F491998
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1231 | 814 | 2462 | 256 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2511231004|2511255533 |
| Length | 306 |
| Sequence | KNAPRFFRYYASSFFAGKPRSYRGASQIDDRFWCPRWGRLYSSYDWMEKMKRLEEKSALITGSARGIGRSFAQAYIREGATVAIADINLERAQATAAELGPNAYAVEMNVTDQQSIDGAIAAVIATTGKLDILINNAALFDLAPITEISRDSYERLFSINVSGTLFTLQAAAKQMIRQGHGGKIINMASQAGRRGEALVAVYCATKAAVISLTQSAGLNLIPHHINVNAIAPGVVDGEHWDGVDALFAKYENRPLGEKKRLAGQEVPYGRMGTADDLVGMAIFLASAESDYIVAQTYNVDGGNWMS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 6 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 44 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 45 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 46 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 47 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 55 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 56 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 57 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 84 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 85 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 88 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 89 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 90 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 91 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 93 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 94 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 136 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 145 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 146 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 151 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 152 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 154 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 168 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 169 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 170 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 181 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 182 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 183 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 184 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 185 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 186 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 187 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 188 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 189 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 190 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 191 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 192 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 193 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 194 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 195 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 196 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 197 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 198 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 199 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 200 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 201 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 202 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 203 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 204 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 205 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 206 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 207 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 208 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 276 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 277 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 278 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 281 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 319 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 324 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 325 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 327 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 328 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 329 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 330 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 331 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 332 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 334 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 336 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 337 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 338 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 339 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 340 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 343 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 344 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 346 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 355 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 356 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 357 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 358 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 359 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 360 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 361 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 362 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 363 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 364 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 365 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 366 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 367 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 368 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 369 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 370 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 371 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 372 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 373 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 374 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 375 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 376 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 377 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 378 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 379 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 380 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 381 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 382 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 383 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 384 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 385 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 386 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 387 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 388 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 389 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 390 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 391 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 392 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 393 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 394 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 395 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 396 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 397 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 398 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 399 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 400 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 401 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 402 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 403 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 404 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 405 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 406 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 407 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 408 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 409 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 410 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 411 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 412 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 413 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 414 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 415 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 416 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 417 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 418 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 419 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 420 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 421 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 422 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 423 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 424 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 425 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 426 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 427 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 428 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 429 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 430 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 431 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 432 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 433 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 434 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 435 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 436 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 437 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 438 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 439 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 440 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 441 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 442 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 443 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 444 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 445 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 446 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 447 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 448 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 449 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 450 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 451 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 452 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 453 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 454 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 455 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 456 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 457 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 458 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 459 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 460 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 461 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 462 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 463 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 464 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 465 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 466 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 467 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 468 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 469 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 470 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 471 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 472 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 473 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 474 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 475 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 476 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 477 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 478 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 479 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 480 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 481 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 482 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 483 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 484 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 485 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 486 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 487 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 488 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 489 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 490 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 491 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 492 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 493 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 494 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 495 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 496 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 497 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 498 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 499 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 500 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 501 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 502 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 503 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 504 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 505 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 506 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 507 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 508 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 509 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 510 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 511 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 512 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 513 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 514 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 515 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 516 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 517 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 518 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 519 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 520 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 521 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 522 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 523 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 524 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 525 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 526 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 527 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 528 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 529 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 530 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 531 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 532 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 533 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 534 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 535 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 536 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 537 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 538 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 539 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 540 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 541 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 542 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 543 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 544 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 545 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 546 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 547 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 548 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 549 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 550 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 551 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 552 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 553 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 554 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 555 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 556 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 557 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 558 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 559 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 560 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 561 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 562 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 563 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 564 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 565 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 566 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 567 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 568 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 569 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 570 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 571 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 572 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 573 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 574 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 575 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 576 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 577 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 