F491998

General Info

Members Datasets Scaffolds Average Seq Length
1231 814 2462 256

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2511231004|2511255533
Length 306
Sequence KNAPRFFRYYASSFFAGKPRSYRGASQIDDRFWCPRWGRLYSSYDWMEKMKRLEEKSALITGSARGIGRSFAQAYIREGATVAIADINLERAQATAAELGPNAYAVEMNVTDQQSIDGAIAAVIATTGKLDILINNAALFDLAPITEISRDSYERLFSINVSGTLFTLQAAAKQMIRQGHGGKIINMASQAGRRGEALVAVYCATKAAVISLTQSAGLNLIPHHINVNAIAPGVVDGEHWDGVDALFAKYENRPLGEKKRLAGQEVPYGRMGTADDLVGMAIFLASAESDYIVAQTYNVDGGNWMS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
84 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
85 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
88 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
89 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
93 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
170 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
182 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
183 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
190 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
191 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
194 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
195 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
196 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
197 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
198 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
199 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
200 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
201 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
202 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
203 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
204 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
207 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
208 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
212 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
215 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
256 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
265 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
266 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
267 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
268 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
269 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
270 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
286 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
317 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
318 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
324 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
325 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
326 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
329 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
330 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
331 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
332 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
333 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
334 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
335 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
336 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
337 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
338 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
339 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
340 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
343 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
344 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
345 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
346 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 2511231004 Pseudomonas sp. GM102 Isolate Nodule
355 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
356 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
357 2509276019 Ensifer aridi TW10 Isolate Nodule
358 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
359 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
360 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
361 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
362 2511231007 Pseudomonas sp. GM18 Isolate Nodule
363 2511231016 Pseudomonas sp. GM50 Isolate Nodule
364 2511231022 Pseudomonas sp. GM79 Isolate Nodule
365 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
366 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
367 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
368 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
369 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
370 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
371 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
372 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
373 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
374 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
375 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
376 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
377 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
378 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
379 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
380 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
381 2516143018 Ensifer sp. BR816 Isolate Nodule
382 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
383 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
384 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
385 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
386 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
387 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
388 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
389 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
390 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
391 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
392 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
393 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
394 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
395 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
396 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
397 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
398 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
399 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
400 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
401 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
402 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
403 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
404 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
405 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
406 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
407 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
408 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
409 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
410 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
411 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
412 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
413 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
414 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
415 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
416 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
417 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
418 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
419 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
420 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
421 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
422 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
423 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
424 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
425 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
426 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
427 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
428 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
429 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
430 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
431 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
432 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
433 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
434 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
435 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
436 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
437 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
438 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
439 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
440 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
441 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
442 2643221557 Ensifer sp. Root558 Isolate Unclassified
443 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
444 2643221582 Rhizobium sp. Root651 Isolate Unclassified
445 2643221607 Rhizobium sp. Root73 Isolate Unclassified
446 2643221610 Ensifer sp. Root74 Isolate Unclassified
447 2643221618 Ensifer sp. Root231 Isolate Unclassified
448 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
449 2643221626 Ensifer sp. Root31 Isolate Unclassified
450 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
451 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
452 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
453 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
454 2643221655 Ensifer sp. Root1252 Isolate Unclassified
455 2643221659 Ensifer sp. Root127 Isolate Unclassified
456 2643221668 Ensifer sp. Root423 Isolate Unclassified
457 2643221675 Ensifer sp. Root1298 Isolate Unclassified
458 2643221680 Ensifer sp. Root1312 Isolate Unclassified
459 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
460 2643221688 Rhizobium sp. Root482 Isolate Unclassified
461 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
462 2643221698 Ensifer sp. Root142 Isolate Unclassified
463 2643221712 Ensifer sp. Root258 Isolate Unclassified
464 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
465 2643221718 Rhizobium sp. Root268 Isolate Unclassified
466 2643221719 Rhizobium sp. Root274 Isolate Unclassified
467 2643221723 Ensifer sp. Root278 Isolate Unclassified
468 2643221726 Ensifer sp. Root954 Isolate Unclassified
469 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
470 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
471 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
472 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
473 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
474 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
475 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
476 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
477 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
478 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
479 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
480 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
481 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
482 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
483 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
484 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
485 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
486 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
487 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
488 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
489 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
490 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
491 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
492 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
493 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
494 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
495 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
496 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
497 2791355267 Rhizobium sp. L18 Isolate Nodule
498 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
499 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
500 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
501 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
502 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
503 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
504 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
505 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
506 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
507 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
508 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
509 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
510 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
511 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
512 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
513 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
514 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
515 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
516 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
517 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
518 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
519 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
520 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
521 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
522 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
523 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
524 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
525 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
526 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
527 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
528 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
529 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
530 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
531 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
532 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
533 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
534 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
535 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
536 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
537 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
538 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
539 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
540 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
541 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
542 2844163670 Ensifer sp. 1H6 Isolate Unclassified
543 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
544 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
545 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
546 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
547 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
548 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
549 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
550 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
551 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
552 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
553 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
554 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
555 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
556 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
557 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
558 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
559 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
560 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
561 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
562 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
563 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
564 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
565 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
566 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
567 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
568 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
