F492000
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1232 | 286 | 2464 | 447 |
Family's Representative Sequence
| Representative Sequence | 3300001915|JGI24741J21665_1006087|JGI24741J21665_10060873 |
| Length | 470 |
| Sequence | MPGPLPDPSPDRPAKQDATEMKPIAKLLPPLALVGALALVPVTAASIAAPDTTNYQELEKFMSVYERVKANYVEPVDDKTLIKGAIDGMLSALDPHSSYVEGADFDQLKTTTDGNYGGLGLTVSLEDGIVKVIAPTEDTPAWRAGIKSGDYITHINGEFLNGVTLDQAVEKMKGAPGTSVKLTIVRPGKNKPFDVAITRERIELRPVKWEIKEGVGYINIDTFTGNVGEQVKSALLSIDKATGGKPLGYVVDLRSNPGGLLDQAVDVADDFLESGEIVSQRGRSKDDIERYYARPGDMAHGLPVIVLTDPGTASASEIVAGALQDHHRALIMGETSFGKGSVQTVVQTGPEAALRLTTARYYTPSGRSVQAGGIEPDIEVPQLTDPDYKDRRFIREADLRRHLLAQAQVKDKXLESDDRPDPRFTAKADDLKKQGIKDFQLYYALNTIKRLGXPXKANIAAGGGASKKSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 173 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 197 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 198 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 199 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 200 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 201 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 202 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 203 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 209 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 249 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 250 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 251 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 253 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 254 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 255 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 262 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 263 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 264 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 265 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 266 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 267 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 268 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 269 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 270 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 271 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 272 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 273 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 274 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 275 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 276 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 277 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 278 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 279 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 280 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 281 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 282 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 283 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 284 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 285 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 286 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.86 |
| Metatranscriptomes | 0 |
| Isolates | 1.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 1.14 |
| Nodule | 0 |
| Rhizoplane | 4.14 |
| Rhizosphere | 93.43 |
| Stem | 0 |
| Stem Tuber | 0.08 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1006087 | 3300001915 | Bacteria | 2458 |
