408_100000463 3300031548 Bacteria 35519
351 Ga0307408_100001241 3300031548 Bacteria 19160
352 Ga0307408_100149765 3300031548 Bacteria 1841
353 Ga0307412_10000011 3300031911 Bacteria 405842
354 Ga0307416_100025826 3300032002 Bacteria 4315
355 Ga0307416_100057331 3300032002 Bacteria 3150
356 Ga0307414_10048541 3300032004 Bacteria 2929
357 Ga0307411_10006659 3300032005 Bacteria 5802
358 Ga0307411_10109399 3300032005 Bacteria 1974
359 Ga0373925_0001962 3300037068 Bacteria 17023
360 Ga0395899_0000093 3300037312 Bacteria 153541
361 Ga0395899_0000149 3300037312 Bacteria 105958
362 Ga0395899_0000802 3300037312 Bacteria 30773
363 Ga0395899_0057731 3300037312 Bacteria 2864
364 Ga0395899_0127966 3300037312 Bacteria 1815
365 Ga0395900_0000169 3300037418 Bacteria 105954
366 Ga0395900_0001006 3300037418 Bacteria 36517
367 Ga0395900_0013095 3300037418 Bacteria 8473
368 Ga0395900_0030583 3300037418 Bacteria 5529
369 Ga0395900_0036169 3300037418 Bacteria 5089
370 Ga0395900_0048251 3300037418 Bacteria 4386
371 Ga0395900_0063130 3300037418 Bacteria 3807
372 Ga0395900_0064826 3300037418 Bacteria 3753
373 Ga0395900_0364682 3300037418 Bacteria 1415
374 Ga0395898_0000338 3300037466 Bacteria 105954
375 Ga0395898_0006942 3300037466 Bacteria 12035
376 Ga0395898_0053289 3300037466 Bacteria 3951
377 Ga0395898_0067730 3300037466 Bacteria 3455
378 Ga0395898_0082800 3300037466 Bacteria 3093
379 Ga0395898_0094911 3300037466 Bacteria 2866
380 Ga0395905_0000079 3300037471 Bacteria 160663
381 Ga0395905_0000249 3300037471 Bacteria 80584
382 Ga0395905_0021786 3300037471 Bacteria 6061
383 Ga0395905_0260691 3300037471 Bacteria 1618
384 Ga0395901_0000084 3300038443 Bacteria 127737
385 Ga0395901_0001099 3300038443 Bacteria 28762
386 Ga0395901_0009132 3300038443 Bacteria 10040
387 Ga0395901_0165706 3300038443 Bacteria 2320
388 Ga0436365_0245511 3300039437 Bacteria 2513
389 Ga0436361_0093744 3300039447 Bacteria 8061
390 Ga0436361_1185928 3300039447 Bacteria 172199
391 Ga0439448_0000325 3300042005 Bacteria 10568
392 Ga0450897_001105 3300042128 Bacteria 1747
393 Ga0450899_010921 3300042135 Bacteria 1009
394 Ga0450904_000600 3300042139 Bacteria 6694
395 Ga0451577_0009948 3300042876 Bacteria 9117
396 Ga0451577_0033475 3300042876 Bacteria 4633
397 Ga0451577_0069542 3300042876 Bacteria 3139
398 Ga0466969_0014035 3300044656 Bacteria 4215
399 Ga0466969_0084910 3300044656 Bacteria 1505
400 Ga0466972_0018823 3300044658 Bacteria 3451
401 Ga0453683_0016909 3300044673 Bacteria 4702
402 Ga0466966_0000277 3300044684 Bacteria 33571
403 Ga0466966_0002148 3300044684 Bacteria 12784
404 Ga0466966_0002376 3300044684 Bacteria 12288
405 Ga0466966_0008254 3300044684 Bacteria 6907
406 Ga0466966_0010101 3300044684 Bacteria 6261
407 Ga0466966_0017218 3300044684 Bacteria 4778
408 Ga0466966_0020096 3300044684 Bacteria 4394
409 Ga0466966_0043405 3300044684 Bacteria 2882
410 Ga0466966_0127820 3300044684 Bacteria 1557
411 Ga0466961_0000344 3300044693 Bacteria 30339
412 Ga0466961_0004968 3300044693 Bacteria 8367
413 Ga0466961_0007588 3300044693 Bacteria 6907
414 Ga0466963_0000554 3300044694 Bacteria 17590
415 Ga0466964_0002478 3300044706 Bacteria 6561
416 Ga0453684_0000193 3300044712 Bacteria 266146
417 Ga0453684_0002276 3300044712 Bacteria 47408
418 Ga0453684_0021760 3300044712 Bacteria 9557
419 Ga0453684_0023287 3300044712 Bacteria 9133
420 Ga0466971_0000270 3300044719 Bacteria 19965
421 Ga0466971_0006464 3300044719 Bacteria 5091
422 Ga0466968_0005379 3300044735 Bacteria 4791
423 Ga0466968_0010283 3300044735 Bacteria 3625
424 Ga0466970_0004253 3300044765 Bacteria 7047
425 Ga0466957_0001982 3300044842 Bacteria 10901
426 Ga0466957_0056022 3300044842 Bacteria 2410
427 Ga0466960_0029263 3300044901 Bacteria 2527
428 Ga0466960_0091677 3300044901 Bacteria 1550
429 Ga0466959_0007383 3300045049 Bacteria 7711
430 Ga0451576_0003152 3300045051 Bacteria 23079
431 Ga0451576_0004673 3300045051 Bacteria 17635
432 Ga0451576_0009113 3300045051 Bacteria 11543
433 Ga0451576_0035379 3300045051 Bacteria 5299
434 Ga0451576_0231898 3300045051 Bacteria 1928
435 Ga0466958_0007390 3300045836 Bacteria 6040
436 Ga0466958_0009629 3300045836 Bacteria 5388
437 Ga0495617_000002 3300046452 Bacteria 710121
438 Ga0495617_000003 3300046452 Bacteria 541914
439 Ga0495617_000210 3300046452 Bacteria 36010
440 Ga0495617_001586 3300046452 Bacteria 9824
441 Ga0495627_000001 3300046453 Bacteria 1104709
442 Ga0495627_000176 3300046453 Bacteria 72651
443 Ga0495627_003352 3300046453 Bacteria 7120
444 Ga0495627_015484 3300046453 Bacteria 2632
445 Ga0495592_0005288 3300046454 Bacteria 9514
446 Ga0495592_0014560 3300046454 Bacteria 5968
447 Ga0495603_0000867 3300046455 Bacteria 17335
448 Ga0495603_0027090 3300046455 Bacteria 3460
449 Ga0495603_0043618 3300046455 Bacteria 2677
450 Ga0495590_0000001 3300046457 Bacteria 762984
451 Ga0495590_0000044 3300046457 Bacteria 119833
452 Ga0495590_0004382 3300046457 Bacteria 5701
453 Ga0495590_0006826 3300046457 Bacteria 4436
454 Ga0495590_0009964 3300046457 Bacteria 3592
455 Ga0495591_000052 3300046458 Bacteria 136101
456 Ga0495591_001869 3300046458 Bacteria 12398
457 Ga0495591_009331 3300046458 Bacteria 3909
458 Ga0495629_0000178 3300046459 Bacteria 56903
459 Ga0495629_0000285 3300046459 Bacteria 43774
460 Ga0495629_0001888 3300046459 Bacteria 16327
461 Ga0495629_0002120 3300046459 Bacteria 15369
462 Ga0495629_0003648 3300046459 Bacteria 11640
463 Ga0495629_0021875 3300046459 Bacteria 4563
464 Ga0495629_0032812 3300046459 Bacteria 3675
465 Ga0495638_0000017 3300046460 Bacteria 391117
466 Ga0495638_0000945 3300046460 Bacteria 29442
467 Ga0495638_0006104 3300046460 Bacteria 8820
468 Ga0495638_0007524 3300046460 Bacteria 7797
469 Ga0495638_0016040 3300046460 Bacteria 5021
470 Ga0495638_0127793 3300046460 Bacteria 1496
471 Ga0495641_0005571 3300046461 Bacteria 8448
472 Ga0495651_0011625 3300046462 Bacteria 6766
473 Ga0495651_0015143 3300046462 Bacteria 5959
474 Ga0495651_0125527 3300046462 Bacteria 1880
475 Ga0495653_0002764 3300046463 Bacteria 14004
476 Ga0495653_0003463 3300046463 Bacteria 12692
477 Ga0495653_0038731 3300046463 Bacteria 3740
478 Ga0495653_0049525 3300046463 Bacteria 3235
479 Ga0495653_0080085 3300046463 Bacteria 2417
480 Ga0495653_0166329 3300046463 Bacteria 1526
481 Ga0495650_0000456 3300046471 Bacteria 64008
482 Ga0495650_0000806 3300046471 Bacteria 38200
483 Ga0495650_0004206 3300046471 Bacteria 9970
484 Ga0495650_0011361 3300046471 Bacteria 4886
485 Ga0495650_0015319 3300046471 Bacteria 3938
486 Ga0495650_0021095 3300046471 Bacteria 3157
487 Ga0495580_0000001 3300046472 Bacteria 180598
488 Ga0495580_0010297 3300046472 Bacteria 7292
489 Ga0495580_0011524 3300046472 Bacteria 6840
490 Ga0495580_0131327 3300046472 Bacteria 1737
491 Ga0495582_0001582 3300046473 Bacteria 12836
492 Ga0495582_0004982 3300046473 Bacteria 7440
493 Ga0495582_0005649 3300046473 Bacteria 6962
494 Ga0495582_0013662 3300046473 Bacteria 4469
495 Ga0495582_0030386 3300046473 Bacteria 2966
496 Ga0495605_0000028 3300046474 Bacteria 218471
497 Ga0495605_0000081 3300046474 Bacteria 125302
498 Ga0495605_0000087 3300046474 Bacteria 120256
499 Ga0495605_0002871 3300046474 Bacteria 10477
500 Ga0495605_0003749 3300046474 Bacteria 9020
501 Ga0495605_0009089 3300046474 Bacteria 5591
502 Ga0495605_0009309 3300046474 Bacteria 5521
503 Ga0495605_0011963 3300046474 Bacteria 4824
504 Ga0495605_0012019 3300046474 Bacteria 4814
505 Ga0495605_0014479 3300046474 Bacteria 4319
506 Ga0495605_0042078 3300046474 Bacteria 2272
507 Ga0495605_0082788 3300046474 Bacteria 1499
508 Ga0495664_0001897 3300046477 Bacteria 11117
509 Ga0495664_0018631 3300046477 Bacteria 3981
510 Ga0495664_0268186 3300046477 Bacteria 1032
511 Ga0495584_0000011 3300046491 Bacteria 208322
512 Ga0495584_0000057 3300046491 Bacteria 81182
513 Ga0495584_0000460 3300046491 Bacteria 28068
514 Ga0495584_0002846 3300046491 Bacteria 9661
515 Ga0495584_0003929 3300046491 Bacteria 8032
516 Ga0495584_0005971 3300046491 Bacteria 6414
517 Ga0495584_0006863 3300046491 Bacteria 5951
518 Ga0495584_0014505 3300046491 Bacteria 4014
519 Ga0495584_0022193 3300046491 Bacteria 3222
520 Ga0495584_0022301 3300046491 Bacteria 3214
521 Ga0495584_0023259 3300046491 Bacteria 3142
522 Ga0495584_0036884 3300046491 Bacteria 2469
523 Ga0495584_0050473 3300046491 Bacteria 2095
524 Ga0495585_0000004 3300046492 Bacteria 348260
525 Ga0495585_0000814 3300046492 Bacteria 27169
526 Ga0495585_0000863 3300046492 Bacteria 25902
527 Ga0495585_0006024 3300046492 Bacteria 7588
528 Ga0495585_0008368 3300046492 Bacteria 6273
529 Ga0495585_0008688 3300046492 Bacteria 6140
530 Ga0495585_0014155 3300046492 Bacteria 4654
531 Ga0495585_0016163 3300046492 Bacteria 4325
532 Ga0495585_0037637 3300046492 Bacteria 2724
533 Ga0495585_0089551 3300046492 Bacteria 1658
534 Ga0495594_0002589 3300046499 Bacteria 9403
535 Ga0495594_0003551 3300046499 Bacteria 8029
536 Ga0495594_0010723 3300046499 Bacteria 4755