578 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 579 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 580 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 581 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 582 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 583 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 584 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 585 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 586 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 587 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 588 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 589 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 590 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 591 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 592 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 593 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 594 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 595 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 596 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 597 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 598 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 599 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 600 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 601 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 602 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 603 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 604 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 605 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 606 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 607 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 608 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 609 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 610 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 611 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 612 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 613 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 614 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 615 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 616 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 617 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 618 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 619 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 620 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 621 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 622 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 623 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 624 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 625 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 626 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 627 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 628 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 629 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 630 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 631 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 632 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 633 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 634 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 635 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 636 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 637 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 638 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 639 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 640 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 641 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 642 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 643 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 644 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 645 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 646 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 647 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 648 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 649 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 650 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 651 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 652 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 653 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 654 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 655 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 656 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 657 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 658 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 659 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 660 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 661 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 662 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 663 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 664 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 665 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 666 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 667 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 668 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 669 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 670 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 671 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 672 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 673 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 674 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 675 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 676 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 677 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 678 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 679 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 680 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 681 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 682 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 683 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 684 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 685 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 686 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 687 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 688 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 689 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 690 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 691 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 692 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 693 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 694 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 695 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 696 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 697 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 698 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 699 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 700 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 701 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 702 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 703 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 704 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 705 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 706 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 707 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 708 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 709 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 710 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 711 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 712 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 713 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 714 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 715 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 716 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 717 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 718 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 719 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 720 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 721 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 722 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 723 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 724 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 725 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 726 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 727 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 728 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 729 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 730 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 731 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 732 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 733 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 734 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 735 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 736 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 737 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 738 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 739 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 740 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 741 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 742 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 743 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 744 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 745 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 746 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 747 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 748 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 749 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 750 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 751 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 752 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 753 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 754 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 755 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 756 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 757 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 758 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 759 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 760 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 761 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 762 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 763 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 764 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 765 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 766 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 767 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 768 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 769 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 770 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 771 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 772 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 773 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 774 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 775 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 776 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 777 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 778 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 779 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 780 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 781 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 782 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 783 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 784 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 785 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 786 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 787 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 788 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 789 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 790 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 791 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 792 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 793 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 794 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 795 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 796 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 797 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 798 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 799 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 800 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 801 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 802 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 803 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 804 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 805 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 806 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 807 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 808 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 809 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 810 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 811 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 812 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 813 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 814 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 61.98 |
| Metatranscriptomes | 0.49 |
| Isolates | 37.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.16 |
| Bulb | 0 |
| Endosphere | 8.61 |
| Nodule | 22.99 |
| Rhizoplane | 3.41 |
| Rhizosphere | 51.1 |
| Stem | 0 |
| Stem Tuber | 0.08 |
| Unclassified | 0.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_26439 | 2124908027 | Bacteria | 831 |
| 2 | SwRhRL2b_contig_1084298 | 2162886007 | Bacteria | 3626 |
| 3 | JGI25159J45721_1000008 | 3300002987 | Bacteria | 172667 |
| 4 | JGI25160J50197_1000033 | 3300003354 | Bacteria | 172667 |
| 5 | JGI25161J50226_1000460 | 3300003374 | Bacteria | 18791 |
| 6 | Ga0055538_1000240 | 3300003751 | Bacteria | 30007 |
| 7 | Ga0055539_1000276 | 3300003752 | Bacteria | 30007 |
| 8 | Ga0055533_1000264 | 3300003756 | Bacteria | 30007 |
| 9 | Ga0055532_1000303 | 3300003758 | Bacteria | 30007 |
| 10 | Ga0055525_1000368 | 3300003759 | Bacteria | 30007 |
| 11 | Ga0055535_1010651 | 3300003761 | Bacteria | 1498 |
| 12 | Ga0055524_1002673 | 3300003775 | Bacteria | 9027 |
| 13 | Ga0055524_1004228 | 3300003775 | Bacteria | 6680 |
| 14 | Ga0055536_1005066 | 3300003781 | Bacteria | 6540 |
| 15 | Ga0055536_1017275 | 3300003781 | Bacteria | 2370 |
| 16 | Ga0055528_1013363 | 3300003790 | Bacteria | 3113 |
| 17 | Ga0055530_10000019 | 3300003791 | Bacteria | 140299 |
| 18 | Ga0055530_10032509 | 3300003791 | Bacteria | 1356 |
| 19 | Ga0055540_1000055 | 3300003792 | Bacteria | 140299 |
| 20 | Ga0055540_1020293 | 3300003792 | Bacteria | 1761 |
| 21 | Ga0055531_10013457 | 3300003794 | Bacteria | 3767 |
| 22 | Ga0055531_10023444 | 3300003794 | Bacteria | 2314 |
| 23 | Ga0055541_1000174 | 3300003841 | Bacteria | 30007 |
| 24 | Ga0058692_1004321 | 3300003856 | Bacteria | 4229 |
| 25 | Ga0055543_1000026 | 3300004625 | Bacteria | 136177 |
| 26 | Ga0065165_1000178 | 3300005262 | Bacteria | 113319 |
| 27 | Ga0065714_10064569 | 3300005288 | Bacteria | 34851 |
| 28 | Ga0065714_10065532 | 3300005288 | Bacteria | 9551 |
| 29 | Ga0065714_10067736 | 3300005288 | Bacteria | 5240 |
| 30 | Ga0065714_10103007 | 3300005288 | Bacteria | 1611 |
| 31 | Ga0065704_10073109 | 3300005289 | Bacteria | 7575 |
| 32 | Ga0065712_10067965 | 3300005290 | Bacteria | 18934 |
| 33 | Ga0070670_100000320 | 3300005331 | Bacteria | 41022 |
| 34 | Ga0070661_100000542 | 3300005344 | Bacteria | 28914 |
| 35 | Ga0070668_100268916 | 3300005347 | Bacteria | 1420 |
| 36 | Ga0070669_100002464 | 3300005353 | Bacteria | 13398 |
| 37 | Ga0070669_100226125 | 3300005353 | Bacteria | 1481 |
| 38 | Ga0070667_100110464 | 3300005367 | Bacteria | 2383 |
| 39 | Ga0070663_100126448 | 3300005455 | Bacteria | 1937 |
| 40 | Ga0070706_100463698 | 3300005467 | Bacteria | 1179 |
| 41 | Ga0070707_100007996 | 3300005468 | Bacteria | 9825 |
| 42 | Ga0070699_100617659 | 3300005518 | Bacteria | 989 |
| 43 | Ga0070697_100182771 | 3300005536 | Bacteria | 1778 |
| 44 | Ga0068853_100002470 | 3300005539 | Bacteria | 13844 |
| 45 | Ga0070665_100021962 | 3300005548 | Bacteria | 6419 |
| 46 | Ga0070665_100310000 | 3300005548 | Bacteria | 1582 |
| 47 | Ga0068855_100262194 | 3300005563 | Bacteria | 1925 |
| 48 | Ga0070664_100000573 | 3300005564 | Bacteria | 28000 |
| 49 | Ga0068864_100253724 | 3300005618 | Bacteria | 1634 |
| 50 | Ga0068851_10000496 | 3300005834 | Bacteria | 17194 |
| 51 | Ga0068862_100421155 | 3300005844 | Bacteria | 1253 |
| 52 | Ga0068862_100510015 | 3300005844 | Bacteria | 1143 |
| 53 | Ga0075365_10080763 | 3300006038 | Bacteria | 2202 |
| 54 | Ga0075365_10192672 | 3300006038 | Bacteria | 1427 |
| 55 | Ga0075368_10002683 | 3300006042 | Bacteria | 5858 |
| 56 | Ga0075363_100149399 | 3300006048 | Bacteria | 1318 |
| 57 | Ga0075364_10000074 | 3300006051 | Bacteria | 38784 |
| 58 | Ga0075364_10042300 | 3300006051 | Bacteria | 2960 |
| 59 | Ga0075432_10001221 | 3300006058 | Bacteria | 8267 |
| 60 | Ga0075432_10008296 | 3300006058 | Bacteria | 3541 |
| 61 | Ga0075432_10046576 | 3300006058 | Bacteria | 1522 |
| 62 | Ga0075362_10001566 | 3300006177 | Bacteria | 7393 |
| 63 | Ga0075362_10002799 | 3300006177 | Bacteria | 5947 |