| 2 | JGI24736J21556_1003968 | 3300001904 | Bacteria | 2547 |
| 3 | JGI24741J21665_1008603 | 3300001915 | Bacteria | 1917 |
| 4 | JGI24740J21852_10000927 | 3300001979 | Bacteria | 13026 |
| 5 | JGI24740J21852_10001189 | 3300001979 | Bacteria | 11731 |
| 6 | JGI24740J21852_10001263 | 3300001979 | Bacteria | 11460 |
| 7 | JGI24740J21852_10001800 | 3300001979 | Bacteria | 9829 |
| 8 | JGI24740J21852_10014355 | 3300001979 | Bacteria | 2924 |
| 9 | JGI24740J21852_10018268 | 3300001979 | Bacteria | 2492 |
| 10 | JGI24739J22299_10001567 | 3300001989 | Bacteria | 8649 |
| 11 | JGI24739J22299_10003804 | 3300001989 | Bacteria | 5762 |
| 12 | JGI24739J22299_10012475 | 3300001989 | Bacteria | 3120 |
| 13 | JGI24737J22298_10000009 | 3300001990 | Bacteria | 58784 |
| 14 | JGI24737J22298_10002710 | 3300001990 | Bacteria | 6263 |
| 15 | JGI24737J22298_10003580 | 3300001990 | Bacteria | 5476 |
| 16 | JGI24737J22298_10025723 | 3300001990 | Bacteria | 1860 |
| 17 | JGI24743J22301_10000629 | 3300001991 | Bacteria | 4299 |
| 18 | JGI24743J22301_10001193 | 3300001991 | Bacteria | 3507 |
| 19 | JGI24735J21928_10003960 | 3300002067 | Bacteria | 5007 |
| 20 | JGI24735J21928_10005379 | 3300002067 | Bacteria | 4250 |
| 21 | JGI24735J21928_10019115 | 3300002067 | Bacteria | 2108 |
| 22 | JGI24748J21848_1002691 | 3300002074 | Bacteria | 2019 |
| 23 | JGI24738J21930_10000008 | 3300002075 | Bacteria | 41238 |
| 24 | JGI24738J21930_10000903 | 3300002075 | Bacteria | 8526 |
| 25 | JGI24738J21930_10004882 | 3300002075 | Bacteria | 3254 |
| 26 | JGI24749J21850_1001519 | 3300002076 | Bacteria | 3279 |
| 27 | JGI24744J21845_10000141 | 3300002077 | Bacteria | 10274 |
| 28 | JGI24751J29686_10000224 | 3300002459 | Bacteria | 23761 |
| 29 | JGI25165J46597_1000071 | 3300003214 | Bacteria | 193222 |
| 30 | Ga0065715_10022832 | 3300005293 | Bacteria | 1599 |
| 31 | Ga0065715_10025490 | 3300005293 | Bacteria | 1615 |
| 32 | Ga0065715_10110992 | 3300005293 | Bacteria | 2592 |
| 33 | Ga0065707_10100179 | 3300005295 | Bacteria | 2949 |
| 34 | Ga0070658_10000216 | 3300005327 | Bacteria | 51121 |
| 35 | Ga0070658_10012639 | 3300005327 | Bacteria | 6772 |
| 36 | Ga0070658_10015071 | 3300005327 | Bacteria | 6187 |
| 37 | Ga0070658_10019319 | 3300005327 | Bacteria | 5457 |
| 38 | Ga0070658_10019384 | 3300005327 | Bacteria | 5448 |
| 39 | Ga0070658_10023479 | 3300005327 | Bacteria | 4949 |
| 40 | Ga0070658_10024170 | 3300005327 | Bacteria | 4876 |
| 41 | Ga0070658_10027449 | 3300005327 | Bacteria | 4568 |
| 42 | Ga0070658_10027839 | 3300005327 | Bacteria | 4535 |
| 43 | Ga0070658_10049499 | 3300005327 | Bacteria | 3404 |
| 44 | Ga0070658_10095899 | 3300005327 | Bacteria | 2449 |
| 45 | Ga0070676_10004565 | 3300005328 | Bacteria | 7298 |
| 46 | Ga0070676_10016885 | 3300005328 | Bacteria | 4036 |
| 47 | Ga0070683_100000646 | 3300005329 | Bacteria | 25125 |
| 48 | Ga0070683_100013737 | 3300005329 | Bacteria | 7069 |
| 49 | Ga0070683_100022790 | 3300005329 | Bacteria | 5600 |
| 50 | Ga0070683_100055685 | 3300005329 | Bacteria | 3670 |
| 51 | Ga0070690_100006006 | 3300005330 | Bacteria | 6861 |
| 52 | Ga0070690_100028084 | 3300005330 | Bacteria | 3482 |
| 53 | Ga0070690_100102055 | 3300005330 | Bacteria | 1903 |
| 54 | Ga0070670_100000069 | 3300005331 | Bacteria | 104077 |
| 55 | Ga0070670_100001019 | 3300005331 | Bacteria | 22131 |
| 56 | Ga0070670_100002391 | 3300005331 | Bacteria | 15462 |
| 57 | Ga0070670_100007469 | 3300005331 | Bacteria | 9281 |