537 Ga0495594_0018124 3300046499 Bacteria 3728
538 Ga0495594_0183424 3300046499 Bacteria 1191
539 Ga0495596_0000633 3300046500 Bacteria 22131
540 Ga0495596_0001840 3300046500 Bacteria 11774
541 Ga0495596_0004150 3300046500 Bacteria 7119
542 Ga0495596_0006018 3300046500 Bacteria 5660
543 Ga0495596_0006065 3300046500 Bacteria 5631
544 Ga0495596_0008424 3300046500 Bacteria 4590
545 Ga0495596_0009225 3300046500 Bacteria 4350
546 Ga0495596_0011133 3300046500 Bacteria 3889
547 Ga0495596_0030815 3300046500 Bacteria 2145
548 Ga0495596_0030977 3300046500 Bacteria 2139
549 Ga0495607_0002567 3300046501 Bacteria 14672
550 Ga0495607_0003451 3300046501 Bacteria 12100
551 Ga0495607_0005170 3300046501 Bacteria 9415
552 Ga0495607_0007144 3300046501 Bacteria 7760
553 Ga0495607_0010718 3300046501 Bacteria 6141
554 Ga0495607_0015241 3300046501 Bacteria 4985
555 Ga0495607_0031243 3300046501 Bacteria 3261
556 Ga0495607_0032512 3300046501 Bacteria 3183
557 Ga0495607_0034340 3300046501 Bacteria 3077
558 Ga0495607_0043436 3300046501 Bacteria 2657
559 Ga0495607_0058904 3300046501 Bacteria 2193
560 Ga0495583_0000050 3300046506 Bacteria 213627
561 Ga0495583_0000067 3300046506 Bacteria 189381
562 Ga0495583_0000241 3300046506 Bacteria 90735
563 Ga0495583_0000430 3300046506 Bacteria 63194
564 Ga0495583_0001408 3300046506 Bacteria 24506
565 Ga0495583_0001716 3300046506 Bacteria 21053
566 Ga0495583_0003837 3300046506 Bacteria 11137
567 Ga0495583_0010073 3300046506 Bacteria 5562
568 Ga0495583_0010118 3300046506 Bacteria 5543
569 Ga0495583_0015715 3300046506 Bacteria 4102
570 Ga0495583_0022997 3300046506 Bacteria 3164
571 Ga0495583_0028050 3300046506 Bacteria 2772
572 Ga0495583_0049103 3300046506 Bacteria 1934
573 Ga0495583_0062359 3300046506 Bacteria 1660
574 Ga0495583_0073904 3300046506 Bacteria 1493
575 Ga0495583_0076467 3300046506 Bacteria 1462
576 Ga0495606_0000563 3300046507 Bacteria 58807
577 Ga0495606_0000820 3300046507 Bacteria 47128
578 Ga0495606_0003201 3300046507 Bacteria 17648
579 Ga0495606_0003747 3300046507 Bacteria 15823
580 Ga0495606_0006662 3300046507 Bacteria 10595
581 Ga0495606_0011903 3300046507 Bacteria 7037
582 Ga0495606_0012318 3300046507 Bacteria 6875
583 Ga0495606_0027799 3300046507 Bacteria 4003
584 Ga0495606_0028347 3300046507 Bacteria 3952
585 Ga0495606_0048740 3300046507 Bacteria 2783
586 Ga0495606_0049990 3300046507 Bacteria 2738
587 Ga0495606_0062801 3300046507 Bacteria 2369
588 Ga0495606_0235338 3300046507 Bacteria 1024
589 Ga0495608_0009419 3300046511 Bacteria 6826
590 Ga0495608_0017053 3300046511 Bacteria 5026
591 Ga0495610_0000506 3300046512 Bacteria 39776
592 Ga0495610_0005396 3300046512 Bacteria 9106
593 Ga0495610_0006646 3300046512 Bacteria 7889
594 Ga0495610_0024568 3300046512 Bacteria 3249
595 Ga0495610_0043323 3300046512 Bacteria 2243
596 Ga0495610_0090828 3300046512 Bacteria 1384
597 Ga0495616_0000218 3300046513 Bacteria 47146
598 Ga0495616_0001339 3300046513 Bacteria 17196
599 Ga0495616_0002294 3300046513 Bacteria 12797
600 Ga0495616_0004089 3300046513 Bacteria 9257
601 Ga0495616_0006247 3300046513 Bacteria 7238
602 Ga0495616_0006363 3300046513 Bacteria 7158
603 Ga0495616_0013987 3300046513 Bacteria 4508
604 Ga0495616_0017342 3300046513 Bacteria 3972
605 Ga0495618_0007168 3300046514 Bacteria 6749
606 Ga0495618_0013665 3300046514 Bacteria 4940
607 Ga0495618_0017662 3300046514 Bacteria 4377
608 Ga0495620_0022583 3300046515 Bacteria 3027
609 Ga0495628_0001900 3300046516 Bacteria 18959
610 Ga0495628_0032607 3300046516 Bacteria 4204
611 Ga0495628_0117777 3300046516 Bacteria 2039
612 Ga0495628_0161007 3300046516 Bacteria 1705
613 Ga0495630_0007017 3300046517 Bacteria 8028
614 Ga0495630_0014192 3300046517 Bacteria 5799
615 Ga0495630_0051251 3300046517 Bacteria 3089
616 Ga0495630_0182640 3300046517 Bacteria 1600
617 Ga0495631_0000556 3300046518 Bacteria 25004
618 Ga0495631_0002191 3300046518 Bacteria 11249
619 Ga0495631_0005244 3300046518 Bacteria 6816
620 Ga0495631_0006335 3300046518 Bacteria 6122
621 Ga0495631_0008026 3300046518 Bacteria 5334
622 Ga0495631_0012942 3300046518 Bacteria 4062
623 Ga0495631_0021299 3300046518 Bacteria 3019
624 Ga0495631_0030852 3300046518 Bacteria 2429
625 Ga0495631_0037413 3300046518 Bacteria 2162
626 Ga0495631_0037447 3300046518 Bacteria 2161
627 Ga0495631_0063583 3300046518 Bacteria 1598
628 Ga0495632_0000040 3300046519 Bacteria 149644
629 Ga0495632_0000114 3300046519 Bacteria 82098
630 Ga0495632_0002437 3300046519 Bacteria 14155
631 Ga0495632_0007437 3300046519 Bacteria 6879
632 Ga0495632_0008625 3300046519 Bacteria 6225
633 Ga0495632_0011980 3300046519 Bacteria 5027
634 Ga0495632_0012370 3300046519 Bacteria 4925
635 Ga0495632_0089230 3300046519 Bacteria 1463
636 Ga0495637_0000006 3300046520 Bacteria 435763
637 Ga0495637_0002126 3300046520 Bacteria 11122
638 Ga0495637_0009761 3300046520 Bacteria 4672
639 Ga0495637_0013100 3300046520 Bacteria 3945
640 Ga0495643_0000028 3300046522 Bacteria 262886
641 Ga0495643_0000192 3300046522 Bacteria 96511
642 Ga0495643_0000285 3300046522 Bacteria 72233
643 Ga0495643_0002723 3300046522 Bacteria 13603
644 Ga0495643_0004024 3300046522 Bacteria 10485
645 Ga0495643_0009197 3300046522 Bacteria 6165
646 Ga0495643_0017628 3300046522 Bacteria 4169
647 Ga0495643_0037000 3300046522 Bacteria 2679
648 Ga0495643_0155334 3300046522 Bacteria 1129
649 Ga0495644_0001463 3300046523 Bacteria 9635
650 Ga0495644_0007508 3300046523 Bacteria 4202
651 Ga0495644_0010273 3300046523 Bacteria 3606
652 Ga0495644_0018694 3300046523 Bacteria 2644
653 Ga0495644_0037979 3300046523 Bacteria 1817
654 Ga0495648_0000001 3300046524 Bacteria 696872
655 Ga0495648_0000802 3300046524 Bacteria 33272
656 Ga0495648_0001359 3300046524 Bacteria 24164
657 Ga0495648_0003099 3300046524 Bacteria 14837
658 Ga0495648_0007560 3300046524 Bacteria 8685
659 Ga0495648_0011159 3300046524 Bacteria 6789
660 Ga0495648_0014398 3300046524 Bacteria 5792
661 Ga0495648_0020179 3300046524 Bacteria 4659
662 Ga0495648_0045197 3300046524 Bacteria 2741
663 Ga0495648_0047136 3300046524 Bacteria 2666
664 Ga0495648_0067678 3300046524 Bacteria 2087
665 Ga0495648_0092890 3300046524 Bacteria 1684
666 Ga0495663_0003544 3300046525 Bacteria 4492
667 Ga0495666_0001627 3300046526 Bacteria 11057
668 Ga0495666_0002374 3300046526 Bacteria 9387
669 Ga0495666_0006592 3300046526 Bacteria 5838
670 Ga0495666_0008866 3300046526 Bacteria 5038
671 Ga0495666_0015604 3300046526 Bacteria 3781
672 Ga0495642_0000813 3300046528 Bacteria 15134
673 Ga0495642_0001190 3300046528 Bacteria 11964
674 Ga0495642_0002336 3300046528 Bacteria 7736
675 Ga0495642_0002344 3300046528 Bacteria 7718
676 Ga0495642_0002537 3300046528 Bacteria 7384
677 Ga0495642_0004410 3300046528 Bacteria 5462
678 Ga0495642_0005459 3300046528 Bacteria 4883
679 Ga0495642_0006314 3300046528 Bacteria 4546
680 Ga0495642_0006627 3300046528 Bacteria 4445
681 Ga0495642_0006928 3300046528 Bacteria 4347
682 Ga0495642_0046984 3300046528 Bacteria 1766
683 Ga0495652_0013316 3300046529 Bacteria 7402
684 Ga0495652_0054241 3300046529 Bacteria 3413
685 Ga0495654_0005270 3300046530 Bacteria 7542
686 Ga0495654_0013309 3300046530 Bacteria 4406
687 Ga0495654_0017765 3300046530 Bacteria 3733
688 Ga0495665_0006958 3300046531 Bacteria 6100
689 Ga0495665_0007081 3300046531 Bacteria 6052
690 Ga0495665_0009119 3300046531 Bacteria 5376
691 Ga0495665_0051567 3300046531 Bacteria 2179
692 Ga0495665_0073064 3300046531 Bacteria 1806
693 Ga0495640_0004099 3300046533 Bacteria 11657
694 Ga0495640_0005465 3300046533 Bacteria 10109
695 Ga0495640_0008491 3300046533 Bacteria 8052
696 Ga0495640_0032792 3300046533 Bacteria 3696
697 Ga0495586_0019439 3300046535 Bacteria 3616
698 Ga0495586_0039934 3300046535 Bacteria 2523
699 Ga0495587_0018997 3300046536 Bacteria 4259
700 Ga0495609_0000096 3300046538 Bacteria 104135
701 Ga0495609_0000110 3300046538 Bacteria 96998
702 Ga0495609_0000497 3300046538 Bacteria 31519
703 Ga0495609_0001124 3300046538 Bacteria 18539
704 Ga0495609_0001475 3300046538 Bacteria 15604
705 Ga0495609_0005063 3300046538 Bacteria 7030
706 Ga0495609_0007366 3300046538 Bacteria 5501
707 Ga0495609_0008283 3300046538 Bacteria 5098
708 Ga0495609_0028135 3300046538 Bacteria 2566
709 Ga0495609_0079776 3300046538 Bacteria 1431
710 Ga0495597_0000459 3300046542 Bacteria 34870
711 Ga0495597_0000579 3300046542 Bacteria 30352
712 Ga0495597_0000587 3300046542 Bacteria 30136
713 Ga0495597_0002689 3300046542 Bacteria 10982
714 Ga0495597_0007925 3300046542 Bacteria 5354
715 Ga0495597_0011861 3300046542 Bacteria 4218
716 Ga0495645_0003031 3300046543 Bacteria 11365
717 Ga0495645_0095089 3300046543 Bacteria 2124
718 Ga0495622_0000075 3300046557 Bacteria 87816
719 Ga0495622_0000131 3300046557 Bacteria 64280
720 Ga0495622_0016534 3300046557 Bacteria 3437
721 Ga0495622_0016605 3300046557 Bacteria 3428
722 Ga0495622_0019672 3300046557 Bacteria 3143
723 Ga0495622_0020634 3300046557 Bacteria 3068