| 64 | Ga0075367_10173662 | 3300006178 | Bacteria | 1343 |
| 65 | Ga0075369_10098754 | 3300006186 | Bacteria | 1308 |
| 66 | Ga0075428_100099432 | 3300006844 | Bacteria | 3172 |
| 67 | Ga0075428_100175897 | 3300006844 | Bacteria | 2318 |
| 68 | Ga0075430_100042774 | 3300006846 | Bacteria | 3830 |
| 69 | Ga0075431_100060324 | 3300006847 | Bacteria | 3914 |
| 70 | Ga0075434_100285627 | 3300006871 | Bacteria | 1670 |
| 71 | Ga0079104_1001498 | 3300006946 | Bacteria | 15520 |
| 72 | Ga0079104_1002729 | 3300006946 | Bacteria | 9011 |
| 73 | Ga0079104_1005594 | 3300006946 | Bacteria | 4978 |
| 74 | Ga0099826_10075882 | 3300006948 | Bacteria | 2115 |
| 75 | Ga0099826_10134000 | 3300006948 | Bacteria | 1440 |
| 76 | Ga0099795_10000722 | 3300007788 | Bacteria | 6438 |
| 77 | Ga0105251_10004799 | 3300009011 | Bacteria | 9046 |
| 78 | Ga0105251_10006015 | 3300009011 | Bacteria | 7826 |
| 79 | Ga0105251_10008857 | 3300009011 | Bacteria | 6025 |
| 80 | Ga0105244_10000741 | 3300009036 | Bacteria | 27900 |
| 81 | Ga0105244_10001750 | 3300009036 | Bacteria | 17059 |
| 82 | Ga0105244_10002217 | 3300009036 | Bacteria | 14804 |
| 83 | Ga0105244_10003560 | 3300009036 | Bacteria | 11063 |
| 84 | Ga0105244_10009527 | 3300009036 | Bacteria | 5962 |
| 85 | Ga0105250_10000064 | 3300009092 | Bacteria | 100417 |
| 86 | Ga0105250_10000426 | 3300009092 | Bacteria | 30810 |
| 87 | Ga0105240_10320663 | 3300009093 | Bacteria | 1766 |
| 88 | Ga0111539_10281585 | 3300009094 | Bacteria | 1935 |
| 89 | Ga0114129_10120872 | 3300009147 | Bacteria | 3606 |
| 90 | Ga0114129_10129765 | 3300009147 | Bacteria | 3463 |
| 91 | Ga0105243_10026924 | 3300009148 | Bacteria | 4404 |
| 92 | Ga0105243_10084947 | 3300009148 | Bacteria | 2593 |
| 93 | Ga0105242_10000808 | 3300009176 | Bacteria | 24276 |
| 94 | Ga0105248_10467769 | 3300009177 | Bacteria | 1421 |
| 95 | Ga0105237_10000096 | 3300009545 | Bacteria | 121683 |
| 96 | Ga0105237_10002778 | 3300009545 | Bacteria | 21261 |
| 97 | Ga0105237_10156526 | 3300009545 | Bacteria | 2276 |
| 98 | Ga0105237_10201694 | 3300009545 | Bacteria | 1989 |
| 99 | Ga0105238_10447232 | 3300009551 | Bacteria | 1289 |
| 100 | Ga0105249_10703009 | 3300009553 | Unclassified | 1071 |
| 101 | Ga0099796_10004345 | 3300010159 | Bacteria | 3417 |
| 102 | Ga0105239_10000658 | 3300010375 | Bacteria | 49182 |
| 103 | Ga0105246_10000442 | 3300011119 | Bacteria | 22222 |
| 104 | Ga0157373_10000324 | 3300013100 | Bacteria | 38632 |
| 105 | Ga0157373_10001736 | 3300013100 | Bacteria | 16567 |
| 106 | Ga0157373_10014229 | 3300013100 | Bacteria | 5835 |
| 107 | Ga0157373_10112917 | 3300013100 | Bacteria | 1910 |
| 108 | Ga0157373_10140499 | 3300013100 | Bacteria | 1698 |
| 109 | Ga0157371_10000283 | 3300013102 | Bacteria | 68598 |
| 110 | Ga0157371_10077570 | 3300013102 | Bacteria | 2352 |
| 111 | Ga0157371_10145560 | 3300013102 | Bacteria | 1688 |
| 112 | Ga0157369_10003599 | 3300013105 | Bacteria | 18407 |
| 113 | Ga0157369_10004013 | 3300013105 | Bacteria | 17447 |
| 114 | Ga0157369_10006150 | 3300013105 | Bacteria | 13927 |
| 115 | Ga0171463_1007 | 3300013249 | Bacteria | 301198 |
| 116 | Ga0163162_10082307 | 3300013306 | Bacteria | 3291 |
| 117 | Ga0163162_10162794 | 3300013306 | Bacteria | 2353 |
| 118 | Ga0163162_10323501 | 3300013306 | Bacteria | 1674 |
| 119 | Ga0163162_10344300 | 3300013306 | Bacteria | 1623 |
| 120 | Ga0163162_10780498 | 3300013306 | Bacteria | 1074 |
| 121 | Ga0157375_10000731 | 3300013308 | Bacteria | 28959 |
| 122 | Ga0157375_10068656 | 3300013308 | Bacteria | 3547 |
| 123 | Ga0157375_10074728 | 3300013308 | Bacteria | 3411 |
| 124 | Ga0157375_10197517 | 3300013308 | Bacteria | 2167 |
| 125 | Ga0182008_10001332 | 3300014497 | Bacteria | 16829 |
| 126 | Ga0157379_10203073 | 3300014968 | Bacteria | 1793 |
| 127 | Ga0182006_1000073 | 3300015261 | Bacteria | 131224 |
| 128 | Ga0182006_1000490 | 3300015261 | Bacteria | 31074 |
| 129 | Ga0182006_1026833 | 3300015261 | Bacteria | 2355 |
| 130 | Ga0182007_10000031 | 3300015262 | Bacteria | 152299 |
| 131 | Ga0182007_10000897 | 3300015262 | Bacteria | 16513 |
| 132 | Ga0182005_1001430 | 3300015265 | Bacteria | 9604 |
| 133 | Ga0183360_10164 | 3300015689 | Bacteria | 1426 |
| 134 | Ga0183363_1084 | 3300015690 | Bacteria | 28436 |
| 135 | Ga0183361_10502 | 3300016635 | Bacteria | 1721 |
| 136 | Ga0163161_10006099 | 3300017792 | Bacteria | 8352 |
| 137 | Ga0163161_10007002 | 3300017792 | Bacteria | 7799 |
| 138 | Ga0163161_10008756 | 3300017792 | Bacteria | 6995 |
| 139 | Ga0163161_10066893 | 3300017792 | Bacteria | 2624 |
| 140 | Ga0163161_10087442 | 3300017792 | Bacteria | 2302 |
| 141 | Ga0214544_1000010 | 3300021320 | Bacteria | 270164 |
| 142 | Ga0214542_1000023 | 3300021321 | Bacteria | 191557 |
| 143 | Ga0214542_1018094 | 3300021321 | Bacteria | 6095 |
| 144 | Ga0214543_1000019 | 3300021327 | Bacteria | 267908 |
| 145 | Ga0214543_1000022 | 3300021327 | Bacteria | 241930 |
| 146 | Ga0213876_10002880 | 3300021384 | Bacteria | 9991 |
| 147 | Ga0224712_10000426 | 3300022467 | Bacteria | 8317 |
| 148 | Ga0228711_1000017 | 3300022739 | Bacteria | 121084 |
| 149 | Ga0228710_1000005 | 3300022740 | Bacteria | 233531 |
| 150 | Ga0209435_100321 | 3300025206 | Bacteria | 11531 |
| 151 | Ga0209784_100112 | 3300025224 | Bacteria | 91142 |
| 152 | Ga0209566_100045 | 3300025225 | Bacteria | 258557 |
| 153 | Ga0209674_100156 | 3300025226 | Bacteria | 91147 |
| 154 | Ga0209147_100056 | 3300025229 | Bacteria | 258557 |
| 155 | Ga0209563_100064 | 3300025230 | Bacteria | 258557 |
| 156 | Ga0207427_101730 | 3300025231 | Bacteria | 7186 |
| 157 | Ga0209258_100588 | 3300025242 | Bacteria | 30150 |
| 158 | Ga0209646_1001226 | 3300025246 | Bacteria | 7308 |
| 159 | Ga0209677_100103 | 3300025253 | Bacteria | 91142 |
| 160 | Ga0209129_1004102 | 3300025258 | Bacteria | 5927 |
| 161 | Ga0209233_1000441 | 3300025261 | Bacteria | 28814 |
| 162 | Ga0209673_1046403 | 3300025273 | Bacteria | 1186 |
| 163 | Ga0209673_1054655 | 3300025273 | Bacteria | 1033 |
| 164 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 165 | Ga0209676_1000286 | 3300025292 | Bacteria | 103478 |
| 166 | Ga0209676_1005118 | 3300025292 | Bacteria | 6988 |
| 167 | Ga0209676_1006789 | 3300025292 | Bacteria | 5556 |
| 168 | Ga0209676_1046704 | 3300025292 | Bacteria | 1169 |
| 169 | Ga0209025_1000153 | 3300025294 | Bacteria | 170548 |
| 170 | Ga0209025_1030262 | 3300025294 | Bacteria | 2595 |
| 171 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 172 | Ga0209564_1035365 | 3300025295 | Bacteria | 1447 |
| 173 | Ga0209758_1003271 | 3300025297 | Bacteria | 15023 |
| 174 | Ga0209758_1066154 | 3300025297 | Bacteria | 1162 |
| 175 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 176 | Ga0209050_1003890 | 3300025298 | Bacteria | 10593 |
| 177 | Ga0209050_1009723 | 3300025298 | Bacteria | 4870 |
| 178 | Ga0209050_1035176 | 3300025298 | Bacteria | 1485 |
| 179 | Ga0209256_1000211 | 3300025299 | Bacteria | 110131 |
| 180 | Ga0209256_1002050 | 3300025299 | Bacteria | 17868 |
| 181 | Ga0209256_1009908 | 3300025299 | Bacteria | 4091 |
| 182 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 183 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 184 | Ga0209051_1018783 | 3300025303 | Bacteria | 3044 |
| 185 | Ga0209051_1029926 | 3300025303 | Bacteria | 2123 |
| 186 | Ga0209051_1031608 | 3300025303 | Bacteria | 2033 |
| 187 | Ga0209257_1006653 | 3300025304 | Bacteria | 7339 |
| 188 | Ga0209257_1007221 | 3300025304 | Bacteria | 6799 |
| 189 | Ga0209257_1013465 | 3300025304 | Bacteria | 3633 |
| 190 | Ga0209257_1024918 | 3300025304 | Bacteria | 2057 |
| 191 | Ga0207656_10000491 | 3300025321 | Bacteria | 13084 |
| 192 | Ga0207696_1000128 | 3300025711 | Bacteria | 134490 |
| 193 | Ga0207696_1000266 | 3300025711 | Bacteria | 65599 |
| 194 | Ga0207655_1000125 | 3300025728 | Bacteria | 152896 |
| 195 | Ga0207655_1000611 | 3300025728 | Bacteria | 43237 |
| 196 | Ga0207655_1002732 | 3300025728 | Bacteria | 13778 |
| 197 | Ga0207655_1015748 | 3300025728 | Bacteria | 4181 |
| 198 | Ga0207655_1027423 | 3300025728 | Bacteria | 2714 |
| 199 | Ga0207713_1001911 | 3300025735 | Bacteria | 15776 |
| 200 | Ga0207713_1003983 | 3300025735 | Bacteria | 9782 |
| 201 | Ga0207713_1017300 | 3300025735 | Bacteria | 3623 |
| 202 | Ga0207645_10057976 | 3300025907 | Bacteria | 2472 |
| 203 | Ga0207684_10221360 | 3300025910 | Bacteria | 1633 |
| 204 | Ga0207695_10570714 | 3300025913 | Bacteria | 1013 |
| 205 | Ga0207671_10000158 | 3300025914 | Bacteria | 105476 |
| 206 | Ga0207671_10000932 | 3300025914 | Bacteria | 36616 |
| 207 | Ga0207649_10000010 | 3300025920 | Bacteria | 284354 |
| 208 | Ga0207646_10178141 | 3300025922 | Bacteria | 1920 |
| 209 | Ga0207681_10001975 | 3300025923 | Bacteria | 13163 |
| 210 | Ga0207650_10000077 | 3300025925 | Bacteria | 132010 |
| 211 | Ga0207650_10001685 | 3300025925 | Bacteria | 15705 |
| 212 | Ga0207679_10000451 | 3300025945 | Bacteria | 28955 |
| 213 | Ga0207639_10001288 | 3300026041 | Bacteria | 16915 |
| 214 | Ga0207678_10012396 | 3300026067 | Bacteria | 7483 |
| 215 | Ga0207676_10243724 | 3300026095 | Bacteria | 1614 |
| 216 | Ga0207674_10128724 | 3300026116 | Bacteria | 2496 |
| 217 | Ga0207675_100108175 | 3300026118 | Bacteria | 2622 |
| 218 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 219 | Ga0209281_1000082 | 3300027111 | Bacteria | 257684 |
| 220 | Ga0209281_1001048 | 3300027111 | Bacteria | 20910 |
| 221 | Ga0209371_1001449 | 3300027312 | Bacteria | 16072 |
| 222 | Ga0209282_1000006 | 3300027666 | Bacteria | 276998 |
| 223 | Ga0209282_1111588 | 3300027666 | Bacteria | 1386 |
| 224 | Ga0207428_10050319 | 3300027907 | Bacteria | 3334 |
| 225 | Ga0268266_10002047 | 3300028379 | Bacteria | 22376 |
| 226 | Ga0268265_10341320 | 3300028380 | Bacteria | 1364 |
| 227 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 228 | Ga0307515_10005257 | 3300028794 | Bacteria | 26313 |
| 229 | Ga0307515_10011281 | 3300028794 | Bacteria | 16963 |
| 230 | Ga0307515_10221353 | 3300028794 | Bacteria | 1709 |
| 231 | Ga0265338_10322077 | 3300028800 | Bacteria | 1119 |
| 232 | Ga0268256_1032064 | 3300030500 | Bacteria | 1255 |
| 233 | Ga0307511_10078808 | 3300030521 | Bacteria | 2333 |
| 234 | Ga0316181_1012985 | 3300030744 | Bacteria | 1559 |
| 235 | Ga0265339_10016336 | 3300031249 | Bacteria | 4427 |
| 236 | Ga0265339_10091481 | 3300031249 | Bacteria | 1594 |
| 237 | Ga0265331_10002957 | 3300031250 | Bacteria | 11197 |
| 238 | Ga0265327_10020386 | 3300031251 | Bacteria | 4042 |
| 239 | Ga0265316_10086395 | 3300031344 | Bacteria | 2398 |
| 240 | Ga0307513_10085610 | 3300031456 | Bacteria | 3234 |
| 241 | Ga0307513_10187530 | 3300031456 | Bacteria | 1923 |
| 242 | Ga0307513_10254991 | 3300031456 | Bacteria | 1548 |
| 243 | Ga0307513_10296206 | 3300031456 | Bacteria | 1387 |
| 244 | Ga0307408_100013718 | 3300031548 | Bacteria | 5379 |
| 245 | Ga0307408_100021328 | 3300031548 | Bacteria | 4383 |
| 246 | Ga0307408_100031953 | 3300031548 | Bacteria | 3668 |
| 247 | Ga0307408_100042897 | 3300031548 | Bacteria | 3216 |
| 248 | Ga0307408_100088572 | 3300031548 | Bacteria | 2331 |
| 249 | Ga0307408_100127763 | 3300031548 | Bacteria | 1979 |
| 250 | Ga0265313_10000427 | 3300031595 | Bacteria | 44927 |
| 251 | Ga0307508_10000120 | 3300031616 | Bacteria | 93316 |
| 252 | Ga0307508_10088555 | 3300031616 | Bacteria | 2680 |
| 253 | Ga0307508_10207925 | 3300031616 | Bacteria | 1558 |
| 254 | Ga0307514_10030872 | 3300031649 | Bacteria | 4299 |
| 255 | Ga0265314_10021289 | 3300031711 | Bacteria | 4990 |
| 256 | Ga0265314_10059438 | 3300031711 | Bacteria | 2615 |
| 257 | Ga0265314_10148720 | 3300031711 | Bacteria | 1439 |
| 258 | Ga0265342_10150825 | 3300031712 | Bacteria | 1291 |
| 259 | Ga0307516_10089119 | 3300031730 | Bacteria | 2916 |
| 260 | Ga0307516_10308522 | 3300031730 | Bacteria | 1256 |
| 261 | Ga0307405_10000074 | 3300031731 | Bacteria | 43352 |
| 262 | Ga0307405_10000880 | 3300031731 | Bacteria | 11893 |
| 263 | Ga0307405_10000937 | 3300031731 | Bacteria | 11623 |
| 264 | Ga0307413_10089645 | 3300031824 | Bacteria | 1998 |
| 265 | Ga0307406_10002998 | 3300031901 | Bacteria | 9186 |
| 266 | Ga0307406_10014480 | 3300031901 | Bacteria | 4540 |
| 267 | Ga0307406_10457577 | 3300031901 | Bacteria | 1025 |
| 268 | Ga0307407_10283552 | 3300031903 | Bacteria | 1148 |
| 269 | Ga0307412_10002361 | 3300031911 | Bacteria | 10465 |
| 270 | Ga0307412_10003241 | 3300031911 | Bacteria | 9049 |
| 271 | Ga0307412_10003971 | 3300031911 | Bacteria | 8242 |
| 272 | Ga0307412_10010245 | 3300031911 | Bacteria | 5396 |
| 273 | Ga0307412_10166307 | 3300031911 | Bacteria | 1645 |
| 274 | Ga0307412_10389637 | 3300031911 | Bacteria | 1131 |
| 275 | Ga0315914_1000003 | 3300031967 | Bacteria | 314370 |
| 276 | Ga0307409_100067840 | 3300031995 | Bacteria | 2818 |
| 277 | Ga0307409_100375502 | 3300031995 | Bacteria | 1350 |
| 278 | Ga0307414_10060523 | 3300032004 | Bacteria | 2678 |
| 279 | Ga0307414_10538574 | 3300032004 | Bacteria | 1039 |
| 280 | Ga0307411_10040590 | 3300032005 | Bacteria | 2953 |
| 281 | Ga0307507_10100847 | 3300033179 | Bacteria | 2417 |
| 282 | Ga0307510_10014749 | 3300033180 | Bacteria | 9249 |
| 283 | Ga0315913_1000001 | 3300033430 | Bacteria | 284459 |
| 284 | Ga0315915_1000008 | 3300033464 | Bacteria | 258517 |
| 285 | Ga0373943_0054017 | 3300035170 | Bacteria | 1986 |
| 286 | Ga0373935_0035845 | 3300035692 | Bacteria | 3097 |
| 287 | Ga0373935_0196192 | 3300035692 | Bacteria | 1393 |
| 288 | Ga0373927_0000178 | 3300035695 | Bacteria | 50343 |
| 289 | Ga0373927_0052629 | 3300035695 | Bacteria | 2633 |
| 290 | Ga0316584_0019902 | 3300036712 | Bacteria | 4857 |
| 291 | Ga0373925_0027566 | 3300037068 | Bacteria | 4157 |
| 292 | Ga0373925_0033116 | 3300037068 | Bacteria | 3809 |
| 293 | Ga0395905_0055924 | 3300037471 | Bacteria | 3693 |
| 294 | Ga0395905_0200689 | 3300037471 | Bacteria | 1870 |
| 295 | Ga0436364_0945858 | 3300037853 | Bacteria | 2447 |
| 296 | Ga0436364_1107967 | 3300037853 | Bacteria | 1755 |
| 297 | Ga0436365_0037768 | 3300039437 | Bacteria | 9764 |
| 298 | Ga0436365_0146384 | 3300039437 | Bacteria | 1201 |
| 299 | Ga0436365_1105090 | 3300039437 | Bacteria | 1476 |
| 300 | Ga0436365_1233355 | 3300039437 | Bacteria | 2556 |
| 301 | Ga0436365_1638075 | 3300039437 | Bacteria | 3484 |
| 302 | Ga0436365_1869873 | 3300039437 | Bacteria | 3038 |
| 303 | Ga0436363_0684692 | 3300039450 | Bacteria | 1983 |
| 304 | Ga0436362_0435552 | 3300039453 | Bacteria | 6559 |
| 305 | Ga0439436_0032531 | 3300041404 | Bacteria | 1512 |
| 306 | Ga0439438_000386 | 3300041405 | Bacteria | 19748 |
| 307 | Ga0439438_000697 | 3300041405 | Bacteria | 15007 |
| 308 | Ga0439438_001340 | 3300041405 | Bacteria | 10914 |
| 309 | Ga0439438_012374 | 3300041405 | Bacteria | 2617 |
| 310 | Ga0439447_008430 | 3300041407 | Bacteria | 3189 |
| 311 | Ga0439447_026102 | 3300041407 | Bacteria | 1500 |
| 312 | Ga0439466_0009542 | 3300041411 | Bacteria | 3626 |
| 313 | Ga0439466_0016293 | 3300041411 | Bacteria | 2687 |
| 314 | Ga0439466_0031091 | 3300041411 | Bacteria | 1828 |
| 315 | Ga0439465_0027929 | 3300041413 | Bacteria | 1788 |
| 316 | Ga0439465_0046991 | 3300041413 | Bacteria | 1406 |
| 317 | Ga0439465_0058743 | 3300041413 | Bacteria | 1271 |
| 318 | Ga0439431_0003155 | 3300041997 | Bacteria | 3622 |
| 319 | Ga0439432_000485 | 3300042006 | Bacteria | 14844 |
| 320 | Ga0439432_001879 | 3300042006 | Bacteria | 7903 |
| 321 | Ga0439432_004874 | 3300042006 | Bacteria | 4870 |
| 322 | Ga0439432_019300 | 3300042006 | Bacteria | 2272 |
| 323 | Ga0439449_0017316 | 3300042007 | Bacteria | 2705 |
| 324 | Ga0439451_001004 | 3300042009 | Bacteria | 5468 |
| 325 | Ga0439451_001789 | 3300042009 | Bacteria | 4292 |
| 326 | Ga0439451_004353 | 3300042009 | Bacteria | 2876 |
| 327 | Ga0439451_021232 | 3300042009 | Bacteria | 1310 |
| 328 | Ga0439451_034048 | 3300042009 | Bacteria | 1024 |
| 329 | Ga0439452_000115 | 3300042010 | Bacteria | 63101 |
| 330 | Ga0439452_004469 | 3300042010 | Bacteria | 4683 |
| 331 | Ga0439452_006930 | 3300042010 | Bacteria | 3508 |
| 332 | Ga0439452_012663 | 3300042010 | Bacteria | 2390 |
| 333 | Ga0439452_018860 | 3300042010 | Bacteria | 1830 |
| 334 | Ga0439456_001848 | 3300042013 | Bacteria | 4280 |
| 335 | Ga0439462_0009599 | 3300042015 | Bacteria | 2447 |
| 336 | Ga0450911_002639 | 3300042115 | Bacteria | 3438 |
| 337 | Ga0450919_014590 | 3300042121 | Bacteria | 887 |
| 338 | Ga0450920_034343 | 3300042122 | Bacteria | 1003 |
| 339 | Ga0450890_000773 | 3300042127 | Bacteria | 4613 |
| 340 | Ga0450902_001124 | 3300042137 | Bacteria | 3564 |
| 341 | Ga0450903_008341 | 3300042138 | Bacteria | 1695 |
| 342 | Ga0450903_029206 | 3300042138 | Bacteria | 835 |
| 343 | Ga0450904_000497 | 3300042139 | Bacteria | 7723 |
| 344 | Ga0450906_002759 | 3300042145 | Bacteria | 3823 |
| 345 | Ga0450907_003145 | 3300042146 | Bacteria | 2991 |
| 346 | Ga0439446_0082398 | 3300042156 | Bacteria | 998 |
| 347 | Ga0450908_011147 | 3300042184 | Bacteria | 1649 |
| 348 | Ga0450909_001067 | 3300042185 | Bacteria | 3775 |
| 349 | Ga0439434_0064628 | 3300042435 | Bacteria | 1147 |
| 350 | Ga0439464_0087209 | 3300042439 | Bacteria | 938 |
| 351 | Ga0450918_004860 | 3300042531 | Bacteria | 2430 |
| 352 | Ga0439440_0063093 | 3300042993 | Bacteria | 949 |
| 353 | Ga0466969_0134136 | 3300044656 | Bacteria | 1147 |
| 354 | Ga0451576_0013360 | 3300045051 | Bacteria | 9188 |
| 355 | Ga0451576_0148426 | 3300045051 | Bacteria | 2445 |
| 356 | Ga0495617_000074 | 3300046452 | Bacteria | 80489 |
| 357 | Ga0495617_010123 | 3300046452 | Bacteria | 3230 |
| 358 | Ga0495627_000589 | 3300046453 | Bacteria | 29043 |
| 359 | Ga0495627_008405 | 3300046453 | Bacteria | 3876 |
| 360 | Ga0495603_0150916 | 3300046455 | Bacteria | 1350 |
| 361 | Ga0495590_0002081 | 3300046457 | Bacteria | 8383 |
| 362 | Ga0495591_000566 | 3300046458 | Bacteria | 28402 |