569 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
570 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
571 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
572 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
573 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
574 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
575 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
576 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
577 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
578 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
579 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
580 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
581 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
582 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
583 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
584 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
585 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
586 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
587 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
588 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
589 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
590 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
591 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
592 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
593 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
594 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
595 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
596 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
597 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
598 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
599 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
600 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
601 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
602 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
603 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
604 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
605 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
606 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
607 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
608 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
609 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
610 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
611 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
612 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
613 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
614 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
615 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
616 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
617 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
618 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
619 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
620 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
621 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
622 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
623 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
624 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
625 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
626 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
627 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
628 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
629 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
630 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
631 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
632 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
633 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
634 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
635 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
636 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
637 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
638 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
639 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
640 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
641 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
642 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
643 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
644 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
645 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
646 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
647 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
648 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
649 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
650 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
651 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
652 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
653 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
654 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
655 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
656 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
657 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
658 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
659 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
660 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
661 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
662 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
663 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
664 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
665 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
666 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
667 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
668 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
669 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
670 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
671 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
672 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
673 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
674 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
675 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
676 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
677 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
678 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
679 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
680 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
681 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
682 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
683 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
684 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
685 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
686 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
687 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
688 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
689 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
690 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
691 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
692 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
693 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
694 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
695 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
696 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
697 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
698 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
699 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
700 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
701 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
702 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
703 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
704 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
705 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
706 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
707 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
708 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
709 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
710 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
711 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
712 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
713 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
714 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
715 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
716 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
717 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
718 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
719 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
720 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
721 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
722 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
723 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
724 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
725 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
726 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
727 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
728 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
729 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
730 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
731 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
732 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
733 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
734 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
735 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
736 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
737 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
738 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
739 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
740 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
741 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
742 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
743 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
744 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
745 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
746 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
747 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
748 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
749 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
750 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
751 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
752 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
753 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
754 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
755 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
756 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
757 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
758 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
759 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
760 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
761 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
762 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
763 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
764 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
765 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
766 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
767 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
768 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
769 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
770 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
771 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
772 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
773 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
774 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
775 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
776 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
777 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
778 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
779 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
780 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
781 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
782 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
783 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
784 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
785 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
786 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
787 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
788 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
789 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
790 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
791 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
792 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
793 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
794 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
795 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
796 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
797 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
798 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
799 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
800 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
801 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
802 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
803 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
804 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
805 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
806 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
807 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
808 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
809 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
810 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
811 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
812 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
813 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
814 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.98
Metatranscriptomes 0.49
Isolates 37.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 8.61
Nodule 22.99
Rhizoplane 3.41
Rhizosphere 51.1
Stem 0
Stem Tuber 0.08
Unclassified 0.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_26439 2124908027 Bacteria 831
2 SwRhRL2b_contig_1084298 2162886007 Bacteria 3626
3 JGI25159J45721_1000008 3300002987 Bacteria 172667
4 JGI25160J50197_1000033 3300003354 Bacteria 172667
5 JGI25161J50226_1000460 3300003374 Bacteria 18791
6 Ga0055538_1000240 3300003751 Bacteria 30007
7 Ga0055539_1000276 3300003752 Bacteria 30007
8 Ga0055533_1000264 3300003756 Bacteria 30007
9 Ga0055532_1000303 3300003758 Bacteria 30007
10 Ga0055525_1000368 3300003759 Bacteria 30007
11 Ga0055535_1010651 3300003761 Bacteria 1498
12 Ga0055524_1002673 3300003775 Bacteria 9027
13 Ga0055524_1004228 3300003775 Bacteria 6680
14 Ga0055536_1005066 3300003781 Bacteria 6540
15 Ga0055536_1017275 3300003781 Bacteria 2370
16 Ga0055528_1013363 3300003790 Bacteria 3113
17 Ga0055530_10000019 3300003791 Bacteria 140299
18 Ga0055530_10032509 3300003791 Bacteria 1356
19 Ga0055540_1000055 3300003792 Bacteria 140299
20 Ga0055540_1020293 3300003792 Bacteria 1761
21 Ga0055531_10013457 3300003794 Bacteria 3767
22 Ga0055531_10023444 3300003794 Bacteria 2314
23 Ga0055541_1000174 3300003841 Bacteria 30007
24 Ga0058692_1004321 3300003856 Bacteria 4229
25 Ga0055543_1000026 3300004625 Bacteria 136177
26 Ga0065165_1000178 3300005262 Bacteria 113319
27 Ga0065714_10064569 3300005288 Bacteria 34851
28 Ga0065714_10065532 3300005288 Bacteria 9551
29 Ga0065714_10067736 3300005288 Bacteria 5240
30 Ga0065714_10103007 3300005288 Bacteria 1611
31 Ga0065704_10073109 3300005289 Bacteria 7575
32 Ga0065712_10067965 3300005290 Bacteria 18934
33 Ga0070670_100000320 3300005331 Bacteria 41022