724 Ga0495622_0045703 3300046557 Bacteria 2034
725 Ga0495633_0000106 3300046558 Bacteria 113381
726 Ga0495633_0001152 3300046558 Bacteria 21220
727 Ga0495633_0001289 3300046558 Bacteria 19834
728 Ga0495633_0001422 3300046558 Bacteria 18622
729 Ga0495633_0002045 3300046558 Bacteria 14548
730 Ga0495633_0002751 3300046558 Bacteria 12161
731 Ga0495633_0006201 3300046558 Bacteria 7142
732 Ga0495667_0027758 3300046559 Bacteria 3812
733 Ga0495667_0119081 3300046559 Bacteria 1705
734 Ga0495656_0003042 3300046615 Bacteria 5640
735 Ga0495656_0027660 3300046615 Bacteria 2267
736 Ga0495656_0057445 3300046615 Bacteria 1685
737 Ga0495668_0000018 3300046616 Bacteria 417480
738 Ga0495668_0000686 3300046616 Bacteria 40735
739 Ga0495668_0001608 3300046616 Bacteria 21175
740 Ga0495668_0002567 3300046616 Bacteria 14753
741 Ga0495668_0008369 3300046616 Bacteria 6470
742 Ga0495668_0009745 3300046616 Bacteria 5869
743 Ga0495668_0030115 3300046616 Bacteria 3065
744 Ga0495668_0030610 3300046616 Bacteria 3037
745 Ga0495668_0032574 3300046616 Bacteria 2931
746 Ga0495668_0055641 3300046616 Bacteria 2184
747 Ga0495668_0062633 3300046616 Bacteria 2049
748 Ga0495668_0144427 3300046616 Bacteria 1302
749 Ga0495634_0001455 3300046642 Bacteria 21032
750 Ga0495634_0013434 3300046642 Bacteria 5915
751 Ga0495634_0036626 3300046642 Bacteria 3355
752 Ga0495611_0000376 3300046648 Bacteria 28720
753 Ga0495611_0000476 3300046648 Bacteria 23975
754 Ga0495611_0001009 3300046648 Bacteria 14914
755 Ga0495611_0003480 3300046648 Bacteria 6934
756 Ga0495611_0004540 3300046648 Bacteria 5987
757 Ga0495611_0005280 3300046648 Bacteria 5534
758 Ga0495611_0009665 3300046648 Bacteria 4075
759 Ga0495611_0015041 3300046648 Bacteria 3307
760 Ga0495611_0015073 3300046648 Bacteria 3304
761 Ga0495611_0022450 3300046648 Bacteria 2730
762 Ga0495611_0040260 3300046648 Bacteria 2083
763 Ga0495625_0000035 3300046660 Bacteria 224323
764 Ga0495625_0002479 3300046660 Bacteria 19887
765 Ga0495625_0005030 3300046660 Bacteria 12268
766 Ga0495625_0022401 3300046660 Bacteria 4844
767 Ga0495625_0034649 3300046660 Bacteria 3725
768 Ga0495625_0040226 3300046660 Bacteria 3411
769 Ga0495625_0043584 3300046660 Bacteria 3253
770 Ga0495625_0059374 3300046660 Bacteria 2714
771 Ga0495625_0117308 3300046660 Bacteria 1814
772 Ga0495625_0166865 3300046660 Bacteria 1471
773 Ga0495635_0001789 3300046663 Bacteria 14524
774 Ga0495635_0013372 3300046663 Bacteria 5744
775 Ga0495635_0022968 3300046663 Bacteria 4347
776 Ga0495659_0000052 3300046664 Bacteria 52258
777 Ga0495659_0000529 3300046664 Bacteria 14098
778 Ga0495661_0000164 3300046665 Bacteria 78742
779 Ga0495661_0003522 3300046665 Bacteria 11537
780 Ga0495661_0006009 3300046665 Bacteria 8566
781 Ga0495661_0014949 3300046665 Bacteria 5188
782 Ga0495661_0015784 3300046665 Bacteria 5029
783 Ga0495661_0025238 3300046665 Bacteria 3840
784 Ga0495661_0037776 3300046665 Bacteria 3012
785 Ga0495661_0041408 3300046665 Bacteria 2850
786 Ga0495661_0058289 3300046665 Bacteria 2302
787 Ga0495661_0115723 3300046665 Bacteria 1488
788 Ga0495588_0000070 3300046674 Bacteria 227611
789 Ga0495588_0005552 3300046674 Bacteria 5619
790 Ga0495588_0040498 3300046674 Bacteria 2376
791 Ga0495588_0053203 3300046674 Bacteria 2087
792 Ga0495588_0102827 3300046674 Bacteria 1502
793 Ga0495599_0002742 3300046678 Bacteria 10274
794 Ga0495599_0021770 3300046678 Bacteria 4001
795 Ga0495623_0001396 3300046679 Bacteria 16416
796 Ga0495623_0019259 3300046679 Bacteria 4411
797 Ga0495623_0024796 3300046679 Bacteria 3863
798 Ga0495623_0028769 3300046679 Bacteria 3575
799 Ga0495623_0140067 3300046679 Bacteria 1440
800 Ga0495646_0001118 3300046680 Bacteria 15653
801 Ga0495646_0016250 3300046680 Bacteria 4724
802 Ga0495646_0032109 3300046680 Bacteria 3268
803 Ga0495646_0033623 3300046680 Bacteria 3187
804 Ga0495646_0041268 3300046680 Bacteria 2836
805 Ga0495647_0015333 3300046681 Bacteria 2684
806 Ga0495669_0000098 3300046684 Bacteria 54514
807 Ga0495669_0000122 3300046684 Bacteria 50338
808 Ga0495669_0000598 3300046684 Bacteria 15808
809 Ga0495669_0008372 3300046684 Bacteria 4347
810 Ga0495669_0010848 3300046684 Bacteria 3857
811 Ga0495669_0026673 3300046684 Bacteria 2525
812 Ga0495613_0003533 3300046689 Bacteria 11716
813 Ga0495613_0003579 3300046689 Bacteria 11641
814 Ga0495613_0013125 3300046689 Bacteria 6155
815 Ga0495613_0017802 3300046689 Bacteria 5295
816 Ga0495624_0005465 3300046690 Bacteria 9155
817 Ga0495624_0015533 3300046690 Bacteria 5138
818 Ga0495624_0018907 3300046690 Bacteria 4603
819 Ga0495624_0027815 3300046690 Bacteria 3698
820 Ga0495624_0072286 3300046690 Bacteria 2145
821 Ga0495670_0000604 3300046691 Bacteria 17142
822 Ga0495670_0000716 3300046691 Bacteria 15813
823 Ga0495670_0002986 3300046691 Bacteria 8343
824 Ga0495670_0006409 3300046691 Bacteria 5780
825 Ga0495670_0028216 3300046691 Bacteria 2782
826 Ga0495670_0030634 3300046691 Bacteria 2672
827 Ga0495670_0070736 3300046691 Bacteria 1765
828 Ga0495670_0079364 3300046691 Bacteria 1670
829 Ga0495671_0000128 3300046692 Bacteria 68354
830 Ga0495671_0000132 3300046692 Bacteria 67269
831 Ga0495671_0014662 3300046692 Bacteria 4211
832 Ga0495671_0018445 3300046692 Bacteria 3703
833 Ga0495671_0020725 3300046692 Bacteria 3462
834 Ga0495671_0026082 3300046692 Bacteria 3032
835 Ga0495671_0035134 3300046692 Bacteria 2547
836 Ga0495671_0036103 3300046692 Bacteria 2506
837 Ga0495649_0001317 3300046694 Bacteria 18939
838 Ga0495649_0004297 3300046694 Bacteria 9346
839 Ga0495649_0004408 3300046694 Bacteria 9197
840 Ga0495649_0016046 3300046694 Bacteria 4252
841 Ga0495649_0029298 3300046694 Bacteria 3046
842 Ga0495649_0049349 3300046694 Bacteria 2286
843 Ga0495649_0052366 3300046694 Bacteria 2212
844 Ga0495649_0114136 3300046694 Bacteria 1431
845 Ga0495589_0000036 3300046794 Bacteria 153299
846 Ga0495589_0000092 3300046794 Bacteria 85372
847 Ga0495589_0001941 3300046794 Bacteria 11711
848 Ga0495589_0002400 3300046794 Bacteria 10520
849 Ga0495589_0002441 3300046794 Bacteria 10434
850 Ga0495589_0011466 3300046794 Bacteria 4602
851 Ga0495589_0016187 3300046794 Bacteria 3832
852 Ga0495589_0022789 3300046794 Bacteria 3193
853 Ga0495589_0035130 3300046794 Bacteria 2514
854 Ga0495589_0096429 3300046794 Bacteria 1433
855 Ga0495600_0000510 3300046809 Bacteria 20142
856 Ga0495600_0005990 3300046809 Bacteria 7361
857 Ga0495600_0148196 3300046809 Bacteria 1520
858 Ga0495660_0000117 3300046810 Bacteria 85237
859 Ga0495660_0000839 3300046810 Bacteria 22805
860 Ga0495660_0002463 3300046810 Bacteria 11811
861 Ga0495660_0003009 3300046810 Bacteria 10514
862 Ga0495660_0003124 3300046810 Bacteria 10316
863 Ga0495660_0008761 3300046810 Bacteria 5910
864 Ga0495660_0009567 3300046810 Bacteria 5651
865 Ga0495660_0010570 3300046810 Bacteria 5369
866 Ga0495660_0022679 3300046810 Bacteria 3583
867 Ga0495660_0023686 3300046810 Bacteria 3502
868 Ga0495660_0055809 3300046810 Bacteria 2137
869 Ga0495581_0004434 3300047315 Bacteria 8113
870 Ga0495581_0004715 3300047315 Bacteria 7872
871 Ga0495581_0016557 3300047315 Bacteria 4284
872 Ga0495581_0093981 3300047315 Bacteria 1740
873 Ga0495604_0000854 3300047317 Bacteria 25462
874 Ga0495604_0005257 3300047317 Bacteria 10259
875 Ga0495604_0007320 3300047317 Bacteria 8740
876 Ga0495604_0017852 3300047317 Bacteria 5675
877 Ga0495604_0037992 3300047317 Bacteria 3788
878 Ga0495604_0072199 3300047317 Bacteria 2609
879 Ga0495604_0128199 3300047317 Bacteria 1826
880 Ga0495636_0000126 3300047318 Bacteria 31355
881 Ga0495636_0007400 3300047318 Bacteria 4320
882 Ga0495636_0010263 3300047318 Bacteria 3695
883 Ga0495636_0012275 3300047318 Bacteria 3392
884 Ga0495636_0034643 3300047318 Bacteria 2078
885 Ga0495636_0067059 3300047318 Bacteria 1527
886 Ga0495674_0024972 3300047319 Bacteria 5484
887 Ga0495674_0039283 3300047319 Bacteria 4243
888 Ga0495674_0062982 3300047319 Bacteria 3227
889 Ga0495674_0080830 3300047319 Bacteria 2788
890 Ga0495674_0112723 3300047319 Bacteria 2304
891 Ga0495674_0131503 3300047319 Bacteria 2108
892 Ga0495674_0230197 3300047319 Bacteria 1529
893 Ga0495672_0000066 3300047320 Bacteria 193318
894 Ga0495672_0000086 3300047320 Bacteria 155010
895 Ga0495672_0000349 3300047320 Bacteria 59139
896 Ga0495672_0000400 3300047320 Bacteria 52696
897 Ga0495672_0000556 3300047320 Bacteria 42391
898 Ga0495672_0002183 3300047320 Bacteria 18230
899 Ga0495672_0003253 3300047320 Bacteria 14086
900 Ga0495672_0003913 3300047320 Bacteria 12501
901 Ga0495672_0013316 3300047320 Bacteria 5679
902 Ga0495672_0021041 3300047320 Bacteria 4260
903 Ga0495672_0026319 3300047320 Bacteria 3713
904 Ga0495676_0000035 3300047321 Bacteria 120519
905 Ga0495676_0006502 3300047321 Bacteria 10769
906 Ga0495676_0009421 3300047321 Bacteria 8894
907 Ga0495676_0033173 3300047321 Bacteria 4351
908 Ga0495680_0015543 3300047322 Bacteria 6565
909 Ga0495680_0017177 3300047322 Bacteria 6189
910 Ga0495680_0032120 3300047322 Bacteria 4265