| 58 | Ga0070670_100007705 | 3300005331 | Bacteria | 9154 |
| 59 | Ga0070670_100010185 | 3300005331 | Bacteria | 8022 |
| 60 | Ga0070670_100011249 | 3300005331 | Bacteria | 7649 |
| 61 | Ga0070670_100029796 | 3300005331 | Bacteria | 4701 |
| 62 | Ga0070670_100035495 | 3300005331 | Bacteria | 4292 |
| 63 | Ga0070670_100038151 | 3300005331 | Bacteria | 4131 |
| 64 | Ga0070677_10001871 | 3300005333 | Bacteria | 6654 |
| 65 | Ga0068869_100000682 | 3300005334 | Bacteria | 19175 |
| 66 | Ga0068869_100071253 | 3300005334 | Bacteria | 2573 |
| 67 | Ga0070666_10000693 | 3300005335 | Bacteria | 20437 |
| 68 | Ga0070666_10000884 | 3300005335 | Bacteria | 18202 |
| 69 | Ga0070666_10032931 | 3300005335 | Bacteria | 3426 |
| 70 | Ga0070680_100002395 | 3300005336 | Bacteria | 13881 |
| 71 | Ga0070680_100007267 | 3300005336 | Bacteria | 8440 |
| 72 | Ga0070680_100011270 | 3300005336 | Bacteria | 6913 |
| 73 | Ga0070680_100038995 | 3300005336 | Bacteria | 3843 |
| 74 | Ga0070682_100001991 | 3300005337 | Bacteria | 11391 |
| 75 | Ga0070682_100023692 | 3300005337 | Bacteria | 3647 |
| 76 | Ga0070682_100113916 | 3300005337 | Bacteria | 1807 |
| 77 | Ga0068868_100001982 | 3300005338 | Bacteria | 14064 |
| 78 | Ga0068868_100002627 | 3300005338 | Bacteria | 12464 |
| 79 | Ga0068868_100040265 | 3300005338 | Bacteria | 3636 |
| 80 | Ga0070660_100000250 | 3300005339 | Bacteria | 35322 |
| 81 | Ga0070660_100004492 | 3300005339 | Bacteria | 9639 |
| 82 | Ga0070660_100006146 | 3300005339 | Bacteria | 8306 |
| 83 | Ga0070660_100011977 | 3300005339 | Bacteria | 6187 |
| 84 | Ga0070660_100015407 | 3300005339 | Bacteria | 5520 |
| 85 | Ga0070660_100017761 | 3300005339 | Bacteria | 5188 |
| 86 | Ga0070660_100019076 | 3300005339 | Bacteria | 5020 |
| 87 | Ga0070660_100024759 | 3300005339 | Bacteria | 4456 |
| 88 | Ga0070660_100032717 | 3300005339 | Bacteria | 3916 |
| 89 | Ga0070660_100037586 | 3300005339 | Bacteria | 3670 |
| 90 | Ga0070660_100040869 | 3300005339 | Bacteria | 3532 |
| 91 | Ga0070660_100044133 | 3300005339 | Bacteria | 3408 |
| 92 | Ga0070660_100057377 | 3300005339 | Bacteria | 3016 |
| 93 | Ga0070660_100067904 | 3300005339 | Bacteria | 2778 |
| 94 | Ga0070660_100122387 | 3300005339 | Bacteria | 2077 |
| 95 | Ga0070660_100126353 | 3300005339 | Bacteria | 2043 |
| 96 | Ga0070660_100150720 | 3300005339 | Bacteria | 1869 |
| 97 | Ga0070661_100001054 | 3300005344 | Bacteria | 19518 |
| 98 | Ga0070661_100003112 | 3300005344 | Bacteria | 11415 |
| 99 | Ga0070661_100003236 | 3300005344 | Bacteria | 11223 |
| 100 | Ga0070661_100003585 | 3300005344 | Bacteria | 10686 |
| 101 | Ga0070661_100007914 | 3300005344 | Bacteria | 7341 |
| 102 | Ga0070661_100014629 | 3300005344 | Bacteria | 5532 |
| 103 | Ga0070661_100017757 | 3300005344 | Bacteria | 5050 |
| 104 | Ga0070661_100019951 | 3300005344 | Bacteria | 4777 |
| 105 | Ga0070661_100033185 | 3300005344 | Bacteria | 3738 |
| 106 | Ga0070661_100050044 | 3300005344 | Bacteria | 3058 |
| 107 | Ga0070661_100050521 | 3300005344 | Bacteria | 3042 |
| 108 | Ga0070661_100081534 | 3300005344 | Bacteria | 2389 |
| 109 | Ga0070661_100113712 | 3300005344 | Bacteria | 2023 |
| 110 | Ga0070692_10010120 | 3300005345 | Bacteria | 4280 |
| 111 | Ga0070668_100000015 | 3300005347 | Bacteria | 106650 |
| 112 | Ga0070668_100000324 | 3300005347 | Bacteria | 31403 |
| 113 | Ga0070668_100004919 | 3300005347 | Bacteria | 9900 |