34 Ga0070661_100000542 3300005344 Bacteria 28914
35 Ga0070668_100268916 3300005347 Bacteria 1420
36 Ga0070669_100002464 3300005353 Bacteria 13398
37 Ga0070669_100226125 3300005353 Bacteria 1481
38 Ga0070667_100110464 3300005367 Bacteria 2383
39 Ga0070663_100126448 3300005455 Bacteria 1937
40 Ga0070706_100463698 3300005467 Bacteria 1179
41 Ga0070707_100007996 3300005468 Bacteria 9825
42 Ga0070699_100617659 3300005518 Bacteria 989
43 Ga0070697_100182771 3300005536 Bacteria 1778
44 Ga0068853_100002470 3300005539 Bacteria 13844
45 Ga0070665_100021962 3300005548 Bacteria 6419
46 Ga0070665_100310000 3300005548 Bacteria 1582
47 Ga0068855_100262194 3300005563 Bacteria 1925
48 Ga0070664_100000573 3300005564 Bacteria 28000
49 Ga0068864_100253724 3300005618 Bacteria 1634
50 Ga0068851_10000496 3300005834 Bacteria 17194
51 Ga0068862_100421155 3300005844 Bacteria 1253
52 Ga0068862_100510015 3300005844 Bacteria 1143
53 Ga0075365_10080763 3300006038 Bacteria 2202
54 Ga0075365_10192672 3300006038 Bacteria 1427
55 Ga0075368_10002683 3300006042 Bacteria 5858
56 Ga0075363_100149399 3300006048 Bacteria 1318
57 Ga0075364_10000074 3300006051 Bacteria 38784
58 Ga0075364_10042300 3300006051 Bacteria 2960
59 Ga0075432_10001221 3300006058 Bacteria 8267
60 Ga0075432_10008296 3300006058 Bacteria 3541
61 Ga0075432_10046576 3300006058 Bacteria 1522
62 Ga0075362_10001566 3300006177 Bacteria 7393
63 Ga0075362_10002799 3300006177 Bacteria 5947
64 Ga0075367_10173662 3300006178 Bacteria 1343
65 Ga0075369_10098754 3300006186 Bacteria 1308
66 Ga0075428_100099432 3300006844 Bacteria 3172
67 Ga0075428_100175897 3300006844 Bacteria 2318
68 Ga0075430_100042774 3300006846 Bacteria 3830
69 Ga0075431_100060324 3300006847 Bacteria 3914
70 Ga0075434_100285627 3300006871 Bacteria 1670
71 Ga0079104_1001498 3300006946 Bacteria 15520
72 Ga0079104_1002729 3300006946 Bacteria 9011
73 Ga0079104_1005594 3300006946 Bacteria 4978
74 Ga0099826_10075882 3300006948 Bacteria 2115
75 Ga0099826_10134000 3300006948 Bacteria 1440
76 Ga0099795_10000722 3300007788 Bacteria 6438
77 Ga0105251_10004799 3300009011 Bacteria 9046
78 Ga0105251_10006015 3300009011 Bacteria 7826
79 Ga0105251_10008857 3300009011 Bacteria 6025
80 Ga0105244_10000741 3300009036 Bacteria 27900
81 Ga0105244_10001750 3300009036 Bacteria 17059
82 Ga0105244_10002217 3300009036 Bacteria 14804
83 Ga0105244_10003560 3300009036 Bacteria 11063
84 Ga0105244_10009527 3300009036 Bacteria 5962
85 Ga0105250_10000064 3300009092 Bacteria 100417
86 Ga0105250_10000426 3300009092 Bacteria 30810
87 Ga0105240_10320663 3300009093 Bacteria 1766
88 Ga0111539_10281585 3300009094 Bacteria 1935
89 Ga0114129_10120872 3300009147 Bacteria 3606
90 Ga0114129_10129765 3300009147 Bacteria 3463
91 Ga0105243_10026924 3300009148 Bacteria 4404
92 Ga0105243_10084947 3300009148 Bacteria 2593
93 Ga0105242_10000808 3300009176 Bacteria 24276
94 Ga0105248_10467769 3300009177 Bacteria 1421
95 Ga0105237_10000096 3300009545 Bacteria 121683
96 Ga0105237_10002778 3300009545 Bacteria 21261
97 Ga0105237_10156526 3300009545 Bacteria 2276
98 Ga0105237_10201694 3300009545 Bacteria 1989
99 Ga0105238_10447232 3300009551 Bacteria 1289
100 Ga0105249_10703009 3300009553 Unclassified 1071
101 Ga0099796_10004345 3300010159 Bacteria 3417
102 Ga0105239_10000658 3300010375 Bacteria 49182
103 Ga0105246_10000442 3300011119 Bacteria 22222
104 Ga0157373_10000324 3300013100 Bacteria 38632
105 Ga0157373_10001736 3300013100 Bacteria 16567
106 Ga0157373_10014229 3300013100 Bacteria 5835
107 Ga0157373_10112917 3300013100 Bacteria 1910
108 Ga0157373_10140499 3300013100 Bacteria 1698
109 Ga0157371_10000283 3300013102 Bacteria 68598
110 Ga0157371_10077570 3300013102 Bacteria 2352
111 Ga0157371_10145560 3300013102 Bacteria 1688
112 Ga0157369_10003599 3300013105 Bacteria 18407
113 Ga0157369_10004013 3300013105 Bacteria 17447
114 Ga0157369_10006150 3300013105 Bacteria 13927
115 Ga0171463_1007 3300013249 Bacteria 301198
116 Ga0163162_10082307 3300013306 Bacteria 3291
117 Ga0163162_10162794 3300013306 Bacteria 2353
118 Ga0163162_10323501 3300013306 Bacteria 1674
119 Ga0163162_10344300 3300013306 Bacteria 1623
120 Ga0163162_10780498 3300013306 Bacteria 1074
121 Ga0157375_10000731 3300013308 Bacteria 28959
122 Ga0157375_10068656 3300013308 Bacteria 3547
123 Ga0157375_10074728 3300013308 Bacteria 3411
124 Ga0157375_10197517 3300013308 Bacteria 2167
125 Ga0182008_10001332 3300014497 Bacteria 16829
126 Ga0157379_10203073 3300014968 Bacteria 1793
127 Ga0182006_1000073 3300015261 Bacteria 131224
128 Ga0182006_1000490 3300015261 Bacteria 31074
129 Ga0182006_1026833 3300015261 Bacteria 2355
130 Ga0182007_10000031 3300015262 Bacteria 152299
131 Ga0182007_10000897 3300015262 Bacteria 16513
132 Ga0182005_1001430 3300015265 Bacteria 9604
133 Ga0183360_10164 3300015689 Bacteria 1426
134 Ga0183363_1084 3300015690 Bacteria 28436
135 Ga0183361_10502 3300016635 Bacteria 1721
136 Ga0163161_10006099 3300017792 Bacteria 8352
137 Ga0163161_10007002 3300017792 Bacteria 7799
138 Ga0163161_10008756 3300017792 Bacteria 6995
139 Ga0163161_10066893 3300017792 Bacteria 2624
140 Ga0163161_10087442 3300017792 Bacteria 2302
141 Ga0214544_1000010 3300021320 Bacteria 270164
142 Ga0214542_1000023 3300021321 Bacteria 191557
143 Ga0214542_1018094 3300021321 Bacteria 6095
144 Ga0214543_1000019 3300021327 Bacteria 267908
145 Ga0214543_1000022 3300021327 Bacteria 241930
146 Ga0213876_10002880 3300021384 Bacteria 9991
147 Ga0224712_10000426 3300022467 Bacteria 8317
148 Ga0228711_1000017 3300022739 Bacteria 121084
149 Ga0228710_1000005 3300022740 Bacteria 233531
150 Ga0209435_100321 3300025206 Bacteria 11531
151 Ga0209784_100112 3300025224 Bacteria 91142
152 Ga0209566_100045 3300025225 Bacteria 258557
153 Ga0209674_100156 3300025226 Bacteria 91147
154 Ga0209147_100056 3300025229 Bacteria 258557
155 Ga0209563_100064 3300025230 Bacteria 258557
156 Ga0207427_101730 3300025231 Bacteria 7186
157 Ga0209258_100588 3300025242 Bacteria 30150
158 Ga0209646_1001226 3300025246 Bacteria 7308
159 Ga0209677_100103 3300025253 Bacteria 91142
160 Ga0209129_1004102 3300025258 Bacteria 5927
161 Ga0209233_1000441 3300025261 Bacteria 28814
162 Ga0209673_1046403 3300025273 Bacteria 1186
163 Ga0209673_1054655 3300025273 Bacteria 1033
164 Ga0209130_1000017 3300025284 Bacteria 388431
165 Ga0209676_1000286 3300025292 Bacteria 103478
166 Ga0209676_1005118 3300025292 Bacteria 6988
167 Ga0209676_1006789 3300025292 Bacteria 5556
168 Ga0209676_1046704 3300025292 Bacteria 1169
169 Ga0209025_1000153 3300025294 Bacteria 170548
170 Ga0209025_1030262 3300025294 Bacteria 2595
171 Ga0209564_1000013 3300025295 Bacteria 775755
172 Ga0209564_1035365 3300025295 Bacteria 1447
173 Ga0209758_1003271 3300025297 Bacteria 15023
174 Ga0209758_1066154 3300025297 Bacteria 1162
175 Ga0209050_1000013 3300025298 Bacteria 811408
176 Ga0209050_1003890 3300025298 Bacteria 10593
177 Ga0209050_1009723 3300025298 Bacteria 4870
178 Ga0209050_1035176 3300025298 Bacteria 1485
179 Ga0209256_1000211 3300025299 Bacteria 110131
180 Ga0209256_1002050 3300025299 Bacteria 17868
181 Ga0209256_1009908 3300025299 Bacteria 4091
182 Ga0207426_1000006 3300025302 Bacteria 1025969
183 Ga0209051_1000007 3300025303 Bacteria 811408
184 Ga0209051_1018783 3300025303 Bacteria 3044
185 Ga0209051_1029926 3300025303 Bacteria 2123
186 Ga0209051_1031608 3300025303 Bacteria 2033
187 Ga0209257_1006653 3300025304 Bacteria 7339
188 Ga0209257_1007221 3300025304 Bacteria 6799
189 Ga0209257_1013465 3300025304 Bacteria 3633
190 Ga0209257_1024918 3300025304 Bacteria 2057
191 Ga0207656_10000491 3300025321 Bacteria 13084
192 Ga0207696_1000128 3300025711 Bacteria 134490
193 Ga0207696_1000266 3300025711 Bacteria 65599
194 Ga0207655_1000125 3300025728 Bacteria 152896
195 Ga0207655_1000611 3300025728 Bacteria 43237
196 Ga0207655_1002732 3300025728 Bacteria 13778
197 Ga0207655_1015748 3300025728 Bacteria 4181
198 Ga0207655_1027423 3300025728 Bacteria 2714
199 Ga0207713_1001911 3300025735 Bacteria 15776
200 Ga0207713_1003983 3300025735 Bacteria 9782
201 Ga0207713_1017300 3300025735 Bacteria 3623
202 Ga0207645_10057976 3300025907 Bacteria 2472
203 Ga0207684_10221360 3300025910 Bacteria 1633
204 Ga0207695_10570714 3300025913 Bacteria 1013
205 Ga0207671_10000158 3300025914 Bacteria 105476
206 Ga0207671_10000932 3300025914 Bacteria 36616
207 Ga0207649_10000010 3300025920 Bacteria 284354
208 Ga0207646_10178141 3300025922 Bacteria 1920
209 Ga0207681_10001975 3300025923 Bacteria 13163
210 Ga0207650_10000077 3300025925 Bacteria 132010
211 Ga0207650_10001685 3300025925 Bacteria 15705
212 Ga0207679_10000451 3300025945 Bacteria 28955
213 Ga0207639_10001288 3300026041 Bacteria 16915
214 Ga0207678_10012396 3300026067 Bacteria 7483
215 Ga0207676_10243724 3300026095 Bacteria 1614
216 Ga0207674_10128724 3300026116 Bacteria 2496
217 Ga0207675_100108175 3300026118 Bacteria 2622
218 Ga0209281_1000009 3300027111 Bacteria 771717
219 Ga0209281_1000082 3300027111 Bacteria 257684
220 Ga0209281_1001048 3300027111 Bacteria 20910
221 Ga0209371_1001449 3300027312 Bacteria 16072
222 Ga0209282_1000006 3300027666 Bacteria 276998
223 Ga0209282_1111588 3300027666 Bacteria 1386
224 Ga0207428_10050319 3300027907 Bacteria 3334
225 Ga0268266_10002047 3300028379 Bacteria 22376
226 Ga0268265_10341320 3300028380 Bacteria 1364
227 Ga0307515_10000017 3300028794 Bacteria 550465
228 Ga0307515_10005257 3300028794 Bacteria 26313
229 Ga0307515_10011281 3300028794 Bacteria 16963
230 Ga0307515_10221353 3300028794 Bacteria 1709
231 Ga0265338_10322077 3300028800 Bacteria 1119
232 Ga0268256_1032064 3300030500 Bacteria 1255
233 Ga0307511_10078808 3300030521 Bacteria 2333
234 Ga0316181_1012985 3300030744 Bacteria 1559
235 Ga0265339_10016336 3300031249 Bacteria 4427
236 Ga0265339_10091481 3300031249 Bacteria 1594
237 Ga0265331_10002957 3300031250 Bacteria 11197
238 Ga0265327_10020386 3300031251 Bacteria 4042
239 Ga0265316_10086395 3300031344 Bacteria 2398
240 Ga0307513_10085610 3300031456 Bacteria 3234
241 Ga0307513_10187530 3300031456 Bacteria 1923
242 Ga0307513_10254991 3300031456 Bacteria 1548
243 Ga0307513_10296206 3300031456 Bacteria 1387
244 Ga0307408_100013718 3300031548 Bacteria 5379
245 Ga0307408_100021328 3300031548 Bacteria 4383
246 Ga0307408_100031953 3300031548 Bacteria 3668
247 Ga0307408_100042897 3300031548 Bacteria 3216
248 Ga0307408_100088572 3300031548 Bacteria 2331
249 Ga0307408_100127763 3300031548 Bacteria 1979
250 Ga0265313_10000427 3300031595 Bacteria 44927
251 Ga0307508_10000120 3300031616 Bacteria 93316
252 Ga0307508_10088555 3300031616 Bacteria 2680
253 Ga0307508_10207925 3300031616 Bacteria 1558
254 Ga0307514_10030872 3300031649 Bacteria 4299
255 Ga0265314_10021289 3300031711 Bacteria 4990
256 Ga0265314_10059438 3300031711 Bacteria 2615
257 Ga0265314_10148720 3300031711 Bacteria 1439
258 Ga0265342_10150825 3300031712 Bacteria 1291
259 Ga0307516_10089119 3300031730 Bacteria 2916
260 Ga0307516_10308522 3300031730 Bacteria 1256
261 Ga0307405_10000074 3300031731 Bacteria 43352
262 Ga0307405_10000880 3300031731 Bacteria 11893
263 Ga0307405_10000937 3300031731 Bacteria 11623
264 Ga0307413_10089645 3300031824 Bacteria 1998
265 Ga0307406_10002998 3300031901 Bacteria 9186
266 Ga0307406_10014480 3300031901 Bacteria 4540
267 Ga0307406_10457577 3300031901 Bacteria 1025
268 Ga0307407_10283552 3300031903 Bacteria 1148
269 Ga0307412_10002361 3300031911 Bacteria 10465
270 Ga0307412_10003241 3300031911 Bacteria 9049
271 Ga0307412_10003971 3300031911 Bacteria 8242
272 Ga0307412_10010245 3300031911 Bacteria 5396
273 Ga0307412_10166307 3300031911 Bacteria 1645
274 Ga0307412_10389637 3300031911 Bacteria 1131
275 Ga0315914_1000003 3300031967 Bacteria 314370
276 Ga0307409_100067840 3300031995 Bacteria 2818
277 Ga0307409_100375502 3300031995 Bacteria 1350
278 Ga0307414_10060523 3300032004 Bacteria 2678
279 Ga0307414_10538574 3300032004 Bacteria 1039
280 Ga0307411_10040590 3300032005 Bacteria 2953
281 Ga0307507_10100847 3300033179 Bacteria 2417
282 Ga0307510_10014749 3300033180 Bacteria 9249
283 Ga0315913_1000001 3300033430 Bacteria 284459
284 Ga0315915_1000008 3300033464 Bacteria 258517
285 Ga0373943_0054017 3300035170 Bacteria 1986
286 Ga0373935_0035845 3300035692 Bacteria 3097
287 Ga0373935_0196192 3300035692 Bacteria 1393
288 Ga0373927_0000178 3300035695 Bacteria 50343
289 Ga0373927_0052629 3300035695 Bacteria 2633
290 Ga0316584_0019902 3300036712 Bacteria 4857
291 Ga0373925_0027566 3300037068 Bacteria 4157
292 Ga0373925_0033116 3300037068 Bacteria 3809
293 Ga0395905_0055924 3300037471 Bacteria 3693
294 Ga0395905_0200689 3300037471 Bacteria 1870
295 Ga0436364_0945858 3300037853 Bacteria 2447
296 Ga0436364_1107967 3300037853 Bacteria 1755
297 Ga0436365_0037768 3300039437 Bacteria 9764
298 Ga0436365_0146384 3300039437 Bacteria 1201
299 Ga0436365_1105090 3300039437 Bacteria 1476
300 Ga0436365_1233355 3300039437 Bacteria 2556
301 Ga0436365_1638075 3300039437 Bacteria 3484
302 Ga0436365_1869873 3300039437 Bacteria 3038
303 Ga0436363_0684692 3300039450 Bacteria 1983
304 Ga0436362_0435552 3300039453 Bacteria 6559
305 Ga0439436_0032531 3300041404 Bacteria 1512
306 Ga0439438_000386 3300041405 Bacteria 19748
307 Ga0439438_000697 3300041405 Bacteria 15007
308 Ga0439438_001340 3300041405 Bacteria 10914
309 Ga0439438_012374 3300041405 Bacteria 2617
310 Ga0439447_008430 3300041407 Bacteria 3189
311 Ga0439447_026102 3300041407 Bacteria 1500
312 Ga0439466_0009542 3300041411 Bacteria 3626
313 Ga0439466_0016293 3300041411 Bacteria 2687
314 Ga0439466_0031091 3300041411 Bacteria 1828
315 Ga0439465_0027929 3300041413 Bacteria 1788
316 Ga0439465_0046991 3300041413 Bacteria 1406
317 Ga0439465_0058743 3300041413 Bacteria 1271
318 Ga0439431_0003155 3300041997 Bacteria 3622
319 Ga0439432_000485 3300042006 Bacteria 14844
320 Ga0439432_001879 3300042006 Bacteria 7903
321 Ga0439432_004874 3300042006 Bacteria 4870
322 Ga0439432_019300 3300042006 Bacteria 2272
323 Ga0439449_0017316 3300042007 Bacteria 2705
324 Ga0439451_001004 3300042009 Bacteria 5468
325 Ga0439451_001789 3300042009 Bacteria 4292
326 Ga0439451_004353 3300042009 Bacteria 2876
327 Ga0439451_021232 3300042009 Bacteria 1310
328 Ga0439451_034048 3300042009 Bacteria 1024
329 Ga0439452_000115 3300042010 Bacteria 63101
330 Ga0439452_004469 3300042010 Bacteria 4683
331 Ga0439452_006930 3300042010 Bacteria 3508
332 Ga0439452_012663 3300042010 Bacteria 2390
333 Ga0439452_018860 3300042010 Bacteria 1830
334 Ga0439456_001848 3300042013 Bacteria 4280
335 Ga0439462_0009599 3300042015 Bacteria 2447
336 Ga0450911_002639 3300042115 Bacteria 3438
337 Ga0450919_014590 3300042121 Bacteria 887
338 Ga0450920_034343 3300042122 Bacteria 1003
339 Ga0450890_000773 3300042127 Bacteria 4613
340 Ga0450902_001124 3300042137 Bacteria 3564
341 Ga0450903_008341 3300042138 Bacteria 1695
342 Ga0450903_029206 3300042138 Bacteria 835
343 Ga0450904_000497 3300042139 Bacteria 7723
344 Ga0450906_002759 3300042145 Bacteria 3823
345 Ga0450907_003145 3300042146 Bacteria 2991
346 Ga0439446_0082398 3300042156 Bacteria 998
347 Ga0450908_011147 3300042184 Bacteria 1649
348 Ga0450909_001067 3300042185 Bacteria 3775
349 Ga0439434_0064628 3300042435 Bacteria 1147
350 Ga0439464_0087209 3300042439 Bacteria 938
351 Ga0450918_004860 3300042531 Bacteria 2430
352 Ga0439440_0063093 3300042993 Bacteria 949
353 Ga0466969_0134136 3300044656 Bacteria 1147
354 Ga0451576_0013360 3300045051 Bacteria 9188
355 Ga0451576_0148426 3300045051 Bacteria 2445
356 Ga0495617_000074 3300046452 Bacteria 80489
357 Ga0495617_010123 3300046452 Bacteria 3230
358 Ga0495627_000589 3300046453 Bacteria 29043
359 Ga0495627_008405 3300046453 Bacteria 3876
360 Ga0495603_0150916 3300046455 Bacteria 1350
361 Ga0495590_0002081 3300046457 Bacteria 8383
362 Ga0495591_000566 3300046458 Bacteria 28402
363 Ga0495591_001343 3300046458 Bacteria 15437
364 Ga0495591_006973 3300046458 Bacteria 4883
365 Ga0495591_009170 3300046458 Bacteria 3956
366 Ga0495591_014319 3300046458 Bacteria 2858
367 Ga0495638_0013208 3300046460 Bacteria 5633
368 Ga0495638_0028211 3300046460 Bacteria 3626
369 Ga0495638_0039708 3300046460 Bacteria 2986
370 Ga0495638_0156690 3300046460 Bacteria 1317