911 Ga0495680_0034256 3300047322 Bacteria 4104
912 Ga0495680_0053360 3300047322 Bacteria 3146
913 Ga0495680_0260151 3300047322 Bacteria 1227
914 Ga0495683_0000080 3300047323 Bacteria 95388
915 Ga0495683_0000576 3300047323 Bacteria 27760
916 Ga0495683_0002800 3300047323 Bacteria 10350
917 Ga0495683_0005543 3300047323 Bacteria 6998
918 Ga0495683_0006408 3300047323 Bacteria 6433
919 Ga0495683_0009633 3300047323 Bacteria 5142
920 Ga0495683_0012554 3300047323 Bacteria 4447
921 Ga0495683_0037783 3300047323 Bacteria 2446
922 Ga0495683_0047557 3300047323 Bacteria 2152
923 Ga0495683_0059501 3300047323 Bacteria 1895
924 Ga0495683_0063414 3300047323 Bacteria 1826
925 Ga0495687_000053 3300047443 Bacteria 195897
926 Ga0495687_000074 3300047443 Bacteria 153464
927 Ga0495687_000154 3300047443 Bacteria 104740
928 Ga0495687_000946 3300047443 Bacteria 29935
929 Ga0495687_001241 3300047443 Bacteria 24342
930 Ga0495687_002558 3300047443 Bacteria 14385
931 Ga0495687_002852 3300047443 Bacteria 13266
932 Ga0495687_003354 3300047443 Bacteria 11695
933 Ga0495687_005143 3300047443 Bacteria 8468
934 Ga0495687_005425 3300047443 Bacteria 8131
935 Ga0495687_015073 3300047443 Bacteria 3944
936 Ga0495687_065664 3300047443 Bacteria 1476
937 Ga0495675_0008503 3300047444 Bacteria 6360
938 Ga0495675_0009650 3300047444 Bacteria 6012
939 Ga0495675_0017405 3300047444 Bacteria 4555
940 Ga0495675_0022719 3300047444 Bacteria 4000
941 Ga0495675_0213444 3300047444 Bacteria 1170
942 Ga0495677_0000037 3300047445 Bacteria 78595
943 Ga0495677_0000214 3300047445 Bacteria 26463
944 Ga0495677_0001397 3300047445 Bacteria 9674
945 Ga0495677_0001947 3300047445 Bacteria 8248
946 Ga0495677_0002817 3300047445 Bacteria 6780
947 Ga0495677_0003246 3300047445 Bacteria 6342
948 Ga0495677_0006506 3300047445 Bacteria 4413
949 Ga0495677_0006565 3300047445 Bacteria 4393
950 Ga0495677_0044671 3300047445 Bacteria 1624
951 Ga0495679_000156 3300047446 Bacteria 61428
952 Ga0495679_000453 3300047446 Bacteria 30221
953 Ga0495679_000509 3300047446 Bacteria 27643
954 Ga0495679_005672 3300047446 Bacteria 5506
955 Ga0495679_013858 3300047446 Bacteria 3007
956 Ga0495685_000011 3300047447 Bacteria 83484
957 Ga0495685_001153 3300047447 Bacteria 8068
958 Ga0495685_006655 3300047447 Bacteria 3794
959 Ga0495685_011400 3300047447 Bacteria 2997
960 Ga0495685_064024 3300047447 Bacteria 1237
961 Ga0495673_0000035 3300047469 Bacteria 316861
962 Ga0495673_0011035 3300047469 Bacteria 4886
963 Ga0495673_0011984 3300047469 Bacteria 4628
964 Ga0495673_0025556 3300047469 Bacteria 2832
965 Ga0495673_0097075 3300047469 Bacteria 1196
966 Ga0495681_0006038 3300047470 Bacteria 8009
967 Ga0495681_0006668 3300047470 Bacteria 7539
968 Ga0495681_0007470 3300047470 Bacteria 6975
969 Ga0495681_0010931 3300047470 Bacteria 5452
970 Ga0495681_0013150 3300047470 Bacteria 4822
971 Ga0495681_0016636 3300047470 Bacteria 4112
972 Ga0495681_0018349 3300047470 Bacteria 3857
973 Ga0495681_0056618 3300047470 Bacteria 1823
974 Ga0495684_0012061 3300047471 Bacteria 6666
975 Ga0495684_0032107 3300047471 Bacteria 4030
976 Ga0495686_0000374 3300047472 Bacteria 71938
977 Ga0495686_0000987 3300047472 Bacteria 34762
978 Ga0495686_0001443 3300047472 Bacteria 25925
979 Ga0495686_0031754 3300047472 Bacteria 3421
980 Ga0495686_0102380 3300047472 Bacteria 1725
981 Ga0495593_0001403 3300047673 Bacteria 14099
982 Ga0495593_0002194 3300047673 Bacteria 11682
983 Ga0495593_0006680 3300047673 Bacteria 6752
984 Ga0495593_0007353 3300047673 Bacteria 6448
985 Ga0495593_0007784 3300047673 Bacteria 6246
986 Ga0495593_0015255 3300047673 Bacteria 4357
987 Ga0495593_0018108 3300047673 Bacteria 3960
988 Ga0495593_0018949 3300047673 Bacteria 3861
989 Ga0495602_0012983 3300048088 Bacteria 8525
990 Ga0495602_0030419 3300048088 Bacteria 5120
991 Ga0495602_0044457 3300048088 Bacteria 4028
992 Ga0495602_0092244 3300048088 Bacteria 2509
993 Ga0495614_0000783 3300048089 Bacteria 13467
994 Ga0495614_0005325 3300048089 Bacteria 5802
995 Ga0495614_0010341 3300048089 Bacteria 4115
996 Ga0495615_0001382 3300048090 Bacteria 3583
997 Ga0495626_0000006 3300048091 Bacteria 284977
998 Ga0495626_0004153 3300048091 Bacteria 8994
999 Ga0495626_0005034 3300048091 Bacteria 7889
1000 Ga0495626_0007142 3300048091 Bacteria 6249
1001 Ga0495626_0007834 3300048091 Bacteria 5916
1002 Ga0495626_0008937 3300048091 Bacteria 5440
1003 Ga0495626_0011758 3300048091 Bacteria 4615
1004 Ga0495626_0012887 3300048091 Bacteria 4362
1005 Ga0495626_0014301 3300048091 Bacteria 4098
1006 Ga0495626_0014308 3300048091 Bacteria 4097
1007 Ga0495626_0014620 3300048091 Bacteria 4041
1008 Ga0495626_0017883 3300048091 Bacteria 3573
1009 Ga0495626_0021946 3300048091 Bacteria 3159
1010 Ga0495626_0029228 3300048091 Bacteria 2668
1011 Ga0495626_0048408 3300048091 Bacteria 1972
1012 Ga0495626_0050272 3300048091 Bacteria 1926
1013 Ga0496100_0060197 3300048903 Bacteria 2498
1014 Ga0496101_0031754 3300048904 Bacteria 3715
1015 Ga0496102_0000253 3300048905 Bacteria 69634
1016 Ga0496102_0001543 3300048905 Bacteria 20339
1017 Ga0496102_0027708 3300048905 Bacteria 5060
1018 Ga0496102_0067864 3300048905 Bacteria 3271
1019 Ga0496103_0002496 3300048906 Bacteria 11545
1020 Ga0496103_0005279 3300048906 Bacteria 7756
1021 Ga0496103_0012509 3300048906 Bacteria 5032
1022 Ga0496103_0015687 3300048906 Bacteria 4515
1023 Ga0496103_0068660 3300048906 Bacteria 2215
1024 Ga0496104_0060011 3300048907 Bacteria 3602
1025 Ga0496105_0085793 3300048908 Bacteria 2601
1026 Ga0496105_0203378 3300048908 Bacteria 1616
1027 Ga0496106_0000432 3300048909 Bacteria 29842
1028 Ga0496106_0037342 3300048909 Bacteria 3634
1029 Ga0496106_0228507 3300048909 Bacteria 1485
1030 Ga0496107_0031164 3300048910 Bacteria 3803
1031 Ga0496107_0043503 3300048910 Bacteria 3227
1032 Ga0496108_0150383 3300048911 Bacteria 2009
1033 Ga0496109_0591084 3300048912 Bacteria 1046
1034 Ga0496110_0001139 3300048913 Bacteria 18808
1035 Ga0496110_0025312 3300048913 Bacteria 5070
1036 Ga0496111_0016215 3300048914 Bacteria 5133
1037 Ga0496112_0025900 3300048915 Bacteria 5636
1038 Ga0496112_0279718 3300048915 Bacteria 1616
1039 Ga0496113_0011257 3300048916 Bacteria 5958
1040 Ga0496113_0015185 3300048916 Bacteria 5283
1041 Ga0496114_0078837 3300048917 Bacteria 2779
1042 Ga0496114_0179791 3300048917 Bacteria 1847
1043 Ga0496115_0013062 3300048918 Bacteria 6270
1044 Ga0496115_0170008 3300048918 Bacteria 1803
1045 Ga0496116_0011621 3300048919 Bacteria 7266
1046 Ga0496116_0027112 3300048919 Bacteria 4175
1047 Ga0496117_0002566 3300048920 Bacteria 22609
1048 Ga0496117_0005210 3300048920 Bacteria 13829
1049 Ga0496117_0007716 3300048920 Bacteria 10404
1050 Ga0496117_0067616 3300048920 Bacteria 2417
1051 Ga0496118_0002656 3300048921 Bacteria 23672
1052 Ga0496118_0004550 3300048921 Bacteria 16356
1053 Ga0496118_0056467 3300048921 Bacteria 2951
1054 Ga0496118_0118332 3300048921 Bacteria 1735
1055 Ga0496121_0002254 3300048924 Bacteria 30068
1056 Ga0496121_0006277 3300048924 Bacteria 14863
1057 Ga0496121_0012852 3300048924 Bacteria 9057
1058 Ga0496121_0021795 3300048924 Bacteria 6257
1059 Ga0496121_0165506 3300048924 Bacteria 1612
1060 Ga0496122_0005543 3300048925 Bacteria 14967
1061 Ga0496122_0010101 3300048925 Bacteria 9797
1062 Ga0496122_0072569 3300048925 Bacteria 2447
1063 Ga0496123_0009734 3300048926 Bacteria 8602
1064 Ga0496124_0000079 3300048927 Bacteria 212057
1065 Ga0496124_0015326 3300048927 Bacteria 7356
1066 Ga0496124_0018387 3300048927 Bacteria 6546
1067 Ga0496124_0026346 3300048927 Bacteria 5244
1068 Ga0496125_0036903 3300048928 Bacteria 4257
1069 Ga0496125_0047293 3300048928 Bacteria 3600
1070 Ga0496126_0000118 3300048929 Bacteria 184719
1071 Ga0496126_0001912 3300048929 Bacteria 29879
1072 Ga0496126_0004117 3300048929 Bacteria 17594
1073 Ga0496126_0007469 3300048929 Bacteria 11975
1074 Ga0496126_0012774 3300048929 Bacteria 8584
1075 Ga0496126_0117942 3300048929 Bacteria 2305
1076 Ga0495678_000002 3300049459 Bacteria 999613
1077 Ga0495678_000029 3300049459 Bacteria 219803
1078 Ga0495678_000064 3300049459 Bacteria 138380
1079 Ga0495678_001683 3300049459 Bacteria 16763
1080 Ga0495678_002660 3300049459 Bacteria 11833
1081 Ga0495678_018210 3300049459 Bacteria 3163
1082 Ga0495682_0000592 3300049460 Bacteria 24625
1083 Ga0495682_0000726 3300049460 Bacteria 21381
1084 Ga0495682_0012560 3300049460 Bacteria 3244
1085 Ga0501292_002034 3300049515 Bacteria 2564
1086 Ga0501297_004592 3300049520 Bacteria 1417
1087 Ga0501300_005419 3300049523 Bacteria 1879
1088 Ga0501039_0044216 3300049575 Bacteria 3440
1089 Ga0501043_0000072 3300049579 Bacteria 89021
1090 Ga0501046_0000112 3300049580 Bacteria 86313
1091 Ga0501047_0000138 3300049581 Bacteria 89028
1092 Ga0501048_0001221 3300049582 Bacteria 19469
1093 Ga0501075_0121025 3300049591 Bacteria 1992
1094 Ga0501201_000825 3300049651 Bacteria 2908
1095 Ga0501207_003795 3300049654 Bacteria 2028
1096 Ga0501211_000079 3300049658 Bacteria 6780