| 114 | Ga0070668_100004964 | 3300005347 | Bacteria | 9852 |
| 115 | Ga0070668_100081744 | 3300005347 | Bacteria | 2533 |
| 116 | Ga0070668_100103118 | 3300005347 | Bacteria | 2263 |
| 117 | Ga0070669_100000105 | 3300005353 | Bacteria | 80655 |
| 118 | Ga0070669_100000128 | 3300005353 | Bacteria | 69625 |
| 119 | Ga0070669_100001383 | 3300005353 | Bacteria | 17504 |
| 120 | Ga0070669_100023566 | 3300005353 | Bacteria | 4407 |
| 121 | Ga0070669_100044334 | 3300005353 | Bacteria | 3240 |
| 122 | Ga0070669_100046214 | 3300005353 | Bacteria | 3175 |
| 123 | Ga0070675_100001581 | 3300005354 | Bacteria | 16808 |
| 124 | Ga0070675_100008335 | 3300005354 | Bacteria | 8042 |
| 125 | Ga0070675_100019332 | 3300005354 | Bacteria | 5427 |
| 126 | Ga0070671_100000247 | 3300005355 | Bacteria | 36402 |
| 127 | Ga0070671_100001057 | 3300005355 | Bacteria | 20291 |
| 128 | Ga0070671_100001903 | 3300005355 | Bacteria | 15966 |
| 129 | Ga0070671_100004394 | 3300005355 | Bacteria | 11145 |
| 130 | Ga0070671_100005300 | 3300005355 | Bacteria | 10284 |
| 131 | Ga0070671_100007225 | 3300005355 | Bacteria | 8880 |
| 132 | Ga0070671_100007523 | 3300005355 | Bacteria | 8710 |
| 133 | Ga0070671_100007827 | 3300005355 | Bacteria | 8540 |
| 134 | Ga0070671_100009536 | 3300005355 | Bacteria | 7796 |
| 135 | Ga0070671_100021226 | 3300005355 | Bacteria | 5304 |
| 136 | Ga0070671_100021586 | 3300005355 | Bacteria | 5259 |
| 137 | Ga0070671_100029626 | 3300005355 | Bacteria | 4514 |
| 138 | Ga0070671_100030377 | 3300005355 | Bacteria | 4459 |
| 139 | Ga0070671_100040392 | 3300005355 | Bacteria | 3874 |
| 140 | Ga0070671_100041609 | 3300005355 | Bacteria | 3819 |
| 141 | Ga0070671_100078873 | 3300005355 | Bacteria | 2752 |
| 142 | Ga0070671_100140273 | 3300005355 | Bacteria | 2039 |
| 143 | Ga0070671_100252564 | 3300005355 | Bacteria | 1498 |
| 144 | Ga0070674_100016533 | 3300005356 | Bacteria | 4625 |
| 145 | Ga0070674_100021244 | 3300005356 | Bacteria | 4163 |
| 146 | Ga0070674_100073676 | 3300005356 | Bacteria | 2421 |
| 147 | Ga0070673_100000204 | 3300005364 | Bacteria | 29365 |
| 148 | Ga0070673_100000590 | 3300005364 | Bacteria | 19738 |
| 149 | Ga0070673_100004070 | 3300005364 | Bacteria | 9206 |
| 150 | Ga0070673_100006278 | 3300005364 | Bacteria | 7709 |
| 151 | Ga0070673_100014748 | 3300005364 | Bacteria | 5460 |
| 152 | Ga0070673_100036630 | 3300005364 | Bacteria | 3731 |
| 153 | Ga0070673_100044398 | 3300005364 | Bacteria | 3441 |
| 154 | Ga0070673_100095019 | 3300005364 | Bacteria | 2444 |
| 155 | Ga0070659_100000086 | 3300005366 | Bacteria | 70060 |
| 156 | Ga0070659_100006587 | 3300005366 | Bacteria | 8388 |
| 157 | Ga0070659_100013059 | 3300005366 | Bacteria | 6177 |
| 158 | Ga0070659_100014971 | 3300005366 | Bacteria | 5802 |
| 159 | Ga0070659_100017011 | 3300005366 | Bacteria | 5466 |
| 160 | Ga0070659_100018067 | 3300005366 | Bacteria | 5318 |
| 161 | Ga0070659_100018589 | 3300005366 | Bacteria | 5245 |
| 162 | Ga0070659_100021833 | 3300005366 | Bacteria | 4881 |
| 163 | Ga0070659_100023101 | 3300005366 | Bacteria | 4754 |
| 164 | Ga0070659_100023963 | 3300005366 | Bacteria | 4675 |
| 165 | Ga0070659_100030394 | 3300005366 | Bacteria | 4181 |
| 166 | Ga0070659_100046010 | 3300005366 | Bacteria | 3420 |
| 167 | Ga0070659_100057300 | 3300005366 | Bacteria | 3072 |
| 168 | Ga0070659_100107184 | 3300005366 | Bacteria | 2253 |
| 169 | Ga0070667_100000017 | 3300005367 | Bacteria | 230531 |