371 Ga0495650_0000522 3300046471 Bacteria 56293
372 Ga0495650_0001172 3300046471 Bacteria 28022
373 Ga0495650_0001646 3300046471 Bacteria 20716
374 Ga0495650_0007710 3300046471 Bacteria 6414
375 Ga0495605_0000002 3300046474 Bacteria 522417
376 Ga0495605_0000274 3300046474 Bacteria 58499
377 Ga0495605_0001555 3300046474 Bacteria 14911
378 Ga0495605_0009296 3300046474 Bacteria 5524
379 Ga0495605_0015866 3300046474 Bacteria 4089
380 Ga0495605_0037597 3300046474 Bacteria 2433
381 Ga0495639_0000002 3300046475 Bacteria 192403
382 Ga0495662_0062591 3300046476 Bacteria 1797
383 Ga0495584_0000084 3300046491 Bacteria 65138
384 Ga0495584_0000094 3300046491 Bacteria 60342
385 Ga0495584_0012466 3300046491 Bacteria 4338
386 Ga0495585_0002777 3300046492 Bacteria 12200
387 Ga0495585_0085280 3300046492 Bacteria 1707
388 Ga0495585_0179364 3300046492 Bacteria 1090
389 Ga0495585_0184253 3300046492 Bacteria 1072
390 Ga0495585_0197839 3300046492 Bacteria 1025
391 Ga0495594_0001723 3300046499 Bacteria 11336
392 Ga0495594_0006359 3300046499 Bacteria 6072
393 Ga0495607_0000092 3300046501 Bacteria 93857
394 Ga0495607_0000094 3300046501 Bacteria 92515
395 Ga0495607_0001096 3300046501 Bacteria 24697
396 Ga0495607_0003046 3300046501 Bacteria 13054
397 Ga0495607_0005609 3300046501 Bacteria 8952
398 Ga0495607_0025163 3300046501 Bacteria 3704
399 Ga0495607_0058068 3300046501 Bacteria 2214
400 Ga0495607_0127710 3300046501 Bacteria 1327
401 Ga0495583_0000012 3300046506 Bacteria 324839
402 Ga0495583_0002173 3300046506 Bacteria 17490
403 Ga0495583_0003086 3300046506 Bacteria 13193
404 Ga0495583_0011012 3300046506 Bacteria 5216
405 Ga0495583_0033369 3300046506 Bacteria 2476
406 Ga0495583_0036450 3300046506 Bacteria 2339
407 Ga0495583_0049265 3300046506 Bacteria 1930
408 Ga0495606_0000199 3300046507 Bacteria 104847
409 Ga0495606_0034210 3300046507 Bacteria 3490
410 Ga0495606_0051216 3300046507 Bacteria 2694
411 Ga0495606_0123685 3300046507 Bacteria 1545
412 Ga0495610_0011302 3300046512 Bacteria 5467
413 Ga0495610_0019119 3300046512 Bacteria 3842
414 Ga0495610_0030834 3300046512 Bacteria 2803
415 Ga0495610_0037718 3300046512 Bacteria 2457
416 Ga0495610_0051303 3300046512 Bacteria 2008
417 Ga0495616_0002349 3300046513 Bacteria 12614
418 Ga0495616_0017389 3300046513 Bacteria 3967
419 Ga0495616_0027295 3300046513 Bacteria 3030
420 Ga0495616_0056317 3300046513 Bacteria 1942
421 Ga0495616_0088595 3300046513 Bacteria 1469
422 Ga0495620_0000010 3300046515 Bacteria 173604
423 Ga0495620_0000374 3300046515 Bacteria 30623
424 Ga0495620_0068612 3300046515 Bacteria 1456
425 Ga0495620_0075044 3300046515 Bacteria 1376
426 Ga0495620_0159967 3300046515 Bacteria 875
427 Ga0495630_0068258 3300046517 Bacteria 2673
428 Ga0495631_0018210 3300046518 Bacteria 3310
429 Ga0495631_0028943 3300046518 Bacteria 2524
430 Ga0495631_0031168 3300046518 Bacteria 2415
431 Ga0495631_0121702 3300046518 Bacteria 1122
432 Ga0495632_0000022 3300046519 Bacteria 187045
433 Ga0495632_0000200 3300046519 Bacteria 60951
434 Ga0495632_0000487 3300046519 Bacteria 37602
435 Ga0495632_0000922 3300046519 Bacteria 25785
436 Ga0495632_0002318 3300046519 Bacteria 14649
437 Ga0495632_0014680 3300046519 Bacteria 4423
438 Ga0495632_0024520 3300046519 Bacteria 3202
439 Ga0495632_0128653 3300046519 Bacteria 1179
440 Ga0495637_0000074 3300046520 Bacteria 80233
441 Ga0495637_0000412 3300046520 Bacteria 31651
442 Ga0495637_0005041 3300046520 Bacteria 6788
443 Ga0495637_0008438 3300046520 Bacteria 5060
444 Ga0495643_0008180 3300046522 Bacteria 6651
445 Ga0495643_0017290 3300046522 Bacteria 4217
446 Ga0495644_0021862 3300046523 Bacteria 2438
447 Ga0495648_0006838 3300046524 Bacteria 9210
448 Ga0495648_0017466 3300046524 Bacteria 5126
449 Ga0495648_0031752 3300046524 Bacteria 3474
450 Ga0495648_0070354 3300046524 Bacteria 2033
451 Ga0495648_0075064 3300046524 Bacteria 1946
452 Ga0495648_0116453 3300046524 Bacteria 1444
453 Ga0495663_0101288 3300046525 Bacteria 949
454 Ga0495666_0012334 3300046526 Bacteria 4261
455 Ga0495642_0001429 3300046528 Bacteria 10696
456 Ga0495642_0001436 3300046528 Bacteria 10677
457 Ga0495654_0000362 3300046530 Bacteria 39403
458 Ga0495654_0000382 3300046530 Bacteria 38175
459 Ga0495654_0000391 3300046530 Bacteria 37667
460 Ga0495654_0003297 3300046530 Bacteria 9949
461 Ga0495654_0012316 3300046530 Bacteria 4596
462 Ga0495654_0025400 3300046530 Bacteria 3051
463 Ga0495654_0031182 3300046530 Bacteria 2706
464 Ga0495654_0035341 3300046530 Bacteria 2517
465 Ga0495654_0040056 3300046530 Bacteria 2337
466 Ga0495640_0065789 3300046533 Bacteria 2447
467 Ga0495609_0000008 3300046538 Bacteria 383025
468 Ga0495609_0000125 3300046538 Bacteria 83190
469 Ga0495609_0000211 3300046538 Bacteria 58163
470 Ga0495609_0005717 3300046538 Bacteria 6475
471 Ga0495609_0044059 3300046538 Bacteria 2002
472 Ga0495597_0000366 3300046542 Bacteria 39958
473 Ga0495597_0004619 3300046542 Bacteria 7509
474 Ga0495597_0014614 3300046542 Bacteria 3735
475 Ga0495597_0091611 3300046542 Bacteria 1290
476 Ga0495622_0003749 3300046557 Bacteria 7111
477 Ga0495622_0005612 3300046557 Bacteria 5819
478 Ga0495633_0000009 3300046558 Bacteria 293183
479 Ga0495633_0023268 3300046558 Bacteria 3070
480 Ga0495633_0039451 3300046558 Bacteria 2254
481 Ga0495668_0036290 3300046616 Bacteria 2762
482 Ga0495611_0000998 3300046648 Bacteria 15040
483 Ga0495625_0014639 3300046660 Bacteria 6249
484 Ga0495625_0050688 3300046660 Bacteria 2978
485 Ga0495625_0052515 3300046660 Bacteria 2918
486 Ga0495625_0118206 3300046660 Bacteria 1806
487 Ga0495625_0186449 3300046660 Bacteria 1376
488 Ga0495625_0239954 3300046660 Bacteria 1180
489 Ga0495659_0000035 3300046664 Bacteria 64001
490 Ga0495659_0012408 3300046664 Bacteria 2759
491 Ga0495659_0025564 3300046664 Bacteria 2022
492 Ga0495659_0039741 3300046664 Bacteria 1673
493 Ga0495661_0000029 3300046665 Bacteria 173899
494 Ga0495661_0000083 3300046665 Bacteria 116027
495 Ga0495661_0000468 3300046665 Bacteria 42758
496 Ga0495661_0002752 3300046665 Bacteria 13365
497 Ga0495661_0037531 3300046665 Bacteria 3024
498 Ga0495661_0054847 3300046665 Bacteria 2391
499 Ga0495669_0005644 3300046684 Bacteria 5222
500 Ga0495624_0192838 3300046690 Bacteria 1239
501 Ga0495670_0000280 3300046691 Bacteria 24045
502 Ga0495670_0002007 3300046691 Bacteria 10014
503 Ga0495670_0023754 3300046691 Bacteria 3026
504 Ga0495670_0053335 3300046691 Bacteria 2025
505 Ga0495670_0129883 3300046691 Bacteria 1313
506 Ga0495670_0179193 3300046691 Bacteria 1118
507 Ga0495671_0000136 3300046692 Bacteria 65148
508 Ga0495671_0000389 3300046692 Bacteria 36241
509 Ga0495671_0025715 3300046692 Bacteria 3056
510 Ga0495671_0086317 3300046692 Bacteria 1537
511 Ga0495649_0000289 3300046694 Bacteria 44254
512 Ga0495649_0001225 3300046694 Bacteria 19753
513 Ga0495649_0001839 3300046694 Bacteria 15570
514 Ga0495649_0034556 3300046694 Bacteria 2781
515 Ga0495589_0000075 3300046794 Bacteria 92974
516 Ga0495589_0000942 3300046794 Bacteria 17846
517 Ga0495589_0011459 3300046794 Bacteria 4602
518 Ga0495589_0018843 3300046794 Bacteria 3539
519 Ga0495600_0093689 3300046809 Bacteria 1958
520 Ga0495660_0000520 3300046810 Bacteria 31644
521 Ga0495660_0002132 3300046810 Bacteria 12783
522 Ga0495660_0039190 3300046810 Bacteria 2631
523 Ga0495660_0041488 3300046810 Bacteria 2547
524 Ga0495660_0128690 3300046810 Bacteria 1272
525 Ga0495660_0159691 3300046810 Bacteria 1106
526 Ga0495581_0001262 3300047315 Bacteria 13921
527 Ga0495604_0001148 3300047317 Bacteria 21939
528 Ga0495636_0001517 3300047318 Bacteria 8809
529 Ga0495672_0000433 3300047320 Bacteria 50107
530 Ga0495672_0000814 3300047320 Bacteria 33480
531 Ga0495672_0011424 3300047320 Bacteria 6268
532 Ga0495672_0051140 3300047320 Bacteria 2435
533 Ga0495672_0055348 3300047320 Bacteria 2315
534 Ga0495672_0101482 3300047320 Bacteria 1559
535 Ga0495680_0021969 3300047322 Bacteria 5331
536 Ga0495680_0036589 3300047322 Bacteria 3940
537 Ga0495683_0000039 3300047323 Bacteria 137702
538 Ga0495683_0005744 3300047323 Bacteria 6838
539 Ga0495683_0023291 3300047323 Bacteria 3182
540 Ga0495683_0062877 3300047323 Bacteria 1835
541 Ga0495683_0112513 3300047323 Bacteria 1298
542 Ga0495683_0112749 3300047323 Bacteria 1296
543 Ga0495687_000260 3300047443 Bacteria 71197
544 Ga0495687_001168 3300047443 Bacteria 25374
545 Ga0495687_002151 3300047443 Bacteria 16448
546 Ga0495687_026573 3300047443 Bacteria 2722
547 Ga0495677_0000490 3300047445 Bacteria 16791
548 Ga0495679_001047 3300047446 Bacteria 16872
549 Ga0495679_008706 3300047446 Bacteria 4106
550 Ga0495679_009235 3300047446 Bacteria 3960
551 Ga0495679_015404 3300047446 Bacteria 2798
552 Ga0495685_020232 3300047447 Bacteria 2287
553 Ga0495685_022820 3300047447 Bacteria 2153
554 Ga0495673_0001395 3300047469 Bacteria 19424
555 Ga0495673_0001462 3300047469 Bacteria 18726
556 Ga0495673_0003525 3300047469 Bacteria 10298
557 Ga0495673_0017671 3300047469 Bacteria 3613
558 Ga0495673_0018312 3300047469 Bacteria 3533
559 Ga0495681_0004673 3300047470 Bacteria 9282
560 Ga0495681_0004690 3300047470 Bacteria 9272
561 Ga0495681_0011322 3300047470 Bacteria 5320
562 Ga0495681_0012410 3300047470 Bacteria 5007
563 Ga0495681_0019758 3300047470 Bacteria 3669
564 Ga0495686_0006218 3300047472 Bacteria 9203
565 Ga0495686_0029683 3300047472 Bacteria 3556
566 Ga0495686_0039808 3300047472 Bacteria 3000
567 Ga0495686_0044657 3300047472 Bacteria 2805
568 Ga0495686_0120405 3300047472 Bacteria 1565
569 Ga0495686_0186660 3300047472 Bacteria 1197
570 Ga0495593_0032130 3300047673 Bacteria 2863
571 Ga0495626_0000544 3300048091 Bacteria 37459
572 Ga0495626_0002984 3300048091 Bacteria 11213
573 Ga0495626_0009129 3300048091 Bacteria 5375
574 Ga0495626_0080541 3300048091 Bacteria 1447
575 Ga0495626_0173340 3300048091 Bacteria 898
576 Ga0496106_0618893 3300048909 Bacteria 867
577 Ga0496116_0000454 3300048919 Bacteria 56678
578 Ga0496117_0000246 3300048920 Bacteria 102783
579 Ga0496117_0008288 3300048920 Bacteria 9890
580 Ga0496117_0055874 3300048920 Bacteria 2754
581 Ga0496117_0133386 3300048920 Bacteria 1500
582 Ga0496118_0022520 3300048921 Bacteria 5503
583 Ga0496118_0055796 3300048921 Bacteria 2976
584 Ga0496118_0057447 3300048921 Bacteria 2916
585 Ga0496118_0138741 3300048921 Bacteria 1546
586 Ga0496120_0007188 3300048923 Bacteria 8337
587 Ga0496120_0020423 3300048923 Bacteria 4210
588 Ga0496121_0000180 3300048924 Bacteria 141128
589 Ga0496121_0002269 3300048924 Bacteria 29925
590 Ga0496121_0031970 3300048924 Bacteria 4796
591 Ga0496121_0064794 3300048924 Bacteria 2977
592 Ga0496121_0149139 3300048924 Bacteria 1724
593 Ga0496122_0016424 3300048925 Bacteria 7004
594 Ga0496122_0042838 3300048925 Bacteria 3555
595 Ga0496122_0045072 3300048925 Bacteria 3432
596 Ga0496122_0106783 3300048925 Bacteria 1852
597 Ga0496122_0255503 3300048925 Bacteria 976
598 Ga0496123_0030860 3300048926 Bacteria 3914
599 Ga0496123_0101778 3300048926 Bacteria 1669
600 Ga0496123_0122028 3300048926 Bacteria 1463
601 Ga0496123_0129984 3300048926 Bacteria 1397
602 Ga0496124_0000035 3300048927 Bacteria 318099
603 Ga0496124_0000239 3300048927 Bacteria 106633
604 Ga0496124_0000426 3300048927 Bacteria 75499
605 Ga0496124_0004925 3300048927 Bacteria 15332
606 Ga0496124_0075394 3300048927 Bacteria 2786
607 Ga0496124_0077830 3300048927 Bacteria 2734
608 Ga0496124_0146188 3300048927 Bacteria 1860
609 Ga0496125_0000266 3300048928 Bacteria 107204
610 Ga0496125_0001791 3300048928 Bacteria 29691
611 Ga0496125_0026408 3300048928 Bacteria 5292
612 Ga0496125_0032347 3300048928 Bacteria 4647
613 Ga0496125_0067574 3300048928 Bacteria 2815
614 Ga0496126_0009133 3300048929 Bacteria 10578
615 Ga0496126_0029029 3300048929 Bacteria 5259
616 Ga0496126_0048532 3300048929 Bacteria 3878
617 Ga0496126_0213918 3300048929 Bacteria 1622
618 Ga0495678_000008 3300049459 Bacteria 445926
619 Ga0495678_000011 3300049459 Bacteria 335512
620 Ga0495678_000255 3300049459 Bacteria 59619
621 Ga0495678_001291 3300049459 Bacteria 20231
622 Ga0495678_009198 3300049459 Bacteria 4915
623 Ga0495682_0030923 3300049460 Bacteria 1980
624 Ga0501031_0000002 3300049568 Bacteria 217588
625 Ga0501031_0095966 3300049568 Bacteria 1935
626 Ga0501031_0333377 3300049568 Bacteria 982
627 Ga0501032_0000004 3300049569 Bacteria 310855
628 Ga0501032_0007011 3300049569 Bacteria 8264
629 Ga0501032_0024083 3300049569 Bacteria 4204
630 Ga0501032_0084271 3300049569 Bacteria 2113
631 Ga0501032_0113675 3300049569 Bacteria 1791
632 Ga0501032_0121464 3300049569 Bacteria 1727
633 Ga0501033_0000016 3300049570 Bacteria 217458
634 Ga0501033_0000776 3300049570 Bacteria 29378
635 Ga0501033_0004986 3300049570 Bacteria 10556
636 Ga0501033_0019437 3300049570 Bacteria 5137
637 Ga0501033_0056499 3300049570 Bacteria 2901
638 Ga0501033_0435889 3300049570 Bacteria 911
639 Ga0501034_0000011 3300049571 Bacteria 310855
640 Ga0501034_0004793 3300049571 Bacteria 14958
641 Ga0501034_0078297 3300049571 Bacteria 3311
642 Ga0501034_0120939 3300049571 Bacteria 2605
643 Ga0501036_0000001 3300049572 Bacteria 310855
644 Ga0501036_0003294 3300049572 Bacteria 12883
645 Ga0501036_0017362 3300049572 Bacteria 6016
646 Ga0501036_0102500 3300049572 Bacteria 2421
647 Ga0501037_0000006 3300049573 Bacteria 217461
648 Ga0501037_0005086 3300049573 Bacteria 9569
649 Ga0501038_0000003 3300049574 Bacteria 310855
650 Ga0501038_0006213 3300049574 Bacteria 11049
651 Ga0501038_0034451 3300049574 Bacteria 4452
652 Ga0501038_0050397 3300049574 Bacteria 3597
653 Ga0501038_0208395 3300049574 Bacteria 1565
654 Ga0501039_0000004 3300049575 Bacteria 310855
655 Ga0501039_0001298 3300049575 Bacteria 18251
656 Ga0501039_0002554 3300049575 Bacteria 13579
657 Ga0501040_0012498 3300049576 Bacteria 5563
658 Ga0501040_0031479 3300049576 Bacteria 3586
659 Ga0501041_0017232 3300049577 Bacteria 4299
660 Ga0501042_0035928 3300049578 Bacteria 3516
661 Ga0501043_0000155 3300049579 Bacteria 62570
662 Ga0501043_0011433 3300049579 Bacteria 6949
663 Ga0501043_0013677 3300049579 Bacteria 6352
664 Ga0501043_0058597 3300049579 Bacteria 3023
665 Ga0501043_0173316 3300049579 Bacteria 1683
666 Ga0501043_0250168 3300049579 Bacteria 1365
667 Ga0501046_0001714 3300049580 Bacteria 20920
668 Ga0501046_0105275 3300049580 Bacteria 2161
669 Ga0501047_0008235 3300049581 Bacteria 9840
670 Ga0501047_0021199 3300049581 Bacteria 6240
671 Ga0501047_0028069 3300049581 Bacteria 5424
672 Ga0501047_0051856 3300049581 Bacteria 3965
673 Ga0501047_0167134 3300049581 Bacteria 2070
674 Ga0501047_0188275 3300049581 Bacteria 1928
675 Ga0501048_0023429 3300049582 Bacteria 4510
676 Ga0501048_0098677 3300049582 Bacteria 2060
677 Ga0501067_0011153 3300049583 Bacteria 4972
678 Ga0501067_0032647 3300049583 Bacteria 2889
679 Ga0501067_0103336 3300049583 Bacteria 1583
680 Ga0501068_0391808 3300049584 Bacteria 895
681 Ga0501069_0002311 3300049585 Bacteria 9623
682 Ga0501069_0002521 3300049585 Bacteria 9350
683 Ga0501069_0044511 3300049585 Bacteria 2457
684 Ga0501070_0004969 3300049586 Bacteria 11347
685 Ga0501070_0022569 3300049586 Bacteria 5271
686 Ga0501070_0024946 3300049586 Bacteria 5014
687 Ga0501070_0285997 3300049586 Bacteria 1345
688 Ga0501072_0224161 3300049588 Bacteria 1498
689 Ga0501073_0002004 3300049589 Bacteria 15198
690 Ga0501073_0081427 3300049589 Bacteria 2252
691 Ga0501074_0005021 3300049590 Bacteria 9496
692 Ga0501074_0015837 3300049590 Bacteria 5483
693 Ga0501076_0033050 3300049592 Bacteria 4039
694 Ga0501077_0184996 3300049593 Bacteria 1324
695 Ga0501080_0002095 3300049742 Bacteria 17315
696 Ga0501080_0005500 3300049742 Bacteria 11307
697 Ga0501080_0054430 3300049742 Bacteria 3726
698 Ga0501080_0059597 3300049742 Bacteria 3552
699 Ga0501080_0303918 3300049742 Bacteria 1446
700 Ga0501081_0051987 3300049743 Bacteria 2826
701 Ga0501081_0165934 3300049743 Bacteria 1593
702 Ga0501083_0006586 3300049744 Bacteria 8243
703 Ga0501083_0015812 3300049744 Bacteria 5282
704 Ga0501035_0000009 3300049822 Bacteria 310827
705 Ga0501035_0000882 3300049822 Bacteria 31844
706 Ga0501035_0003895 3300049822 Bacteria 14234
707 Ga0501035_0010603 3300049822 Bacteria 8534
708 Ga0501035_0011132 3300049822 Bacteria 8331
709 Ga0501035_0086021 3300049822 Bacteria 2770
710 Ga0501035_0138933 3300049822 Bacteria 2113