| 363 | Ga0495591_001343 | 3300046458 | Bacteria | 15437 |
| 364 | Ga0495591_006973 | 3300046458 | Bacteria | 4883 |
| 365 | Ga0495591_009170 | 3300046458 | Bacteria | 3956 |
| 366 | Ga0495591_014319 | 3300046458 | Bacteria | 2858 |
| 367 | Ga0495638_0013208 | 3300046460 | Bacteria | 5633 |
| 368 | Ga0495638_0028211 | 3300046460 | Bacteria | 3626 |
| 369 | Ga0495638_0039708 | 3300046460 | Bacteria | 2986 |
| 370 | Ga0495638_0156690 | 3300046460 | Bacteria | 1317 |
| 371 | Ga0495650_0000522 | 3300046471 | Bacteria | 56293 |
| 372 | Ga0495650_0001172 | 3300046471 | Bacteria | 28022 |
| 373 | Ga0495650_0001646 | 3300046471 | Bacteria | 20716 |
| 374 | Ga0495650_0007710 | 3300046471 | Bacteria | 6414 |
| 375 | Ga0495605_0000002 | 3300046474 | Bacteria | 522417 |
| 376 | Ga0495605_0000274 | 3300046474 | Bacteria | 58499 |
| 377 | Ga0495605_0001555 | 3300046474 | Bacteria | 14911 |
| 378 | Ga0495605_0009296 | 3300046474 | Bacteria | 5524 |
| 379 | Ga0495605_0015866 | 3300046474 | Bacteria | 4089 |
| 380 | Ga0495605_0037597 | 3300046474 | Bacteria | 2433 |
| 381 | Ga0495639_0000002 | 3300046475 | Bacteria | 192403 |
| 382 | Ga0495662_0062591 | 3300046476 | Bacteria | 1797 |
| 383 | Ga0495584_0000084 | 3300046491 | Bacteria | 65138 |
| 384 | Ga0495584_0000094 | 3300046491 | Bacteria | 60342 |
| 385 | Ga0495584_0012466 | 3300046491 | Bacteria | 4338 |
| 386 | Ga0495585_0002777 | 3300046492 | Bacteria | 12200 |
| 387 | Ga0495585_0085280 | 3300046492 | Bacteria | 1707 |
| 388 | Ga0495585_0179364 | 3300046492 | Bacteria | 1090 |
| 389 | Ga0495585_0184253 | 3300046492 | Bacteria | 1072 |
| 390 | Ga0495585_0197839 | 3300046492 | Bacteria | 1025 |
| 391 | Ga0495594_0001723 | 3300046499 | Bacteria | 11336 |
| 392 | Ga0495594_0006359 | 3300046499 | Bacteria | 6072 |
| 393 | Ga0495607_0000092 | 3300046501 | Bacteria | 93857 |
| 394 | Ga0495607_0000094 | 3300046501 | Bacteria | 92515 |
| 395 | Ga0495607_0001096 | 3300046501 | Bacteria | 24697 |
| 396 | Ga0495607_0003046 | 3300046501 | Bacteria | 13054 |
| 397 | Ga0495607_0005609 | 3300046501 | Bacteria | 8952 |
| 398 | Ga0495607_0025163 | 3300046501 | Bacteria | 3704 |
| 399 | Ga0495607_0058068 | 3300046501 | Bacteria | 2214 |
| 400 | Ga0495607_0127710 | 3300046501 | Bacteria | 1327 |
| 401 | Ga0495583_0000012 | 3300046506 | Bacteria | 324839 |
| 402 | Ga0495583_0002173 | 3300046506 | Bacteria | 17490 |
| 403 | Ga0495583_0003086 | 3300046506 | Bacteria | 13193 |
| 404 | Ga0495583_0011012 | 3300046506 | Bacteria | 5216 |
| 405 | Ga0495583_0033369 | 3300046506 | Bacteria | 2476 |
| 406 | Ga0495583_0036450 | 3300046506 | Bacteria | 2339 |
| 407 | Ga0495583_0049265 | 3300046506 | Bacteria | 1930 |
| 408 | Ga0495606_0000199 | 3300046507 | Bacteria | 104847 |
| 409 | Ga0495606_0034210 | 3300046507 | Bacteria | 3490 |
| 410 | Ga0495606_0051216 | 3300046507 | Bacteria | 2694 |
| 411 | Ga0495606_0123685 | 3300046507 | Bacteria | 1545 |
| 412 | Ga0495610_0011302 | 3300046512 | Bacteria | 5467 |
| 413 | Ga0495610_0019119 | 3300046512 | Bacteria | 3842 |
| 414 | Ga0495610_0030834 | 3300046512 | Bacteria | 2803 |
| 415 | Ga0495610_0037718 | 3300046512 | Bacteria | 2457 |
| 416 | Ga0495610_0051303 | 3300046512 | Bacteria | 2008 |
| 417 | Ga0495616_0002349 | 3300046513 | Bacteria | 12614 |
| 418 | Ga0495616_0017389 | 3300046513 | Bacteria | 3967 |
| 419 | Ga0495616_0027295 | 3300046513 | Bacteria | 3030 |
| 420 | Ga0495616_0056317 | 3300046513 | Bacteria | 1942 |
| 421 | Ga0495616_0088595 | 3300046513 | Bacteria | 1469 |
| 422 | Ga0495620_0000010 | 3300046515 | Bacteria | 173604 |
| 423 | Ga0495620_0000374 | 3300046515 | Bacteria | 30623 |
| 424 | Ga0495620_0068612 | 3300046515 | Bacteria | 1456 |
| 425 | Ga0495620_0075044 | 3300046515 | Bacteria | 1376 |
| 426 | Ga0495620_0159967 | 3300046515 | Bacteria | 875 |
| 427 | Ga0495630_0068258 | 3300046517 | Bacteria | 2673 |
| 428 | Ga0495631_0018210 | 3300046518 | Bacteria | 3310 |
| 429 | Ga0495631_0028943 | 3300046518 | Bacteria | 2524 |
| 430 | Ga0495631_0031168 | 3300046518 | Bacteria | 2415 |
| 431 | Ga0495631_0121702 | 3300046518 | Bacteria | 1122 |
| 432 | Ga0495632_0000022 | 3300046519 | Bacteria | 187045 |
| 433 | Ga0495632_0000200 | 3300046519 | Bacteria | 60951 |
| 434 | Ga0495632_0000487 | 3300046519 | Bacteria | 37602 |
| 435 | Ga0495632_0000922 | 3300046519 | Bacteria | 25785 |
| 436 | Ga0495632_0002318 | 3300046519 | Bacteria | 14649 |
| 437 | Ga0495632_0014680 | 3300046519 | Bacteria | 4423 |
| 438 | Ga0495632_0024520 | 3300046519 | Bacteria | 3202 |
| 439 | Ga0495632_0128653 | 3300046519 | Bacteria | 1179 |
| 440 | Ga0495637_0000074 | 3300046520 | Bacteria | 80233 |
| 441 | Ga0495637_0000412 | 3300046520 | Bacteria | 31651 |
| 442 | Ga0495637_0005041 | 3300046520 | Bacteria | 6788 |
| 443 | Ga0495637_0008438 | 3300046520 | Bacteria | 5060 |
| 444 | Ga0495643_0008180 | 3300046522 | Bacteria | 6651 |
| 445 | Ga0495643_0017290 | 3300046522 | Bacteria | 4217 |
| 446 | Ga0495644_0021862 | 3300046523 | Bacteria | 2438 |
| 447 | Ga0495648_0006838 | 3300046524 | Bacteria | 9210 |
| 448 | Ga0495648_0017466 | 3300046524 | Bacteria | 5126 |
| 449 | Ga0495648_0031752 | 3300046524 | Bacteria | 3474 |
| 450 | Ga0495648_0070354 | 3300046524 | Bacteria | 2033 |
| 451 | Ga0495648_0075064 | 3300046524 | Bacteria | 1946 |
| 452 | Ga0495648_0116453 | 3300046524 | Bacteria | 1444 |
| 453 | Ga0495663_0101288 | 3300046525 | Bacteria | 949 |
| 454 | Ga0495666_0012334 | 3300046526 | Bacteria | 4261 |
| 455 | Ga0495642_0001429 | 3300046528 | Bacteria | 10696 |
| 456 | Ga0495642_0001436 | 3300046528 | Bacteria | 10677 |
| 457 | Ga0495654_0000362 | 3300046530 | Bacteria | 39403 |
| 458 | Ga0495654_0000382 | 3300046530 | Bacteria | 38175 |
| 459 | Ga0495654_0000391 | 3300046530 | Bacteria | 37667 |
| 460 | Ga0495654_0003297 | 3300046530 | Bacteria | 9949 |
| 461 | Ga0495654_0012316 | 3300046530 | Bacteria | 4596 |
| 462 | Ga0495654_0025400 | 3300046530 | Bacteria | 3051 |
| 463 | Ga0495654_0031182 | 3300046530 | Bacteria | 2706 |
| 464 | Ga0495654_0035341 | 3300046530 | Bacteria | 2517 |
| 465 | Ga0495654_0040056 | 3300046530 | Bacteria | 2337 |
| 466 | Ga0495640_0065789 | 3300046533 | Bacteria | 2447 |
| 467 | Ga0495609_0000008 | 3300046538 | Bacteria | 383025 |
| 468 | Ga0495609_0000125 | 3300046538 | Bacteria | 83190 |
| 469 | Ga0495609_0000211 | 3300046538 | Bacteria | 58163 |
| 470 | Ga0495609_0005717 | 3300046538 | Bacteria | 6475 |
| 471 | Ga0495609_0044059 | 3300046538 | Bacteria | 2002 |
| 472 | Ga0495597_0000366 | 3300046542 | Bacteria | 39958 |
| 473 | Ga0495597_0004619 | 3300046542 | Bacteria | 7509 |
| 474 | Ga0495597_0014614 | 3300046542 | Bacteria | 3735 |
| 475 | Ga0495597_0091611 | 3300046542 | Bacteria | 1290 |
| 476 | Ga0495622_0003749 | 3300046557 | Bacteria | 7111 |
| 477 | Ga0495622_0005612 | 3300046557 | Bacteria | 5819 |
| 478 | Ga0495633_0000009 | 3300046558 | Bacteria | 293183 |
| 479 | Ga0495633_0023268 | 3300046558 | Bacteria | 3070 |
| 480 | Ga0495633_0039451 | 3300046558 | Bacteria | 2254 |
| 481 | Ga0495668_0036290 | 3300046616 | Bacteria | 2762 |
| 482 | Ga0495611_0000998 | 3300046648 | Bacteria | 15040 |
| 483 | Ga0495625_0014639 | 3300046660 | Bacteria | 6249 |
| 484 | Ga0495625_0050688 | 3300046660 | Bacteria | 2978 |
| 485 | Ga0495625_0052515 | 3300046660 | Bacteria | 2918 |
| 486 | Ga0495625_0118206 | 3300046660 | Bacteria | 1806 |
| 487 | Ga0495625_0186449 | 3300046660 | Bacteria | 1376 |
| 488 | Ga0495625_0239954 | 3300046660 | Bacteria | 1180 |
| 489 | Ga0495659_0000035 | 3300046664 | Bacteria | 64001 |
| 490 | Ga0495659_0012408 | 3300046664 | Bacteria | 2759 |
| 491 | Ga0495659_0025564 | 3300046664 | Bacteria | 2022 |
| 492 | Ga0495659_0039741 | 3300046664 | Bacteria | 1673 |
| 493 | Ga0495661_0000029 | 3300046665 | Bacteria | 173899 |
| 494 | Ga0495661_0000083 | 3300046665 | Bacteria | 116027 |
| 495 | Ga0495661_0000468 | 3300046665 | Bacteria | 42758 |
| 496 | Ga0495661_0002752 | 3300046665 | Bacteria | 13365 |
| 497 | Ga0495661_0037531 | 3300046665 | Bacteria | 3024 |
| 498 | Ga0495661_0054847 | 3300046665 | Bacteria | 2391 |
| 499 | Ga0495669_0005644 | 3300046684 | Bacteria | 5222 |
| 500 | Ga0495624_0192838 | 3300046690 | Bacteria | 1239 |
| 501 | Ga0495670_0000280 | 3300046691 | Bacteria | 24045 |
| 502 | Ga0495670_0002007 | 3300046691 | Bacteria | 10014 |
| 503 | Ga0495670_0023754 | 3300046691 | Bacteria | 3026 |
| 504 | Ga0495670_0053335 | 3300046691 | Bacteria | 2025 |
| 505 | Ga0495670_0129883 | 3300046691 | Bacteria | 1313 |
| 506 | Ga0495670_0179193 | 3300046691 | Bacteria | 1118 |
| 507 | Ga0495671_0000136 | 3300046692 | Bacteria | 65148 |
| 508 | Ga0495671_0000389 | 3300046692 | Bacteria | 36241 |
| 509 | Ga0495671_0025715 | 3300046692 | Bacteria | 3056 |
| 510 | Ga0495671_0086317 | 3300046692 | Bacteria | 1537 |
| 511 | Ga0495649_0000289 | 3300046694 | Bacteria | 44254 |
| 512 | Ga0495649_0001225 | 3300046694 | Bacteria | 19753 |
| 513 | Ga0495649_0001839 | 3300046694 | Bacteria | 15570 |
| 514 | Ga0495649_0034556 | 3300046694 | Bacteria | 2781 |
| 515 | Ga0495589_0000075 | 3300046794 | Bacteria | 92974 |
| 516 | Ga0495589_0000942 | 3300046794 | Bacteria | 17846 |
| 517 | Ga0495589_0011459 | 3300046794 | Bacteria | 4602 |
| 518 | Ga0495589_0018843 | 3300046794 | Bacteria | 3539 |
| 519 | Ga0495600_0093689 | 3300046809 | Bacteria | 1958 |
| 520 | Ga0495660_0000520 | 3300046810 | Bacteria | 31644 |
| 521 | Ga0495660_0002132 | 3300046810 | Bacteria | 12783 |
| 522 | Ga0495660_0039190 | 3300046810 | Bacteria | 2631 |
| 523 | Ga0495660_0041488 | 3300046810 | Bacteria | 2547 |
| 524 | Ga0495660_0128690 | 3300046810 | Bacteria | 1272 |
| 525 | Ga0495660_0159691 | 3300046810 | Bacteria | 1106 |
| 526 | Ga0495581_0001262 | 3300047315 | Bacteria | 13921 |
| 527 | Ga0495604_0001148 | 3300047317 | Bacteria | 21939 |
| 528 | Ga0495636_0001517 | 3300047318 | Bacteria | 8809 |
| 529 | Ga0495672_0000433 | 3300047320 | Bacteria | 50107 |
| 530 | Ga0495672_0000814 | 3300047320 | Bacteria | 33480 |
| 531 | Ga0495672_0011424 | 3300047320 | Bacteria | 6268 |
| 532 | Ga0495672_0051140 | 3300047320 | Bacteria | 2435 |
| 533 | Ga0495672_0055348 | 3300047320 | Bacteria | 2315 |
| 534 | Ga0495672_0101482 | 3300047320 | Bacteria | 1559 |
| 535 | Ga0495680_0021969 | 3300047322 | Bacteria | 5331 |
| 536 | Ga0495680_0036589 | 3300047322 | Bacteria | 3940 |
| 537 | Ga0495683_0000039 | 3300047323 | Bacteria | 137702 |
| 538 | Ga0495683_0005744 | 3300047323 | Bacteria | 6838 |
| 539 | Ga0495683_0023291 | 3300047323 | Bacteria | 3182 |
| 540 | Ga0495683_0062877 | 3300047323 | Bacteria | 1835 |
| 541 | Ga0495683_0112513 | 3300047323 | Bacteria | 1298 |
| 542 | Ga0495683_0112749 | 3300047323 | Bacteria | 1296 |
| 543 | Ga0495687_000260 | 3300047443 | Bacteria | 71197 |
| 544 | Ga0495687_001168 | 3300047443 | Bacteria | 25374 |
| 545 | Ga0495687_002151 | 3300047443 | Bacteria | 16448 |
| 546 | Ga0495687_026573 | 3300047443 | Bacteria | 2722 |
| 547 | Ga0495677_0000490 | 3300047445 | Bacteria | 16791 |
| 548 | Ga0495679_001047 | 3300047446 | Bacteria | 16872 |
| 549 | Ga0495679_008706 | 3300047446 | Bacteria | 4106 |
| 550 | Ga0495679_009235 | 3300047446 | Bacteria | 3960 |
| 551 | Ga0495679_015404 | 3300047446 | Bacteria | 2798 |
| 552 | Ga0495685_020232 | 3300047447 | Bacteria | 2287 |
| 553 | Ga0495685_022820 | 3300047447 | Bacteria | 2153 |
| 554 | Ga0495673_0001395 | 3300047469 | Bacteria | 19424 |
| 555 | Ga0495673_0001462 | 3300047469 | Bacteria | 18726 |
| 556 | Ga0495673_0003525 | 3300047469 | Bacteria | 10298 |
| 557 | Ga0495673_0017671 | 3300047469 | Bacteria | 3613 |
| 558 | Ga0495673_0018312 | 3300047469 | Bacteria | 3533 |
| 559 | Ga0495681_0004673 | 3300047470 | Bacteria | 9282 |
| 560 | Ga0495681_0004690 | 3300047470 | Bacteria | 9272 |
| 561 | Ga0495681_0011322 | 3300047470 | Bacteria | 5320 |
| 562 | Ga0495681_0012410 | 3300047470 | Bacteria | 5007 |
| 563 | Ga0495681_0019758 | 3300047470 | Bacteria | 3669 |
| 564 | Ga0495686_0006218 | 3300047472 | Bacteria | 9203 |
| 565 | Ga0495686_0029683 | 3300047472 | Bacteria | 3556 |
| 566 | Ga0495686_0039808 | 3300047472 | Bacteria | 3000 |
| 567 | Ga0495686_0044657 | 3300047472 | Bacteria | 2805 |
| 568 | Ga0495686_0120405 | 3300047472 | Bacteria | 1565 |
| 569 | Ga0495686_0186660 | 3300047472 | Bacteria | 1197 |
| 570 | Ga0495593_0032130 | 3300047673 | Bacteria | 2863 |
| 571 | Ga0495626_0000544 | 3300048091 | Bacteria | 37459 |
| 572 | Ga0495626_0002984 | 3300048091 | Bacteria | 11213 |
| 573 | Ga0495626_0009129 | 3300048091 | Bacteria | 5375 |
| 574 | Ga0495626_0080541 | 3300048091 | Bacteria | 1447 |
| 575 | Ga0495626_0173340 | 3300048091 | Bacteria | 898 |
| 576 | Ga0496106_0618893 | 3300048909 | Bacteria | 867 |
| 577 | Ga0496116_0000454 | 3300048919 | Bacteria | 56678 |
| 578 | Ga0496117_0000246 | 3300048920 | Bacteria | 102783 |
| 579 | Ga0496117_0008288 | 3300048920 | Bacteria | 9890 |
| 580 | Ga0496117_0055874 | 3300048920 | Bacteria | 2754 |
| 581 | Ga0496117_0133386 | 3300048920 | Bacteria | 1500 |
| 582 | Ga0496118_0022520 | 3300048921 | Bacteria | 5503 |
| 583 | Ga0496118_0055796 | 3300048921 | Bacteria | 2976 |
| 584 | Ga0496118_0057447 | 3300048921 | Bacteria | 2916 |
| 585 | Ga0496118_0138741 | 3300048921 | Bacteria | 1546 |
| 586 | Ga0496120_0007188 | 3300048923 | Bacteria | 8337 |
| 587 | Ga0496120_0020423 | 3300048923 | Bacteria | 4210 |
| 588 | Ga0496121_0000180 | 3300048924 | Bacteria | 141128 |
| 589 | Ga0496121_0002269 | 3300048924 | Bacteria | 29925 |
| 590 | Ga0496121_0031970 | 3300048924 | Bacteria | 4796 |
| 591 | Ga0496121_0064794 | 3300048924 | Bacteria | 2977 |
| 592 | Ga0496121_0149139 | 3300048924 | Bacteria | 1724 |
| 593 | Ga0496122_0016424 | 3300048925 | Bacteria | 7004 |
| 594 | Ga0496122_0042838 | 3300048925 | Bacteria | 3555 |
| 595 | Ga0496122_0045072 | 3300048925 | Bacteria | 3432 |
| 596 | Ga0496122_0106783 | 3300048925 | Bacteria | 1852 |
| 597 | Ga0496122_0255503 | 3300048925 | Bacteria | 976 |
| 598 | Ga0496123_0030860 | 3300048926 | Bacteria | 3914 |
| 599 | Ga0496123_0101778 | 3300048926 | Bacteria | 1669 |
| 600 | Ga0496123_0122028 | 3300048926 | Bacteria | 1463 |
| 601 | Ga0496123_0129984 | 3300048926 | Bacteria | 1397 |
| 602 | Ga0496124_0000035 | 3300048927 | Bacteria | 318099 |
| 603 | Ga0496124_0000239 | 3300048927 | Bacteria | 106633 |
| 604 | Ga0496124_0000426 | 3300048927 | Bacteria | 75499 |
| 605 | Ga0496124_0004925 | 3300048927 | Bacteria | 15332 |
| 606 | Ga0496124_0075394 | 3300048927 | Bacteria | 2786 |
| 607 | Ga0496124_0077830 | 3300048927 | Bacteria | 2734 |
| 608 | Ga0496124_0146188 | 3300048927 | Bacteria | 1860 |
| 609 | Ga0496125_0000266 | 3300048928 | Bacteria | 107204 |
| 610 | Ga0496125_0001791 | 3300048928 | Bacteria | 29691 |
| 611 | Ga0496125_0026408 | 3300048928 | Bacteria | 5292 |
| 612 | Ga0496125_0032347 | 3300048928 | Bacteria | 4647 |
| 613 | Ga0496125_0067574 | 3300048928 | Bacteria | 2815 |
| 614 | Ga0496126_0009133 | 3300048929 | Bacteria | 10578 |
| 615 | Ga0496126_0029029 | 3300048929 | Bacteria | 5259 |
| 616 | Ga0496126_0048532 | 3300048929 | Bacteria | 3878 |
| 617 | Ga0496126_0213918 | 3300048929 | Bacteria | 1622 |
| 618 | Ga0495678_000008 | 3300049459 | Bacteria | 445926 |
| 619 | Ga0495678_000011 | 3300049459 | Bacteria | 335512 |
| 620 | Ga0495678_000255 | 3300049459 | Bacteria | 59619 |
| 621 | Ga0495678_001291 | 3300049459 | Bacteria | 20231 |
| 622 | Ga0495678_009198 | 3300049459 | Bacteria | 4915 |
| 623 | Ga0495682_0030923 | 3300049460 | Bacteria | 1980 |
| 624 | Ga0501031_0000002 | 3300049568 | Bacteria | 217588 |
| 625 | Ga0501031_0095966 | 3300049568 | Bacteria | 1935 |
| 626 | Ga0501031_0333377 | 3300049568 | Bacteria | 982 |
| 627 | Ga0501032_0000004 | 3300049569 | Bacteria | 310855 |
| 628 | Ga0501032_0007011 | 3300049569 | Bacteria | 8264 |
| 629 | Ga0501032_0024083 | 3300049569 | Bacteria | 4204 |
| 630 | Ga0501032_0084271 | 3300049569 | Bacteria | 2113 |
| 631 | Ga0501032_0113675 | 3300049569 | Bacteria | 1791 |
| 632 | Ga0501032_0121464 | 3300049569 | Bacteria | 1727 |
| 633 | Ga0501033_0000016 | 3300049570 | Bacteria | 217458 |
| 634 | Ga0501033_0000776 | 3300049570 | Bacteria | 29378 |
| 635 | Ga0501033_0004986 | 3300049570 | Bacteria | 10556 |
| 636 | Ga0501033_0019437 | 3300049570 | Bacteria | 5137 |
| 637 | Ga0501033_0056499 | 3300049570 | Bacteria | 2901 |
| 638 | Ga0501033_0435889 | 3300049570 | Bacteria | 911 |
| 639 | Ga0501034_0000011 | 3300049571 | Bacteria | 310855 |
| 640 | Ga0501034_0004793 | 3300049571 | Bacteria | 14958 |
| 641 | Ga0501034_0078297 | 3300049571 | Bacteria | 3311 |
| 642 | Ga0501034_0120939 | 3300049571 | Bacteria | 2605 |
| 643 | Ga0501036_0000001 | 3300049572 | Bacteria | 310855 |
| 644 | Ga0501036_0003294 | 3300049572 | Bacteria | 12883 |
| 645 | Ga0501036_0017362 | 3300049572 | Bacteria | 6016 |
| 646 | Ga0501036_0102500 | 3300049572 | Bacteria | 2421 |
| 647 | Ga0501037_0000006 | 3300049573 | Bacteria | 217461 |
| 648 | Ga0501037_0005086 | 3300049573 | Bacteria | 9569 |
| 649 | Ga0501038_0000003 | 3300049574 | Bacteria | 310855 |
| 650 | Ga0501038_0006213 | 3300049574 | Bacteria | 11049 |
| 651 | Ga0501038_0034451 | 3300049574 | Bacteria | 4452 |
| 652 | Ga0501038_0050397 | 3300049574 | Bacteria | 3597 |
| 653 | Ga0501038_0208395 | 3300049574 | Bacteria | 1565 |
| 654 | Ga0501039_0000004 | 3300049575 | Bacteria | 310855 |
| 655 | Ga0501039_0001298 | 3300049575 | Bacteria | 18251 |
| 656 | Ga0501039_0002554 | 3300049575 | Bacteria | 13579 |
| 657 | Ga0501040_0012498 | 3300049576 | Bacteria | 5563 |
| 658 | Ga0501040_0031479 | 3300049576 | Bacteria | 3586 |
| 659 | Ga0501041_0017232 | 3300049577 | Bacteria | 4299 |
| 660 | Ga0501042_0035928 | 3300049578 | Bacteria | 3516 |
| 661 | Ga0501043_0000155 | 3300049579 | Bacteria | 62570 |
| 662 | Ga0501043_0011433 | 3300049579 | Bacteria | 6949 |