1097 Ga0501222_001066 3300049662 Bacteria 3884
1098 Ga0501227_006353 3300049665 Bacteria 2542
1099 Ga0501233_000690 3300049668 Bacteria 5566
1100 Ga0501249_006134 3300049679 Bacteria 2470
1101 Ga0501253_015142 3300049683 Bacteria 1261
1102 Ga0501255_000839 3300049684 Bacteria 2271
1103 Ga0501221_000470 3300049704 Bacteria 6302
1104 Ga0501232_003431 3300049757 Bacteria 1446
1105 Ga0501262_000761 3300049759 Bacteria 3716
1106 Ga0501262_002795 3300049759 Bacteria 1975
1107 Ga0501265_002219 3300049762 Bacteria 2203
1108 Ga0501269_000010 3300049766 Bacteria 70454
1109 Ga0501272_000733 3300049769 Bacteria 2960
1110 Ga0501274_000666 3300049771 Bacteria 2497
1111 Ga0501279_002908 3300049775 Bacteria 2230
1112 Ga0501279_009393 3300049775 Bacteria 1309
1113 Ga0501044_0278396 3300049823 Bacteria 1607
1114 Ga0501045_0001874 3300049824 Bacteria 14253
1115 Ga0500618_025783 3300053125 Bacteria 1407
1116 Ga0500586_000998 3300053145 Bacteria 5848
1117 Ga0587072_001186 3300059643 Bacteria 3122
1118 Ga0466962_0000108 3300061719 Bacteria 33805
1119 Ga0466962_0000704 3300061719 Bacteria 14880
1120 Ga0466962_0001877 3300061719 Bacteria 9894
1121 Ga0466962_0005173 3300061719 Bacteria 6279
1122 2501074628 2501025501 Bacteria 7768574
1123 2501078321 2501025502 Bacteria 9641094
1124 2501410090 2501025504 Bacteria 8008976
1125 2509128021 2508501125 Bacteria 7208311
1126 2510252836 2510065045 Bacteria 7761063
1127 2511090027 2510917013 Bacteria 9951648
1128 2511095412 2510917014 Bacteria 8296963
1129 2511105070 2510917015 Bacteria 7950052
1130 2512346926 2512047030 Bacteria 9031815
1131 2513556048 2513237082 Bacteria 8640282
1132 2513561322 2513237083 Bacteria 8410967
1133 2513959523 2513237151 Bacteria 6309801
1134 2514046856 2513237166 Bacteria 10373764
1135 2515683293 2515154122 Bacteria 8609520
1136 2515688301 2515154123 Bacteria 6387382
1137 2519457279 2519103095 Bacteria 6629912
1138 2527078463 2526164713 Bacteria 6780608
1139 2563055466 2562617112 Bacteria 10918404
1140 2585292177 2582581311 Bacteria 6763856
1141 2597032403 2596583598 Bacteria 5251611
1142 2599448314 2599185178 Bacteria 5365746
1143 2599738779 2599185239 Bacteria 8686614
1144 2599747611 2599185240 Bacteria 7968121
1145 2600209495 2599185355 Bacteria 7968906
1146 2600814262 2600255067 Bacteria 6795583
1147 2643790800 2643221554 Bacteria 6603920
1148 2643935710 2643221585 Bacteria 5812563
1149 2644211721 2643221638 Bacteria 6579467
1150 2644221945 2643221639 Bacteria 6649903
1151 2644251314 2643221645 Bacteria 7207331
1152 2644317493 2643221656 Bacteria 5809961
1153 2644357486 2643221664 Bacteria 7272945
1154 2676745554 2675903129 Bacteria 7964495
1155 2713478889 2711768613 Bacteria 11048459
1156 2719641937 2718217991 Bacteria 7829542
1157 2735816427 2734482258 Unclassified 2930739
1158 2738740079 2738541280 Bacteria 6630198
1159 2738823053 2738541296 Bacteria 7285013
1160 2738835260 2738541298 Bacteria 7286732
1161 2738844161 2738541300 Bacteria 6675882
1162 2738876739 2738541306 Bacteria 7284992
1163 2739188798 2738543002 Bacteria 7284546
1164 2739223450 2738543008 Bacteria 7282815
1165 2739274279 2738543018 Bacteria 6718814
1166 2739343323 2738543030 Bacteria 6719714
1167 2746086743 2744054900 Bacteria 8399525
1168 2746094142 2744054901 Bacteria 8397047
1169 2753568571 2751185846 Bacteria 7242164
1170 2792839312 2791355137 Bacteria 9654227
1171 2808971310 2808606384 Bacteria 8474373
1172 2809006306 2808606390 Bacteria 8476311
1173 2809013277 2808606391 Bacteria 8308166
1174 2809144230 2808606418 Bacteria 6724496
1175 2817259482 2816332253 Bacteria 6764532
1176 2817277151 2816332256 Bacteria 6891714
1177 2817454065 2816332286 Bacteria 6853759
1178 2819622590 2818991450 Bacteria 6962147
1179 2819634732 2818991452 Bacteria 8442785
1180 2842329079 2842324504 Bacteria 9364110
1181 2842353502 2842348783 Bacteria 9002918
1182 2842459025 2842454564 Bacteria 8730687
1183 2842715566 2842711865 Bacteria 7155354
1184 2856290397 2856287931 Bacteria 7223934
1185 2857359932 2857357740 Bacteria 9937880
1186 2857555888 2857553236 Bacteria 6166726
1187 2857561787 2857558681 Bacteria 6617694
1188 2863425420 2863421361 Bacteria 7300805
1189 2870069660 2870068957 Bacteria 8925310
1190 2883096083 2883087390 Bacteria 9532701
1191 2885269397 2885266251 Bacteria 4796748
1192 2885276190 2885270888 Bacteria 9831543
1193 2900578933 2900577576 Bacteria 5438534
1194 2900636795 2900634093 Bacteria 10263517
1195 2902691643 2902682994 Bacteria 8951596
1196 2904425677 2904424332 Bacteria 7633521
1197 2904488163 2904483920 Bacteria 7545285
1198 2904570169 2904564687 Bacteria 7609577
1199 2904577299 2904571731 Bacteria 7608790
1200 2904617536 2904615490 Bacteria 10047340
1201 2919478231 2919476304 Bacteria 5888696
1202 2919531076 2919527303 Bacteria 7718827
1203 2928060566 2928058823 Bacteria 5520022
1204 2928112687 2928108538 Bacteria 7360024
1205 2928139660 2928135762 Bacteria 7259641
1206 2928163699 2928157003 Bacteria 7522202
1207 2928170548 2928163908 Bacteria 7561269
1208 2928175869 2928170801 Bacteria 8785406
1209 2928508457 2928503688 Bacteria 7268108
1210 2928541512 2928536128 Bacteria 7657547
1211 2945934858 2945934425 Bacteria 7444609
1212 2981995740 2981990288 Bacteria 7590678
1213 2990704565 2990703756 Bacteria 7715990
1214 642425124 641736151 Bacteria 7477263
1215 642416044 641736154 Bacteria 7689995
1216 642594866 642555112 Bacteria 8676562
1217 642623517 642555113 Bacteria 8214658
1218 8003958777 8003955200 Bacteria 8601927
1219 8018848072 8018845410 Bacteria 8933938
1220 8020810272 8020807995 Bacteria 6801506
1221 8020939206 8020938398 Bacteria 7472757
1222 8020948503 8020945358 Bacteria 8467355
1223 8020956264 8020953355 Bacteria 7439080
1224 8021127065 8021120328 Bacteria 8782274
1225 8039100658 8039098773 Bacteria 6602928
1226 8040169578 8040167225 Bacteria 6542727
1227 8040174611 8040173305 Bacteria 6827067
1228 8047679037 8047673197 Bacteria 7395230
1229 8055270757 8055266321 Bacteria 7999742
1230 8055305559 8055301274 Bacteria 8587385
1231 Ga0395901_0000017
1232 JGI24741J21665_1001242
1233 JGI24740J21852_10001764
1234 JGI24740J21852_10004026
1235 JGI24739J22299_10003401
1236 JGI24739J22299_10004196
1237 JGI24737J22298_10003060
1238 JGI24737J22298_10014717
1239 JGI24735J21928_10000065
1240 JGI24735J21928_10000495
1241 JGI24735J21928_10000604
1242 JGI24735J21928_10002748
1243 JGI24735J21928_10004710
1244 JGI24735J21928_10006897
1245 JGI24738J21930_10000758
1246 JGI25156J39149_1002277
1247 JGI25156J39149_1005822
1248 JGI25154J39366_1000553
1249 JGI25154J39366_1002494
1250 JGI25158J39367_1000007
1251 JGI25158J39367_1010914
1252 JGI25152J39213_1000242
1253 JGI25152J39213_1011033
1254 JGI25150J39212_1000487
1255 JGI25150J39212_1005864
1256 JGI25159J45721_1000127
1257 JGI25159J45721_1000340
1258 JGI25159J45721_1001229
1259 JGI25153J46596_10014274
1260 JGI25153J46596_10032011
1261 rootL2_10049059
1262 rootL2_10277707
1263 rootH1_10023956
1264 JGI25160J50197_1000016
1265 JGI25160J50197_1000132
1266 JGI25161J50226_1000105
1267 Ga0007417J51691_1034284
1268 Ga0007410J51695_1042566
1269 Ga0055539_1000541
1270 Ga0055532_1000022
1271 Ga0055532_1000761
1272 Ga0055532_1000786
1273 Ga0055525_1001433
1274 Ga0055527_1000016
1275 Ga0055527_1000604
1276 Ga0055527_1000990
1277 Ga0055535_1000017
1278 Ga0055535_1001501
1279 Ga0055535_1001507
1280 Ga0055535_1001576
1281 Ga0055542_1000030
1282 Ga0055542_1001136
1283 Ga0055542_1001580
1284 Ga0055542_1002027
1285 Ga0055542_1007268
1286 Ga0055529_1000033
1287 Ga0055529_1000688
1288 Ga0055529_1001155
1289 Ga0055526_1000018
1290 Ga0055526_1000053
1291 Ga0055526_1000133
1292 Ga0055526_1000602
1293 Ga0055526_1001869
1294 Ga0055526_1015807
1295 Ga0055537_1000093
1296 Ga0055537_1000191
1297 Ga0055537_1004892
1298 Ga0055524_1000003
1299 Ga0055524_1000192
1300 Ga0055524_1000223
1301 Ga0055524_1006395
1302 Ga0055524_1006501
1303 Ga0055534_1000051
1304 Ga0055534_1000098
1305 Ga0055534_1006053
1306 Ga0055528_1000174
1307 Ga0055528_1009739
1308 Ga0055530_10000262
1309 Ga0055531_10009510
1310 Ga0055541_1001057
1311 Ga0055541_1012002
1312 Ga0058692_1000568
1313 Ga0055543_1000101
1314 Ga0055543_1000136
1315 Ga0065165_1000282
1316 Ga0065165_1000612
1317 Ga0065165_1000677
1318 Ga0065165_1000875
1319 Ga0065165_1001278
1320 Ga0065715_10101354
1321 Ga0070658_10002494
1322 Ga0070658_10033012
1323 Ga0070658_10035402
1324 Ga0070658_10264974
1325 Ga0070682_100061547
1326 Ga0070660_100000108
1327 Ga0070660_100002533
1328 Ga0070660_100068203
1329 Ga0070661_100000892
1330 Ga0070661_100049980
1331 Ga0070659_100000070
1332 Ga0070659_100002030
1333 Ga0070659_100033866
1334 Ga0070667_100009565
1335 Ga0070663_100000463
1336 Ga0070663_100000496
1337 Ga0070663_100003045
1338 Ga0070678_100105428
1339 Ga0070672_100092786
1340 Ga0070665_100178582
1341 Ga0068855_100002049
1342 Ga0068855_100029356
1343 Ga0068855_100109969
1344 Ga0070664_100002094
1345 Ga0068857_100014572