711 Ga0501035_0556100 3300049822 Bacteria 939
712 Ga0501044_0000005 3300049823 Bacteria 310855
713 Ga0501044_0002857 3300049823 Bacteria 19658
714 Ga0501044_0004158 3300049823 Bacteria 16261
715 Ga0501044_0008383 3300049823 Bacteria 11335
716 Ga0501044_0058607 3300049823 Bacteria 3948
717 Ga0501044_0108391 3300049823 Bacteria 2787
718 Ga0501044_0145502 3300049823 Bacteria 2356
719 Ga0501045_0035725 3300049824 Bacteria 3608
720 Ga0501045_0192189 3300049824 Bacteria 1521
721 nmdc:mga03683_1610_c1 3300050489 Bacteria 6761
722 nmdc:mga00v17_156797_c1 3300050491 Bacteria 1129
723 nmdc:mga00v17_34678_c1 3300050491 Bacteria 2999
724 nmdc:mga00v17_78_c1 3300050491 Bacteria 40508
725 nmdc:mga06z11_130956_c1 3300050494 Bacteria 1409
726 nmdc:mga05p37_91105_c1 3300050507 Bacteria 3757
727 nmdc:mga0qj67_35425_c1 3300050509 Bacteria 3902
728 nmdc:mga06r32_63496_c1 3300050510 Bacteria 3560
729 Ga0500610_0111003 3300053079 Bacteria 1410
730 Ga0500635_0076582 3300053080 Bacteria 1195
731 Ga0500578_0027239 3300053086 Bacteria 3669
732 Ga0500578_0080411 3300053086 Bacteria 2073
733 Ga0500578_0144913 3300053086 Bacteria 1483
734 Ga0500643_000018 3300053087 Bacteria 296505
735 Ga0500651_0047064 3300053093 Bacteria 2712
736 Ga0500557_026644 3300053105 Bacteria 1712
737 Ga0500569_013068 3300053109 Bacteria 2024
738 Ga0500594_0013298 3300053118 Bacteria 1955
739 Ga0500595_025960 3300053119 Bacteria 2024
740 Ga0500618_001769 3300053125 Bacteria 9143
741 Ga0500628_048075 3300053129 Bacteria 1002
742 Ga0500658_0089692 3300053134 Bacteria 1327
743 Ga0500568_0000559 3300053139 Bacteria 27350
744 Ga0500573_0000318 3300053140 Bacteria 20446
745 Ga0500573_0186650 3300053140 Bacteria 1110
746 Ga0500577_0015467 3300053142 Bacteria 2385
747 Ga0500577_0140349 3300053142 Bacteria 1019
748 Ga0500588_0000513 3300053146 Bacteria 6205
749 Ga0500590_008948 3300053148 Bacteria 5016
750 Ga0500590_100009 3300053148 Bacteria 1394
751 Ga0500603_023857 3300053150 Bacteria 1526
752 Ga0500616_0121440 3300053153 Bacteria 1247
753 Ga0500634_0030134 3300053161 Bacteria 2956
754 Ga0500638_083866 3300053162 Bacteria 1510
755 Ga0500636_0003139 3300053177 Bacteria 9260
756 Ga0500637_0096670 3300053178 Bacteria 1711
757 Ga0500657_052883 3300053728 Bacteria 1845
758 Ga0501084_0007525 3300054114 Bacteria 8979
759 Ga0587077_000735 3300059493 Bacteria 3082
760 Ga0587090_000082 3300059510 Bacteria 5551
761 Ga0587101_000045 3300059623 Bacteria 5392
762 Ga0587128_000033 3300059630 Bacteria 5729
763 Ga0587062_003060 3300059639 Bacteria 1659
764 Ga0501082_0010931 3300060353 Bacteria 7812
765 Ga0501082_0028554 3300060353 Bacteria 4805
766 Ga0501082_0080476 3300060353 Bacteria 2811
767 Ga0501082_0094165 3300060353 Bacteria 2588
768 Ga0501082_0133163 3300060353 Bacteria 2157
769 Ga0501082_0136596 3300060353 Bacteria 2128
770 2511255533 2511231004 Bacteria 6669789
771 2509108037 2508501122 Bacteria 6292184
772 2509140883 2508501127 Bacteria 7037543
773 2509376783 2509276019 Bacteria 6802256
774 2510282181 2510065053 Bacteria 5005518
775 2510291614 2510065055 Bacteria 5037935
776 2510308310 2510065057 Bacteria 6649661
777 2510310329 2510065058 Bacteria 5005894
778 2511270464 2511231007 Bacteria 6306603
779 2511328534 2511231016 Bacteria 6704427
780 2511362772 2511231022 Bacteria 6719296
781 2511391656 2511231027 Bacteria 5013807
782 2511502514 2511231052 Bacteria 6974333
783 2511824950 2511231156 Bacteria 6845832
784 2512533888 2512047086 Bacteria 6850303
785 2512970353 2512875026 Bacteria 6861065
786 2513581640 2513237085 Bacteria 7695351
787 2513587454 2513237086 Bacteria 7265287
788 2513601417 2513237089 Bacteria 6553624
789 2513619568 2513237091 Bacteria 6900273
790 2513881799 2513237140 Bacteria 7076289
791 2513904943 2513237143 Bacteria 6664116
792 2513983615 2513237156 Bacteria 6402557
793 2513997563 2513237159 Bacteria 6810126
794 2514003136 2513237160 Bacteria 6650282
795 2515609302 2515154107 Bacteria 6795637
796 2515744628 2515154134 Bacteria 7220242
797 2516206065 2516143018 Bacteria 6951533
798 2516893889 2516653046 Bacteria 6989037
799 2517570609 2517487022 Bacteria 7227575
800 2524448288 2524023207 Bacteria 6813453
801 2551679604 2551306084 Bacteria 8942552
802 2551689435 2551306085 Bacteria 7347181
803 2551696966 2551306086 Bacteria 6843938
804 2551701303 2551306087 Bacteria 7351905
805 2551709517 2551306089 Bacteria 7162724
806 2551723850 2551306090 Bacteria 7953713
807 2551724796 2551306091 Bacteria 7086830
808 2551735549 2551306092 Bacteria 6992595
809 2551743360 2551306093 Bacteria 7064773
810 2558865859 2558860100 Bacteria 8458965
811 2585167565 2582581283 Bacteria 6030556
812 2585265791 2582581306 Bacteria 6450535
813 2585389038 2582581865 Bacteria 6644329
814 2585395185 2582581866 Bacteria 6859583
815 2585405028 2582581867 Bacteria 7184437
816 2585530386 2585427526 Bacteria 7258840
817 2597864445 2597489888 Bacteria 6179543
818 2597869431 2597489889 Bacteria 6297495
819 2599331208 2599185155 Bacteria 5827168
820 2599332103 2599185156 Bacteria 5403036
821 2599399331 2599185167 Bacteria 6353609
822 2599453568 2599185179 Bacteria 6611171
823 2599500654 2599185188 Bacteria 6164180
824 2599510450 2599185189 Bacteria 5862825
825 2599513822 2599185190 Bacteria 6285678
826 2599519001 2599185191 Bacteria 6297582
827 2599606177 2599185210 Bacteria 5624189
828 2599612851 2599185212 Bacteria 6765997
829 2599769057 2599185248 Bacteria 6696816
830 2599880997 2599185288 Bacteria 6666191
831 2599888302 2599185289 Bacteria 6778765
832 2599892879 2599185290 Bacteria 6289611
833 2599895970 2599185291 Bacteria 6775623
834 2599932317 2599185300 Bacteria 6062622
835 2599951210 2599185303 Bacteria 6512725
836 2599957855 2599185305 Bacteria 6748700
837 2599966795 2599185306 Bacteria 6637356
838 2599970876 2599185307 Bacteria 6194719
839 2599978074 2599185308 Bacteria 6621546
840 2599993363 2599185311 Bacteria 6354990
841 2600004052 2599185313 Bacteria 6658188
842 2600012199 2599185314 Bacteria 6621749
843 2600015578 2599185315 Bacteria 6771107
844 2600021948 2599185316 Bacteria 6320029
845 2600028538 2599185317 Bacteria 6435722
846 2600037545 2599185318 Bacteria 6961590
847 2600042858 2599185319 Bacteria 6637840
848 2600050786 2599185321 Bacteria 6764560
849 2600060068 2599185322 Bacteria 6763055
850 2600063289 2599185323 Bacteria 6688755
851 2600072686 2599185324 Bacteria 6590677
852 2600075222 2599185325 Bacteria 6324919
853 2600196066 2599185352 Bacteria 7228948
854 2600357705 2600254930 Bacteria 6431253
855 2601690328 2600255296 Bacteria 5784754
856 2621299175 2619619299 Bacteria 6649820
857 2624492081 2623620446 Bacteria 6500345
858 2643804393 2643221557 Bacteria 7184309
859 2643871753 2643221571 Bacteria 6228673
860 2643917569 2643221582 Bacteria 5804683
861 2644050092 2643221607 Bacteria 6314006
862 2644065164 2643221610 Bacteria 7480339
863 2644105456 2643221618 Bacteria 7717186
864 2644133858 2643221623 Bacteria 5239945
865 2644146459 2643221626 Bacteria 8069654
866 2644204848 2643221636 Bacteria 6583769
867 2644208686 2643221637 Bacteria 5345260
868 2644283950 2643221650 Bacteria 7029547
869 2644298176 2643221653 Bacteria 4569637
870 2644308207 2643221655 Bacteria 7722067
871 2644334031 2643221659 Bacteria 7890716
872 2644377573 2643221668 Bacteria 7306521
873 2644416836 2643221675 Bacteria 7473456
874 2644449876 2643221680 Bacteria 7473610
875 2644483013 2643221686 Bacteria 6310811
876 2644494204 2643221688 Bacteria 5260751
877 2644497680 2643221689 Bacteria 6042950
878 2644541628 2643221698 Bacteria 7756764
879 2644615489 2643221712 Bacteria 7729434
880 2644620552 2643221713 Bacteria 6554480
881 2644652216 2643221718 Bacteria 5345506
882 2644656428 2643221719 Bacteria 4568197
883 2644672771 2643221723 Bacteria 7095460
884 2644690011 2643221726 Bacteria 7455827
885 2657684856 2657244999 Bacteria 5946535
886 2671088662 2667528170 Bacteria 6786960
887 2671126296 2667528176 Bacteria 6724917
888 2677899174 2675903420 Bacteria 6247433
889 2678263614 2675903515 Bacteria 6580491
890 2692315172 2690316117 Bacteria 6800650
891 2715498988 2713897090 Bacteria 3353799
892 2723249149 2721755607 Bacteria 5841722
893 2738672332 2738541265 Bacteria 6594665
894 2738687787 2738541271 Bacteria 5657310
895 2738750725 2738541282 Bacteria 6593925
896 2738812155 2738541294 Bacteria 6925949
897 2738859766 2738541303 Bacteria 6591772
898 2738899515 2738541309 Bacteria 6926455
899 2738944305 2738541317 Bacteria 5340176
900 2739263778 2738543016 Bacteria 5657564
901 2745009945 2744054620 Bacteria 6551379
902 2753463347 2751185821 Bacteria 6189929
903 2757571031 2757320392 Bacteria 3737298
904 2765467721 2765235802 Bacteria 5618596
905 2770197825 2767802442 Bacteria 5747986
906 2774130883 2773857672 Bacteria 4993178
907 2776269099 2775506902 Bacteria 6208009
908 2776283762 2775506904 Bacteria 5954060
909 2792581543 2791355082 Bacteria 5973319
910 2792620474 2791355091 Bacteria 6135441
911 2792625832 2791355092 Bacteria 6248105
912 2792638774 2791355094 Bacteria 7011481
913 2793365768 2791355267 Bacteria 7222458
914 2794597186 2791355520 Bacteria 5948615
915 2802716710 2802428858 Bacteria 6636079
916 2802725521 2802428859 Bacteria 6667919
917 2802730387 2802428860 Bacteria 6525526
918 2802737641 2802428861 Bacteria 6534206
919 2802742969 2802428862 Bacteria 6633353
920 2802750393 2802428863 Bacteria 6410669
921 2804753014 2802429268 Bacteria 6094027
922 2808933235 2808606377 Bacteria 6646337
923 2808955391 2808606381 Bacteria 6646461
924 2808978603 2808606385 Bacteria 6711065
925 2808993870 2808606388 Bacteria 6706662
926 2809214687 2808606445 Bacteria 6057339
927 2817491738 2816332298 Bacteria 6852809
928 2819244229 2818991272 Bacteria 4622173
929 2825651962 2825651385 Bacteria 6715909
930 2826586838 2826581358 Bacteria 5963467
931 2834030314 2834028612 Bacteria 6354979
932 2837652464 2837651117 Bacteria 3772164
933 2838079667 2838074704 Bacteria 6785777
934 2838679979 2838675328 Bacteria 4909118
935 2838717776 2838714209 Bacteria 5525906
936 2838724550 2838719591 Bacteria 5523910
937 2838729508 2838724970 Bacteria 4908691
938 2839993719 2839993093 Bacteria 5512535
939 2840766749 2840764183 Bacteria 6358399
940 2841849944 2841846520 Bacteria 5345850
941 2842128416 2842124991 Bacteria 5346824
942 2842134661 2842130223 Bacteria 4909145
943 2842156507 2842152218 Bacteria 4908957
944 2842165274 2842163707 Bacteria 6916235
945 2842174021 2842170452 Bacteria 5525737
946 2842180128 2842175837 Bacteria 4908771
947 2842192127 2842187318 Bacteria 5524014
948 2842216593 2842211629 Bacteria 5523832
949 2842229163 2842224351 Bacteria 5524473
950 2842522194 2842521101 Bacteria 6569494
951 2842819309 2842815866 Bacteria 5947510
952 2842828371 2842826826 Bacteria 5974129
953 2842842753 2842837860 Bacteria 6066181
954 2842852295 2842849001 Bacteria 5924277
955 2842858163 2842854478 Bacteria 6143501
956 2842875241 2842871566 Bacteria 4827117
957 2842924458 2842922631 Bacteria 5824079
958 2844166370 2844163670 Bacteria 7266046
959 2847419771 2847417321 Bacteria 6913799
960 2848994788 2848992105 Bacteria 6810864
961 2850081786 2850079185 Bacteria 6848280
962 2852617365 2852612431 Bacteria 6885235
963 2852672516 2852667396 Bacteria 6885555
964 2855023505 2855020534 Bacteria 3204685
965 2855826614 2855825444 Bacteria 6785811
966 2855842005 2855839649 Bacteria 7135830
967 2855877287 2855872281 Bacteria 6964271
968 2858802679 2858800743 Bacteria 6603254
969 2860870199 2860867994 Bacteria 5645326
970 2871451905 2871444079 Bacteria 6423508
971 2874105844 2874102143 Bacteria 6342645
972 2876398314 2876392853 Bacteria 6660880
973 2881167401 2881161766 Bacteria 7127907
974 2885309303 2885305155 Bacteria 7348390
975 2885330060 2885326080 Bacteria 7134805
976 2889790840 2889790730 Bacteria 5689708
977 2889915222 2889914905 Bacteria 5702301
978 2896391221 2896384573 Bacteria 7700774
979 2898798577 2898795034 Bacteria 4294459
980 2899261641 2899259804 Bacteria 3320927
981 2899276501 2899275550 Bacteria 3958688
982 2899793172 2899792073 Bacteria 4926588
983 2904579571 2904578770 Bacteria 5302906
984 2904664869 2904659560 Bacteria 6685615
985 2906330113 2906328253 Bacteria 6585166
986 2908450236 2908446538 Bacteria 6829095
987 2909400050 2909399089 Bacteria 3922598
988 2913039692 2913036834 Bacteria 6704877
989 2913308924 2913308742 Bacteria 5350706
990 2915981149 2915980308 Bacteria 6624279
991 2915993243 2915986958 Bacteria 6739310
992 2915999028 2915993759 Bacteria 7016183
993 2916005056 2916000859 Bacteria 6865702
994 2916012722 2916007675 Bacteria 6898660
995 2916018950 2916014648 Bacteria 6946486
996 2916023027 2916021584 Bacteria 6854472
997 2916034189 2916028427 Bacteria 6748433
998 2916039353 2916035215 Bacteria 6755766
999 2916044383 2916041962 Bacteria 6820487
1000 2916050431 2916048683 Bacteria 6543552
1001 2916061494 2916055098 Bacteria 6758838
1002 2916068638 2916061851 Bacteria 6737736
1003 2916080481 2916076590 Bacteria 6596108
1004 2917835819 2917832318 Bacteria 5346010
1005 2919118056 2919114240 Bacteria 5700270
1006 2919120763 2919119836 Bacteria 5208557
1007 2919125780 2919125081 Bacteria 5385106
1008 2919484780 2919481497 Bacteria 6907839
1009 2919680091 2919679072 Bacteria 4629602
1010 2919698253 2919697872 Bacteria 6553725
1011 2920761177 2920760137 Bacteria 7427611
1012 2920825632 2920822456 Bacteria 6897201
1013 2921205774 2921201388 Bacteria 6926299
1014 2921212567 2921208531 Bacteria 6745326
1015 2921240006 2921237296 Bacteria 6876710
1016 2921247801 2921244191 Bacteria 6568419
1017 2921251658 2921250672 Bacteria 6677771
1018 2921262645 2921257292 Bacteria 6808382
1019 2921269622 2921263974 Bacteria 6864552
1020 2921287141 2921282425 Bacteria 6826397
1021 2921294111 2921289301 Bacteria 7316391
1022 2921299553 2921296804 Bacteria 7176999
1023 2922164822 2922158528 Bacteria 6573167
1024 2923588855 2923586266 Bacteria 6565975
1025 2924148575 2924144063 Bacteria 6883928
1026 2924156539 2924150972 Bacteria 7169444
1027 2924159894 2924158325 Bacteria 7188855
1028 2924172242 2924165586 Bacteria 7260590
1029 2924179667 2924172951 Bacteria 6749356
1030 2924183491 2924179722 Bacteria 6843264
1031 2924193098 2924186466 Bacteria 6876637
1032 2924196448 2924193448 Bacteria 6955718
1033 2924203898 2924200457 Bacteria 6757188
1034 2924210809 2924207177 Bacteria 6917007
1035 2924216577 2924214083 Bacteria 7080103
1036 2924225643 2924221636 Bacteria 7113495
1037 2924233263 2924228884 Bacteria 6633132
1038 2924728687 2924726620 Bacteria 6271473
1039 2926757821 2926754445 Bacteria 5964435
1040 2928522366 2928521798 Bacteria 4960112
1041 2929146605 2929144301 Bacteria 6622272
1042 2929147568 2929144301 Bacteria 6622272
1043 2929192108 2929189879 Bacteria 5930554
1044 2931369428 2931369376 Bacteria 6847892
1045 2931394449 2931390751 Bacteria 6273349
1046 2933010439 2933006813 Bacteria 4912075
1047 2935902806 2935901341 Bacteria 7341747
1048 2937002765 2936996657 Bacteria 6298727
1049 2937005330 2937002841 Bacteria 6934057
1050 2937012865 2937009748 Bacteria 6746052
1051 2937021869 2937016420 Bacteria 6782579
1052 2937027340 2937023124 Bacteria 6815156
1053 2937035640 2937029754 Bacteria 6424026
1054 2937039673 2937036028 Bacteria 6846469
1055 2937044950 2937042894 Bacteria 6741576
1056 2937055564 2937049772 Bacteria 6757901
1057 2937063797 2937056579 Bacteria 7107896
1058 2937068689 2937063883 Bacteria 7199456
1059 2937075934 2937071275 Bacteria 6984483
1060 2937080702 2937078374 Bacteria 6610289
1061 2937090127 2937084907 Bacteria 6618516
1062 2937097430 2937091812 Bacteria 6979387
1063 2937101145 2937098957 Bacteria 7249374
1064 2937110218 2937106411 Bacteria 6947143
1065 2937117677 2937113482 Bacteria 6505872
1066 2937124509 2937119839 Bacteria 6597547
1067 2937132953 2937126314 Bacteria 6771275
1068 2937897903 2937891427 Bacteria 6357007
1069 2941504602 2941499720 Bacteria 7599444
1070 2945933925 2945928738 Bacteria 6053221
1071 2945964262 2945961074 Bacteria 7342064
1072 2946009323 2946006987 Bacteria 6705746
1073 2946030433 2946027586 Bacteria 6049274
1074 2947237332 2947233263 Bacteria 6439278
1075 2954014212 2954011201 Bacteria 4762601