| 663 | Ga0501043_0013677 | 3300049579 | Bacteria | 6352 |
| 664 | Ga0501043_0058597 | 3300049579 | Bacteria | 3023 |
| 665 | Ga0501043_0173316 | 3300049579 | Bacteria | 1683 |
| 666 | Ga0501043_0250168 | 3300049579 | Bacteria | 1365 |
| 667 | Ga0501046_0001714 | 3300049580 | Bacteria | 20920 |
| 668 | Ga0501046_0105275 | 3300049580 | Bacteria | 2161 |
| 669 | Ga0501047_0008235 | 3300049581 | Bacteria | 9840 |
| 670 | Ga0501047_0021199 | 3300049581 | Bacteria | 6240 |
| 671 | Ga0501047_0028069 | 3300049581 | Bacteria | 5424 |
| 672 | Ga0501047_0051856 | 3300049581 | Bacteria | 3965 |
| 673 | Ga0501047_0167134 | 3300049581 | Bacteria | 2070 |
| 674 | Ga0501047_0188275 | 3300049581 | Bacteria | 1928 |
| 675 | Ga0501048_0023429 | 3300049582 | Bacteria | 4510 |
| 676 | Ga0501048_0098677 | 3300049582 | Bacteria | 2060 |
| 677 | Ga0501067_0011153 | 3300049583 | Bacteria | 4972 |
| 678 | Ga0501067_0032647 | 3300049583 | Bacteria | 2889 |
| 679 | Ga0501067_0103336 | 3300049583 | Bacteria | 1583 |
| 680 | Ga0501068_0391808 | 3300049584 | Bacteria | 895 |
| 681 | Ga0501069_0002311 | 3300049585 | Bacteria | 9623 |
| 682 | Ga0501069_0002521 | 3300049585 | Bacteria | 9350 |
| 683 | Ga0501069_0044511 | 3300049585 | Bacteria | 2457 |
| 684 | Ga0501070_0004969 | 3300049586 | Bacteria | 11347 |
| 685 | Ga0501070_0022569 | 3300049586 | Bacteria | 5271 |
| 686 | Ga0501070_0024946 | 3300049586 | Bacteria | 5014 |
| 687 | Ga0501070_0285997 | 3300049586 | Bacteria | 1345 |
| 688 | Ga0501072_0224161 | 3300049588 | Bacteria | 1498 |
| 689 | Ga0501073_0002004 | 3300049589 | Bacteria | 15198 |
| 690 | Ga0501073_0081427 | 3300049589 | Bacteria | 2252 |
| 691 | Ga0501074_0005021 | 3300049590 | Bacteria | 9496 |
| 692 | Ga0501074_0015837 | 3300049590 | Bacteria | 5483 |
| 693 | Ga0501076_0033050 | 3300049592 | Bacteria | 4039 |
| 694 | Ga0501077_0184996 | 3300049593 | Bacteria | 1324 |
| 695 | Ga0501080_0002095 | 3300049742 | Bacteria | 17315 |
| 696 | Ga0501080_0005500 | 3300049742 | Bacteria | 11307 |
| 697 | Ga0501080_0054430 | 3300049742 | Bacteria | 3726 |
| 698 | Ga0501080_0059597 | 3300049742 | Bacteria | 3552 |
| 699 | Ga0501080_0303918 | 3300049742 | Bacteria | 1446 |
| 700 | Ga0501081_0051987 | 3300049743 | Bacteria | 2826 |
| 701 | Ga0501081_0165934 | 3300049743 | Bacteria | 1593 |
| 702 | Ga0501083_0006586 | 3300049744 | Bacteria | 8243 |
| 703 | Ga0501083_0015812 | 3300049744 | Bacteria | 5282 |
| 704 | Ga0501035_0000009 | 3300049822 | Bacteria | 310827 |
| 705 | Ga0501035_0000882 | 3300049822 | Bacteria | 31844 |
| 706 | Ga0501035_0003895 | 3300049822 | Bacteria | 14234 |
| 707 | Ga0501035_0010603 | 3300049822 | Bacteria | 8534 |
| 708 | Ga0501035_0011132 | 3300049822 | Bacteria | 8331 |
| 709 | Ga0501035_0086021 | 3300049822 | Bacteria | 2770 |
| 710 | Ga0501035_0138933 | 3300049822 | Bacteria | 2113 |
| 711 | Ga0501035_0556100 | 3300049822 | Bacteria | 939 |
| 712 | Ga0501044_0000005 | 3300049823 | Bacteria | 310855 |
| 713 | Ga0501044_0002857 | 3300049823 | Bacteria | 19658 |
| 714 | Ga0501044_0004158 | 3300049823 | Bacteria | 16261 |
| 715 | Ga0501044_0008383 | 3300049823 | Bacteria | 11335 |
| 716 | Ga0501044_0058607 | 3300049823 | Bacteria | 3948 |
| 717 | Ga0501044_0108391 | 3300049823 | Bacteria | 2787 |
| 718 | Ga0501044_0145502 | 3300049823 | Bacteria | 2356 |
| 719 | Ga0501045_0035725 | 3300049824 | Bacteria | 3608 |
| 720 | Ga0501045_0192189 | 3300049824 | Bacteria | 1521 |
| 721 | nmdc:mga03683_1610_c1 | 3300050489 | Bacteria | 6761 |
| 722 | nmdc:mga00v17_156797_c1 | 3300050491 | Bacteria | 1129 |
| 723 | nmdc:mga00v17_34678_c1 | 3300050491 | Bacteria | 2999 |
| 724 | nmdc:mga00v17_78_c1 | 3300050491 | Bacteria | 40508 |
| 725 | nmdc:mga06z11_130956_c1 | 3300050494 | Bacteria | 1409 |
| 726 | nmdc:mga05p37_91105_c1 | 3300050507 | Bacteria | 3757 |
| 727 | nmdc:mga0qj67_35425_c1 | 3300050509 | Bacteria | 3902 |
| 728 | nmdc:mga06r32_63496_c1 | 3300050510 | Bacteria | 3560 |
| 729 | Ga0500610_0111003 | 3300053079 | Bacteria | 1410 |
| 730 | Ga0500635_0076582 | 3300053080 | Bacteria | 1195 |
| 731 | Ga0500578_0027239 | 3300053086 | Bacteria | 3669 |
| 732 | Ga0500578_0080411 | 3300053086 | Bacteria | 2073 |
| 733 | Ga0500578_0144913 | 3300053086 | Bacteria | 1483 |
| 734 | Ga0500643_000018 | 3300053087 | Bacteria | 296505 |
| 735 | Ga0500651_0047064 | 3300053093 | Bacteria | 2712 |
| 736 | Ga0500557_026644 | 3300053105 | Bacteria | 1712 |
| 737 | Ga0500569_013068 | 3300053109 | Bacteria | 2024 |
| 738 | Ga0500594_0013298 | 3300053118 | Bacteria | 1955 |
| 739 | Ga0500595_025960 | 3300053119 | Bacteria | 2024 |
| 740 | Ga0500618_001769 | 3300053125 | Bacteria | 9143 |
| 741 | Ga0500628_048075 | 3300053129 | Bacteria | 1002 |
| 742 | Ga0500658_0089692 | 3300053134 | Bacteria | 1327 |
| 743 | Ga0500568_0000559 | 3300053139 | Bacteria | 27350 |
| 744 | Ga0500573_0000318 | 3300053140 | Bacteria | 20446 |
| 745 | Ga0500573_0186650 | 3300053140 | Bacteria | 1110 |
| 746 | Ga0500577_0015467 | 3300053142 | Bacteria | 2385 |
| 747 | Ga0500577_0140349 | 3300053142 | Bacteria | 1019 |
| 748 | Ga0500588_0000513 | 3300053146 | Bacteria | 6205 |
| 749 | Ga0500590_008948 | 3300053148 | Bacteria | 5016 |
| 750 | Ga0500590_100009 | 3300053148 | Bacteria | 1394 |
| 751 | Ga0500603_023857 | 3300053150 | Bacteria | 1526 |
| 752 | Ga0500616_0121440 | 3300053153 | Bacteria | 1247 |
| 753 | Ga0500634_0030134 | 3300053161 | Bacteria | 2956 |
| 754 | Ga0500638_083866 | 3300053162 | Bacteria | 1510 |
| 755 | Ga0500636_0003139 | 3300053177 | Bacteria | 9260 |
| 756 | Ga0500637_0096670 | 3300053178 | Bacteria | 1711 |
| 757 | Ga0500657_052883 | 3300053728 | Bacteria | 1845 |
| 758 | Ga0501084_0007525 | 3300054114 | Bacteria | 8979 |
| 759 | Ga0587077_000735 | 3300059493 | Bacteria | 3082 |
| 760 | Ga0587090_000082 | 3300059510 | Bacteria | 5551 |
| 761 | Ga0587101_000045 | 3300059623 | Bacteria | 5392 |
| 762 | Ga0587128_000033 | 3300059630 | Bacteria | 5729 |
| 763 | Ga0587062_003060 | 3300059639 | Bacteria | 1659 |
| 764 | Ga0501082_0010931 | 3300060353 | Bacteria | 7812 |
| 765 | Ga0501082_0028554 | 3300060353 | Bacteria | 4805 |
| 766 | Ga0501082_0080476 | 3300060353 | Bacteria | 2811 |
| 767 | Ga0501082_0094165 | 3300060353 | Bacteria | 2588 |
| 768 | Ga0501082_0133163 | 3300060353 | Bacteria | 2157 |
| 769 | Ga0501082_0136596 | 3300060353 | Bacteria | 2128 |
| 770 | 2511255533 | 2511231004 | Bacteria | 6669789 |
| 771 | 2509108037 | 2508501122 | Bacteria | 6292184 |
| 772 | 2509140883 | 2508501127 | Bacteria | 7037543 |
| 773 | 2509376783 | 2509276019 | Bacteria | 6802256 |
| 774 | 2510282181 | 2510065053 | Bacteria | 5005518 |
| 775 | 2510291614 | 2510065055 | Bacteria | 5037935 |
| 776 | 2510308310 | 2510065057 | Bacteria | 6649661 |
| 777 | 2510310329 | 2510065058 | Bacteria | 5005894 |
| 778 | 2511270464 | 2511231007 | Bacteria | 6306603 |
| 779 | 2511328534 | 2511231016 | Bacteria | 6704427 |
| 780 | 2511362772 | 2511231022 | Bacteria | 6719296 |
| 781 | 2511391656 | 2511231027 | Bacteria | 5013807 |
| 782 | 2511502514 | 2511231052 | Bacteria | 6974333 |
| 783 | 2511824950 | 2511231156 | Bacteria | 6845832 |
| 784 | 2512533888 | 2512047086 | Bacteria | 6850303 |
| 785 | 2512970353 | 2512875026 | Bacteria | 6861065 |
| 786 | 2513581640 | 2513237085 | Bacteria | 7695351 |
| 787 | 2513587454 | 2513237086 | Bacteria | 7265287 |
| 788 | 2513601417 | 2513237089 | Bacteria | 6553624 |
| 789 | 2513619568 | 2513237091 | Bacteria | 6900273 |
| 790 | 2513881799 | 2513237140 | Bacteria | 7076289 |
| 791 | 2513904943 | 2513237143 | Bacteria | 6664116 |
| 792 | 2513983615 | 2513237156 | Bacteria | 6402557 |
| 793 | 2513997563 | 2513237159 | Bacteria | 6810126 |
| 794 | 2514003136 | 2513237160 | Bacteria | 6650282 |
| 795 | 2515609302 | 2515154107 | Bacteria | 6795637 |
| 796 | 2515744628 | 2515154134 | Bacteria | 7220242 |
| 797 | 2516206065 | 2516143018 | Bacteria | 6951533 |
| 798 | 2516893889 | 2516653046 | Bacteria | 6989037 |
| 799 | 2517570609 | 2517487022 | Bacteria | 7227575 |
| 800 | 2524448288 | 2524023207 | Bacteria | 6813453 |
| 801 | 2551679604 | 2551306084 | Bacteria | 8942552 |
| 802 | 2551689435 | 2551306085 | Bacteria | 7347181 |
| 803 | 2551696966 | 2551306086 | Bacteria | 6843938 |
| 804 | 2551701303 | 2551306087 | Bacteria | 7351905 |
| 805 | 2551709517 | 2551306089 | Bacteria | 7162724 |
| 806 | 2551723850 | 2551306090 | Bacteria | 7953713 |
| 807 | 2551724796 | 2551306091 | Bacteria | 7086830 |
| 808 | 2551735549 | 2551306092 | Bacteria | 6992595 |
| 809 | 2551743360 | 2551306093 | Bacteria | 7064773 |
| 810 | 2558865859 | 2558860100 | Bacteria | 8458965 |
| 811 | 2585167565 | 2582581283 | Bacteria | 6030556 |
| 812 | 2585265791 | 2582581306 | Bacteria | 6450535 |
| 813 | 2585389038 | 2582581865 | Bacteria | 6644329 |
| 814 | 2585395185 | 2582581866 | Bacteria | 6859583 |
| 815 | 2585405028 | 2582581867 | Bacteria | 7184437 |
| 816 | 2585530386 | 2585427526 | Bacteria | 7258840 |
| 817 | 2597864445 | 2597489888 | Bacteria | 6179543 |
| 818 | 2597869431 | 2597489889 | Bacteria | 6297495 |
| 819 | 2599331208 | 2599185155 | Bacteria | 5827168 |
| 820 | 2599332103 | 2599185156 | Bacteria | 5403036 |
| 821 | 2599399331 | 2599185167 | Bacteria | 6353609 |
| 822 | 2599453568 | 2599185179 | Bacteria | 6611171 |
| 823 | 2599500654 | 2599185188 | Bacteria | 6164180 |
| 824 | 2599510450 | 2599185189 | Bacteria | 5862825 |
| 825 | 2599513822 | 2599185190 | Bacteria | 6285678 |
| 826 | 2599519001 | 2599185191 | Bacteria | 6297582 |
| 827 | 2599606177 | 2599185210 | Bacteria | 5624189 |
| 828 | 2599612851 | 2599185212 | Bacteria | 6765997 |
| 829 | 2599769057 | 2599185248 | Bacteria | 6696816 |
| 830 | 2599880997 | 2599185288 | Bacteria | 6666191 |
| 831 | 2599888302 | 2599185289 | Bacteria | 6778765 |
| 832 | 2599892879 | 2599185290 | Bacteria | 6289611 |
| 833 | 2599895970 | 2599185291 | Bacteria | 6775623 |
| 834 | 2599932317 | 2599185300 | Bacteria | 6062622 |
| 835 | 2599951210 | 2599185303 | Bacteria | 6512725 |
| 836 | 2599957855 | 2599185305 | Bacteria | 6748700 |
| 837 | 2599966795 | 2599185306 | Bacteria | 6637356 |
| 838 | 2599970876 | 2599185307 | Bacteria | 6194719 |
| 839 | 2599978074 | 2599185308 | Bacteria | 6621546 |
| 840 | 2599993363 | 2599185311 | Bacteria | 6354990 |
| 841 | 2600004052 | 2599185313 | Bacteria | 6658188 |
| 842 | 2600012199 | 2599185314 | Bacteria | 6621749 |
| 843 | 2600015578 | 2599185315 | Bacteria | 6771107 |
| 844 | 2600021948 | 2599185316 | Bacteria | 6320029 |
| 845 | 2600028538 | 2599185317 | Bacteria | 6435722 |
| 846 | 2600037545 | 2599185318 | Bacteria | 6961590 |
| 847 | 2600042858 | 2599185319 | Bacteria | 6637840 |
| 848 | 2600050786 | 2599185321 | Bacteria | 6764560 |
| 849 | 2600060068 | 2599185322 | Bacteria | 6763055 |
| 850 | 2600063289 | 2599185323 | Bacteria | 6688755 |
| 851 | 2600072686 | 2599185324 | Bacteria | 6590677 |
| 852 | 2600075222 | 2599185325 | Bacteria | 6324919 |
| 853 | 2600196066 | 2599185352 | Bacteria | 7228948 |
| 854 | 2600357705 | 2600254930 | Bacteria | 6431253 |
| 855 | 2601690328 | 2600255296 | Bacteria | 5784754 |
| 856 | 2621299175 | 2619619299 | Bacteria | 6649820 |
| 857 | 2624492081 | 2623620446 | Bacteria | 6500345 |
| 858 | 2643804393 | 2643221557 | Bacteria | 7184309 |
| 859 | 2643871753 | 2643221571 | Bacteria | 6228673 |
| 860 | 2643917569 | 2643221582 | Bacteria | 5804683 |
| 861 | 2644050092 | 2643221607 | Bacteria | 6314006 |
| 862 | 2644065164 | 2643221610 | Bacteria | 7480339 |
| 863 | 2644105456 | 2643221618 | Bacteria | 7717186 |
| 864 | 2644133858 | 2643221623 | Bacteria | 5239945 |
| 865 | 2644146459 | 2643221626 | Bacteria | 8069654 |
| 866 | 2644204848 | 2643221636 | Bacteria | 6583769 |
| 867 | 2644208686 | 2643221637 | Bacteria | 5345260 |
| 868 | 2644283950 | 2643221650 | Bacteria | 7029547 |
| 869 | 2644298176 | 2643221653 | Bacteria | 4569637 |
| 870 | 2644308207 | 2643221655 | Bacteria | 7722067 |
| 871 | 2644334031 | 2643221659 | Bacteria | 7890716 |
| 872 | 2644377573 | 2643221668 | Bacteria | 7306521 |
| 873 | 2644416836 | 2643221675 | Bacteria | 7473456 |
| 874 | 2644449876 | 2643221680 | Bacteria | 7473610 |
| 875 | 2644483013 | 2643221686 | Bacteria | 6310811 |
| 876 | 2644494204 | 2643221688 | Bacteria | 5260751 |
| 877 | 2644497680 | 2643221689 | Bacteria | 6042950 |
| 878 | 2644541628 | 2643221698 | Bacteria | 7756764 |
| 879 | 2644615489 | 2643221712 | Bacteria | 7729434 |
| 880 | 2644620552 | 2643221713 | Bacteria | 6554480 |
| 881 | 2644652216 | 2643221718 | Bacteria | 5345506 |
| 882 | 2644656428 | 2643221719 | Bacteria | 4568197 |
| 883 | 2644672771 | 2643221723 | Bacteria | 7095460 |
| 884 | 2644690011 | 2643221726 | Bacteria | 7455827 |
| 885 | 2657684856 | 2657244999 | Bacteria | 5946535 |
| 886 | 2671088662 | 2667528170 | Bacteria | 6786960 |
| 887 | 2671126296 | 2667528176 | Bacteria | 6724917 |
| 888 | 2677899174 | 2675903420 | Bacteria | 6247433 |
| 889 | 2678263614 | 2675903515 | Bacteria | 6580491 |
| 890 | 2692315172 | 2690316117 | Bacteria | 6800650 |
| 891 | 2715498988 | 2713897090 | Bacteria | 3353799 |
| 892 | 2723249149 | 2721755607 | Bacteria | 5841722 |
| 893 | 2738672332 | 2738541265 | Bacteria | 6594665 |
| 894 | 2738687787 | 2738541271 | Bacteria | 5657310 |
| 895 | 2738750725 | 2738541282 | Bacteria | 6593925 |
| 896 | 2738812155 | 2738541294 | Bacteria | 6925949 |
| 897 | 2738859766 | 2738541303 | Bacteria | 6591772 |
| 898 | 2738899515 | 2738541309 | Bacteria | 6926455 |
| 899 | 2738944305 | 2738541317 | Bacteria | 5340176 |
| 900 | 2739263778 | 2738543016 | Bacteria | 5657564 |
| 901 | 2745009945 | 2744054620 | Bacteria | 6551379 |
| 902 | 2753463347 | 2751185821 | Bacteria | 6189929 |
| 903 | 2757571031 | 2757320392 | Bacteria | 3737298 |
| 904 | 2765467721 | 2765235802 | Bacteria | 5618596 |
| 905 | 2770197825 | 2767802442 | Bacteria | 5747986 |
| 906 | 2774130883 | 2773857672 | Bacteria | 4993178 |
| 907 | 2776269099 | 2775506902 | Bacteria | 6208009 |
| 908 | 2776283762 | 2775506904 | Bacteria | 5954060 |
| 909 | 2792581543 | 2791355082 | Bacteria | 5973319 |
| 910 | 2792620474 | 2791355091 | Bacteria | 6135441 |
| 911 | 2792625832 | 2791355092 | Bacteria | 6248105 |
| 912 | 2792638774 | 2791355094 | Bacteria | 7011481 |
| 913 | 2793365768 | 2791355267 | Bacteria | 7222458 |
| 914 | 2794597186 | 2791355520 | Bacteria | 5948615 |
| 915 | 2802716710 | 2802428858 | Bacteria | 6636079 |
| 916 | 2802725521 | 2802428859 | Bacteria | 6667919 |
| 917 | 2802730387 | 2802428860 | Bacteria | 6525526 |
| 918 | 2802737641 | 2802428861 | Bacteria | 6534206 |
| 919 | 2802742969 | 2802428862 | Bacteria | 6633353 |
| 920 | 2802750393 | 2802428863 | Bacteria | 6410669 |
| 921 | 2804753014 | 2802429268 | Bacteria | 6094027 |
| 922 | 2808933235 | 2808606377 | Bacteria | 6646337 |
| 923 | 2808955391 | 2808606381 | Bacteria | 6646461 |
| 924 | 2808978603 | 2808606385 | Bacteria | 6711065 |
| 925 | 2808993870 | 2808606388 | Bacteria | 6706662 |
| 926 | 2809214687 | 2808606445 | Bacteria | 6057339 |
| 927 | 2817491738 | 2816332298 | Bacteria | 6852809 |
| 928 | 2819244229 | 2818991272 | Bacteria | 4622173 |
| 929 | 2825651962 | 2825651385 | Bacteria | 6715909 |
| 930 | 2826586838 | 2826581358 | Bacteria | 5963467 |
| 931 | 2834030314 | 2834028612 | Bacteria | 6354979 |
| 932 | 2837652464 | 2837651117 | Bacteria | 3772164 |
| 933 | 2838079667 | 2838074704 | Bacteria | 6785777 |
| 934 | 2838679979 | 2838675328 | Bacteria | 4909118 |
| 935 | 2838717776 | 2838714209 | Bacteria | 5525906 |
| 936 | 2838724550 | 2838719591 | Bacteria | 5523910 |
| 937 | 2838729508 | 2838724970 | Bacteria | 4908691 |
| 938 | 2839993719 | 2839993093 | Bacteria | 5512535 |
| 939 | 2840766749 | 2840764183 | Bacteria | 6358399 |
| 940 | 2841849944 | 2841846520 | Bacteria | 5345850 |
| 941 | 2842128416 | 2842124991 | Bacteria | 5346824 |
| 942 | 2842134661 | 2842130223 | Bacteria | 4909145 |
| 943 | 2842156507 | 2842152218 | Bacteria | 4908957 |
| 944 | 2842165274 | 2842163707 | Bacteria | 6916235 |
| 945 | 2842174021 | 2842170452 | Bacteria | 5525737 |
| 946 | 2842180128 | 2842175837 | Bacteria | 4908771 |
| 947 | 2842192127 | 2842187318 | Bacteria | 5524014 |
| 948 | 2842216593 | 2842211629 | Bacteria | 5523832 |
| 949 | 2842229163 | 2842224351 | Bacteria | 5524473 |
| 950 | 2842522194 | 2842521101 | Bacteria | 6569494 |
| 951 | 2842819309 | 2842815866 | Bacteria | 5947510 |
| 952 | 2842828371 | 2842826826 | Bacteria | 5974129 |
| 953 | 2842842753 | 2842837860 | Bacteria | 6066181 |
| 954 | 2842852295 | 2842849001 | Bacteria | 5924277 |
| 955 | 2842858163 | 2842854478 | Bacteria | 6143501 |
| 956 | 2842875241 | 2842871566 | Bacteria | 4827117 |
| 957 | 2842924458 | 2842922631 | Bacteria | 5824079 |
| 958 | 2844166370 | 2844163670 | Bacteria | 7266046 |
| 959 | 2847419771 | 2847417321 | Bacteria | 6913799 |
| 960 | 2848994788 | 2848992105 | Bacteria | 6810864 |
| 961 | 2850081786 | 2850079185 | Bacteria | 6848280 |
| 962 | 2852617365 | 2852612431 | Bacteria | 6885235 |
| 963 | 2852672516 | 2852667396 | Bacteria | 6885555 |
| 964 | 2855023505 | 2855020534 | Bacteria | 3204685 |
| 965 | 2855826614 | 2855825444 | Bacteria | 6785811 |
| 966 | 2855842005 | 2855839649 | Bacteria | 7135830 |
| 967 | 2855877287 | 2855872281 | Bacteria | 6964271 |
| 968 | 2858802679 | 2858800743 | Bacteria | 6603254 |
| 969 | 2860870199 | 2860867994 | Bacteria | 5645326 |
| 970 | 2871451905 | 2871444079 | Bacteria | 6423508 |
| 971 | 2874105844 | 2874102143 | Bacteria | 6342645 |
| 972 | 2876398314 | 2876392853 | Bacteria | 6660880 |
| 973 | 2881167401 | 2881161766 | Bacteria | 7127907 |
| 974 | 2885309303 | 2885305155 | Bacteria | 7348390 |
| 975 | 2885330060 | 2885326080 | Bacteria | 7134805 |
| 976 | 2889790840 | 2889790730 | Bacteria | 5689708 |
| 977 | 2889915222 | 2889914905 | Bacteria | 5702301 |