1346 Ga0068854_100000776
1347 Ga0068856_100003674
1348 Ga0068852_100016151
1349 Ga0068859_100457272
1350 Ga0068860_100001092
1351 Ga0068860_100084407
1352 Ga0070717_10013109
1353 Ga0068865_100015058
1354 Ga0097620_100457272
1355 Ga0079104_1008017
1356 Ga0099826_10000002
1357 Ga0105251_10000324
1358 Ga0105251_10000937
1359 Ga0105251_10034380
1360 Ga0105244_10002111
1361 Ga0105244_10004090
1362 Ga0105244_10034717
1363 Ga0105250_10001043
1364 Ga0105240_10002436
1365 Ga0105240_10019691
1366 Ga0105240_10338906
1367 Ga0105242_10021383
1368 Ga0105248_10006077
1369 Ga0105248_10182053
1370 Ga0105237_10001786
1371 Ga0105237_10227872
1372 Ga0105238_10011315
1373 Ga0105238_10066755
1374 Ga0105249_10009272
1375 Ga0105239_10001217
1376 Ga0105239_10201891
1377 Ga0157373_10005365
1378 Ga0157373_10013675
1379 Ga0157373_10119483
1380 Ga0157371_10001831
1381 Ga0157370_10000900
1382 Ga0157370_10001175
1383 Ga0157370_10014987
1384 Ga0157370_10042205
1385 Ga0157369_10000304
1386 Ga0157369_10001395
1387 Ga0157369_10001472
1388 Ga0157369_10009847
1389 Ga0157369_10034147
1390 Ga0157369_10063750
1391 Ga0157369_10105783
1392 Ga0157374_10001412
1393 Ga0157374_10017669
1394 Ga0157378_10033324
1395 Ga0163162_10004078
1396 Ga0163162_10011991
1397 Ga0163162_10034105
1398 Ga0157372_10002150
1399 Ga0157372_10012810
1400 Ga0182008_10023466
1401 Ga0182008_10030084
1402 Ga0157379_10189956
1403 Ga0157376_10168730
1404 Ga0182006_1000040
1405 Ga0182006_1001529
1406 Ga0182007_10031221
1407 Ga0183361_10001
1408 Ga0163161_10012823
1409 Ga0197907_10873026
1410 Ga0206356_10848462
1411 Ga0206351_10868641
1412 Ga0154015_1236554
1413 Ga0213872_10000001
1414 Ga0224712_10000838
1415 Ga0209435_101584
1416 Ga0209436_100028
1417 Ga0209436_100216
1418 Ga0209784_100006
1419 Ga0209784_100753
1420 Ga0209784_101546
1421 Ga0209566_100002
1422 Ga0209566_100244
1423 Ga0209674_100010
1424 Ga0209674_100017
1425 Ga0209674_100176
1426 Ga0209674_100291
1427 Ga0209674_100320
1428 Ga0209674_102227
1429 Ga0209672_100001
1430 Ga0209672_100110
1431 Ga0209672_100115
1432 Ga0209672_100136
1433 Ga0209672_101102
1434 Ga0209147_100018
1435 Ga0209147_100022
1436 Ga0209147_100164
1437 Ga0209147_100215
1438 Ga0209563_100041
1439 Ga0209563_100603
1440 Ga0207427_102931
1441 Ga0209258_100028
1442 Ga0209258_100033
1443 Ga0209258_100261
1444 Ga0209258_100271
1445 Ga0207425_1000001
1446 Ga0207425_1000039
1447 Ga0209646_1000043
1448 Ga0209026_1003044
1449 Ga0209677_100007
1450 Ga0209677_103393
1451 Ga0209148_1000046
1452 Ga0209148_1000104
1453 Ga0209148_1000151
1454 Ga0209148_1000609
1455 Ga0209148_1001656
1456 Ga0209759_1000180
1457 Ga0209759_1000231
1458 Ga0209759_1000568
1459 Ga0209759_1001163
1460 Ga0209759_1001504
1461 Ga0209759_1001749
1462 Ga0209759_1002276
1463 Ga0209759_1026497
1464 Ga0209129_1000001
1465 Ga0209129_1001725
1466 Ga0209233_1000050
1467 Ga0209565_1000017
1468 Ga0209565_1000157
1469 Ga0209565_1000901
1470 Ga0209565_1002806
1471 Ga0209565_1004699
1472 Ga0209565_1004992
1473 Ga0209455_1000038
1474 Ga0209455_1000065
1475 Ga0209455_1000097
1476 Ga0209455_1001610
1477 Ga0209673_1000007
1478 Ga0209673_1000124
1479 Ga0209673_1028792
1480 Ga0209673_1030592
1481 Ga0209130_1000078
1482 Ga0209130_1000189
1483 Ga0209130_1001043
1484 Ga0209130_1003615
1485 Ga0209675_1000009
1486 Ga0209675_1000158
1487 Ga0209675_1001665
1488 Ga0209675_1002349
1489 Ga0209564_1000036
1490 Ga0209564_1000055
1491 Ga0209564_1000068
1492 Ga0209564_1000109
1493 Ga0209564_1000342
1494 Ga0209564_1004204
1495 Ga0209564_1006074
1496 Ga0209564_1008762
1497 Ga0209758_1000020
1498 Ga0209050_1000074
1499 Ga0209050_1006726
1500 Ga0209050_1007129
1501 Ga0209256_1000007
1502 Ga0209256_1000028
1503 Ga0209256_1000167
1504 Ga0209256_1000214
1505 Ga0209256_1002827
1506 Ga0209256_1008481
1507 Ga0207426_1000007
1508 Ga0207426_1000343
1509 Ga0207426_1002201
1510 Ga0207426_1002710
1511 Ga0207426_1012629
1512 Ga0209257_1000003
1513 Ga0207696_1002613
1514 Ga0207655_1005932
1515 Ga0207713_1000064
1516 Ga0207713_1010707
1517 Ga0207688_10130275
1518 Ga0207647_10000160
1519 Ga0207647_10001680
1520 Ga0207647_10002319
1521 Ga0207647_10011447
1522 Ga0207647_10011897
1523 Ga0207705_10000377
1524 Ga0207705_10028057
1525 Ga0207705_10133170
1526 Ga0207695_10000872
1527 Ga0207695_10008234
1528 Ga0207695_10009754
1529 Ga0207695_10011993
1530 Ga0207695_10047753
1531 Ga0207657_10000183
1532 Ga0207657_10024202
1533 Ga0207649_10002344
1534 Ga0207649_10129405
1535 Ga0207694_10019921
1536 Ga0207694_10027835
1537 Ga0207690_10000012
1538 Ga0207690_10007640
1539 Ga0207690_10018067
1540 Ga0207669_10008954
1541 Ga0207704_10005345
1542 Ga0207691_10106253
1543 Ga0207711_10063159
1544 Ga0207679_10000012
1545 Ga0207679_10153330
1546 Ga0207667_10000889
1547 Ga0207667_10003325
1548 Ga0207712_10038851
1549 Ga0207640_10000047
1550 Ga0207658_10039833
1551 Ga0207658_10173798
1552 Ga0207703_10032912
1553 Ga0207678_10000076
1554 Ga0207678_10001558
1555 Ga0207678_10004352
1556 Ga0207678_10008226
1557 Ga0207678_10032652
1558 Ga0207702_10001737
1559 Ga0207702_10052435
1560 Ga0207648_10001123
1561 Ga0207674_10020244
1562 Ga0207674_10073877
1563 Ga0207675_100166478
1564 Ga0207683_10147890
1565 Ga0207698_10031168
1566 Ga0209281_1002903
1567 Ga0209371_1000185
1568 Ga0209371_1008576
1569 Ga0209282_1000001
1570 Ga0268264_10007100
1571 Ga0265338_10000187
1572 Ga0265338_10000590
1573 Ga0268256_1000211
1574 Ga0268256_1005547
1575 Ga0316177_1084301
1576 Ga0316180_1145736
1577 Ga0316181_1071815
1578 Ga0316182_1005578
1579 Ga0307408_100000126
1580 Ga0307408_100000463
1581 Ga0307408_100001241
1582 Ga0307408_100149765
1583 Ga0307412_10000011
1584 Ga0307416_100025826
1585 Ga0307416_100057331
1586 Ga0307414_10048541
1587 Ga0307411_10006659
1588 Ga0307411_10109399
1589 Ga0373925_0001962
1590 Ga0395899_0000093
1591 Ga0395899_0000149
1592 Ga0395899_0000802
1593 Ga0395899_0057731
1594 Ga0395899_0127966
1595 Ga0395900_0000169
1596 Ga0395900_0001006
1597 Ga0395900_0013095
1598 Ga0395900_0030583
1599 Ga0395900_0036169
1600 Ga0395900_0048251
1601 Ga0395900_0063130
1602 Ga0395900_0064826
1603 Ga0395900_0364682
1604 Ga0395898_0000338
1605 Ga0395898_0006942
1606 Ga0395898_0053289
1607 Ga0395898_0067730
1608 Ga0395898_0082800
1609 Ga0395898_0094911
1610 Ga0395905_0000079
1611 Ga0395905_0000249
1612 Ga0395905_0021786
1613 Ga0395905_0260691
1614 Ga0395901_0000084
1615 Ga0395901_0001099
1616 Ga0395901_0009132
1617 Ga0395901_0165706
1618 Ga0436365_0245511
1619 Ga0436361_0093744
1620 Ga0436361_1185928
1621 Ga0439448_0000325
1622 Ga0450897_001105
1623 Ga0450899_010921
1624 Ga0450904_000600
1625 Ga0451577_0009948
1626 Ga0451577_0033475
1627 Ga0451577_0069542
1628 Ga0466969_0014035
1629 Ga0466969_0084910
1630 Ga0466972_0018823
1631 Ga0453683_0016909
1632 Ga0466966_0000277
1633 Ga0466966_0002148
1634 Ga0466966_0002376
1635 Ga0466966_0008254
1636 Ga0466966_0010101
1637 Ga0466966_0017218
1638 Ga0466966_0020096
1639 Ga0466966_0043405
1640 Ga0466966_0127820
1641 Ga0466961_0000344
1642 Ga0466961_0004968
1643 Ga0466961_0007588
1644 Ga0466963_0000554
1645 Ga0466964_0002478
1646 Ga0453684_0000193
1647 Ga0453684_0002276
1648 Ga0453684_0021760
1649 Ga0453684_0023287
1650 Ga0466971_0000270
1651 Ga0466971_0006464
1652 Ga0466968_0005379
1653 Ga0466968_0010283
1654 Ga0466970_0004253
1655 Ga0466957_0001982
1656 Ga0466957_0056022
1657 Ga0466960_0029263
1658 Ga0466960_0091677
1659 Ga0466959_0007383
1660 Ga0451576_0003152
1661 Ga0451576_0004673
1662 Ga0451576_0009113
1663 Ga0451576_0035379
1664 Ga0451576_0231898
1665 Ga0466958_0007390
1666 Ga0466958_0009629
1667 Ga0495617_000002
1668 Ga0495617_000003
1669 Ga0495617_000210
1670 Ga0495617_001586
1671 Ga0495627_000001
1672 Ga0495627_000176
1673 Ga0495627_003352
1674 Ga0495627_015484
1675 Ga0495592_0005288
1676 Ga0495592_0014560
1677 Ga0495603_0000867
1678 Ga0495603_0027090
1679 Ga0495603_0043618
1680 Ga0495590_0000001
1681 Ga0495590_0000044
1682 Ga0495590_0004382
1683 Ga0495590_0006826
1684 Ga0495590_0009964
1685 Ga0495591_000052
1686 Ga0495591_001869
1687 Ga0495591_009331
1688 Ga0495629_0000178
1689 Ga0495629_0000285
1690 Ga0495629_0001888
1691 Ga0495629_0002120
1692 Ga0495629_0003648
1693 Ga0495629_0021875
1694 Ga0495629_0032812
1695 Ga0495638_0000017
1696 Ga0495638_0000945
1697 Ga0495638_0006104
1698 Ga0495638_0007524
1699 Ga0495638_0016040
1700 Ga0495638_0127793
1701 Ga0495641_0005571
1702 Ga0495651_0011625
1703 Ga0495651_0015143
1704 Ga0495651_0125527
1705 Ga0495653_0002764
1706 Ga0495653_0003463
1707 Ga0495653_0038731
1708 Ga0495653_0049525
1709 Ga0495653_0080085
1710 Ga0495653_0166329
1711 Ga0495650_0000456
1712 Ga0495650_0000806
1713 Ga0495650_0004206
1714 Ga0495650_0011361
1715 Ga0495650_0015319
1716 Ga0495650_0021095
1717 Ga0495580_0000001
1718 Ga0495580_0010297
1719 Ga0495580_0011524
1720 Ga0495580_0131327
1721 Ga0495582_0001582
1722 Ga0495582_0004982
1723 Ga0495582_0005649
1724 Ga0495582_0013662
1725 Ga0495582_0030386
1726 Ga0495605_0000028