1076 2957380685 2957375807 Bacteria 6425588
1077 2957387262 2957382221 Bacteria 6737050
1078 2957389502 2957388812 Bacteria 6778072
1079 2957397257 2957395598 Bacteria 6822399
1080 2957408321 2957402308 Bacteria 6741770
1081 2957412923 2957408893 Bacteria 6558585
1082 2957418942 2957415311 Bacteria 6991633
1083 2957423775 2957422303 Bacteria 7172205
1084 2957435817 2957430029 Bacteria 7022557
1085 2957438414 2957437181 Bacteria 6568994
1086 2957450572 2957443900 Bacteria 6869977
1087 2957451638 2957450854 Bacteria 6765715
1088 2957460450 2957457609 Bacteria 6967680
1089 2957468820 2957464669 Bacteria 6568877
1090 2957476628 2957471148 Bacteria 6797643
1091 2957483561 2957478035 Bacteria 6756658
1092 2957489178 2957484790 Bacteria 6703082
1093 2957495132 2957491536 Bacteria 6695180
1094 2957501693 2957498199 Bacteria 7126688
1095 2957512302 2957505466 Bacteria 7253085
1096 2958118354 2958115193 Bacteria 6923548
1097 2960584864 2960584000 Bacteria 6864594
1098 2960591815 2960591022 Bacteria 6622873
1099 2960602105 2960597568 Bacteria 6550735
1100 2960604861 2960603979 Bacteria 6898737
1101 2960613099 2960610863 Bacteria 6691244
1102 2960617997 2960617483 Bacteria 6727748
1103 2960625666 2960624210 Bacteria 6875384
1104 2960634016 2960631154 Bacteria 6732508
1105 2960639916 2960637947 Bacteria 7296468
1106 2960651114 2960645483 Bacteria 7211087
1107 2960655037 2960652885 Bacteria 7083688
1108 2960667127 2960660292 Bacteria 7041660
1109 2960670726 2960667422 Bacteria 6763020
1110 2960675057 2960674078 Bacteria 6609048
1111 2960680801 2960680706 Bacteria 6624464
1112 2960688203 2960687367 Bacteria 6535474
1113 2960699605 2960693952 Bacteria 6749742
1114 2961119868 2961114664 Bacteria 6680456
1115 2964608982 2964607997 Bacteria 7101408
1116 2964621872 2964615318 Bacteria 6809089
1117 2964628033 2964621998 Bacteria 6834995
1118 2964634205 2964628898 Bacteria 7083044
1119 2964639142 2964636051 Bacteria 7091832
1120 2964646250 2964643177 Bacteria 6820887
1121 2964651247 2964649959 Bacteria 6675118
1122 2964663308 2964656573 Bacteria 7100150
1123 2964667664 2964663802 Bacteria 7019362
1124 2964671005 2964670856 Bacteria 6851364
1125 2964682664 2964678106 Bacteria 6792020
1126 2964689219 2964685014 Bacteria 6839111
1127 2964694805 2964691889 Bacteria 6802758
1128 2964704501 2964698721 Bacteria 6765331
1129 2964706498 2964705432 Bacteria 7114648
1130 2964718790 2964712639 Bacteria 6695970
1131 2964725806 2964719344 Bacteria 7286602
1132 2965064564 2965062239 Bacteria 7412989
1133 2967665231 2967664464 Bacteria 6948836
1134 2967672051 2967671571 Bacteria 7021409
1135 2967685824 2967678726 Bacteria 7264382
1136 2967690037 2967686174 Bacteria 6678622
1137 2967698637 2967693043 Bacteria 6804451
1138 2967701434 2967699805 Bacteria 6854538
1139 2967711419 2967706974 Bacteria 7186053
1140 2967720387 2967714385 Bacteria 7000047
1141 2967727242 2967721400 Bacteria 7073753
1142 2967734131 2967728569 Bacteria 6641507
1143 2967739864 2967735183 Bacteria 6827012
1144 2967743336 2967742019 Bacteria 6794534
1145 2967754202 2967748971 Bacteria 6733771
1146 2967759651 2967755722 Bacteria 6814706
1147 2967768443 2967762386 Bacteria 6923502
1148 2967772703 2967769361 Bacteria 6587838
1149 2967776379 2967775926 Bacteria 6738189
1150 2968096260 2968091066 Bacteria 6052692
1151 2968098761 2968097103 Bacteria 6107094
1152 2968116225 2968110612 Bacteria 6814636
1153 2968129784 2968128360 Bacteria 6270294
1154 2970024317 2970019648 Bacteria 7072033
1155 2970027579 2970026789 Bacteria 6785236
1156 2970035982 2970033650 Bacteria 7118744
1157 2970045200 2970040964 Bacteria 6731123
1158 2970051464 2970047711 Bacteria 7088379
1159 2970056226 2970054988 Bacteria 6611507
1160 2970065501 2970061556 Bacteria 7099761
1161 2970070991 2970068827 Bacteria 7123112
1162 2970079421 2970076120 Bacteria 6697332
1163 2970084611 2970082768 Bacteria 6183754
1164 2970094333 2970088815 Bacteria 6933825
1165 2970099971 2970095765 Bacteria 6936963
1166 2970103968 2970102677 Bacteria 6812532
1167 2970111895 2970109326 Bacteria 6863976
1168 2970120559 2970116247 Bacteria 6501857
1169 2970126334 2970122695 Bacteria 6625855
1170 2970134697 2970129317 Bacteria 6806560
1171 2970141785 2970136068 Bacteria 7207982
1172 2970147136 2970143518 Bacteria 6446480
1173 2970152456 2970149975 Bacteria 6779706
1174 2970162265 2970156795 Bacteria 7168044
1175 2970168275 2970164137 Bacteria 6861252
1176 2970175930 2970170962 Bacteria 6876229
1177 2970181106 2970177841 Bacteria 6768001
1178 2970186244 2970184632 Bacteria 7054431
1179 2970196149 2970191845 Bacteria 7032787
1180 2974299982 2974298342 Bacteria 4840922
1181 2977523307 2977516862 Bacteria 6940108
1182 2977528082 2977523885 Bacteria 6960446
1183 2977536390 2977530762 Bacteria 6951399
1184 2977543337 2977537788 Bacteria 6929320
1185 2977549667 2977544691 Bacteria 6875412
1186 2977553025 2977551784 Bacteria 7125765
1187 2977564158 2977558990 Bacteria 6863948
1188 2977568821 2977565890 Bacteria 6901543
1189 2977574087 2977572785 Bacteria 6763888
1190 2977585945 2977579622 Bacteria 6772100
1191 2977861908 2977858184 Bacteria 6215359
1192 2977870745 2977864932 Bacteria 7534097
1193 2979783843 2979779861 Bacteria 6219781
1194 2984502361 2984499530 Bacteria 5020881
1195 2984508967 2984504281 Bacteria 5262371
1196 2989350187 2989349275 Bacteria 6349068
1197 2989773314 2989771324 Bacteria 5605128
1198 2989776868 2989776772 Bacteria 4843317
1199 2996316033 2996310559 Bacteria 6357320
1200 2996336526 2996336353 Bacteria 5511628
1201 2996346197 2996341866 Bacteria 6643098
1202 3000021247 3000017691 Bacteria 3772574
1203 3002142112 3002141150 Bacteria 5254435
1204 3003934654 3003930520 Bacteria 5667563
1205 3007869150 3007866637 Bacteria 5899198
1206 643826665 643692032 Bacteria 6891900
1207 648739503 648276728 Bacteria 6968865
1208 8002291010 8002285264 Bacteria 6717907
1209 8003994440 8003992118 Bacteria 7266902
1210 8004002146 8003999396 Bacteria 7063185
1211 8004449331 8004445564 Bacteria 6322258
1212 8004709256 8004703790 Bacteria 8006957
1213 8005310733 8005307578 Bacteria 7395396
1214 8005662259 8005658619 Bacteria 4500593
1215 8016728730 8016728285 Bacteria 5263933
1216 8018154682 8018150411 Bacteria 5549903
1217 8019779860 8019775933 Bacteria 6858656
1218 8049295625 8049293176 Bacteria 6128433
1219 8054285922 8054285046 Bacteria 6919322
1220 8054351531 8054347763 Bacteria 5901107
1221 8054505757 8054503363 Bacteria 6101651
1222 8054561884 8054558443 Bacteria 5204801
1223 8054565921 8054563764 Bacteria 5592885
1224 8055432183 8055431914 Bacteria 4551896
1225 8055820275 8055817908 Bacteria 6609162
1226 8056134324 8056131705 Bacteria 6107031
1227 8056146190 8056143049 Bacteria 6307666
1228 8056150112 8056148874 Bacteria 6479865
1229 8056158912 8056155041 Bacteria 6486948
1230 8056166550 8056161164 Bacteria 6106669
1231 8056378661 8056375014 Bacteria 7006639
1232 MRS2a_Contig_26439
1233 SwRhRL2b_contig_1084298
1234 JGI25159J45721_1000008
1235 JGI25160J50197_1000033
1236 JGI25161J50226_1000460
1237 Ga0055538_1000240
1238 Ga0055539_1000276
1239 Ga0055533_1000264
1240 Ga0055532_1000303
1241 Ga0055525_1000368
1242 Ga0055535_1010651
1243 Ga0055524_1002673
1244 Ga0055524_1004228
1245 Ga0055536_1005066
1246 Ga0055536_1017275
1247 Ga0055528_1013363
1248 Ga0055530_10000019
1249 Ga0055530_10032509
1250 Ga0055540_1000055
1251 Ga0055540_1020293
1252 Ga0055531_10013457
1253 Ga0055531_10023444
1254 Ga0055541_1000174
1255 Ga0058692_1004321
1256 Ga0055543_1000026
1257 Ga0065165_1000178
1258 Ga0065714_10064569
1259 Ga0065714_10065532
1260 Ga0065714_10067736
1261 Ga0065714_10103007
1262 Ga0065704_10073109
1263 Ga0065712_10067965
1264 Ga0070670_100000320
1265 Ga0070661_100000542
1266 Ga0070668_100268916
1267 Ga0070669_100002464
1268 Ga0070669_100226125
1269 Ga0070667_100110464
1270 Ga0070663_100126448
1271 Ga0070706_100463698
1272 Ga0070707_100007996
1273 Ga0070699_100617659
1274 Ga0070697_100182771
1275 Ga0068853_100002470
1276 Ga0070665_100021962
1277 Ga0070665_100310000
1278 Ga0068855_100262194
1279 Ga0070664_100000573
1280 Ga0068864_100253724
1281 Ga0068851_10000496
1282 Ga0068862_100421155
1283 Ga0068862_100510015
1284 Ga0075365_10080763
1285 Ga0075365_10192672
1286 Ga0075368_10002683
1287 Ga0075363_100149399
1288 Ga0075364_10000074
1289 Ga0075364_10042300
1290 Ga0075432_10001221
1291 Ga0075432_10008296
1292 Ga0075432_10046576
1293 Ga0075362_10001566
1294 Ga0075362_10002799
1295 Ga0075367_10173662
1296 Ga0075369_10098754
1297 Ga0075428_100099432
1298 Ga0075428_100175897
1299 Ga0075430_100042774
1300 Ga0075431_100060324
1301 Ga0075434_100285627
1302 Ga0079104_1001498
1303 Ga0079104_1002729
1304 Ga0079104_1005594
1305 Ga0099826_10075882
1306 Ga0099826_10134000
1307 Ga0099795_10000722
1308 Ga0105251_10004799
1309 Ga0105251_10006015
1310 Ga0105251_10008857
1311 Ga0105244_10000741
1312 Ga0105244_10001750
1313 Ga0105244_10002217
1314 Ga0105244_10003560
1315 Ga0105244_10009527
1316 Ga0105250_10000064
1317 Ga0105250_10000426
1318 Ga0105240_10320663
1319 Ga0111539_10281585
1320 Ga0114129_10120872
1321 Ga0114129_10129765
1322 Ga0105243_10026924
1323 Ga0105243_10084947
1324 Ga0105242_10000808
1325 Ga0105248_10467769
1326 Ga0105237_10000096
1327 Ga0105237_10002778
1328 Ga0105237_10156526
1329 Ga0105237_10201694
1330 Ga0105238_10447232
1331 Ga0105249_10703009
1332 Ga0099796_10004345
1333 Ga0105239_10000658
1334 Ga0105246_10000442
1335 Ga0157373_10000324
1336 Ga0157373_10001736
1337 Ga0157373_10014229
1338 Ga0157373_10112917
1339 Ga0157373_10140499
1340 Ga0157371_10000283
1341 Ga0157371_10077570
1342 Ga0157371_10145560
1343 Ga0157369_10003599
1344 Ga0157369_10004013
1345 Ga0157369_10006150
1346 Ga0171463_1007
1347 Ga0163162_10082307
1348 Ga0163162_10162794
1349 Ga0163162_10323501
1350 Ga0163162_10344300
1351 Ga0163162_10780498
1352 Ga0157375_10000731
1353 Ga0157375_10068656
1354 Ga0157375_10074728
1355 Ga0157375_10197517
1356 Ga0182008_10001332
1357 Ga0157379_10203073
1358 Ga0182006_1000073
1359 Ga0182006_1000490
1360 Ga0182006_1026833
1361 Ga0182007_10000031
1362 Ga0182007_10000897
1363 Ga0182005_1001430
1364 Ga0183360_10164
1365 Ga0183363_1084
1366 Ga0183361_10502
1367 Ga0163161_10006099
1368 Ga0163161_10007002
1369 Ga0163161_10008756
1370 Ga0163161_10066893
1371 Ga0163161_10087442
1372 Ga0214544_1000010
1373 Ga0214542_1000023
1374 Ga0214542_1018094
1375 Ga0214543_1000019
1376 Ga0214543_1000022
1377 Ga0213876_10002880
1378 Ga0224712_10000426
1379 Ga0228711_1000017
1380 Ga0228710_1000005
1381 Ga0209435_100321
1382 Ga0209784_100112
1383 Ga0209566_100045
1384 Ga0209674_100156
1385 Ga0209147_100056
1386 Ga0209563_100064
1387 Ga0207427_101730
1388 Ga0209258_100588
1389 Ga0209646_1001226
1390 Ga0209677_100103
1391 Ga0209129_1004102
1392 Ga0209233_1000441
1393 Ga0209673_1046403
1394 Ga0209673_1054655
1395 Ga0209130_1000017
1396 Ga0209676_1000286
1397 Ga0209676_1005118
1398 Ga0209676_1006789
1399 Ga0209676_1046704
1400 Ga0209025_1000153
1401 Ga0209025_1030262
1402 Ga0209564_1000013
1403 Ga0209564_1035365
1404 Ga0209758_1003271
1405 Ga0209758_1066154
1406 Ga0209050_1000013
1407 Ga0209050_1003890
1408 Ga0209050_1009723
1409 Ga0209050_1035176
1410 Ga0209256_1000211
1411 Ga0209256_1002050
1412 Ga0209256_1009908
1413 Ga0207426_1000006
1414 Ga0209051_1000007
1415 Ga0209051_1018783
1416 Ga0209051_1029926
1417 Ga0209051_1031608
1418 Ga0209257_1006653
1419 Ga0209257_1007221
1420 Ga0209257_1013465
1421 Ga0209257_1024918
1422 Ga0207656_10000491
1423 Ga0207696_1000128
1424 Ga0207696_1000266
1425 Ga0207655_1000125
1426 Ga0207655_1000611
1427 Ga0207655_1002732
1428 Ga0207655_1015748
1429 Ga0207655_1027423
1430 Ga0207713_1001911
1431 Ga0207713_1003983
1432 Ga0207713_1017300
1433 Ga0207645_10057976
1434 Ga0207684_10221360
1435 Ga0207695_10570714
1436 Ga0207671_10000158
1437 Ga0207671_10000932
1438 Ga0207649_10000010
1439 Ga0207646_10178141
1440 Ga0207681_10001975
1441 Ga0207650_10000077
1442 Ga0207650_10001685
1443 Ga0207679_10000451
1444 Ga0207639_10001288
1445 Ga0207678_10012396
1446 Ga0207676_10243724
1447 Ga0207674_10128724
1448 Ga0207675_100108175
1449 Ga0209281_1000009
1450 Ga0209281_1000082
1451 Ga0209281_1001048
1452 Ga0209371_1001449
1453 Ga0209282_1000006
1454 Ga0209282_1111588
1455 Ga0207428_10050319
1456 Ga0268266_10002047
1457 Ga0268265_10341320
1458 Ga0307515_10000017
1459 Ga0307515_10005257
1460 Ga0307515_10011281
1461 Ga0307515_10221353
1462 Ga0265338_10322077
1463 Ga0268256_1032064
1464 Ga0307511_10078808
1465 Ga0316181_1012985
1466 Ga0265339_10016336
1467 Ga0265339_10091481
1468 Ga0265331_10002957
1469 Ga0265327_10020386
1470 Ga0265316_10086395
1471 Ga0307513_10085610
1472 Ga0307513_10187530
1473 Ga0307513_10254991
1474 Ga0307513_10296206
1475 Ga0307408_100013718
1476 Ga0307408_100021328
1477 Ga0307408_100031953
1478 Ga0307408_100042897
1479 Ga0307408_100088572
1480 Ga0307408_100127763
1481 Ga0265313_10000427
1482 Ga0307508_10000120
1483 Ga0307508_10088555
1484 Ga0307508_10207925
1485 Ga0307514_10030872
1486 Ga0265314_10021289
1487 Ga0265314_10059438
1488 Ga0265314_10148720
1489 Ga0265342_10150825
1490 Ga0307516_10089119
1491 Ga0307516_10308522
1492 Ga0307405_10000074
1493 Ga0307405_10000880
1494 Ga0307405_10000937
1495 Ga0307413_10089645
1496 Ga0307406_10002998
1497 Ga0307406_10014480
1498 Ga0307406_10457577
1499 Ga0307407_10283552
1500 Ga0307412_10002361
1501 Ga0307412_10003241
1502 Ga0307412_10003971
1503 Ga0307412_10010245
1504 Ga0307412_10166307
1505 Ga0307412_10389637
1506 Ga0315914_1000003
1507 Ga0307409_100067840
1508 Ga0307409_100375502
1509 Ga0307414_10060523
1510 Ga0307414_10538574
1511 Ga0307411_10040590
1512 Ga0307507_10100847
1513 Ga0307510_10014749
1514 Ga0315913_1000001
1515 Ga0315915_1000008
1516 Ga0373943_0054017
1517 Ga0373935_0035845
1518 Ga0373935_0196192
1519 Ga0373927_0000178
1520 Ga0373927_0052629
1521 Ga0316584_0019902
1522 Ga0373925_0027566
1523 Ga0373925_0033116
1524 Ga0395905_0055924
1525 Ga0395905_0200689
1526 Ga0436364_0945858
1527 Ga0436364_1107967
1528 Ga0436365_0037768
1529 Ga0436365_0146384
1530 Ga0436365_1105090
1531 Ga0436365_1233355
1532 Ga0436365_1638075
1533 Ga0436365_1869873
1534 Ga0436363_0684692
1535 Ga0436362_0435552
1536 Ga0439436_0032531
1537 Ga0439438_000386
1538 Ga0439438_000697
1539 Ga0439438_001340
1540 Ga0439438_012374
1541 Ga0439447_008430
1542 Ga0439447_026102
1543 Ga0439466_0009542
1544 Ga0439466_0016293
1545 Ga0439466_0031091
1546 Ga0439465_0027929
1547 Ga0439465_0046991
1548 Ga0439465_0058743
1549 Ga0439431_0003155
1550 Ga0439432_000485
1551 Ga0439432_001879
1552 Ga0439432_004874
1553 Ga0439432_019300
1554 Ga0439449_0017316
1555 Ga0439451_001004
1556 Ga0439451_001789
1557 Ga0439451_004353
1558 Ga0439451_021232
1559 Ga0439451_034048
1560 Ga0439452_000115
1561 Ga0439452_004469
1562 Ga0439452_006930
1563 Ga0439452_012663
1564 Ga0439452_018860
1565 Ga0439456_001848
1566 Ga0439462_0009599
1567 Ga0450911_002639
1568 Ga0450919_014590
1569 Ga0450920_034343
1570 Ga0450890_000773
1571 Ga0450902_001124
1572 Ga0450903_008341
1573 Ga0450903_029206
1574 Ga0450904_000497
1575 Ga0450906_002759
1576 Ga0450907_003145
1577 Ga0439446_0082398
1578 Ga0450908_011147
1579 Ga0450909_001067
1580 Ga0439434_0064628
1581 Ga0439464_0087209
1582 Ga0450918_004860
1583 Ga0439440_0063093
1584 Ga0466969_0134136
1585 Ga0451576_0013360
1586 Ga0451576_0148426
1587 Ga0495617_000074
1588 Ga0495617_010123
1589 Ga0495627_000589
1590 Ga0495627_008405
1591 Ga0495603_0150916
1592 Ga0495590_0002081
1593 Ga0495591_000566
1594 Ga0495591_001343
1595 Ga0495591_006973
1596 Ga0495591_009170
1597 Ga0495591_014319
1598 Ga0495638_0013208
1599 Ga0495638_0028211
1600 Ga0495638_0039708
1601 Ga0495638_0156690
1602 Ga0495650_0000522
1603 Ga0495650_0001172
1604 Ga0495650_0001646
1605 Ga0495650_0007710
1606 Ga0495605_0000002
1607 Ga0495605_0000274
1608 Ga0495605_0001555
1609 Ga0495605_0009296
1610 Ga0495605_0015866
1611 Ga0495605_0037597
1612 Ga0495639_0000002
1613 Ga0495662_0062591
1614 Ga0495584_0000084
1615 Ga0495584_0000094
1616 Ga0495584_0012466
1617 Ga0495585_0002777
1618 Ga0495585_0085280
1619 Ga0495585_0179364
1620 Ga0495585_0184253
1621 Ga0495585_0197839
1622 Ga0495594_0001723
1623 Ga0495594_0006359