| 978 | 2896391221 | 2896384573 | Bacteria | 7700774 |
| 979 | 2898798577 | 2898795034 | Bacteria | 4294459 |
| 980 | 2899261641 | 2899259804 | Bacteria | 3320927 |
| 981 | 2899276501 | 2899275550 | Bacteria | 3958688 |
| 982 | 2899793172 | 2899792073 | Bacteria | 4926588 |
| 983 | 2904579571 | 2904578770 | Bacteria | 5302906 |
| 984 | 2904664869 | 2904659560 | Bacteria | 6685615 |
| 985 | 2906330113 | 2906328253 | Bacteria | 6585166 |
| 986 | 2908450236 | 2908446538 | Bacteria | 6829095 |
| 987 | 2909400050 | 2909399089 | Bacteria | 3922598 |
| 988 | 2913039692 | 2913036834 | Bacteria | 6704877 |
| 989 | 2913308924 | 2913308742 | Bacteria | 5350706 |
| 990 | 2915981149 | 2915980308 | Bacteria | 6624279 |
| 991 | 2915993243 | 2915986958 | Bacteria | 6739310 |
| 992 | 2915999028 | 2915993759 | Bacteria | 7016183 |
| 993 | 2916005056 | 2916000859 | Bacteria | 6865702 |
| 994 | 2916012722 | 2916007675 | Bacteria | 6898660 |
| 995 | 2916018950 | 2916014648 | Bacteria | 6946486 |
| 996 | 2916023027 | 2916021584 | Bacteria | 6854472 |
| 997 | 2916034189 | 2916028427 | Bacteria | 6748433 |
| 998 | 2916039353 | 2916035215 | Bacteria | 6755766 |
| 999 | 2916044383 | 2916041962 | Bacteria | 6820487 |
| 1000 | 2916050431 | 2916048683 | Bacteria | 6543552 |
| 1001 | 2916061494 | 2916055098 | Bacteria | 6758838 |
| 1002 | 2916068638 | 2916061851 | Bacteria | 6737736 |
| 1003 | 2916080481 | 2916076590 | Bacteria | 6596108 |
| 1004 | 2917835819 | 2917832318 | Bacteria | 5346010 |
| 1005 | 2919118056 | 2919114240 | Bacteria | 5700270 |
| 1006 | 2919120763 | 2919119836 | Bacteria | 5208557 |
| 1007 | 2919125780 | 2919125081 | Bacteria | 5385106 |
| 1008 | 2919484780 | 2919481497 | Bacteria | 6907839 |
| 1009 | 2919680091 | 2919679072 | Bacteria | 4629602 |
| 1010 | 2919698253 | 2919697872 | Bacteria | 6553725 |
| 1011 | 2920761177 | 2920760137 | Bacteria | 7427611 |
| 1012 | 2920825632 | 2920822456 | Bacteria | 6897201 |
| 1013 | 2921205774 | 2921201388 | Bacteria | 6926299 |
| 1014 | 2921212567 | 2921208531 | Bacteria | 6745326 |
| 1015 | 2921240006 | 2921237296 | Bacteria | 6876710 |
| 1016 | 2921247801 | 2921244191 | Bacteria | 6568419 |
| 1017 | 2921251658 | 2921250672 | Bacteria | 6677771 |
| 1018 | 2921262645 | 2921257292 | Bacteria | 6808382 |
| 1019 | 2921269622 | 2921263974 | Bacteria | 6864552 |
| 1020 | 2921287141 | 2921282425 | Bacteria | 6826397 |
| 1021 | 2921294111 | 2921289301 | Bacteria | 7316391 |
| 1022 | 2921299553 | 2921296804 | Bacteria | 7176999 |
| 1023 | 2922164822 | 2922158528 | Bacteria | 6573167 |
| 1024 | 2923588855 | 2923586266 | Bacteria | 6565975 |
| 1025 | 2924148575 | 2924144063 | Bacteria | 6883928 |
| 1026 | 2924156539 | 2924150972 | Bacteria | 7169444 |
| 1027 | 2924159894 | 2924158325 | Bacteria | 7188855 |
| 1028 | 2924172242 | 2924165586 | Bacteria | 7260590 |
| 1029 | 2924179667 | 2924172951 | Bacteria | 6749356 |
| 1030 | 2924183491 | 2924179722 | Bacteria | 6843264 |
| 1031 | 2924193098 | 2924186466 | Bacteria | 6876637 |
| 1032 | 2924196448 | 2924193448 | Bacteria | 6955718 |
| 1033 | 2924203898 | 2924200457 | Bacteria | 6757188 |
| 1034 | 2924210809 | 2924207177 | Bacteria | 6917007 |
| 1035 | 2924216577 | 2924214083 | Bacteria | 7080103 |
| 1036 | 2924225643 | 2924221636 | Bacteria | 7113495 |
| 1037 | 2924233263 | 2924228884 | Bacteria | 6633132 |
| 1038 | 2924728687 | 2924726620 | Bacteria | 6271473 |
| 1039 | 2926757821 | 2926754445 | Bacteria | 5964435 |
| 1040 | 2928522366 | 2928521798 | Bacteria | 4960112 |
| 1041 | 2929146605 | 2929144301 | Bacteria | 6622272 |
| 1042 | 2929147568 | 2929144301 | Bacteria | 6622272 |
| 1043 | 2929192108 | 2929189879 | Bacteria | 5930554 |
| 1044 | 2931369428 | 2931369376 | Bacteria | 6847892 |
| 1045 | 2931394449 | 2931390751 | Bacteria | 6273349 |
| 1046 | 2933010439 | 2933006813 | Bacteria | 4912075 |
| 1047 | 2935902806 | 2935901341 | Bacteria | 7341747 |
| 1048 | 2937002765 | 2936996657 | Bacteria | 6298727 |
| 1049 | 2937005330 | 2937002841 | Bacteria | 6934057 |
| 1050 | 2937012865 | 2937009748 | Bacteria | 6746052 |
| 1051 | 2937021869 | 2937016420 | Bacteria | 6782579 |
| 1052 | 2937027340 | 2937023124 | Bacteria | 6815156 |
| 1053 | 2937035640 | 2937029754 | Bacteria | 6424026 |
| 1054 | 2937039673 | 2937036028 | Bacteria | 6846469 |
| 1055 | 2937044950 | 2937042894 | Bacteria | 6741576 |
| 1056 | 2937055564 | 2937049772 | Bacteria | 6757901 |
| 1057 | 2937063797 | 2937056579 | Bacteria | 7107896 |
| 1058 | 2937068689 | 2937063883 | Bacteria | 7199456 |
| 1059 | 2937075934 | 2937071275 | Bacteria | 6984483 |
| 1060 | 2937080702 | 2937078374 | Bacteria | 6610289 |
| 1061 | 2937090127 | 2937084907 | Bacteria | 6618516 |
| 1062 | 2937097430 | 2937091812 | Bacteria | 6979387 |
| 1063 | 2937101145 | 2937098957 | Bacteria | 7249374 |
| 1064 | 2937110218 | 2937106411 | Bacteria | 6947143 |
| 1065 | 2937117677 | 2937113482 | Bacteria | 6505872 |
| 1066 | 2937124509 | 2937119839 | Bacteria | 6597547 |
| 1067 | 2937132953 | 2937126314 | Bacteria | 6771275 |
| 1068 | 2937897903 | 2937891427 | Bacteria | 6357007 |
| 1069 | 2941504602 | 2941499720 | Bacteria | 7599444 |
| 1070 | 2945933925 | 2945928738 | Bacteria | 6053221 |
| 1071 | 2945964262 | 2945961074 | Bacteria | 7342064 |
| 1072 | 2946009323 | 2946006987 | Bacteria | 6705746 |
| 1073 | 2946030433 | 2946027586 | Bacteria | 6049274 |
| 1074 | 2947237332 | 2947233263 | Bacteria | 6439278 |
| 1075 | 2954014212 | 2954011201 | Bacteria | 4762601 |
| 1076 | 2957380685 | 2957375807 | Bacteria | 6425588 |
| 1077 | 2957387262 | 2957382221 | Bacteria | 6737050 |
| 1078 | 2957389502 | 2957388812 | Bacteria | 6778072 |
| 1079 | 2957397257 | 2957395598 | Bacteria | 6822399 |
| 1080 | 2957408321 | 2957402308 | Bacteria | 6741770 |
| 1081 | 2957412923 | 2957408893 | Bacteria | 6558585 |
| 1082 | 2957418942 | 2957415311 | Bacteria | 6991633 |
| 1083 | 2957423775 | 2957422303 | Bacteria | 7172205 |
| 1084 | 2957435817 | 2957430029 | Bacteria | 7022557 |
| 1085 | 2957438414 | 2957437181 | Bacteria | 6568994 |
| 1086 | 2957450572 | 2957443900 | Bacteria | 6869977 |
| 1087 | 2957451638 | 2957450854 | Bacteria | 6765715 |
| 1088 | 2957460450 | 2957457609 | Bacteria | 6967680 |
| 1089 | 2957468820 | 2957464669 | Bacteria | 6568877 |
| 1090 | 2957476628 | 2957471148 | Bacteria | 6797643 |
| 1091 | 2957483561 | 2957478035 | Bacteria | 6756658 |
| 1092 | 2957489178 | 2957484790 | Bacteria | 6703082 |
| 1093 | 2957495132 | 2957491536 | Bacteria | 6695180 |
| 1094 | 2957501693 | 2957498199 | Bacteria | 7126688 |
| 1095 | 2957512302 | 2957505466 | Bacteria | 7253085 |
| 1096 | 2958118354 | 2958115193 | Bacteria | 6923548 |
| 1097 | 2960584864 | 2960584000 | Bacteria | 6864594 |
| 1098 | 2960591815 | 2960591022 | Bacteria | 6622873 |
| 1099 | 2960602105 | 2960597568 | Bacteria | 6550735 |
| 1100 | 2960604861 | 2960603979 | Bacteria | 6898737 |
| 1101 | 2960613099 | 2960610863 | Bacteria | 6691244 |
| 1102 | 2960617997 | 2960617483 | Bacteria | 6727748 |
| 1103 | 2960625666 | 2960624210 | Bacteria | 6875384 |
| 1104 | 2960634016 | 2960631154 | Bacteria | 6732508 |
| 1105 | 2960639916 | 2960637947 | Bacteria | 7296468 |
| 1106 | 2960651114 | 2960645483 | Bacteria | 7211087 |
| 1107 | 2960655037 | 2960652885 | Bacteria | 7083688 |
| 1108 | 2960667127 | 2960660292 | Bacteria | 7041660 |
| 1109 | 2960670726 | 2960667422 | Bacteria | 6763020 |
| 1110 | 2960675057 | 2960674078 | Bacteria | 6609048 |
| 1111 | 2960680801 | 2960680706 | Bacteria | 6624464 |
| 1112 | 2960688203 | 2960687367 | Bacteria | 6535474 |
| 1113 | 2960699605 | 2960693952 | Bacteria | 6749742 |
| 1114 | 2961119868 | 2961114664 | Bacteria | 6680456 |
| 1115 | 2964608982 | 2964607997 | Bacteria | 7101408 |
| 1116 | 2964621872 | 2964615318 | Bacteria | 6809089 |
| 1117 | 2964628033 | 2964621998 | Bacteria | 6834995 |
| 1118 | 2964634205 | 2964628898 | Bacteria | 7083044 |
| 1119 | 2964639142 | 2964636051 | Bacteria | 7091832 |
| 1120 | 2964646250 | 2964643177 | Bacteria | 6820887 |
| 1121 | 2964651247 | 2964649959 | Bacteria | 6675118 |
| 1122 | 2964663308 | 2964656573 | Bacteria | 7100150 |
| 1123 | 2964667664 | 2964663802 | Bacteria | 7019362 |
| 1124 | 2964671005 | 2964670856 | Bacteria | 6851364 |
| 1125 | 2964682664 | 2964678106 | Bacteria | 6792020 |
| 1126 | 2964689219 | 2964685014 | Bacteria | 6839111 |
| 1127 | 2964694805 | 2964691889 | Bacteria | 6802758 |
| 1128 | 2964704501 | 2964698721 | Bacteria | 6765331 |
| 1129 | 2964706498 | 2964705432 | Bacteria | 7114648 |
| 1130 | 2964718790 | 2964712639 | Bacteria | 6695970 |
| 1131 | 2964725806 | 2964719344 | Bacteria | 7286602 |
| 1132 | 2965064564 | 2965062239 | Bacteria | 7412989 |
| 1133 | 2967665231 | 2967664464 | Bacteria | 6948836 |
| 1134 | 2967672051 | 2967671571 | Bacteria | 7021409 |
| 1135 | 2967685824 | 2967678726 | Bacteria | 7264382 |
| 1136 | 2967690037 | 2967686174 | Bacteria | 6678622 |
| 1137 | 2967698637 | 2967693043 | Bacteria | 6804451 |
| 1138 | 2967701434 | 2967699805 | Bacteria | 6854538 |
| 1139 | 2967711419 | 2967706974 | Bacteria | 7186053 |
| 1140 | 2967720387 | 2967714385 | Bacteria | 7000047 |
| 1141 | 2967727242 | 2967721400 | Bacteria | 7073753 |
| 1142 | 2967734131 | 2967728569 | Bacteria | 6641507 |
| 1143 | 2967739864 | 2967735183 | Bacteria | 6827012 |
| 1144 | 2967743336 | 2967742019 | Bacteria | 6794534 |
| 1145 | 2967754202 | 2967748971 | Bacteria | 6733771 |
| 1146 | 2967759651 | 2967755722 | Bacteria | 6814706 |
| 1147 | 2967768443 | 2967762386 | Bacteria | 6923502 |
| 1148 | 2967772703 | 2967769361 | Bacteria | 6587838 |
| 1149 | 2967776379 | 2967775926 | Bacteria | 6738189 |
| 1150 | 2968096260 | 2968091066 | Bacteria | 6052692 |
| 1151 | 2968098761 | 2968097103 | Bacteria | 6107094 |
| 1152 | 2968116225 | 2968110612 | Bacteria | 6814636 |
| 1153 | 2968129784 | 2968128360 | Bacteria | 6270294 |
| 1154 | 2970024317 | 2970019648 | Bacteria | 7072033 |
| 1155 | 2970027579 | 2970026789 | Bacteria | 6785236 |
| 1156 | 2970035982 | 2970033650 | Bacteria | 7118744 |
| 1157 | 2970045200 | 2970040964 | Bacteria | 6731123 |
| 1158 | 2970051464 | 2970047711 | Bacteria | 7088379 |
| 1159 | 2970056226 | 2970054988 | Bacteria | 6611507 |
| 1160 | 2970065501 | 2970061556 | Bacteria | 7099761 |
| 1161 | 2970070991 | 2970068827 | Bacteria | 7123112 |
| 1162 | 2970079421 | 2970076120 | Bacteria | 6697332 |
| 1163 | 2970084611 | 2970082768 | Bacteria | 6183754 |
| 1164 | 2970094333 | 2970088815 | Bacteria | 6933825 |
| 1165 | 2970099971 | 2970095765 | Bacteria | 6936963 |
| 1166 | 2970103968 | 2970102677 | Bacteria | 6812532 |
| 1167 | 2970111895 | 2970109326 | Bacteria | 6863976 |
| 1168 | 2970120559 | 2970116247 | Bacteria | 6501857 |
| 1169 | 2970126334 | 2970122695 | Bacteria | 6625855 |
| 1170 | 2970134697 | 2970129317 | Bacteria | 6806560 |
| 1171 | 2970141785 | 2970136068 | Bacteria | 7207982 |
| 1172 | 2970147136 | 2970143518 | Bacteria | 6446480 |
| 1173 | 2970152456 | 2970149975 | Bacteria | 6779706 |
| 1174 | 2970162265 | 2970156795 | Bacteria | 7168044 |
| 1175 | 2970168275 | 2970164137 | Bacteria | 6861252 |
| 1176 | 2970175930 | 2970170962 | Bacteria | 6876229 |
| 1177 | 2970181106 | 2970177841 | Bacteria | 6768001 |
| 1178 | 2970186244 | 2970184632 | Bacteria | 7054431 |
| 1179 | 2970196149 | 2970191845 | Bacteria | 7032787 |
| 1180 | 2974299982 | 2974298342 | Bacteria | 4840922 |
| 1181 | 2977523307 | 2977516862 | Bacteria | 6940108 |
| 1182 | 2977528082 | 2977523885 | Bacteria | 6960446 |
| 1183 | 2977536390 | 2977530762 | Bacteria | 6951399 |
| 1184 | 2977543337 | 2977537788 | Bacteria | 6929320 |
| 1185 | 2977549667 | 2977544691 | Bacteria | 6875412 |
| 1186 | 2977553025 | 2977551784 | Bacteria | 7125765 |
| 1187 | 2977564158 | 2977558990 | Bacteria | 6863948 |
| 1188 | 2977568821 | 2977565890 | Bacteria | 6901543 |
| 1189 | 2977574087 | 2977572785 | Bacteria | 6763888 |
| 1190 | 2977585945 | 2977579622 | Bacteria | 6772100 |
| 1191 | 2977861908 | 2977858184 | Bacteria | 6215359 |
| 1192 | 2977870745 | 2977864932 | Bacteria | 7534097 |
| 1193 | 2979783843 | 2979779861 | Bacteria | 6219781 |
| 1194 | 2984502361 | 2984499530 | Bacteria | 5020881 |
| 1195 | 2984508967 | 2984504281 | Bacteria | 5262371 |
| 1196 | 2989350187 | 2989349275 | Bacteria | 6349068 |
| 1197 | 2989773314 | 2989771324 | Bacteria | 5605128 |
| 1198 | 2989776868 | 2989776772 | Bacteria | 4843317 |
| 1199 | 2996316033 | 2996310559 | Bacteria | 6357320 |
| 1200 | 2996336526 | 2996336353 | Bacteria | 5511628 |
| 1201 | 2996346197 | 2996341866 | Bacteria | 6643098 |
| 1202 | 3000021247 | 3000017691 | Bacteria | 3772574 |
| 1203 | 3002142112 | 3002141150 | Bacteria | 5254435 |
| 1204 | 3003934654 | 3003930520 | Bacteria | 5667563 |
| 1205 | 3007869150 | 3007866637 | Bacteria | 5899198 |
| 1206 | 643826665 | 643692032 | Bacteria | 6891900 |
| 1207 | 648739503 | 648276728 | Bacteria | 6968865 |
| 1208 | 8002291010 | 8002285264 | Bacteria | 6717907 |
| 1209 | 8003994440 | 8003992118 | Bacteria | 7266902 |
| 1210 | 8004002146 | 8003999396 | Bacteria | 7063185 |
| 1211 | 8004449331 | 8004445564 | Bacteria | 6322258 |
| 1212 | 8004709256 | 8004703790 | Bacteria | 8006957 |
| 1213 | 8005310733 | 8005307578 | Bacteria | 7395396 |
| 1214 | 8005662259 | 8005658619 | Bacteria | 4500593 |
| 1215 | 8016728730 | 8016728285 | Bacteria | 5263933 |
| 1216 | 8018154682 | 8018150411 | Bacteria | 5549903 |
| 1217 | 8019779860 | 8019775933 | Bacteria | 6858656 |
| 1218 | 8049295625 | 8049293176 | Bacteria | 6128433 |
| 1219 | 8054285922 | 8054285046 | Bacteria | 6919322 |
| 1220 | 8054351531 | 8054347763 | Bacteria | 5901107 |
| 1221 | 8054505757 | 8054503363 | Bacteria | 6101651 |
| 1222 | 8054561884 | 8054558443 | Bacteria | 5204801 |
| 1223 | 8054565921 | 8054563764 | Bacteria | 5592885 |
| 1224 | 8055432183 | 8055431914 | Bacteria | 4551896 |
| 1225 | 8055820275 | 8055817908 | Bacteria | 6609162 |
| 1226 | 8056134324 | 8056131705 | Bacteria | 6107031 |
| 1227 | 8056146190 | 8056143049 | Bacteria | 6307666 |
| 1228 | 8056150112 | 8056148874 | Bacteria | 6479865 |
| 1229 | 8056158912 | 8056155041 | Bacteria | 6486948 |
| 1230 | 8056166550 | 8056161164 | Bacteria | 6106669 |
| 1231 | 8056378661 | 8056375014 | Bacteria | 7006639 |
| 1232 | MRS2a_Contig_26439 | |||
| 1233 | SwRhRL2b_contig_1084298 | |||
| 1234 | JGI25159J45721_1000008 | |||
| 1235 | JGI25160J50197_1000033 | |||
| 1236 | JGI25161J50226_1000460 | |||
| 1237 | Ga0055538_1000240 | |||
| 1238 | Ga0055539_1000276 | |||
| 1239 | Ga0055533_1000264 | |||
| 1240 | Ga0055532_1000303 | |||
| 1241 | Ga0055525_1000368 | |||
| 1242 | Ga0055535_1010651 | |||
| 1243 | Ga0055524_1002673 | |||
| 1244 | Ga0055524_1004228 | |||
| 1245 | Ga0055536_1005066 | |||
| 1246 | Ga0055536_1017275 | |||
| 1247 | Ga0055528_1013363 | |||
| 1248 | Ga0055530_10000019 | |||
| 1249 | Ga0055530_10032509 | |||
| 1250 | Ga0055540_1000055 | |||
| 1251 | Ga0055540_1020293 | |||
| 1252 | Ga0055531_10013457 | |||
| 1253 | Ga0055531_10023444 | |||
| 1254 | Ga0055541_1000174 | |||
| 1255 | Ga0058692_1004321 | |||
| 1256 | Ga0055543_1000026 | |||
| 1257 | Ga0065165_1000178 | |||
| 1258 | Ga0065714_10064569 | |||
| 1259 | Ga0065714_10065532 | |||
| 1260 | Ga0065714_10067736 | |||
| 1261 | Ga0065714_10103007 | |||
| 1262 | Ga0065704_10073109 | |||
| 1263 | Ga0065712_10067965 | |||
| 1264 | Ga0070670_100000320 | |||
| 1265 | Ga0070661_100000542 | |||
| 1266 | Ga0070668_100268916 | |||
| 1267 | Ga0070669_100002464 | |||
| 1268 | Ga0070669_100226125 | |||
| 1269 | Ga0070667_100110464 | |||
| 1270 | Ga0070663_100126448 | |||
| 1271 | Ga0070706_100463698 | |||
| 1272 | Ga0070707_100007996 | |||
| 1273 | Ga0070699_100617659 | |||
| 1274 | Ga0070697_100182771 | |||
| 1275 | Ga0068853_100002470 | |||
| 1276 | Ga0070665_100021962 | |||
| 1277 | Ga0070665_100310000 | |||
| 1278 | Ga0068855_100262194 | |||
| 1279 | Ga0070664_100000573 | |||
| 1280 | Ga0068864_100253724 | |||
| 1281 | Ga0068851_10000496 | |||
| 1282 | Ga0068862_100421155 | |||
| 1283 | Ga0068862_100510015 | |||
| 1284 | Ga0075365_10080763 | |||
| 1285 | Ga0075365_10192672 | |||
| 1286 | Ga0075368_10002683 | |||
| 1287 | Ga0075363_100149399 | |||
| 1288 | Ga0075364_10000074 | |||
| 1289 | Ga0075364_10042300 | |||
| 1290 | Ga0075432_10001221 | |||
| 1291 | Ga0075432_10008296 | |||
| 1292 | Ga0075432_10046576 | |||
| 1293 | Ga0075362_10001566 | |||
| 1294 | Ga0075362_10002799 | |||
| 1295 | Ga0075367_10173662 | |||
| 1296 | Ga0075369_10098754 | |||
| 1297 | Ga0075428_100099432 | |||
| 1298 | Ga0075428_100175897 | |||
| 1299 | Ga0075430_100042774 | |||
| 1300 | Ga0075431_100060324 | |||
| 1301 | Ga0075434_100285627 | |||
| 1302 | Ga0079104_1001498 | |||
| 1303 | Ga0079104_1002729 | |||
| 1304 | Ga0079104_1005594 | |||
| 1305 | Ga0099826_10075882 | |||
| 1306 | Ga0099826_10134000 | |||
| 1307 | Ga0099795_10000722 | |||
| 1308 | Ga0105251_10004799 | |||
| 1309 | Ga0105251_10006015 | |||
| 1310 | Ga0105251_10008857 | |||
| 1311 | Ga0105244_10000741 | |||
| 1312 | Ga0105244_10001750 | |||
| 1313 | Ga0105244_10002217 | |||
| 1314 | Ga0105244_10003560 | |||
| 1315 | Ga0105244_10009527 | |||
| 1316 | Ga0105250_10000064 | |||
| 1317 | Ga0105250_10000426 | |||
| 1318 | Ga0105240_10320663 | |||
| 1319 | Ga0111539_10281585 | |||
| 1320 | Ga0114129_10120872 | |||
| 1321 | Ga0114129_10129765 | |||
| 1322 | Ga0105243_10026924 | |||
| 1323 | Ga0105243_10084947 | |||
| 1324 | Ga0105242_10000808 | |||
| 1325 | Ga0105248_10467769 | |||
| 1326 | Ga0105237_10000096 | |||
| 1327 | Ga0105237_10002778 | |||
| 1328 | Ga0105237_10156526 | |||
| 1329 | Ga0105237_10201694 | |||
| 1330 | Ga0105238_10447232 | |||
| 1331 | Ga0105249_10703009 | |||
| 1332 | Ga0099796_10004345 | |||
| 1333 | Ga0105239_10000658 | |||
| 1334 | Ga0105246_10000442 | |||
| 1335 | Ga0157373_10000324 | |||
| 1336 | Ga0157373_10001736 | |||
| 1337 | Ga0157373_10014229 | |||