| 170 | Ga0070667_100001539 | 3300005367 | Bacteria | 20661 |
| 171 | Ga0070667_100001793 | 3300005367 | Bacteria | 19116 |
| 172 | Ga0070667_100004350 | 3300005367 | Bacteria | 11952 |
| 173 | Ga0070667_100005340 | 3300005367 | Bacteria | 10732 |
| 174 | Ga0070667_100007452 | 3300005367 | Bacteria | 9084 |
| 175 | Ga0070667_100010364 | 3300005367 | Bacteria | 7696 |
| 176 | Ga0070667_100013709 | 3300005367 | Bacteria | 6699 |
| 177 | Ga0070667_100030024 | 3300005367 | Bacteria | 4533 |
| 178 | Ga0070667_100041572 | 3300005367 | Bacteria | 3857 |
| 179 | Ga0070667_100043677 | 3300005367 | Bacteria | 3762 |
| 180 | Ga0070667_100046554 | 3300005367 | Bacteria | 3649 |
| 181 | Ga0070667_100058499 | 3300005367 | Bacteria | 3259 |
| 182 | Ga0070667_100211550 | 3300005367 | Bacteria | 1723 |
| 183 | Ga0070714_100031716 | 3300005435 | Bacteria | 4411 |
| 184 | Ga0070714_100060591 | 3300005435 | Bacteria | 3248 |
| 185 | Ga0070714_100203485 | 3300005435 | Bacteria | 1812 |
| 186 | Ga0070713_100003021 | 3300005436 | Bacteria | 11043 |
| 187 | Ga0070713_100013750 | 3300005436 | Bacteria | 5986 |
| 188 | Ga0070663_100003483 | 3300005455 | Bacteria | 9075 |
| 189 | Ga0070663_100016740 | 3300005455 | Bacteria | 4771 |
| 190 | Ga0070663_100037899 | 3300005455 | Bacteria | 3359 |
| 191 | Ga0070663_100074038 | 3300005455 | Bacteria | 2486 |
| 192 | Ga0070663_100089051 | 3300005455 | Bacteria | 2283 |
| 193 | Ga0070678_100013101 | 3300005456 | Bacteria | 5185 |
| 194 | Ga0070678_100050898 | 3300005456 | Bacteria | 2999 |
| 195 | Ga0070678_100059215 | 3300005456 | Bacteria | 2814 |
| 196 | Ga0070662_100000082 | 3300005457 | Bacteria | 53245 |
| 197 | Ga0070662_100000287 | 3300005457 | Bacteria | 29960 |
| 198 | Ga0070662_100002026 | 3300005457 | Bacteria | 12411 |
| 199 | Ga0070662_100009542 | 3300005457 | Bacteria | 6351 |
| 200 | Ga0070662_100011887 | 3300005457 | Bacteria | 5755 |
| 201 | Ga0070662_100020460 | 3300005457 | Bacteria | 4506 |
| 202 | Ga0070662_100024689 | 3300005457 | Bacteria | 4144 |
| 203 | Ga0070662_100026880 | 3300005457 | Bacteria | 3989 |
| 204 | Ga0070662_100029073 | 3300005457 | Bacteria | 3854 |
| 205 | Ga0070662_100037083 | 3300005457 | Bacteria | 3454 |
| 206 | Ga0070662_100174891 | 3300005457 | Bacteria | 1688 |
| 207 | Ga0070681_10012374 | 3300005458 | Bacteria | 8462 |
| 208 | Ga0070681_10014887 | 3300005458 | Bacteria | 7734 |
| 209 | Ga0070681_10113814 | 3300005458 | Bacteria | 2644 |
| 210 | Ga0070681_10180918 | 3300005458 | Bacteria | 2030 |
| 211 | Ga0068867_100000045 | 3300005459 | Bacteria | 75898 |
| 212 | Ga0068867_100003377 | 3300005459 | Bacteria | 11235 |
| 213 | Ga0068867_100015007 | 3300005459 | Bacteria | 5492 |
| 214 | Ga0068867_100018334 | 3300005459 | Bacteria | 4975 |
| 215 | Ga0068867_100019003 | 3300005459 | Bacteria | 4892 |
| 216 | Ga0068867_100020790 | 3300005459 | Bacteria | 4679 |
| 217 | Ga0068867_100067164 | 3300005459 | Bacteria | 2672 |
| 218 | Ga0068867_100147944 | 3300005459 | Bacteria | 1843 |
| 219 | Ga0070679_100015808 | 3300005530 | Bacteria | 7260 |
| 220 | Ga0070679_100020657 | 3300005530 | Bacteria | 6422 |
| 221 | Ga0070679_100025380 | 3300005530 | Bacteria | 5815 |
| 222 | Ga0070679_100069452 | 3300005530 | Bacteria | 3514 |
| 223 | Ga0070679_100105752 | 3300005530 | Bacteria | 2800 |
| 224 | Ga0070684_100002928 | 3300005535 | Bacteria | 12687 |