1624 Ga0495607_0000092
1625 Ga0495607_0000094
1626 Ga0495607_0001096
1627 Ga0495607_0003046
1628 Ga0495607_0005609
1629 Ga0495607_0025163
1630 Ga0495607_0058068
1631 Ga0495607_0127710
1632 Ga0495583_0000012
1633 Ga0495583_0002173
1634 Ga0495583_0003086
1635 Ga0495583_0011012
1636 Ga0495583_0033369
1637 Ga0495583_0036450
1638 Ga0495583_0049265
1639 Ga0495606_0000199
1640 Ga0495606_0034210
1641 Ga0495606_0051216
1642 Ga0495606_0123685
1643 Ga0495610_0011302
1644 Ga0495610_0019119
1645 Ga0495610_0030834
1646 Ga0495610_0037718
1647 Ga0495610_0051303
1648 Ga0495616_0002349
1649 Ga0495616_0017389
1650 Ga0495616_0027295
1651 Ga0495616_0056317
1652 Ga0495616_0088595
1653 Ga0495620_0000010
1654 Ga0495620_0000374
1655 Ga0495620_0068612
1656 Ga0495620_0075044
1657 Ga0495620_0159967
1658 Ga0495630_0068258
1659 Ga0495631_0018210
1660 Ga0495631_0028943
1661 Ga0495631_0031168
1662 Ga0495631_0121702
1663 Ga0495632_0000022
1664 Ga0495632_0000200
1665 Ga0495632_0000487
1666 Ga0495632_0000922
1667 Ga0495632_0002318
1668 Ga0495632_0014680
1669 Ga0495632_0024520
1670 Ga0495632_0128653
1671 Ga0495637_0000074
1672 Ga0495637_0000412
1673 Ga0495637_0005041
1674 Ga0495637_0008438
1675 Ga0495643_0008180
1676 Ga0495643_0017290
1677 Ga0495644_0021862
1678 Ga0495648_0006838
1679 Ga0495648_0017466
1680 Ga0495648_0031752
1681 Ga0495648_0070354
1682 Ga0495648_0075064
1683 Ga0495648_0116453
1684 Ga0495663_0101288
1685 Ga0495666_0012334
1686 Ga0495642_0001429
1687 Ga0495642_0001436
1688 Ga0495654_0000362
1689 Ga0495654_0000382
1690 Ga0495654_0000391
1691 Ga0495654_0003297
1692 Ga0495654_0012316
1693 Ga0495654_0025400
1694 Ga0495654_0031182
1695 Ga0495654_0035341
1696 Ga0495654_0040056
1697 Ga0495640_0065789
1698 Ga0495609_0000008
1699 Ga0495609_0000125
1700 Ga0495609_0000211
1701 Ga0495609_0005717
1702 Ga0495609_0044059
1703 Ga0495597_0000366
1704 Ga0495597_0004619
1705 Ga0495597_0014614
1706 Ga0495597_0091611
1707 Ga0495622_0003749
1708 Ga0495622_0005612
1709 Ga0495633_0000009
1710 Ga0495633_0023268
1711 Ga0495633_0039451
1712 Ga0495668_0036290
1713 Ga0495611_0000998
1714 Ga0495625_0014639
1715 Ga0495625_0050688
1716 Ga0495625_0052515
1717 Ga0495625_0118206
1718 Ga0495625_0186449
1719 Ga0495625_0239954
1720 Ga0495659_0000035
1721 Ga0495659_0012408
1722 Ga0495659_0025564
1723 Ga0495659_0039741
1724 Ga0495661_0000029
1725 Ga0495661_0000083
1726 Ga0495661_0000468
1727 Ga0495661_0002752
1728 Ga0495661_0037531
1729 Ga0495661_0054847
1730 Ga0495669_0005644
1731 Ga0495624_0192838
1732 Ga0495670_0000280
1733 Ga0495670_0002007
1734 Ga0495670_0023754
1735 Ga0495670_0053335
1736 Ga0495670_0129883
1737 Ga0495670_0179193
1738 Ga0495671_0000136
1739 Ga0495671_0000389
1740 Ga0495671_0025715
1741 Ga0495671_0086317
1742 Ga0495649_0000289
1743 Ga0495649_0001225
1744 Ga0495649_0001839
1745 Ga0495649_0034556
1746 Ga0495589_0000075
1747 Ga0495589_0000942
1748 Ga0495589_0011459
1749 Ga0495589_0018843
1750 Ga0495600_0093689
1751 Ga0495660_0000520
1752 Ga0495660_0002132
1753 Ga0495660_0039190
1754 Ga0495660_0041488
1755 Ga0495660_0128690
1756 Ga0495660_0159691
1757 Ga0495581_0001262
1758 Ga0495604_0001148
1759 Ga0495636_0001517
1760 Ga0495672_0000433
1761 Ga0495672_0000814
1762 Ga0495672_0011424
1763 Ga0495672_0051140
1764 Ga0495672_0055348
1765 Ga0495672_0101482
1766 Ga0495680_0021969
1767 Ga0495680_0036589
1768 Ga0495683_0000039
1769 Ga0495683_0005744
1770 Ga0495683_0023291
1771 Ga0495683_0062877
1772 Ga0495683_0112513
1773 Ga0495683_0112749
1774 Ga0495687_000260
1775 Ga0495687_001168
1776 Ga0495687_002151
1777 Ga0495687_026573
1778 Ga0495677_0000490
1779 Ga0495679_001047
1780 Ga0495679_008706
1781 Ga0495679_009235
1782 Ga0495679_015404
1783 Ga0495685_020232
1784 Ga0495685_022820
1785 Ga0495673_0001395
1786 Ga0495673_0001462
1787 Ga0495673_0003525
1788 Ga0495673_0017671
1789 Ga0495673_0018312
1790 Ga0495681_0004673
1791 Ga0495681_0004690
1792 Ga0495681_0011322
1793 Ga0495681_0012410
1794 Ga0495681_0019758
1795 Ga0495686_0006218
1796 Ga0495686_0029683
1797 Ga0495686_0039808
1798 Ga0495686_0044657
1799 Ga0495686_0120405
1800 Ga0495686_0186660
1801 Ga0495593_0032130
1802 Ga0495626_0000544
1803 Ga0495626_0002984
1804 Ga0495626_0009129
1805 Ga0495626_0080541
1806 Ga0495626_0173340
1807 Ga0496106_0618893
1808 Ga0496116_0000454
1809 Ga0496117_0000246
1810 Ga0496117_0008288
1811 Ga0496117_0055874
1812 Ga0496117_0133386
1813 Ga0496118_0022520
1814 Ga0496118_0055796
1815 Ga0496118_0057447
1816 Ga0496118_0138741
1817 Ga0496120_0007188
1818 Ga0496120_0020423
1819 Ga0496121_0000180
1820 Ga0496121_0002269
1821 Ga0496121_0031970
1822 Ga0496121_0064794
1823 Ga0496121_0149139
1824 Ga0496122_0016424
1825 Ga0496122_0042838
1826 Ga0496122_0045072
1827 Ga0496122_0106783
1828 Ga0496122_0255503
1829 Ga0496123_0030860
1830 Ga0496123_0101778
1831 Ga0496123_0122028
1832 Ga0496123_0129984
1833 Ga0496124_0000035
1834 Ga0496124_0000239
1835 Ga0496124_0000426
1836 Ga0496124_0004925
1837 Ga0496124_0075394
1838 Ga0496124_0077830
1839 Ga0496124_0146188
1840 Ga0496125_0000266
1841 Ga0496125_0001791
1842 Ga0496125_0026408
1843 Ga0496125_0032347
1844 Ga0496125_0067574
1845 Ga0496126_0009133
1846 Ga0496126_0029029
1847 Ga0496126_0048532
1848 Ga0496126_0213918
1849 Ga0495678_000008
1850 Ga0495678_000011
1851 Ga0495678_000255
1852 Ga0495678_001291
1853 Ga0495678_009198
1854 Ga0495682_0030923
1855 Ga0501031_0000002
1856 Ga0501031_0095966
1857 Ga0501031_0333377
1858 Ga0501032_0000004
1859 Ga0501032_0007011
1860 Ga0501032_0024083
1861 Ga0501032_0084271
1862 Ga0501032_0113675
1863 Ga0501032_0121464
1864 Ga0501033_0000016
1865 Ga0501033_0000776
1866 Ga0501033_0004986
1867 Ga0501033_0019437
1868 Ga0501033_0056499
1869 Ga0501033_0435889
1870 Ga0501034_0000011
1871 Ga0501034_0004793
1872 Ga0501034_0078297
1873 Ga0501034_0120939
1874 Ga0501036_0000001
1875 Ga0501036_0003294
1876 Ga0501036_0017362
1877 Ga0501036_0102500
1878 Ga0501037_0000006
1879 Ga0501037_0005086
1880 Ga0501038_0000003
1881 Ga0501038_0006213
1882 Ga0501038_0034451
1883 Ga0501038_0050397
1884 Ga0501038_0208395
1885 Ga0501039_0000004
1886 Ga0501039_0001298
1887 Ga0501039_0002554
1888 Ga0501040_0012498
1889 Ga0501040_0031479
1890 Ga0501041_0017232
1891 Ga0501042_0035928
1892 Ga0501043_0000155
1893 Ga0501043_0011433
1894 Ga0501043_0013677
1895 Ga0501043_0058597
1896 Ga0501043_0173316
1897 Ga0501043_0250168
1898 Ga0501046_0001714
1899 Ga0501046_0105275
1900 Ga0501047_0008235
1901 Ga0501047_0021199
1902 Ga0501047_0028069
1903 Ga0501047_0051856
1904 Ga0501047_0167134
1905 Ga0501047_0188275
1906 Ga0501048_0023429
1907 Ga0501048_0098677
1908 Ga0501067_0011153
1909 Ga0501067_0032647
1910 Ga0501067_0103336
1911 Ga0501068_0391808
1912 Ga0501069_0002311
1913 Ga0501069_0002521
1914 Ga0501069_0044511
1915 Ga0501070_0004969
1916 Ga0501070_0022569
1917 Ga0501070_0024946
1918 Ga0501070_0285997
1919 Ga0501072_0224161
1920 Ga0501073_0002004
1921 Ga0501073_0081427
1922 Ga0501074_0005021
1923 Ga0501074_0015837
1924 Ga0501076_0033050
1925 Ga0501077_0184996
1926 Ga0501080_0002095
1927 Ga0501080_0005500
1928 Ga0501080_0054430
1929 Ga0501080_0059597
1930 Ga0501080_0303918
1931 Ga0501081_0051987
1932 Ga0501081_0165934
1933 Ga0501083_0006586
1934 Ga0501083_0015812
1935 Ga0501035_0000009
1936 Ga0501035_0000882
1937 Ga0501035_0003895
1938 Ga0501035_0010603
1939 Ga0501035_0011132
1940 Ga0501035_0086021
1941 Ga0501035_0138933
1942 Ga0501035_0556100
1943 Ga0501044_0000005
1944 Ga0501044_0002857
1945 Ga0501044_0004158
1946 Ga0501044_0008383
1947 Ga0501044_0058607
1948 Ga0501044_0108391
1949 Ga0501044_0145502
1950 Ga0501045_0035725
1951 Ga0501045_0192189
1952 nmdc:mga03683_1610_c1
1953 nmdc:mga00v17_156797_c1
1954 nmdc:mga00v17_34678_c1
1955 nmdc:mga00v17_78_c1
1956 nmdc:mga06z11_130956_c1
1957 nmdc:mga05p37_91105_c1
1958 nmdc:mga0qj67_35425_c1
1959 nmdc:mga06r32_63496_c1
1960 Ga0500610_0111003
1961 Ga0500635_0076582
1962 Ga0500578_0027239
1963 Ga0500578_0080411
1964 Ga0500578_0144913
1965 Ga0500643_000018
1966 Ga0500651_0047064
1967 Ga0500557_026644
1968 Ga0500569_013068
1969 Ga0500594_0013298
1970 Ga0500595_025960
1971 Ga0500618_001769
1972 Ga0500628_048075
1973 Ga0500658_0089692
1974 Ga0500568_0000559
1975 Ga0500573_0000318
1976 Ga0500573_0186650
1977 Ga0500577_0015467
1978 Ga0500577_0140349
1979 Ga0500588_0000513
1980 Ga0500590_008948
1981 Ga0500590_100009
1982 Ga0500603_023857
1983 Ga0500616_0121440
1984 Ga0500634_0030134
1985 Ga0500638_083866
1986 Ga0500636_0003139
1987 Ga0500637_0096670
1988 Ga0500657_052883
1989 Ga0501084_0007525
1990 Ga0587077_000735
1991 Ga0587090_000082
1992 Ga0587101_000045
1993 Ga0587128_000033
1994 Ga0587062_003060
1995 Ga0501082_0010931
1996 Ga0501082_0028554
1997 Ga0501082_0080476
1998 Ga0501082_0094165
1999 Ga0501082_0133163
2000 Ga0501082_0136596
2001 2511255533
2002 2509108037
2003 2509140883
2004 2509376783
2005 2510282181
2006 2510291614
2007 2510308310
2008 2510310329
2009 2511270464
2010 2511328534
2011 2511362772
2012 2511391656
2013 2511502514
2014 2511824950
2015 2512533888
2016 2512970353
2017 2513581640
2018 2513587454
2019 2513601417
2020 2513619568
2021 2513881799
2022 2513904943
2023 2513983615
2024 2513997563
2025 2514003136
2026 2515609302
2027 2515744628
2028 2516206065
2029 2516893889
2030 2517570609
2031 2524448288
2032 2551679604
2033 2551689435
2034 2551696966
2035 2551701303
2036 2551709517
2037 2551723850
2038 2551724796
2039 2551735549
2040 2551743360
2041 2558865859
2042 2585167565
2043 2585265791
2044 2585389038
2045 2585395185
2046 2585405028
2047 2585530386
2048 2597864445
2049 2597869431
2050 2599331208
2051 2599332103
2052 2599399331
2053 2599453568
2054 2599500654
2055 2599510450
2056 2599513822
2057 2599519001
2058 2599606177
2059 2599612851
2060 2599769057
2061 2599880997
2062 2599888302
2063 2599892879
2064 2599895970
2065 2599932317
2066 2599951210
2067 2599957855
2068 2599966795
2069 2599970876
2070 2599978074
2071 2599993363
2072 2600004052
2073 2600012199
2074 2600015578
2075 2600021948
2076 2600028538
2077 2600037545
2078 2600042858
2079 2600050786
2080 2600060068
2081 2600063289
2082 2600072686
2083 2600075222
2084 2600196066
2085 2600357705
2086 2601690328
2087 2621299175
2088 2624492081
2089 2643804393
2090 2643871753
2091 2643917569
2092 2644050092
2093 2644065164
2094 2644105456
2095 2644133858
2096 2644146459
2097 2644204848
2098 2644208686
2099 2644283950
2100 2644298176
2101 2644308207
2102 2644334031
2103 2644377573
2104 2644416836
2105 2644449876
2106 2644483013
2107 2644494204
2108 2644497680
2109 2644541628
2110 2644615489
2111 2644620552
2112 2644652216
2113 2644656428
2114 2644672771
2115 2644690011
2116 2657684856
2117 2671088662
2118 2671126296
2119 2677899174
2120 2678263614
2121 2692315172
2122 2715498988
2123 2723249149
2124 2738672332
2125 2738687787
2126 2738750725
2127 2738812155
2128 2738859766
2129 2738899515
2130 2738944305
2131 2739263778
2132 2745009945
2133 2753463347
2134 2757571031
2135 2765467721
2136 2770197825
2137 2774130883
2138 2776269099
2139 2776283762
2140 2792581543
2141 2792620474
2142 2792625832
2143 2792638774
2144 2793365768
2145 2794597186
2146 2802716710
2147 2802725521
2148 2802730387
2149 2802737641
2150 2802742969
2151 2802750393
2152 2804753014
2153 2808933235
2154 2808955391
2155 2808978603
2156 2808993870
2157 2809214687
2158 2817491738
2159 2819244229
2160 2825651962
2161 2826586838
2162 2834030314
2163 2837652464
2164 2838079667
2165 2838679979
2166 2838717776
2167 2838724550
2168 2838729508
2169 2839993719
2170 2840766749
2171 2841849944
2172 2842128416
2173 2842134661
2174 2842156507
2175 2842165274
2176 2842174021
2177 2842180128
2178 2842192127
2179 2842216593
2180 2842229163
2181 2842522194
2182 2842819309
2183 2842828371
2184 2842842753
2185 2842852295
2186 2842858163
2187 2842875241
2188 2842924458
2189 2844166370
2190 2847419771
2191 2848994788
2192 2850081786
2193 2852617365
2194 2852672516
2195 2855023505
2196 2855826614
2197 2855842005
2198 2855877287
2199 2858802679
2200 2860870199
2201 2871451905
2202 2874105844
2203 2876398314
2204 2881167401
2205 2885309303
2206 2885330060
2207 2889790840
2208 2889915222
2209 2896391221
2210 2898798577
2211 2899261641
2212 2899276501
2213 2899793172
2214 2904579571
2215 2904664869
2216 2906330113
2217 2908450236
2218 2909400050
2219 2913039692
2220 2913308924
2221 2915981149
2222 2915993243
2223 2915999028
2224 2916005056
2225 2916012722
2226 2916018950
2227 2916023027
2228 2916034189
2229 2916039353
2230 2916044383
2231 2916050431
2232 2916061494
2233 2916068638
2234 2916080481
2235 2917835819
2236 2919118056
2237 2919120763
2238 2919125780
2239 2919484780
2240 2919680091
2241 2919698253
2242 2920761177
2243 2920825632
2244 2921205774
2245 2921212567
2246 2921240006
2247 2921247801
2248 2921251658
2249 2921262645
2250 2921269622
2251 2921287141
2252 2921294111
2253 2921299553
2254 2922164822
2255 2923588855
2256 2924148575
2257 2924156539
2258 2924159894
2259 2924172242
2260 2924179667
2261 2924183491
2262 2924193098
2263 2924196448
2264 2924203898
2265 2924210809
2266 2924216577
2267 2924225643
2268 2924233263
2269 2924728687
2270 2926757821
2271 2928522366
2272 2929146605
2273 2929147568
2274 2929192108
2275 2931369428
2276 2931394449
2277 2933010439
2278 2935902806
2279 2937002765
2280 2937005330
2281 2937012865
2282 2937021869
2283 2937027340
2284 2937035640
2285 2937039673
2286 2937044950
2287 2937055564
2288 2937063797
2289 2937068689
2290 2937075934
2291 2937080702
2292 2937090127
2293 2937097430
2294 2937101145
2295 2937110218
2296 2937117677
2297 2937124509
2298 2937132953
2299 2937897903
2300 2941504602
2301 2945933925
2302 2945964262
2303 2946009323
2304 2946030433
2305 2947237332
2306 2954014212
2307 2957380685
2308 2957387262
2309 2957389502
2310 2957397257
2311 2957408321
2312 2957412923
2313 2957418942
2314 2957423775
2315 2957435817
2316 2957438414
2317 2957450572
2318 2957451638
2319 2957460450
2320 2957468820
2321 2957476628
2322 2957483561
2323 2957489178
2324 2957495132
2325 2957501693
2326 2957512302
2327 2958118354
2328 2960584864
2329 2960591815
2330 2960602105
2331 2960604861
2332 2960613099
2333 2960617997
2334 2960625666
2335 2960634016
2336 2960639916
2337 2960651114
2338 2960655037
2339 2960667127
2340 2960670726
2341 2960675057
2342 2960680801
2343 2960688203
2344 2960699605
2345 2961119868
2346 2964608982
2347 2964621872
2348 2964628033
2349 2964634205
2350 2964639142
2351 2964646250
2352 2964651247
2353 2964663308
2354 2964667664
2355 2964671005
2356 2964682664
2357 2964689219
2358 2964694805
2359 2964704501
2360 2964706498
2361 2964718790
2362 2964725806
2363 2965064564
2364 2967665231
2365 2967672051
2366 2967685824
2367 2967690037
2368 2967698637
2369 2967701434
2370 2967711419
2371 2967720387
2372 2967727242
2373 2967734131
2374 2967739864
2375 2967743336
2376 2967754202
2377 2967759651
2378 2967768443
2379 2967772703
2380 2967776379
2381 2968096260
2382 2968098761
2383 2968116225
2384 2968129784
2385 2970024317
2386 2970027579
2387 2970035982
2388 2970045200
2389 2970051464
2390 2970056226
2391 2970065501
2392 2970070991
2393 2970079421
2394 2970084611
2395 2970094333
2396 2970099971
2397 2970103968
2398 2970111895
2399 2970120559
2400 2970126334
2401 2970134697
2402 2970141785
2403 2970147136
2404 2970152456
2405 2970162265
2406 2970168275
2407 2970175930
2408 2970181106
2409 2970186244
2410 2970196149
2411 2974299982
2412 2977523307
2413 2977528082
2414 2977536390
2415 2977543337
2416 2977549667
2417 2977553025
2418 2977564158
2419 2977568821
2420 2977574087
2421 2977585945
2422 2977861908
2423 2977870745
2424 2979783843
2425 2984502361
2426 2984508967
2427 2989350187
2428 2989773314
2429 2989776868
2430 2996316033
2431 2996336526
2432 2996346197
2433 3000021247
2434 3002142112
2435 3003934654
2436 3007869150
2437 643826665
2438 648739503
2439 8002291010
2440 8003994440
2441 8004002146
2442 8004449331
2443 8004709256
2444 8005310733
2445 8005662259
2446 8016728730
2447 8018154682
2448 8019779860
2449 8049295625
2450 8054285922
2451 8054351531
2452 8054505757
2453 8054561884
2454 8054565921
2455 8055432183
2456 8055820275
2457 8056134324
2458 8056146190
2459 8056150112
2460 8056158912
2461 8056166550
2462 8056378661