| 1338 | Ga0157373_10112917 | |||
| 1339 | Ga0157373_10140499 | |||
| 1340 | Ga0157371_10000283 | |||
| 1341 | Ga0157371_10077570 | |||
| 1342 | Ga0157371_10145560 | |||
| 1343 | Ga0157369_10003599 | |||
| 1344 | Ga0157369_10004013 | |||
| 1345 | Ga0157369_10006150 | |||
| 1346 | Ga0171463_1007 | |||
| 1347 | Ga0163162_10082307 | |||
| 1348 | Ga0163162_10162794 | |||
| 1349 | Ga0163162_10323501 | |||
| 1350 | Ga0163162_10344300 | |||
| 1351 | Ga0163162_10780498 | |||
| 1352 | Ga0157375_10000731 | |||
| 1353 | Ga0157375_10068656 | |||
| 1354 | Ga0157375_10074728 | |||
| 1355 | Ga0157375_10197517 | |||
| 1356 | Ga0182008_10001332 | |||
| 1357 | Ga0157379_10203073 | |||
| 1358 | Ga0182006_1000073 | |||
| 1359 | Ga0182006_1000490 | |||
| 1360 | Ga0182006_1026833 | |||
| 1361 | Ga0182007_10000031 | |||
| 1362 | Ga0182007_10000897 | |||
| 1363 | Ga0182005_1001430 | |||
| 1364 | Ga0183360_10164 | |||
| 1365 | Ga0183363_1084 | |||
| 1366 | Ga0183361_10502 | |||
| 1367 | Ga0163161_10006099 | |||
| 1368 | Ga0163161_10007002 | |||
| 1369 | Ga0163161_10008756 | |||
| 1370 | Ga0163161_10066893 | |||
| 1371 | Ga0163161_10087442 | |||
| 1372 | Ga0214544_1000010 | |||
| 1373 | Ga0214542_1000023 | |||
| 1374 | Ga0214542_1018094 | |||
| 1375 | Ga0214543_1000019 | |||
| 1376 | Ga0214543_1000022 | |||
| 1377 | Ga0213876_10002880 | |||
| 1378 | Ga0224712_10000426 | |||
| 1379 | Ga0228711_1000017 | |||
| 1380 | Ga0228710_1000005 | |||
| 1381 | Ga0209435_100321 | |||
| 1382 | Ga0209784_100112 | |||
| 1383 | Ga0209566_100045 | |||
| 1384 | Ga0209674_100156 | |||
| 1385 | Ga0209147_100056 | |||
| 1386 | Ga0209563_100064 | |||
| 1387 | Ga0207427_101730 | |||
| 1388 | Ga0209258_100588 | |||
| 1389 | Ga0209646_1001226 | |||
| 1390 | Ga0209677_100103 | |||
| 1391 | Ga0209129_1004102 | |||
| 1392 | Ga0209233_1000441 | |||
| 1393 | Ga0209673_1046403 | |||
| 1394 | Ga0209673_1054655 | |||
| 1395 | Ga0209130_1000017 | |||
| 1396 | Ga0209676_1000286 | |||
| 1397 | Ga0209676_1005118 | |||
| 1398 | Ga0209676_1006789 | |||
| 1399 | Ga0209676_1046704 | |||
| 1400 | Ga0209025_1000153 | |||
| 1401 | Ga0209025_1030262 | |||
| 1402 | Ga0209564_1000013 | |||
| 1403 | Ga0209564_1035365 | |||
| 1404 | Ga0209758_1003271 | |||
| 1405 | Ga0209758_1066154 | |||
| 1406 | Ga0209050_1000013 | |||
| 1407 | Ga0209050_1003890 | |||
| 1408 | Ga0209050_1009723 | |||
| 1409 | Ga0209050_1035176 | |||
| 1410 | Ga0209256_1000211 | |||
| 1411 | Ga0209256_1002050 | |||
| 1412 | Ga0209256_1009908 | |||
| 1413 | Ga0207426_1000006 | |||
| 1414 | Ga0209051_1000007 | |||
| 1415 | Ga0209051_1018783 | |||
| 1416 | Ga0209051_1029926 | |||
| 1417 | Ga0209051_1031608 | |||
| 1418 | Ga0209257_1006653 | |||
| 1419 | Ga0209257_1007221 | |||
| 1420 | Ga0209257_1013465 | |||
| 1421 | Ga0209257_1024918 | |||
| 1422 | Ga0207656_10000491 | |||
| 1423 | Ga0207696_1000128 | |||
| 1424 | Ga0207696_1000266 | |||
| 1425 | Ga0207655_1000125 | |||
| 1426 | Ga0207655_1000611 | |||
| 1427 | Ga0207655_1002732 | |||
| 1428 | Ga0207655_1015748 | |||
| 1429 | Ga0207655_1027423 | |||
| 1430 | Ga0207713_1001911 | |||
| 1431 | Ga0207713_1003983 | |||
| 1432 | Ga0207713_1017300 | |||
| 1433 | Ga0207645_10057976 | |||
| 1434 | Ga0207684_10221360 | |||
| 1435 | Ga0207695_10570714 | |||
| 1436 | Ga0207671_10000158 | |||
| 1437 | Ga0207671_10000932 | |||
| 1438 | Ga0207649_10000010 | |||
| 1439 | Ga0207646_10178141 | |||
| 1440 | Ga0207681_10001975 | |||
| 1441 | Ga0207650_10000077 | |||
| 1442 | Ga0207650_10001685 | |||
| 1443 | Ga0207679_10000451 | |||
| 1444 | Ga0207639_10001288 | |||
| 1445 | Ga0207678_10012396 | |||
| 1446 | Ga0207676_10243724 | |||
| 1447 | Ga0207674_10128724 | |||
| 1448 | Ga0207675_100108175 | |||
| 1449 | Ga0209281_1000009 | |||
| 1450 | Ga0209281_1000082 | |||
| 1451 | Ga0209281_1001048 | |||
| 1452 | Ga0209371_1001449 | |||
| 1453 | Ga0209282_1000006 | |||
| 1454 | Ga0209282_1111588 | |||
| 1455 | Ga0207428_10050319 | |||
| 1456 | Ga0268266_10002047 | |||
| 1457 | Ga0268265_10341320 | |||
| 1458 | Ga0307515_10000017 | |||
| 1459 | Ga0307515_10005257 | |||
| 1460 | Ga0307515_10011281 | |||
| 1461 | Ga0307515_10221353 | |||
| 1462 | Ga0265338_10322077 | |||
| 1463 | Ga0268256_1032064 | |||
| 1464 | Ga0307511_10078808 | |||
| 1465 | Ga0316181_1012985 | |||
| 1466 | Ga0265339_10016336 | |||
| 1467 | Ga0265339_10091481 | |||
| 1468 | Ga0265331_10002957 | |||
| 1469 | Ga0265327_10020386 | |||
| 1470 | Ga0265316_10086395 | |||
| 1471 | Ga0307513_10085610 | |||
| 1472 | Ga0307513_10187530 | |||
| 1473 | Ga0307513_10254991 | |||
| 1474 | Ga0307513_10296206 | |||
| 1475 | Ga0307408_100013718 | |||
| 1476 | Ga0307408_100021328 | |||
| 1477 | Ga0307408_100031953 | |||
| 1478 | Ga0307408_100042897 | |||
| 1479 | Ga0307408_100088572 | |||
| 1480 | Ga0307408_100127763 | |||
| 1481 | Ga0265313_10000427 | |||
| 1482 | Ga0307508_10000120 | |||
| 1483 | Ga0307508_10088555 | |||
| 1484 | Ga0307508_10207925 | |||
| 1485 | Ga0307514_10030872 | |||
| 1486 | Ga0265314_10021289 | |||
| 1487 | Ga0265314_10059438 | |||
| 1488 | Ga0265314_10148720 | |||
| 1489 | Ga0265342_10150825 | |||
| 1490 | Ga0307516_10089119 | |||
| 1491 | Ga0307516_10308522 | |||
| 1492 | Ga0307405_10000074 | |||
| 1493 | Ga0307405_10000880 | |||
| 1494 | Ga0307405_10000937 | |||
| 1495 | Ga0307413_10089645 | |||
| 1496 | Ga0307406_10002998 | |||
| 1497 | Ga0307406_10014480 | |||
| 1498 | Ga0307406_10457577 | |||
| 1499 | Ga0307407_10283552 | |||
| 1500 | Ga0307412_10002361 | |||
| 1501 | Ga0307412_10003241 | |||
| 1502 | Ga0307412_10003971 | |||
| 1503 | Ga0307412_10010245 | |||
| 1504 | Ga0307412_10166307 | |||
| 1505 | Ga0307412_10389637 | |||
| 1506 | Ga0315914_1000003 | |||
| 1507 | Ga0307409_100067840 | |||
| 1508 | Ga0307409_100375502 | |||
| 1509 | Ga0307414_10060523 | |||
| 1510 | Ga0307414_10538574 | |||
| 1511 | Ga0307411_10040590 | |||
| 1512 | Ga0307507_10100847 | |||
| 1513 | Ga0307510_10014749 | |||
| 1514 | Ga0315913_1000001 | |||
| 1515 | Ga0315915_1000008 | |||
| 1516 | Ga0373943_0054017 | |||
| 1517 | Ga0373935_0035845 | |||
| 1518 | Ga0373935_0196192 | |||
| 1519 | Ga0373927_0000178 | |||
| 1520 | Ga0373927_0052629 | |||
| 1521 | Ga0316584_0019902 | |||
| 1522 | Ga0373925_0027566 | |||
| 1523 | Ga0373925_0033116 | |||
| 1524 | Ga0395905_0055924 | |||
| 1525 | Ga0395905_0200689 | |||
| 1526 | Ga0436364_0945858 | |||
| 1527 | Ga0436364_1107967 | |||
| 1528 | Ga0436365_0037768 | |||
| 1529 | Ga0436365_0146384 | |||
| 1530 | Ga0436365_1105090 | |||
| 1531 | Ga0436365_1233355 | |||
| 1532 | Ga0436365_1638075 | |||
| 1533 | Ga0436365_1869873 | |||
| 1534 | Ga0436363_0684692 | |||
| 1535 | Ga0436362_0435552 | |||
| 1536 | Ga0439436_0032531 | |||
| 1537 | Ga0439438_000386 | |||
| 1538 | Ga0439438_000697 | |||
| 1539 | Ga0439438_001340 | |||
| 1540 | Ga0439438_012374 | |||
| 1541 | Ga0439447_008430 | |||
| 1542 | Ga0439447_026102 | |||
| 1543 | Ga0439466_0009542 | |||
| 1544 | Ga0439466_0016293 | |||
| 1545 | Ga0439466_0031091 | |||
| 1546 | Ga0439465_0027929 | |||
| 1547 | Ga0439465_0046991 | |||
| 1548 | Ga0439465_0058743 | |||
| 1549 | Ga0439431_0003155 | |||
| 1550 | Ga0439432_000485 | |||
| 1551 | Ga0439432_001879 | |||
| 1552 | Ga0439432_004874 | |||
| 1553 | Ga0439432_019300 | |||
| 1554 | Ga0439449_0017316 | |||
| 1555 | Ga0439451_001004 | |||
| 1556 | Ga0439451_001789 | |||
| 1557 | Ga0439451_004353 | |||
| 1558 | Ga0439451_021232 | |||
| 1559 | Ga0439451_034048 | |||
| 1560 | Ga0439452_000115 | |||
| 1561 | Ga0439452_004469 | |||
| 1562 | Ga0439452_006930 | |||
| 1563 | Ga0439452_012663 | |||
| 1564 | Ga0439452_018860 | |||
| 1565 | Ga0439456_001848 | |||
| 1566 | Ga0439462_0009599 | |||
| 1567 | Ga0450911_002639 | |||
| 1568 | Ga0450919_014590 | |||
| 1569 | Ga0450920_034343 | |||
| 1570 | Ga0450890_000773 | |||
| 1571 | Ga0450902_001124 | |||
| 1572 | Ga0450903_008341 | |||
| 1573 | Ga0450903_029206 | |||
| 1574 | Ga0450904_000497 | |||
| 1575 | Ga0450906_002759 | |||
| 1576 | Ga0450907_003145 | |||
| 1577 | Ga0439446_0082398 | |||
| 1578 | Ga0450908_011147 | |||
| 1579 | Ga0450909_001067 | |||
| 1580 | Ga0439434_0064628 | |||
| 1581 | Ga0439464_0087209 | |||
| 1582 | Ga0450918_004860 | |||
| 1583 | Ga0439440_0063093 | |||
| 1584 | Ga0466969_0134136 | |||
| 1585 | Ga0451576_0013360 | |||
| 1586 | Ga0451576_0148426 | |||
| 1587 | Ga0495617_000074 | |||
| 1588 | Ga0495617_010123 | |||
| 1589 | Ga0495627_000589 | |||
| 1590 | Ga0495627_008405 | |||
| 1591 | Ga0495603_0150916 | |||
| 1592 | Ga0495590_0002081 | |||
| 1593 | Ga0495591_000566 | |||
| 1594 | Ga0495591_001343 | |||
| 1595 | Ga0495591_006973 | |||
| 1596 | Ga0495591_009170 | |||
| 1597 | Ga0495591_014319 | |||
| 1598 | Ga0495638_0013208 | |||
| 1599 | Ga0495638_0028211 | |||
| 1600 | Ga0495638_0039708 | |||
| 1601 | Ga0495638_0156690 | |||
| 1602 | Ga0495650_0000522 | |||
| 1603 | Ga0495650_0001172 | |||
| 1604 | Ga0495650_0001646 | |||
| 1605 | Ga0495650_0007710 | |||
| 1606 | Ga0495605_0000002 | |||
| 1607 | Ga0495605_0000274 | |||
| 1608 | Ga0495605_0001555 | |||
| 1609 | Ga0495605_0009296 | |||
| 1610 | Ga0495605_0015866 | |||
| 1611 | Ga0495605_0037597 | |||
| 1612 | Ga0495639_0000002 | |||
| 1613 | Ga0495662_0062591 | |||
| 1614 | Ga0495584_0000084 | |||
| 1615 | Ga0495584_0000094 | |||
| 1616 | Ga0495584_0012466 | |||
| 1617 | Ga0495585_0002777 | |||
| 1618 | Ga0495585_0085280 | |||
| 1619 | Ga0495585_0179364 | |||
| 1620 | Ga0495585_0184253 | |||
| 1621 | Ga0495585_0197839 | |||
| 1622 | Ga0495594_0001723 | |||
| 1623 | Ga0495594_0006359 | |||
| 1624 | Ga0495607_0000092 | |||
| 1625 | Ga0495607_0000094 | |||
| 1626 | Ga0495607_0001096 | |||
| 1627 | Ga0495607_0003046 | |||
| 1628 | Ga0495607_0005609 | |||
| 1629 | Ga0495607_0025163 | |||
| 1630 | Ga0495607_0058068 | |||
| 1631 | Ga0495607_0127710 | |||
| 1632 | Ga0495583_0000012 | |||
| 1633 | Ga0495583_0002173 | |||
| 1634 | Ga0495583_0003086 | |||
| 1635 | Ga0495583_0011012 | |||
| 1636 | Ga0495583_0033369 | |||
| 1637 | Ga0495583_0036450 | |||
| 1638 | Ga0495583_0049265 | |||
| 1639 | Ga0495606_0000199 | |||
| 1640 | Ga0495606_0034210 | |||
| 1641 | Ga0495606_0051216 | |||
| 1642 | Ga0495606_0123685 | |||
| 1643 | Ga0495610_0011302 | |||
| 1644 | Ga0495610_0019119 | |||
| 1645 | Ga0495610_0030834 | |||
| 1646 | Ga0495610_0037718 | |||
| 1647 | Ga0495610_0051303 | |||
| 1648 | Ga0495616_0002349 | |||
| 1649 | Ga0495616_0017389 | |||
| 1650 | Ga0495616_0027295 | |||
| 1651 | Ga0495616_0056317 | |||
| 1652 | Ga0495616_0088595 | |||
| 1653 | Ga0495620_0000010 | |||
| 1654 | Ga0495620_0000374 | |||
| 1655 | Ga0495620_0068612 | |||
| 1656 | Ga0495620_0075044 | |||
| 1657 | Ga0495620_0159967 | |||
| 1658 | Ga0495630_0068258 | |||
| 1659 | Ga0495631_0018210 | |||
| 1660 | Ga0495631_0028943 | |||
| 1661 | Ga0495631_0031168 | |||
| 1662 | Ga0495631_0121702 | |||
| 1663 | Ga0495632_0000022 | |||
| 1664 | Ga0495632_0000200 | |||
| 1665 | Ga0495632_0000487 | |||
| 1666 | Ga0495632_0000922 | |||
| 1667 | Ga0495632_0002318 | |||
| 1668 | Ga0495632_0014680 | |||
| 1669 | Ga0495632_0024520 | |||
| 1670 | Ga0495632_0128653 | |||
| 1671 | Ga0495637_0000074 | |||
| 1672 | Ga0495637_0000412 | |||
| 1673 | Ga0495637_0005041 | |||
| 1674 | Ga0495637_0008438 | |||
| 1675 | Ga0495643_0008180 | |||
| 1676 | Ga0495643_0017290 | |||
| 1677 | Ga0495644_0021862 | |||
| 1678 | Ga0495648_0006838 | |||
| 1679 | Ga0495648_0017466 | |||
| 1680 | Ga0495648_0031752 | |||
| 1681 | Ga0495648_0070354 | |||
| 1682 | Ga0495648_0075064 | |||
| 1683 | Ga0495648_0116453 | |||
| 1684 | Ga0495663_0101288 | |||
| 1685 | Ga0495666_0012334 | |||
| 1686 | Ga0495642_0001429 | |||
| 1687 | Ga0495642_0001436 | |||
| 1688 | Ga0495654_0000362 | |||
| 1689 | Ga0495654_0000382 | |||
| 1690 | Ga0495654_0000391 | |||
| 1691 | Ga0495654_0003297 | |||
| 1692 | Ga0495654_0012316 | |||
| 1693 | Ga0495654_0025400 | |||
| 1694 | Ga0495654_0031182 | |||
| 1695 | Ga0495654_0035341 | |||
| 1696 | Ga0495654_0040056 | |||
| 1697 | Ga0495640_0065789 | |||
| 1698 | Ga0495609_0000008 | |||
| 1699 | Ga0495609_0000125 | |||
| 1700 | Ga0495609_0000211 | |||
| 1701 | Ga0495609_0005717 | |||
| 1702 | Ga0495609_0044059 | |||
| 1703 | Ga0495597_0000366 | |||
| 1704 | Ga0495597_0004619 | |||
| 1705 | Ga0495597_0014614 | |||
| 1706 | Ga0495597_0091611 | |||
| 1707 | Ga0495622_0003749 | |||
| 1708 | Ga0495622_0005612 | |||
| 1709 | Ga0495633_0000009 | |||
| 1710 | Ga0495633_0023268 | |||
| 1711 | Ga0495633_0039451 | |||
| 1712 | Ga0495668_0036290 | |||
| 1713 | Ga0495611_0000998 | |||
| 1714 | Ga0495625_0014639 | |||
| 1715 | Ga0495625_0050688 | |||
| 1716 | Ga0495625_0052515 | |||
| 1717 | Ga0495625_0118206 | |||
| 1718 | Ga0495625_0186449 | |||
| 1719 | Ga0495625_0239954 | |||
| 1720 | Ga0495659_0000035 | |||
| 1721 | Ga0495659_0012408 | |||
| 1722 | Ga0495659_0025564 | |||
| 1723 | Ga0495659_0039741 | |||
| 1724 | Ga0495661_0000029 | |||
| 1725 | Ga0495661_0000083 | |||
| 1726 | Ga0495661_0000468 | |||
| 1727 | Ga0495661_0002752 | |||
| 1728 | Ga0495661_0037531 | |||
| 1729 | Ga0495661_0054847 | |||
| 1730 | Ga0495669_0005644 | |||
| 1731 | Ga0495624_0192838 | |||
| 1732 | Ga0495670_0000280 | |||
| 1733 | Ga0495670_0002007 | |||
| 1734 | Ga0495670_0023754 | |||
| 1735 | Ga0495670_0053335 | |||
| 1736 | Ga0495670_0129883 | |||
| 1737 | Ga0495670_0179193 | |||
| 1738 | Ga0495671_0000136 | |||
| 1739 | Ga0495671_0000389 | |||
| 1740 | Ga0495671_0025715 | |||
| 1741 | Ga0495671_0086317 | |||
| 1742 | Ga0495649_0000289 | |||
| 1743 | Ga0495649_0001225 | |||
| 1744 | Ga0495649_0001839 | |||
| 1745 | Ga0495649_0034556 | |||
| 1746 | Ga0495589_0000075 | |||
| 1747 | Ga0495589_0000942 | |||
| 1748 | Ga0495589_0011459 | |||
| 1749 | Ga0495589_0018843 | |||
| 1750 | Ga0495600_0093689 | |||
| 1751 | Ga0495660_0000520 | |||
| 1752 | Ga0495660_0002132 | |||
| 1753 | Ga0495660_0039190 | |||
| 1754 | Ga0495660_0041488 | |||
| 1755 | Ga0495660_0128690 | |||
| 1756 | Ga0495660_0159691 | |||
| 1757 | Ga0495581_0001262 | |||
| 1758 | Ga0495604_0001148 | |||
| 1759 | Ga0495636_0001517 | |||
| 1760 | Ga0495672_0000433 | |||
| 1761 | Ga0495672_0000814 | |||
| 1762 | Ga0495672_0011424 | |||
| 1763 | Ga0495672_0051140 | |||
| 1764 | Ga0495672_0055348 | |||
| 1765 | Ga0495672_0101482 | |||
| 1766 | Ga0495680_0021969 | |||
| 1767 | Ga0495680_0036589 | |||
| 1768 | Ga0495683_0000039 | |||
| 1769 | Ga0495683_0005744 | |||
| 1770 | Ga0495683_0023291 | |||
| 1771 | Ga0495683_0062877 | |||
| 1772 | Ga0495683_0112513 | |||
| 1773 | Ga0495683_0112749 | |||
| 1774 | Ga0495687_000260 | |||
| 1775 | Ga0495687_001168 | |||
| 1776 | Ga0495687_002151 | |||
| 1777 | Ga0495687_026573 | |||
| 1778 | Ga0495677_0000490 | |||
| 1779 | Ga0495679_001047 | |||
| 1780 | Ga0495679_008706 | |||
| 1781 | Ga0495679_009235 | |||
| 1782 | Ga0495679_015404 | |||
| 1783 | Ga0495685_020232 | |||
| 1784 | Ga0495685_022820 | |||
| 1785 | Ga0495673_0001395 | |||
| 1786 | Ga0495673_0001462 | |||
| 1787 | Ga0495673_0003525 | |||
| 1788 | Ga0495673_0017671 | |||
| 1789 | Ga0495673_0018312 | |||
| 1790 | Ga0495681_0004673 | |||
| 1791 | Ga0495681_0004690 | |||
| 1792 | Ga0495681_0011322 | |||
| 1793 | Ga0495681_0012410 | |||
| 1794 | Ga0495681_0019758 | |||
| 1795 | Ga0495686_0006218 | |||
| 1796 | Ga0495686_0029683 | |||
| 1797 | Ga0495686_0039808 | |||
| 1798 | Ga0495686_0044657 | |||
| 1799 | Ga0495686_0120405 | |||
| 1800 | Ga0495686_0186660 | |||
| 1801 | Ga0495593_0032130 | |||
| 1802 | Ga0495626_0000544 | |||
| 1803 | Ga0495626_0002984 | |||
| 1804 | Ga0495626_0009129 | |||
| 1805 | Ga0495626_0080541 | |||
| 1806 | Ga0495626_0173340 | |||
| 1807 | Ga0496106_0618893 | |||
| 1808 | Ga0496116_0000454 | |||
| 1809 | Ga0496117_0000246 | |||
| 1810 | Ga0496117_0008288 | |||
| 1811 | Ga0496117_0055874 | |||
| 1812 | Ga0496117_0133386 | |||
| 1813 | Ga0496118_0022520 | |||
| 1814 | Ga0496118_0055796 | |||
| 1815 | Ga0496118_0057447 | |||
| 1816 | Ga0496118_0138741 | |||
| 1817 | Ga0496120_0007188 | |||
| 1818 | Ga0496120_0020423 | |||
| 1819 | Ga0496121_0000180 | |||
| 1820 | Ga0496121_0002269 | |||
| 1821 | Ga0496121_0031970 | |||
| 1822 | Ga0496121_0064794 | |||
| 1823 | Ga0496121_0149139 | |||
| 1824 | Ga0496122_0016424 | |||
| 1825 | Ga0496122_0042838 | |||
| 1826 | Ga0496122_0045072 | |||
| 1827 | Ga0496122_0106783 | |||
| 1828 | Ga0496122_0255503 | |||
| 1829 | Ga0496123_0030860 | |||
| 1830 | Ga0496123_0101778 | |||
| 1831 | Ga0496123_0122028 | |||
| 1832 | Ga0496123_0129984 | |||
| 1833 | Ga0496124_0000035 | |||
| 1834 | Ga0496124_0000239 | |||
| 1835 | Ga0496124_0000426 | |||
| 1836 | Ga0496124_0004925 | |||
| 1837 | Ga0496124_0075394 | |||
| 1838 | Ga0496124_0077830 | |||
| 1839 | Ga0496124_0146188 | |||
| 1840 | Ga0496125_0000266 | |||
| 1841 | Ga0496125_0001791 | |||
| 1842 | Ga0496125_0026408 | |||
| 1843 | Ga0496125_0032347 | |||
| 1844 | Ga0496125_0067574 | |||
| 1845 | Ga0496126_0009133 | |||
| 1846 | Ga0496126_0029029 | |||
| 1847 | Ga0496126_0048532 | |||
| 1848 | Ga0496126_0213918 | |||
| 1849 | Ga0495678_000008 | |||
| 1850 | Ga0495678_000011 | |||
| 1851 | Ga0495678_000255 | |||
| 1852 | Ga0495678_001291 | |||
| 1853 | Ga0495678_009198 | |||
| 1854 | Ga0495682_0030923 | |||
| 1855 | Ga0501031_0000002 | |||
| 1856 | Ga0501031_0095966 | |||
| 1857 | Ga0501031_0333377 | |||
| 1858 | Ga0501032_0000004 | |||
| 1859 | Ga0501032_0007011 | |||
| 1860 | Ga0501032_0024083 | |||
| 1861 | Ga0501032_0084271 | |||
| 1862 | Ga0501032_0113675 | |||
| 1863 | Ga0501032_0121464 | |||
| 1864 | Ga0501033_0000016 | |||
| 1865 | Ga0501033_0000776 | |||
| 1866 | Ga0501033_0004986 | |||
| 1867 | Ga0501033_0019437 | |||
| 1868 | Ga0501033_0056499 | |||
| 1869 | Ga0501033_0435889 | |||
| 1870 | Ga0501034_0000011 | |||
| 1871 | Ga0501034_0004793 | |||
| 1872 | Ga0501034_0078297 | |||
| 1873 | Ga0501034_0120939 | |||
| 1874 | Ga0501036_0000001 | |||
| 1875 | Ga0501036_0003294 | |||
| 1876 | Ga0501036_0017362 | |||