| 225 | Ga0070684_100006344 | 3300005535 | Bacteria | 9137 |
| 226 | Ga0070684_100010464 | 3300005535 | Bacteria | 7352 |
| 227 | Ga0070684_100021814 | 3300005535 | Bacteria | 5334 |
| 228 | Ga0070684_100196347 | 3300005535 | Bacteria | 1838 |
| 229 | Ga0068853_100000151 | 3300005539 | Bacteria | 47652 |
| 230 | Ga0068853_100000162 | 3300005539 | Bacteria | 45622 |
| 231 | Ga0068853_100009683 | 3300005539 | Bacteria | 7769 |
| 232 | Ga0068853_100014738 | 3300005539 | Bacteria | 6415 |
| 233 | Ga0068853_100023556 | 3300005539 | Bacteria | 5156 |
| 234 | Ga0068853_100024862 | 3300005539 | Bacteria | 5024 |
| 235 | Ga0068853_100051655 | 3300005539 | Bacteria | 3539 |
| 236 | Ga0070672_100000041 | 3300005543 | Bacteria | 56886 |
| 237 | Ga0070672_100001502 | 3300005543 | Bacteria | 14484 |
| 238 | Ga0070672_100004463 | 3300005543 | Bacteria | 9165 |
| 239 | Ga0070672_100009120 | 3300005543 | Bacteria | 6825 |
| 240 | Ga0070672_100039229 | 3300005543 | Bacteria | 3626 |
| 241 | Ga0070672_100040941 | 3300005543 | Bacteria | 3559 |
| 242 | Ga0070686_100038761 | 3300005544 | Bacteria | 2964 |
| 243 | Ga0070696_100005700 | 3300005546 | Bacteria | 8319 |
| 244 | Ga0070696_100017850 | 3300005546 | Bacteria | 4791 |
| 245 | Ga0070693_100001450 | 3300005547 | Bacteria | 10691 |
| 246 | Ga0070693_100011985 | 3300005547 | Bacteria | 4378 |
| 247 | Ga0070693_100017906 | 3300005547 | Bacteria | 3693 |
| 248 | Ga0070665_100000670 | 3300005548 | Bacteria | 45961 |
| 249 | Ga0070665_100002033 | 3300005548 | Bacteria | 22765 |
| 250 | Ga0070665_100005768 | 3300005548 | Bacteria | 12717 |
| 251 | Ga0070665_100026211 | 3300005548 | Bacteria | 5870 |
| 252 | Ga0070665_100058238 | 3300005548 | Bacteria | 3873 |
| 253 | Ga0070665_100101401 | 3300005548 | Bacteria | 2882 |
| 254 | Ga0070665_100149292 | 3300005548 | Bacteria | 2340 |
| 255 | Ga0068855_100000742 | 3300005563 | Bacteria | 40114 |
| 256 | Ga0068855_100018216 | 3300005563 | Bacteria | 8435 |
| 257 | Ga0068855_100023878 | 3300005563 | Bacteria | 7324 |
| 258 | Ga0068855_100025338 | 3300005563 | Bacteria | 7098 |
| 259 | Ga0068855_100097713 | 3300005563 | Bacteria | 3383 |
| 260 | Ga0068855_100104893 | 3300005563 | Bacteria | 3251 |
| 261 | Ga0068855_100144783 | 3300005563 | Bacteria | 2706 |
| 262 | Ga0068855_100150977 | 3300005563 | Bacteria | 2642 |
| 263 | Ga0068855_100230041 | 3300005563 | Bacteria | 2076 |
| 264 | Ga0070664_100000113 | 3300005564 | Bacteria | 53220 |
| 265 | Ga0070664_100001064 | 3300005564 | Bacteria | 21598 |
| 266 | Ga0070664_100002825 | 3300005564 | Bacteria | 14048 |
| 267 | Ga0070664_100003970 | 3300005564 | Bacteria | 11898 |
| 268 | Ga0070664_100009109 | 3300005564 | Bacteria | 8055 |
| 269 | Ga0070664_100011044 | 3300005564 | Bacteria | 7324 |
| 270 | Ga0070664_100016775 | 3300005564 | Bacteria | 6010 |
| 271 | Ga0070664_100021362 | 3300005564 | Bacteria | 5334 |
| 272 | Ga0070664_100027914 | 3300005564 | Bacteria | 4694 |
| 273 | Ga0070664_100078203 | 3300005564 | Bacteria | 2846 |
| 274 | Ga0068857_100001542 | 3300005577 | Bacteria | 18443 |
| 275 | Ga0068857_100008535 | 3300005577 | Bacteria | 8859 |
| 276 | Ga0068857_100008558 | 3300005577 | Bacteria | 8849 |
| 277 | Ga0068857_100009896 | 3300005577 | Bacteria | 8279 |
| 278 | Ga0068857_100015197 | 3300005577 | Bacteria | 6717 |
| 279 | Ga0068857_100020339 | 3300005577 | Bacteria | 5837 |
| 280 | Ga0068857_100022916 | 3300005577 | Bacteria | 5494 |