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

56

245

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

62

303

0.91

PF08659

KR

KR domain

57

222

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pej-assembly1.cif.gz_B structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol 0.983 1 257
7e6o-assembly1.cif.gz_D crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9783 3 257
1k2w-assembly1.cif.gz_A crystal structure of sorbitol dehydrogenase from r. sphaeroides 0.9771 3 257
7e6o-assembly1.cif.gz_C crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9724 3 257
7e6o-assembly1.cif.gz_D crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9706 3 257
ID Description Score Start End Superfamily
4e6pC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9822 2 256 3.40.50.720
4e6pC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9783 2 256 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9637 2 79 3.40.50.720
3ak4D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9636 4 257 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9627 2 253 3.40.50.720
ID Description Score Start End GO Terms
AF-F2KA38-F1-model_v4 L-iditol 2-dehydrogenase, (Sorbitol dehydrogenase) 0.9881 1 257 GO:0016616
AF-A0A657LU17-F1-model_v4 Sorbitol dehydrogenase 0.9871 1 257 GO:0016616
AF-A0A3P3G131-F1-model_v4 L-iditol 2-dehydrogenase (EC 1.1.1.14) 0.987 3 257 GO:0003939
AF-A0A271KM51-F1-model_v4 Sorbitol dehydrogenase (EC 1.1.99.21) 0.9869 3 257 GO:0016616
GO:0047833
AF-A0A502YCV6-F1-model_v4 L-iditol 2-dehydrogenase (EC 1.1.1.14) 0.9868 3 257 GO:0003939

Map