1727 Ga0495605_0000081
1728 Ga0495605_0000087
1729 Ga0495605_0002871
1730 Ga0495605_0003749
1731 Ga0495605_0009089
1732 Ga0495605_0009309
1733 Ga0495605_0011963
1734 Ga0495605_0012019
1735 Ga0495605_0014479
1736 Ga0495605_0042078
1737 Ga0495605_0082788
1738 Ga0495664_0001897
1739 Ga0495664_0018631
1740 Ga0495664_0268186
1741 Ga0495584_0000011
1742 Ga0495584_0000057
1743 Ga0495584_0000460
1744 Ga0495584_0002846
1745 Ga0495584_0003929
1746 Ga0495584_0005971
1747 Ga0495584_0006863
1748 Ga0495584_0014505
1749 Ga0495584_0022193
1750 Ga0495584_0022301
1751 Ga0495584_0023259
1752 Ga0495584_0036884
1753 Ga0495584_0050473
1754 Ga0495585_0000004
1755 Ga0495585_0000814
1756 Ga0495585_0000863
1757 Ga0495585_0006024
1758 Ga0495585_0008368
1759 Ga0495585_0008688
1760 Ga0495585_0014155
1761 Ga0495585_0016163
1762 Ga0495585_0037637
1763 Ga0495585_0089551
1764 Ga0495594_0002589
1765 Ga0495594_0003551
1766 Ga0495594_0010723
1767 Ga0495594_0018124
1768 Ga0495594_0183424
1769 Ga0495596_0000633
1770 Ga0495596_0001840
1771 Ga0495596_0004150
1772 Ga0495596_0006018
1773 Ga0495596_0006065
1774 Ga0495596_0008424
1775 Ga0495596_0009225
1776 Ga0495596_0011133
1777 Ga0495596_0030815
1778 Ga0495596_0030977
1779 Ga0495607_0002567
1780 Ga0495607_0003451
1781 Ga0495607_0005170
1782 Ga0495607_0007144
1783 Ga0495607_0010718
1784 Ga0495607_0015241
1785 Ga0495607_0031243
1786 Ga0495607_0032512
1787 Ga0495607_0034340
1788 Ga0495607_0043436
1789 Ga0495607_0058904
1790 Ga0495583_0000050
1791 Ga0495583_0000067
1792 Ga0495583_0000241
1793 Ga0495583_0000430
1794 Ga0495583_0001408
1795 Ga0495583_0001716
1796 Ga0495583_0003837
1797 Ga0495583_0010073
1798 Ga0495583_0010118
1799 Ga0495583_0015715
1800 Ga0495583_0022997
1801 Ga0495583_0028050
1802 Ga0495583_0049103
1803 Ga0495583_0062359
1804 Ga0495583_0073904
1805 Ga0495583_0076467
1806 Ga0495606_0000563
1807 Ga0495606_0000820
1808 Ga0495606_0003201
1809 Ga0495606_0003747
1810 Ga0495606_0006662
1811 Ga0495606_0011903
1812 Ga0495606_0012318
1813 Ga0495606_0027799
1814 Ga0495606_0028347
1815 Ga0495606_0048740
1816 Ga0495606_0049990
1817 Ga0495606_0062801
1818 Ga0495606_0235338
1819 Ga0495608_0009419
1820 Ga0495608_0017053
1821 Ga0495610_0000506
1822 Ga0495610_0005396
1823 Ga0495610_0006646
1824 Ga0495610_0024568
1825 Ga0495610_0043323
1826 Ga0495610_0090828
1827 Ga0495616_0000218
1828 Ga0495616_0001339
1829 Ga0495616_0002294
1830 Ga0495616_0004089
1831 Ga0495616_0006247
1832 Ga0495616_0006363
1833 Ga0495616_0013987
1834 Ga0495616_0017342
1835 Ga0495618_0007168
1836 Ga0495618_0013665
1837 Ga0495618_0017662
1838 Ga0495620_0022583
1839 Ga0495628_0001900
1840 Ga0495628_0032607
1841 Ga0495628_0117777
1842 Ga0495628_0161007
1843 Ga0495630_0007017
1844 Ga0495630_0014192
1845 Ga0495630_0051251
1846 Ga0495630_0182640
1847 Ga0495631_0000556
1848 Ga0495631_0002191
1849 Ga0495631_0005244
1850 Ga0495631_0006335
1851 Ga0495631_0008026
1852 Ga0495631_0012942
1853 Ga0495631_0021299
1854 Ga0495631_0030852
1855 Ga0495631_0037413
1856 Ga0495631_0037447
1857 Ga0495631_0063583
1858 Ga0495632_0000040
1859 Ga0495632_0000114
1860 Ga0495632_0002437
1861 Ga0495632_0007437
1862 Ga0495632_0008625
1863 Ga0495632_0011980
1864 Ga0495632_0012370
1865 Ga0495632_0089230
1866 Ga0495637_0000006
1867 Ga0495637_0002126
1868 Ga0495637_0009761
1869 Ga0495637_0013100
1870 Ga0495643_0000028
1871 Ga0495643_0000192
1872 Ga0495643_0000285
1873 Ga0495643_0002723
1874 Ga0495643_0004024
1875 Ga0495643_0009197
1876 Ga0495643_0017628
1877 Ga0495643_0037000
1878 Ga0495643_0155334
1879 Ga0495644_0001463
1880 Ga0495644_0007508
1881 Ga0495644_0010273
1882 Ga0495644_0018694
1883 Ga0495644_0037979
1884 Ga0495648_0000001
1885 Ga0495648_0000802
1886 Ga0495648_0001359
1887 Ga0495648_0003099
1888 Ga0495648_0007560
1889 Ga0495648_0011159
1890 Ga0495648_0014398
1891 Ga0495648_0020179
1892 Ga0495648_0045197
1893 Ga0495648_0047136
1894 Ga0495648_0067678
1895 Ga0495648_0092890
1896 Ga0495663_0003544
1897 Ga0495666_0001627
1898 Ga0495666_0002374
1899 Ga0495666_0006592
1900 Ga0495666_0008866
1901 Ga0495666_0015604
1902 Ga0495642_0000813
1903 Ga0495642_0001190
1904 Ga0495642_0002336
1905 Ga0495642_0002344
1906 Ga0495642_0002537
1907 Ga0495642_0004410
1908 Ga0495642_0005459
1909 Ga0495642_0006314
1910 Ga0495642_0006627
1911 Ga0495642_0006928
1912 Ga0495642_0046984
1913 Ga0495652_0013316
1914 Ga0495652_0054241
1915 Ga0495654_0005270
1916 Ga0495654_0013309
1917 Ga0495654_0017765
1918 Ga0495665_0006958
1919 Ga0495665_0007081
1920 Ga0495665_0009119
1921 Ga0495665_0051567
1922 Ga0495665_0073064
1923 Ga0495640_0004099
1924 Ga0495640_0005465
1925 Ga0495640_0008491
1926 Ga0495640_0032792
1927 Ga0495586_0019439
1928 Ga0495586_0039934
1929 Ga0495587_0018997
1930 Ga0495609_0000096
1931 Ga0495609_0000110
1932 Ga0495609_0000497
1933 Ga0495609_0001124
1934 Ga0495609_0001475
1935 Ga0495609_0005063
1936 Ga0495609_0007366
1937 Ga0495609_0008283
1938 Ga0495609_0028135
1939 Ga0495609_0079776
1940 Ga0495597_0000459
1941 Ga0495597_0000579
1942 Ga0495597_0000587
1943 Ga0495597_0002689
1944 Ga0495597_0007925
1945 Ga0495597_0011861
1946 Ga0495645_0003031
1947 Ga0495645_0095089
1948 Ga0495622_0000075
1949 Ga0495622_0000131
1950 Ga0495622_0016534
1951 Ga0495622_0016605
1952 Ga0495622_0019672
1953 Ga0495622_0020634
1954 Ga0495622_0045703
1955 Ga0495633_0000106
1956 Ga0495633_0001152
1957 Ga0495633_0001289
1958 Ga0495633_0001422
1959 Ga0495633_0002045
1960 Ga0495633_0002751
1961 Ga0495633_0006201
1962 Ga0495667_0027758
1963 Ga0495667_0119081
1964 Ga0495656_0003042
1965 Ga0495656_0027660
1966 Ga0495656_0057445
1967 Ga0495668_0000018
1968 Ga0495668_0000686
1969 Ga0495668_0001608
1970 Ga0495668_0002567
1971 Ga0495668_0008369
1972 Ga0495668_0009745
1973 Ga0495668_0030115
1974 Ga0495668_0030610
1975 Ga0495668_0032574
1976 Ga0495668_0055641
1977 Ga0495668_0062633
1978 Ga0495668_0144427
1979 Ga0495634_0001455
1980 Ga0495634_0013434
1981 Ga0495634_0036626
1982 Ga0495611_0000376
1983 Ga0495611_0000476
1984 Ga0495611_0001009
1985 Ga0495611_0003480
1986 Ga0495611_0004540
1987 Ga0495611_0005280
1988 Ga0495611_0009665
1989 Ga0495611_0015041
1990 Ga0495611_0015073
1991 Ga0495611_0022450
1992 Ga0495611_0040260
1993 Ga0495625_0000035
1994 Ga0495625_0002479
1995 Ga0495625_0005030
1996 Ga0495625_0022401
1997 Ga0495625_0034649
1998 Ga0495625_0040226
1999 Ga0495625_0043584
2000 Ga0495625_0059374
2001 Ga0495625_0117308
2002 Ga0495625_0166865
2003 Ga0495635_0001789
2004 Ga0495635_0013372
2005 Ga0495635_0022968
2006 Ga0495659_0000052
2007 Ga0495659_0000529
2008 Ga0495661_0000164
2009 Ga0495661_0003522
2010 Ga0495661_0006009
2011 Ga0495661_0014949
2012 Ga0495661_0015784
2013 Ga0495661_0025238
2014 Ga0495661_0037776
2015 Ga0495661_0041408
2016 Ga0495661_0058289
2017 Ga0495661_0115723
2018 Ga0495588_0000070
2019 Ga0495588_0005552
2020 Ga0495588_0040498
2021 Ga0495588_0053203
2022 Ga0495588_0102827
2023 Ga0495599_0002742
2024 Ga0495599_0021770
2025 Ga0495623_0001396
2026 Ga0495623_0019259
2027 Ga0495623_0024796
2028 Ga0495623_0028769
2029 Ga0495623_0140067
2030 Ga0495646_0001118
2031 Ga0495646_0016250
2032 Ga0495646_0032109
2033 Ga0495646_0033623
2034 Ga0495646_0041268
2035 Ga0495647_0015333
2036 Ga0495669_0000098
2037 Ga0495669_0000122
2038 Ga0495669_0000598
2039 Ga0495669_0008372
2040 Ga0495669_0010848
2041 Ga0495669_0026673
2042 Ga0495613_0003533
2043 Ga0495613_0003579
2044 Ga0495613_0013125
2045 Ga0495613_0017802
2046 Ga0495624_0005465
2047 Ga0495624_0015533
2048 Ga0495624_0018907
2049 Ga0495624_0027815
2050 Ga0495624_0072286
2051 Ga0495670_0000604
2052 Ga0495670_0000716
2053 Ga0495670_0002986
2054 Ga0495670_0006409
2055 Ga0495670_0028216
2056 Ga0495670_0030634
2057 Ga0495670_0070736
2058 Ga0495670_0079364
2059 Ga0495671_0000128
2060 Ga0495671_0000132
2061 Ga0495671_0014662
2062 Ga0495671_0018445
2063 Ga0495671_0020725
2064 Ga0495671_0026082
2065 Ga0495671_0035134
2066 Ga0495671_0036103
2067 Ga0495649_0001317
2068 Ga0495649_0004297
2069 Ga0495649_0004408
2070 Ga0495649_0016046
2071 Ga0495649_0029298
2072 Ga0495649_0049349
2073 Ga0495649_0052366
2074 Ga0495649_0114136
2075 Ga0495589_0000036
2076 Ga0495589_0000092
2077 Ga0495589_0001941
2078 Ga0495589_0002400
2079 Ga0495589_0002441
2080 Ga0495589_0011466
2081 Ga0495589_0016187
2082 Ga0495589_0022789
2083 Ga0495589_0035130
2084 Ga0495589_0096429
2085 Ga0495600_0000510
2086 Ga0495600_0005990
2087 Ga0495600_0148196
2088 Ga0495660_0000117
2089 Ga0495660_0000839
2090 Ga0495660_0002463
2091 Ga0495660_0003009
2092 Ga0495660_0003124
2093 Ga0495660_0008761
2094 Ga0495660_0009567
2095 Ga0495660_0010570
2096 Ga0495660_0022679
2097 Ga0495660_0023686
2098 Ga0495660_0055809
2099 Ga0495581_0004434
2100 Ga0495581_0004715
2101 Ga0495581_0016557
2102 Ga0495581_0093981
2103 Ga0495604_0000854
2104 Ga0495604_0005257
2105 Ga0495604_0007320
2106 Ga0495604_0017852
2107 Ga0495604_0037992
2108 Ga0495604_0072199
2109 Ga0495604_0128199
2110 Ga0495636_0000126
2111 Ga0495636_0007400
2112 Ga0495636_0010263