| 281 | Ga0068857_100038155 | 3300005577 | Bacteria | 4254 |
| 282 | Ga0068857_100096943 | 3300005577 | Bacteria | 2643 |
| 283 | Ga0068854_100000542 | 3300005578 | Bacteria | 22825 |
| 284 | Ga0068854_100001932 | 3300005578 | Bacteria | 12640 |
| 285 | Ga0068854_100005841 | 3300005578 | Bacteria | 7792 |
| 286 | Ga0068854_100007038 | 3300005578 | Bacteria | 7179 |
| 287 | Ga0068854_100008980 | 3300005578 | Bacteria | 6441 |
| 288 | Ga0068854_100042581 | 3300005578 | Bacteria | 3214 |
| 289 | Ga0068854_100061529 | 3300005578 | Bacteria | 2720 |
| 290 | Ga0068854_100072161 | 3300005578 | Bacteria | 2528 |
| 291 | Ga0068856_100000159 | 3300005614 | Bacteria | 70023 |
| 292 | Ga0068856_100029169 | 3300005614 | Bacteria | 5389 |
| 293 | Ga0068856_100074129 | 3300005614 | Bacteria | 3369 |
| 294 | Ga0068856_100096782 | 3300005614 | Bacteria | 2940 |
| 295 | Ga0068856_100207352 | 3300005614 | Bacteria | 1974 |
| 296 | Ga0068856_100221472 | 3300005614 | Bacteria | 1907 |
| 297 | Ga0068852_100001609 | 3300005616 | Bacteria | 15379 |
| 298 | Ga0068852_100001650 | 3300005616 | Bacteria | 15231 |
| 299 | Ga0068852_100001814 | 3300005616 | Bacteria | 14511 |
| 300 | Ga0068852_100002219 | 3300005616 | Bacteria | 13323 |
| 301 | Ga0068852_100002795 | 3300005616 | Bacteria | 12094 |
| 302 | Ga0068852_100006345 | 3300005616 | Bacteria | 8535 |
| 303 | Ga0068852_100007134 | 3300005616 | Bacteria | 8142 |
| 304 | Ga0068852_100010580 | 3300005616 | Bacteria | 6902 |
| 305 | Ga0068852_100020995 | 3300005616 | Bacteria | 5202 |
| 306 | Ga0068852_100021738 | 3300005616 | Bacteria | 5131 |
| 307 | Ga0068852_100025430 | 3300005616 | Bacteria | 4797 |
| 308 | Ga0068852_100026465 | 3300005616 | Bacteria | 4715 |
| 309 | Ga0068859_100000088 | 3300005617 | Bacteria | 84390 |
| 310 | Ga0068859_100004053 | 3300005617 | Bacteria | 14939 |
| 311 | Ga0068859_100004551 | 3300005617 | Bacteria | 14140 |
| 312 | Ga0068859_100008428 | 3300005617 | Bacteria | 10440 |
| 313 | Ga0068859_100011079 | 3300005617 | Bacteria | 9073 |
| 314 | Ga0068859_100014660 | 3300005617 | Bacteria | 7877 |
| 315 | Ga0068859_100018006 | 3300005617 | Bacteria | 7099 |
| 316 | Ga0068859_100041650 | 3300005617 | Bacteria | 4613 |
| 317 | Ga0068859_100072008 | 3300005617 | Bacteria | 3492 |
| 318 | Ga0068859_100106176 | 3300005617 | Bacteria | 2868 |
| 319 | Ga0068859_100255522 | 3300005617 | Bacteria | 1843 |
| 320 | Ga0068864_100000047 | 3300005618 | Bacteria | 150798 |
| 321 | Ga0068864_100000079 | 3300005618 | Bacteria | 102835 |
| 322 | Ga0068864_100000136 | 3300005618 | Bacteria | 70797 |
| 323 | Ga0068864_100001503 | 3300005618 | Bacteria | 19202 |
| 324 | Ga0068864_100002002 | 3300005618 | Bacteria | 16780 |
| 325 | Ga0068864_100004809 | 3300005618 | Bacteria | 11070 |
| 326 | Ga0068864_100006405 | 3300005618 | Bacteria | 9649 |
| 327 | Ga0068864_100020446 | 3300005618 | Bacteria | 5538 |
| 328 | Ga0068864_100058935 | 3300005618 | Bacteria | 3320 |
| 329 | Ga0068864_100061173 | 3300005618 | Bacteria | 3262 |
| 330 | Ga0068864_100083533 | 3300005618 | Bacteria | 2805 |
| 331 | Ga0068864_100127424 | 3300005618 | Bacteria | 2283 |
| 332 | Ga0068864_100183765 | 3300005618 | Bacteria | 1913 |
| 333 | Ga0068866_10003876 | 3300005718 | Bacteria | 6134 |
| 334 | Ga0068866_10004832 | 3300005718 | Bacteria | 5533 |
| 335 | Ga0068866_10004933 | 3300005718 | Bacteria | 5486 |
| 336 | Ga0068861_100004950 | 3300005719 | Bacteria | 8975 |