| 1877 | Ga0501036_0102500 | |||
| 1878 | Ga0501037_0000006 | |||
| 1879 | Ga0501037_0005086 | |||
| 1880 | Ga0501038_0000003 | |||
| 1881 | Ga0501038_0006213 | |||
| 1882 | Ga0501038_0034451 | |||
| 1883 | Ga0501038_0050397 | |||
| 1884 | Ga0501038_0208395 | |||
| 1885 | Ga0501039_0000004 | |||
| 1886 | Ga0501039_0001298 | |||
| 1887 | Ga0501039_0002554 | |||
| 1888 | Ga0501040_0012498 | |||
| 1889 | Ga0501040_0031479 | |||
| 1890 | Ga0501041_0017232 | |||
| 1891 | Ga0501042_0035928 | |||
| 1892 | Ga0501043_0000155 | |||
| 1893 | Ga0501043_0011433 | |||
| 1894 | Ga0501043_0013677 | |||
| 1895 | Ga0501043_0058597 | |||
| 1896 | Ga0501043_0173316 | |||
| 1897 | Ga0501043_0250168 | |||
| 1898 | Ga0501046_0001714 | |||
| 1899 | Ga0501046_0105275 | |||
| 1900 | Ga0501047_0008235 | |||
| 1901 | Ga0501047_0021199 | |||
| 1902 | Ga0501047_0028069 | |||
| 1903 | Ga0501047_0051856 | |||
| 1904 | Ga0501047_0167134 | |||
| 1905 | Ga0501047_0188275 | |||
| 1906 | Ga0501048_0023429 | |||
| 1907 | Ga0501048_0098677 | |||
| 1908 | Ga0501067_0011153 | |||
| 1909 | Ga0501067_0032647 | |||
| 1910 | Ga0501067_0103336 | |||
| 1911 | Ga0501068_0391808 | |||
| 1912 | Ga0501069_0002311 | |||
| 1913 | Ga0501069_0002521 | |||
| 1914 | Ga0501069_0044511 | |||
| 1915 | Ga0501070_0004969 | |||
| 1916 | Ga0501070_0022569 | |||
| 1917 | Ga0501070_0024946 | |||
| 1918 | Ga0501070_0285997 | |||
| 1919 | Ga0501072_0224161 | |||
| 1920 | Ga0501073_0002004 | |||
| 1921 | Ga0501073_0081427 | |||
| 1922 | Ga0501074_0005021 | |||
| 1923 | Ga0501074_0015837 | |||
| 1924 | Ga0501076_0033050 | |||
| 1925 | Ga0501077_0184996 | |||
| 1926 | Ga0501080_0002095 | |||
| 1927 | Ga0501080_0005500 | |||
| 1928 | Ga0501080_0054430 | |||
| 1929 | Ga0501080_0059597 | |||
| 1930 | Ga0501080_0303918 | |||
| 1931 | Ga0501081_0051987 | |||
| 1932 | Ga0501081_0165934 | |||
| 1933 | Ga0501083_0006586 | |||
| 1934 | Ga0501083_0015812 | |||
| 1935 | Ga0501035_0000009 | |||
| 1936 | Ga0501035_0000882 | |||
| 1937 | Ga0501035_0003895 | |||
| 1938 | Ga0501035_0010603 | |||
| 1939 | Ga0501035_0011132 | |||
| 1940 | Ga0501035_0086021 | |||
| 1941 | Ga0501035_0138933 | |||
| 1942 | Ga0501035_0556100 | |||
| 1943 | Ga0501044_0000005 | |||
| 1944 | Ga0501044_0002857 | |||
| 1945 | Ga0501044_0004158 | |||
| 1946 | Ga0501044_0008383 | |||
| 1947 | Ga0501044_0058607 | |||
| 1948 | Ga0501044_0108391 | |||
| 1949 | Ga0501044_0145502 | |||
| 1950 | Ga0501045_0035725 | |||
| 1951 | Ga0501045_0192189 | |||
| 1952 | nmdc:mga03683_1610_c1 | |||
| 1953 | nmdc:mga00v17_156797_c1 | |||
| 1954 | nmdc:mga00v17_34678_c1 | |||
| 1955 | nmdc:mga00v17_78_c1 | |||
| 1956 | nmdc:mga06z11_130956_c1 | |||
| 1957 | nmdc:mga05p37_91105_c1 | |||
| 1958 | nmdc:mga0qj67_35425_c1 | |||
| 1959 | nmdc:mga06r32_63496_c1 | |||
| 1960 | Ga0500610_0111003 | |||
| 1961 | Ga0500635_0076582 | |||
| 1962 | Ga0500578_0027239 | |||
| 1963 | Ga0500578_0080411 | |||
| 1964 | Ga0500578_0144913 | |||
| 1965 | Ga0500643_000018 | |||
| 1966 | Ga0500651_0047064 | |||
| 1967 | Ga0500557_026644 | |||
| 1968 | Ga0500569_013068 | |||
| 1969 | Ga0500594_0013298 | |||
| 1970 | Ga0500595_025960 | |||
| 1971 | Ga0500618_001769 | |||
| 1972 | Ga0500628_048075 | |||
| 1973 | Ga0500658_0089692 | |||
| 1974 | Ga0500568_0000559 | |||
| 1975 | Ga0500573_0000318 | |||
| 1976 | Ga0500573_0186650 | |||
| 1977 | Ga0500577_0015467 | |||
| 1978 | Ga0500577_0140349 | |||
| 1979 | Ga0500588_0000513 | |||
| 1980 | Ga0500590_008948 | |||
| 1981 | Ga0500590_100009 | |||
| 1982 | Ga0500603_023857 | |||
| 1983 | Ga0500616_0121440 | |||
| 1984 | Ga0500634_0030134 | |||
| 1985 | Ga0500638_083866 | |||
| 1986 | Ga0500636_0003139 | |||
| 1987 | Ga0500637_0096670 | |||
| 1988 | Ga0500657_052883 | |||
| 1989 | Ga0501084_0007525 | |||
| 1990 | Ga0587077_000735 | |||
| 1991 | Ga0587090_000082 | |||
| 1992 | Ga0587101_000045 | |||
| 1993 | Ga0587128_000033 | |||
| 1994 | Ga0587062_003060 | |||
| 1995 | Ga0501082_0010931 | |||
| 1996 | Ga0501082_0028554 | |||
| 1997 | Ga0501082_0080476 | |||
| 1998 | Ga0501082_0094165 | |||
| 1999 | Ga0501082_0133163 | |||
| 2000 | Ga0501082_0136596 | |||
| 2001 | 2511255533 | |||
| 2002 | 2509108037 | |||
| 2003 | 2509140883 | |||
| 2004 | 2509376783 | |||
| 2005 | 2510282181 | |||
| 2006 | 2510291614 | |||
| 2007 | 2510308310 | |||
| 2008 | 2510310329 | |||
| 2009 | 2511270464 | |||
| 2010 | 2511328534 | |||
| 2011 | 2511362772 | |||
| 2012 | 2511391656 | |||
| 2013 | 2511502514 | |||
| 2014 | 2511824950 | |||
| 2015 | 2512533888 | |||
| 2016 | 2512970353 | |||
| 2017 | 2513581640 | |||
| 2018 | 2513587454 | |||
| 2019 | 2513601417 | |||
| 2020 | 2513619568 | |||
| 2021 | 2513881799 | |||
| 2022 | 2513904943 | |||
| 2023 | 2513983615 | |||
| 2024 | 2513997563 | |||
| 2025 | 2514003136 | |||
| 2026 | 2515609302 | |||
| 2027 | 2515744628 | |||
| 2028 | 2516206065 | |||
| 2029 | 2516893889 | |||
| 2030 | 2517570609 | |||
| 2031 | 2524448288 | |||
| 2032 | 2551679604 | |||
| 2033 | 2551689435 | |||
| 2034 | 2551696966 | |||
| 2035 | 2551701303 | |||
| 2036 | 2551709517 | |||
| 2037 | 2551723850 | |||
| 2038 | 2551724796 | |||
| 2039 | 2551735549 | |||
| 2040 | 2551743360 | |||
| 2041 | 2558865859 | |||
| 2042 | 2585167565 | |||
| 2043 | 2585265791 | |||
| 2044 | 2585389038 | |||
| 2045 | 2585395185 | |||
| 2046 | 2585405028 | |||
| 2047 | 2585530386 | |||
| 2048 | 2597864445 | |||
| 2049 | 2597869431 | |||
| 2050 | 2599331208 | |||
| 2051 | 2599332103 | |||
| 2052 | 2599399331 | |||
| 2053 | 2599453568 | |||
| 2054 | 2599500654 | |||
| 2055 | 2599510450 | |||
| 2056 | 2599513822 | |||
| 2057 | 2599519001 | |||
| 2058 | 2599606177 | |||
| 2059 | 2599612851 | |||
| 2060 | 2599769057 | |||
| 2061 | 2599880997 | |||
| 2062 | 2599888302 | |||
| 2063 | 2599892879 | |||
| 2064 | 2599895970 | |||
| 2065 | 2599932317 | |||
| 2066 | 2599951210 | |||
| 2067 | 2599957855 | |||
| 2068 | 2599966795 | |||
| 2069 | 2599970876 | |||
| 2070 | 2599978074 | |||
| 2071 | 2599993363 | |||
| 2072 | 2600004052 | |||
| 2073 | 2600012199 | |||
| 2074 | 2600015578 | |||
| 2075 | 2600021948 | |||
| 2076 | 2600028538 | |||
| 2077 | 2600037545 | |||
| 2078 | 2600042858 | |||
| 2079 | 2600050786 | |||
| 2080 | 2600060068 | |||
| 2081 | 2600063289 | |||
| 2082 | 2600072686 | |||
| 2083 | 2600075222 | |||
| 2084 | 2600196066 | |||
| 2085 | 2600357705 | |||
| 2086 | 2601690328 | |||
| 2087 | 2621299175 | |||
| 2088 | 2624492081 | |||
| 2089 | 2643804393 | |||
| 2090 | 2643871753 | |||
| 2091 | 2643917569 | |||
| 2092 | 2644050092 | |||
| 2093 | 2644065164 | |||
| 2094 | 2644105456 | |||
| 2095 | 2644133858 | |||
| 2096 | 2644146459 | |||
| 2097 | 2644204848 | |||
| 2098 | 2644208686 | |||
| 2099 | 2644283950 | |||
| 2100 | 2644298176 | |||
| 2101 | 2644308207 | |||
| 2102 | 2644334031 | |||
| 2103 | 2644377573 | |||
| 2104 | 2644416836 | |||
| 2105 | 2644449876 | |||
| 2106 | 2644483013 | |||
| 2107 | 2644494204 | |||
| 2108 | 2644497680 | |||
| 2109 | 2644541628 | |||
| 2110 | 2644615489 | |||
| 2111 | 2644620552 | |||
| 2112 | 2644652216 | |||
| 2113 | 2644656428 | |||
| 2114 | 2644672771 | |||
| 2115 | 2644690011 | |||
| 2116 | 2657684856 | |||
| 2117 | 2671088662 | |||
| 2118 | 2671126296 | |||
| 2119 | 2677899174 | |||
| 2120 | 2678263614 | |||
| 2121 | 2692315172 | |||
| 2122 | 2715498988 | |||
| 2123 | 2723249149 | |||
| 2124 | 2738672332 | |||
| 2125 | 2738687787 | |||
| 2126 | 2738750725 | |||
| 2127 | 2738812155 | |||
| 2128 | 2738859766 | |||
| 2129 | 2738899515 | |||
| 2130 | 2738944305 | |||
| 2131 | 2739263778 | |||
| 2132 | 2745009945 | |||
| 2133 | 2753463347 | |||
| 2134 | 2757571031 | |||
| 2135 | 2765467721 | |||
| 2136 | 2770197825 | |||
| 2137 | 2774130883 | |||
| 2138 | 2776269099 | |||
| 2139 | 2776283762 | |||
| 2140 | 2792581543 | |||
| 2141 | 2792620474 | |||
| 2142 | 2792625832 | |||
| 2143 | 2792638774 | |||
| 2144 | 2793365768 | |||
| 2145 | 2794597186 | |||
| 2146 | 2802716710 | |||
| 2147 | 2802725521 | |||
| 2148 | 2802730387 | |||
| 2149 | 2802737641 | |||
| 2150 | 2802742969 | |||
| 2151 | 2802750393 | |||
| 2152 | 2804753014 | |||
| 2153 | 2808933235 | |||
| 2154 | 2808955391 | |||
| 2155 | 2808978603 | |||
| 2156 | 2808993870 | |||
| 2157 | 2809214687 | |||
| 2158 | 2817491738 | |||
| 2159 | 2819244229 | |||
| 2160 | 2825651962 | |||
| 2161 | 2826586838 | |||
| 2162 | 2834030314 | |||
| 2163 | 2837652464 | |||
| 2164 | 2838079667 | |||
| 2165 | 2838679979 | |||
| 2166 | 2838717776 | |||
| 2167 | 2838724550 | |||
| 2168 | 2838729508 | |||
| 2169 | 2839993719 | |||
| 2170 | 2840766749 | |||
| 2171 | 2841849944 | |||
| 2172 | 2842128416 | |||
| 2173 | 2842134661 | |||
| 2174 | 2842156507 | |||
| 2175 | 2842165274 | |||
| 2176 | 2842174021 | |||
| 2177 | 2842180128 | |||
| 2178 | 2842192127 | |||
| 2179 | 2842216593 | |||
| 2180 | 2842229163 | |||
| 2181 | 2842522194 | |||
| 2182 | 2842819309 | |||
| 2183 | 2842828371 | |||
| 2184 | 2842842753 | |||
| 2185 | 2842852295 | |||
| 2186 | 2842858163 | |||
| 2187 | 2842875241 | |||
| 2188 | 2842924458 | |||
| 2189 | 2844166370 | |||
| 2190 | 2847419771 | |||
| 2191 | 2848994788 | |||
| 2192 | 2850081786 | |||
| 2193 | 2852617365 | |||
| 2194 | 2852672516 | |||
| 2195 | 2855023505 | |||
| 2196 | 2855826614 | |||
| 2197 | 2855842005 | |||
| 2198 | 2855877287 | |||
| 2199 | 2858802679 | |||
| 2200 | 2860870199 | |||
| 2201 | 2871451905 | |||
| 2202 | 2874105844 | |||
| 2203 | 2876398314 | |||
| 2204 | 2881167401 | |||
| 2205 | 2885309303 | |||
| 2206 | 2885330060 | |||
| 2207 | 2889790840 | |||
| 2208 | 2889915222 | |||
| 2209 | 2896391221 | |||
| 2210 | 2898798577 | |||
| 2211 | 2899261641 | |||
| 2212 | 2899276501 | |||
| 2213 | 2899793172 | |||
| 2214 | 2904579571 | |||
| 2215 | 2904664869 | |||
| 2216 | 2906330113 | |||
| 2217 | 2908450236 | |||
| 2218 | 2909400050 | |||
| 2219 | 2913039692 | |||
| 2220 | 2913308924 | |||
| 2221 | 2915981149 | |||
| 2222 | 2915993243 | |||
| 2223 | 2915999028 | |||
| 2224 | 2916005056 | |||
| 2225 | 2916012722 | |||
| 2226 | 2916018950 | |||
| 2227 | 2916023027 | |||
| 2228 | 2916034189 | |||
| 2229 | 2916039353 | |||
| 2230 | 2916044383 | |||
| 2231 | 2916050431 | |||
| 2232 | 2916061494 | |||
| 2233 | 2916068638 | |||
| 2234 | 2916080481 | |||
| 2235 | 2917835819 | |||
| 2236 | 2919118056 | |||
| 2237 | 2919120763 | |||
| 2238 | 2919125780 | |||
| 2239 | 2919484780 | |||
| 2240 | 2919680091 | |||
| 2241 | 2919698253 | |||
| 2242 | 2920761177 | |||
| 2243 | 2920825632 | |||
| 2244 | 2921205774 | |||
| 2245 | 2921212567 | |||
| 2246 | 2921240006 | |||
| 2247 | 2921247801 | |||
| 2248 | 2921251658 | |||
| 2249 | 2921262645 | |||
| 2250 | 2921269622 | |||
| 2251 | 2921287141 | |||
| 2252 | 2921294111 | |||
| 2253 | 2921299553 | |||
| 2254 | 2922164822 | |||
| 2255 | 2923588855 | |||
| 2256 | 2924148575 | |||
| 2257 | 2924156539 | |||
| 2258 | 2924159894 | |||
| 2259 | 2924172242 | |||
| 2260 | 2924179667 | |||
| 2261 | 2924183491 | |||
| 2262 | 2924193098 | |||
| 2263 | 2924196448 | |||
| 2264 | 2924203898 | |||
| 2265 | 2924210809 | |||
| 2266 | 2924216577 | |||
| 2267 | 2924225643 | |||
| 2268 | 2924233263 | |||
| 2269 | 2924728687 | |||
| 2270 | 2926757821 | |||
| 2271 | 2928522366 | |||
| 2272 | 2929146605 | |||
| 2273 | 2929147568 | |||
| 2274 | 2929192108 | |||
| 2275 | 2931369428 | |||
| 2276 | 2931394449 | |||
| 2277 | 2933010439 | |||
| 2278 | 2935902806 | |||
| 2279 | 2937002765 | |||
| 2280 | 2937005330 | |||
| 2281 | 2937012865 | |||
| 2282 | 2937021869 | |||
| 2283 | 2937027340 | |||
| 2284 | 2937035640 | |||
| 2285 | 2937039673 | |||
| 2286 | 2937044950 | |||
| 2287 | 2937055564 | |||
| 2288 | 2937063797 | |||
| 2289 | 2937068689 | |||
| 2290 | 2937075934 | |||
| 2291 | 2937080702 | |||
| 2292 | 2937090127 | |||
| 2293 | 2937097430 | |||
| 2294 | 2937101145 | |||
| 2295 | 2937110218 | |||
| 2296 | 2937117677 | |||
| 2297 | 2937124509 | |||
| 2298 | 2937132953 | |||
| 2299 | 2937897903 | |||
| 2300 | 2941504602 | |||
| 2301 | 2945933925 | |||
| 2302 | 2945964262 | |||
| 2303 | 2946009323 | |||
| 2304 | 2946030433 | |||
| 2305 | 2947237332 | |||
| 2306 | 2954014212 | |||
| 2307 | 2957380685 | |||
| 2308 | 2957387262 | |||
| 2309 | 2957389502 | |||
| 2310 | 2957397257 | |||
| 2311 | 2957408321 | |||
| 2312 | 2957412923 | |||
| 2313 | 2957418942 | |||
| 2314 | 2957423775 | |||
| 2315 | 2957435817 | |||
| 2316 | 2957438414 | |||
| 2317 | 2957450572 | |||
| 2318 | 2957451638 | |||
| 2319 | 2957460450 | |||
| 2320 | 2957468820 | |||
| 2321 | 2957476628 | |||
| 2322 | 2957483561 | |||
| 2323 | 2957489178 | |||
| 2324 | 2957495132 | |||
| 2325 | 2957501693 | |||
| 2326 | 2957512302 | |||
| 2327 | 2958118354 | |||
| 2328 | 2960584864 | |||
| 2329 | 2960591815 | |||
| 2330 | 2960602105 | |||
| 2331 | 2960604861 | |||
| 2332 | 2960613099 | |||
| 2333 | 2960617997 | |||
| 2334 | 2960625666 | |||
| 2335 | 2960634016 | |||
| 2336 | 2960639916 | |||
| 2337 | 2960651114 | |||
| 2338 | 2960655037 | |||
| 2339 | 2960667127 | |||
| 2340 | 2960670726 | |||
| 2341 | 2960675057 | |||
| 2342 | 2960680801 | |||
| 2343 | 2960688203 | |||
| 2344 | 2960699605 | |||
| 2345 | 2961119868 | |||
| 2346 | 2964608982 | |||
| 2347 | 2964621872 | |||
| 2348 | 2964628033 | |||
| 2349 | 2964634205 | |||
| 2350 | 2964639142 | |||
| 2351 | 2964646250 | |||
| 2352 | 2964651247 | |||
| 2353 | 2964663308 | |||
| 2354 | 2964667664 | |||
| 2355 | 2964671005 | |||
| 2356 | 2964682664 | |||
| 2357 | 2964689219 | |||
| 2358 | 2964694805 | |||
| 2359 | 2964704501 | |||
| 2360 | 2964706498 | |||
| 2361 | 2964718790 | |||
| 2362 | 2964725806 | |||
| 2363 | 2965064564 | |||
| 2364 | 2967665231 | |||
| 2365 | 2967672051 | |||
| 2366 | 2967685824 | |||
| 2367 | 2967690037 | |||
| 2368 | 2967698637 | |||
| 2369 | 2967701434 | |||
| 2370 | 2967711419 | |||
| 2371 | 2967720387 | |||
| 2372 | 2967727242 | |||
| 2373 | 2967734131 | |||
| 2374 | 2967739864 | |||
| 2375 | 2967743336 | |||
| 2376 | 2967754202 | |||
| 2377 | 2967759651 | |||
| 2378 | 2967768443 | |||
| 2379 | 2967772703 | |||
| 2380 | 2967776379 | |||
| 2381 | 2968096260 | |||
| 2382 | 2968098761 | |||
| 2383 | 2968116225 | |||
| 2384 | 2968129784 | |||
| 2385 | 2970024317 | |||
| 2386 | 2970027579 | |||
| 2387 | 2970035982 | |||
| 2388 | 2970045200 | |||
| 2389 | 2970051464 | |||
| 2390 | 2970056226 | |||
| 2391 | 2970065501 | |||
| 2392 | 2970070991 | |||
| 2393 | 2970079421 | |||
| 2394 | 2970084611 | |||
| 2395 | 2970094333 | |||
| 2396 | 2970099971 | |||
| 2397 | 2970103968 | |||
| 2398 | 2970111895 | |||
| 2399 | 2970120559 | |||
| 2400 | 2970126334 | |||
| 2401 | 2970134697 | |||
| 2402 | 2970141785 | |||
| 2403 | 2970147136 | |||
| 2404 | 2970152456 | |||
| 2405 | 2970162265 | |||
| 2406 | 2970168275 | |||
| 2407 | 2970175930 | |||
| 2408 | 2970181106 | |||
| 2409 | 2970186244 | |||
| 2410 | 2970196149 | |||
| 2411 | 2974299982 | |||
| 2412 | 2977523307 | |||
| 2413 | 2977528082 | |||
| 2414 | 2977536390 | |||
| 2415 | 2977543337 | |||
| 2416 | 2977549667 | |||
| 2417 | 2977553025 | |||
| 2418 | 2977564158 | |||
| 2419 | 2977568821 | |||
| 2420 | 2977574087 | |||
| 2421 | 2977585945 | |||
| 2422 | 2977861908 | |||
| 2423 | 2977870745 | |||
| 2424 | 2979783843 | |||
| 2425 | 2984502361 | |||
| 2426 | 2984508967 | |||
| 2427 | 2989350187 | |||
| 2428 | 2989773314 | |||
| 2429 | 2989776868 | |||
| 2430 | 2996316033 | |||
| 2431 | 2996336526 | |||
| 2432 | 2996346197 | |||
| 2433 | 3000021247 | |||
| 2434 | 3002142112 | |||
| 2435 | 3003934654 | |||
| 2436 | 3007869150 | |||
| 2437 | 643826665 | |||
| 2438 | 648739503 | |||
| 2439 | 8002291010 | |||
| 2440 | 8003994440 | |||
| 2441 | 8004002146 | |||
| 2442 | 8004449331 | |||
| 2443 | 8004709256 | |||
| 2444 | 8005310733 | |||
| 2445 | 8005662259 | |||
| 2446 | 8016728730 | |||
| 2447 | 8018154682 | |||
| 2448 | 8019779860 | |||
| 2449 | 8049295625 | |||
| 2450 | 8054285922 | |||
| 2451 | 8054351531 | |||
| 2452 | 8054505757 | |||
| 2453 | 8054561884 | |||
| 2454 | 8054565921 | |||
| 2455 | 8055432183 | |||
| 2456 | 8055820275 | |||
| 2457 | 8056134324 | |||
| 2458 | 8056146190 | |||
| 2459 | 8056150112 | |||
| 2460 | 8056158912 | |||
| 2461 | 8056166550 | |||
| 2462 | 8056378661 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pej-assembly1.cif.gz_B | structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol | 0.983 | 1 | 257 |
| 7e6o-assembly1.cif.gz_D | crystal structure of polyol dehydrogenase from paracoccus denitrificans | 0.9783 | 3 | 257 |
| 1k2w-assembly1.cif.gz_A | crystal structure of sorbitol dehydrogenase from r. sphaeroides | 0.9771 | 3 | 257 |
| 7e6o-assembly1.cif.gz_C | crystal structure of polyol dehydrogenase from paracoccus denitrificans | 0.9724 | 3 | 257 |
| 7e6o-assembly1.cif.gz_D | crystal structure of polyol dehydrogenase from paracoccus denitrificans | 0.9706 | 3 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4e6pC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9822 | 2 | 256 | 3.40.50.720 |
| 4e6pC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9783 | 2 | 256 | 3.40.50.720 |
| af_C6T421_12_106_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9637 | 2 | 79 | 3.40.50.720 |
| 3ak4D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9636 | 4 | 257 | 3.40.50.720 |
| 4npcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9627 | 2 | 253 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F2KA38-F1-model_v4 | L-iditol 2-dehydrogenase, (Sorbitol dehydrogenase) | 0.9881 | 1 | 257 |
GO:0016616
|
| AF-A0A657LU17-F1-model_v4 | Sorbitol dehydrogenase | 0.9871 | 1 | 257 |
GO:0016616
|
| AF-A0A3P3G131-F1-model_v4 | L-iditol 2-dehydrogenase (EC 1.1.1.14) | 0.987 | 3 | 257 |
GO:0003939
|
| AF-A0A271KM51-F1-model_v4 | Sorbitol dehydrogenase (EC 1.1.99.21) | 0.9869 | 3 | 257 |
GO:0016616
GO:0047833 |
| AF-A0A502YCV6-F1-model_v4 | L-iditol 2-dehydrogenase (EC 1.1.1.14) | 0.9868 | 3 | 257 |
GO:0003939
|