2113 Ga0495636_0012275
2114 Ga0495636_0034643
2115 Ga0495636_0067059
2116 Ga0495674_0024972
2117 Ga0495674_0039283
2118 Ga0495674_0062982
2119 Ga0495674_0080830
2120 Ga0495674_0112723
2121 Ga0495674_0131503
2122 Ga0495674_0230197
2123 Ga0495672_0000066
2124 Ga0495672_0000086
2125 Ga0495672_0000349
2126 Ga0495672_0000400
2127 Ga0495672_0000556
2128 Ga0495672_0002183
2129 Ga0495672_0003253
2130 Ga0495672_0003913
2131 Ga0495672_0013316
2132 Ga0495672_0021041
2133 Ga0495672_0026319
2134 Ga0495676_0000035
2135 Ga0495676_0006502
2136 Ga0495676_0009421
2137 Ga0495676_0033173
2138 Ga0495680_0015543
2139 Ga0495680_0017177
2140 Ga0495680_0032120
2141 Ga0495680_0034256
2142 Ga0495680_0053360
2143 Ga0495680_0260151
2144 Ga0495683_0000080
2145 Ga0495683_0000576
2146 Ga0495683_0002800
2147 Ga0495683_0005543
2148 Ga0495683_0006408
2149 Ga0495683_0009633
2150 Ga0495683_0012554
2151 Ga0495683_0037783
2152 Ga0495683_0047557
2153 Ga0495683_0059501
2154 Ga0495683_0063414
2155 Ga0495687_000053
2156 Ga0495687_000074
2157 Ga0495687_000154
2158 Ga0495687_000946
2159 Ga0495687_001241
2160 Ga0495687_002558
2161 Ga0495687_002852
2162 Ga0495687_003354
2163 Ga0495687_005143
2164 Ga0495687_005425
2165 Ga0495687_015073
2166 Ga0495687_065664
2167 Ga0495675_0008503
2168 Ga0495675_0009650
2169 Ga0495675_0017405
2170 Ga0495675_0022719
2171 Ga0495675_0213444
2172 Ga0495677_0000037
2173 Ga0495677_0000214
2174 Ga0495677_0001397
2175 Ga0495677_0001947
2176 Ga0495677_0002817
2177 Ga0495677_0003246
2178 Ga0495677_0006506
2179 Ga0495677_0006565
2180 Ga0495677_0044671
2181 Ga0495679_000156
2182 Ga0495679_000453
2183 Ga0495679_000509
2184 Ga0495679_005672
2185 Ga0495679_013858
2186 Ga0495685_000011
2187 Ga0495685_001153
2188 Ga0495685_006655
2189 Ga0495685_011400
2190 Ga0495685_064024
2191 Ga0495673_0000035
2192 Ga0495673_0011035
2193 Ga0495673_0011984
2194 Ga0495673_0025556
2195 Ga0495673_0097075
2196 Ga0495681_0006038
2197 Ga0495681_0006668
2198 Ga0495681_0007470
2199 Ga0495681_0010931
2200 Ga0495681_0013150
2201 Ga0495681_0016636
2202 Ga0495681_0018349
2203 Ga0495681_0056618
2204 Ga0495684_0012061
2205 Ga0495684_0032107
2206 Ga0495686_0000374
2207 Ga0495686_0000987
2208 Ga0495686_0001443
2209 Ga0495686_0031754
2210 Ga0495686_0102380
2211 Ga0495593_0001403
2212 Ga0495593_0002194
2213 Ga0495593_0006680
2214 Ga0495593_0007353
2215 Ga0495593_0007784
2216 Ga0495593_0015255
2217 Ga0495593_0018108
2218 Ga0495593_0018949
2219 Ga0495602_0012983
2220 Ga0495602_0030419
2221 Ga0495602_0044457
2222 Ga0495602_0092244
2223 Ga0495614_0000783
2224 Ga0495614_0005325
2225 Ga0495614_0010341
2226 Ga0495615_0001382
2227 Ga0495626_0000006
2228 Ga0495626_0004153
2229 Ga0495626_0005034
2230 Ga0495626_0007142
2231 Ga0495626_0007834
2232 Ga0495626_0008937
2233 Ga0495626_0011758
2234 Ga0495626_0012887
2235 Ga0495626_0014301
2236 Ga0495626_0014308
2237 Ga0495626_0014620
2238 Ga0495626_0017883
2239 Ga0495626_0021946
2240 Ga0495626_0029228
2241 Ga0495626_0048408
2242 Ga0495626_0050272
2243 Ga0496100_0060197
2244 Ga0496101_0031754
2245 Ga0496102_0000253
2246 Ga0496102_0001543
2247 Ga0496102_0027708
2248 Ga0496102_0067864
2249 Ga0496103_0002496
2250 Ga0496103_0005279
2251 Ga0496103_0012509
2252 Ga0496103_0015687
2253 Ga0496103_0068660
2254 Ga0496104_0060011
2255 Ga0496105_0085793
2256 Ga0496105_0203378
2257 Ga0496106_0000432
2258 Ga0496106_0037342
2259 Ga0496106_0228507
2260 Ga0496107_0031164
2261 Ga0496107_0043503
2262 Ga0496108_0150383
2263 Ga0496109_0591084
2264 Ga0496110_0001139
2265 Ga0496110_0025312
2266 Ga0496111_0016215
2267 Ga0496112_0025900
2268 Ga0496112_0279718
2269 Ga0496113_0011257
2270 Ga0496113_0015185
2271 Ga0496114_0078837
2272 Ga0496114_0179791
2273 Ga0496115_0013062
2274 Ga0496115_0170008
2275 Ga0496116_0011621
2276 Ga0496116_0027112
2277 Ga0496117_0002566
2278 Ga0496117_0005210
2279 Ga0496117_0007716
2280 Ga0496117_0067616
2281 Ga0496118_0002656
2282 Ga0496118_0004550
2283 Ga0496118_0056467
2284 Ga0496118_0118332
2285 Ga0496121_0002254
2286 Ga0496121_0006277
2287 Ga0496121_0012852
2288 Ga0496121_0021795
2289 Ga0496121_0165506
2290 Ga0496122_0005543
2291 Ga0496122_0010101
2292 Ga0496122_0072569
2293 Ga0496123_0009734
2294 Ga0496124_0000079
2295 Ga0496124_0015326
2296 Ga0496124_0018387
2297 Ga0496124_0026346
2298 Ga0496125_0036903
2299 Ga0496125_0047293
2300 Ga0496126_0000118
2301 Ga0496126_0001912
2302 Ga0496126_0004117
2303 Ga0496126_0007469
2304 Ga0496126_0012774
2305 Ga0496126_0117942
2306 Ga0495678_000002
2307 Ga0495678_000029
2308 Ga0495678_000064
2309 Ga0495678_001683
2310 Ga0495678_002660
2311 Ga0495678_018210
2312 Ga0495682_0000592
2313 Ga0495682_0000726
2314 Ga0495682_0012560
2315 Ga0501292_002034
2316 Ga0501297_004592
2317 Ga0501300_005419
2318 Ga0501039_0044216
2319 Ga0501043_0000072
2320 Ga0501046_0000112
2321 Ga0501047_0000138
2322 Ga0501048_0001221
2323 Ga0501075_0121025
2324 Ga0501201_000825
2325 Ga0501207_003795
2326 Ga0501211_000079
2327 Ga0501222_001066
2328 Ga0501227_006353
2329 Ga0501233_000690
2330 Ga0501249_006134
2331 Ga0501253_015142
2332 Ga0501255_000839
2333 Ga0501221_000470
2334 Ga0501232_003431
2335 Ga0501262_000761
2336 Ga0501262_002795
2337 Ga0501265_002219
2338 Ga0501269_000010
2339 Ga0501272_000733
2340 Ga0501274_000666
2341 Ga0501279_002908
2342 Ga0501279_009393
2343 Ga0501044_0278396
2344 Ga0501045_0001874
2345 Ga0500618_025783
2346 Ga0500586_000998
2347 Ga0587072_001186
2348 Ga0466962_0000108
2349 Ga0466962_0000704
2350 Ga0466962_0001877
2351 Ga0466962_0005173
2352 2501074628
2353 2501078321
2354 2501410090
2355 2509128021
2356 2510252836
2357 2511090027
2358 2511095412
2359 2511105070
2360 2512346926
2361 2513556048
2362 2513561322
2363 2513959523
2364 2514046856
2365 2515683293
2366 2515688301
2367 2519457279
2368 2527078463
2369 2563055466
2370 2585292177
2371 2597032403
2372 2599448314
2373 2599738779
2374 2599747611
2375 2600209495
2376 2600814262
2377 2643790800
2378 2643935710
2379 2644211721
2380 2644221945
2381 2644251314
2382 2644317493
2383 2644357486
2384 2676745554
2385 2713478889
2386 2719641937
2387 2735816427
2388 2738740079
2389 2738823053
2390 2738835260
2391 2738844161
2392 2738876739
2393 2739188798
2394 2739223450
2395 2739274279
2396 2739343323
2397 2746086743
2398 2746094142
2399 2753568571
2400 2792839312
2401 2808971310
2402 2809006306
2403 2809013277
2404 2809144230
2405 2817259482
2406 2817277151
2407 2817454065
2408 2819622590
2409 2819634732
2410 2842329079
2411 2842353502
2412 2842459025
2413 2842715566
2414 2856290397
2415 2857359932
2416 2857555888
2417 2857561787
2418 2863425420
2419 2870069660
2420 2883096083
2421 2885269397
2422 2885276190
2423 2900578933
2424 2900636795
2425 2902691643
2426 2904425677
2427 2904488163
2428 2904570169
2429 2904577299
2430 2904617536
2431 2919478231
2432 2919531076
2433 2928060566
2434 2928112687
2435 2928139660
2436 2928163699
2437 2928170548
2438 2928175869
2439 2928508457
2440 2928541512
2441 2945934858
2442 2981995740
2443 2990704565
2444 642425124
2445 642416044
2446 642594866
2447 642623517
2448 8003958777
2449 8018848072
2450 8020810272
2451 8020939206
2452 8020948503
2453 8020956264
2454 8021127065
2455 8039100658
2456 8040169578
2457 8040174611
2458 8047679037
2459 8055270757
2460 8055305559

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04107

GCS2

Glutamate-cysteine ligase family 2(GCS2)

47

325

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tt4-assembly1.cif.gz_B structure of np459575, a predicted glutathione synthase from salmonella typhimurium 0.9639 6 369
1r8g-assembly1.cif.gz_B structure and function of ybdk 0.9618 3 369
1tt4-assembly1.cif.gz_B structure of np459575, a predicted glutathione synthase from salmonella typhimurium 0.956 6 369
1r8g-assembly1.cif.gz_B structure and function of ybdk 0.9539 3 369
1r8g-assembly1.cif.gz_A structure and function of ybdk 0.9473 3 369
ID Description Score Start End Superfamily
1r8gA00 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9437 3 369 3.30.590.20
1r8gA00 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9384 3 369 3.30.590.20
af_P9WPK9_8_375_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9381 5 369 3.30.590.20
af_P9WPK9_8_375_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9258 5 369 3.30.590.20
af_I6YCS6_35_480_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.7932 13 356 3.30.590.20
ID Description Score Start End GO Terms
AF-A0A1C6R0V2-F1-model_v4 Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) 0.9894 1 373 GO:0004357
GO:0005524
GO:0042398
AF-A0A7L5Y800-F1-model_v4 Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) 0.9878 2 373 GO:0004357
GO:0005524
GO:0016020
GO:0042398
AF-A0A520DV78-F1-model_v4 Glutamate--cysteine ligase 0.9876 195 369 GO:0004357
GO:0042398
AF-A0A4Q3PB65-F1-model_v4 deleted 0.9875 1 94
AF-A0A645A4B0-F1-model_v4 Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) 0.9865 151 372 GO:0004357
GO:0042398

Map