| 337 | Ga0068861_100012530 | 3300005719 | Bacteria | 5916 |
| 338 | Ga0068861_100059987 | 3300005719 | Bacteria | 2914 |
| 339 | Ga0068851_10002427 | 3300005834 | Bacteria | 8184 |
| 340 | Ga0068851_10008521 | 3300005834 | Bacteria | 4745 |
| 341 | Ga0068851_10009986 | 3300005834 | Bacteria | 4420 |
| 342 | Ga0068851_10012686 | 3300005834 | Bacteria | 3978 |
| 343 | Ga0068851_10017180 | 3300005834 | Bacteria | 3471 |
| 344 | Ga0068851_10052314 | 3300005834 | Bacteria | 2076 |
| 345 | Ga0068851_10053316 | 3300005834 | Bacteria | 2059 |
| 346 | Ga0068870_10027095 | 3300005840 | Bacteria | 2864 |
| 347 | Ga0068863_100000289 | 3300005841 | Bacteria | 52032 |
| 348 | Ga0068863_100001560 | 3300005841 | Bacteria | 22637 |
| 349 | Ga0068863_100003406 | 3300005841 | Bacteria | 15677 |
| 350 | Ga0068863_100005004 | 3300005841 | Bacteria | 13068 |
| 351 | Ga0068863_100009191 | 3300005841 | Bacteria | 9642 |
| 352 | Ga0068863_100009866 | 3300005841 | Bacteria | 9303 |
| 353 | Ga0068863_100108263 | 3300005841 | Bacteria | 2645 |
| 354 | Ga0068863_100168842 | 3300005841 | Bacteria | 2098 |
| 355 | Ga0068858_100000063 | 3300005842 | Bacteria | 111811 |
| 356 | Ga0068858_100000093 | 3300005842 | Bacteria | 93236 |
| 357 | Ga0068858_100000303 | 3300005842 | Bacteria | 52646 |
| 358 | Ga0068858_100000631 | 3300005842 | Bacteria | 36634 |
| 359 | Ga0068858_100000855 | 3300005842 | Bacteria | 31513 |
| 360 | Ga0068858_100009554 | 3300005842 | Bacteria | 9252 |
| 361 | Ga0068858_100013046 | 3300005842 | Bacteria | 7838 |
| 362 | Ga0068858_100015178 | 3300005842 | Bacteria | 7246 |
| 363 | Ga0068858_100020829 | 3300005842 | Bacteria | 6128 |
| 364 | Ga0068858_100082795 | 3300005842 | Bacteria | 2983 |
| 365 | Ga0068858_100112515 | 3300005842 | Bacteria | 2542 |
| 366 | Ga0068860_100000056 | 3300005843 | Bacteria | 202751 |
| 367 | Ga0068860_100005063 | 3300005843 | Bacteria | 13404 |
| 368 | Ga0068860_100006008 | 3300005843 | Bacteria | 12217 |
| 369 | Ga0068860_100019484 | 3300005843 | Bacteria | 6577 |
| 370 | Ga0068860_100027709 | 3300005843 | Bacteria | 5456 |
| 371 | Ga0068860_100036953 | 3300005843 | Bacteria | 4676 |
| 372 | Ga0068860_100142572 | 3300005843 | Bacteria | 2304 |
| 373 | Ga0068862_100000033 | 3300005844 | Bacteria | 176515 |
| 374 | Ga0068862_100000108 | 3300005844 | Bacteria | 99413 |
| 375 | Ga0068862_100002790 | 3300005844 | Bacteria | 15308 |
| 376 | Ga0068862_100002942 | 3300005844 | Bacteria | 14886 |
| 377 | Ga0068862_100008241 | 3300005844 | Bacteria | 8622 |
| 378 | Ga0068862_100024321 | 3300005844 | Bacteria | 5082 |
| 379 | Ga0068862_100088529 | 3300005844 | Bacteria | 2694 |
| 380 | Ga0070717_10142196 | 3300006028 | Bacteria | 2070 |
| 381 | Ga0070717_10150657 | 3300006028 | Bacteria | 2012 |
| 382 | Ga0075366_10011282 | 3300006195 | Bacteria | 5043 |
| 383 | Ga0097621_100025055 | 3300006237 | Bacteria | 4665 |
| 384 | Ga0097621_100106120 | 3300006237 | Bacteria | 2369 |
| 385 | Ga0097621_100129764 | 3300006237 | Bacteria | 2145 |
| 386 | Ga0068871_100003697 | 3300006358 | Bacteria | 10515 |
| 387 | Ga0068871_100019814 | 3300006358 | Bacteria | 5141 |
| 388 | Ga0068871_100021709 | 3300006358 | Bacteria | 4940 |
| 389 | Ga0068871_100060412 | 3300006358 | Bacteria | 3092 |
| 390 | Ga0075428_100062026 | 3300006844 | Bacteria | 4094 |
| 391 | Ga0075433_10118970 | 3300006852 | Bacteria | 2344 |
| 392 | Ga0075429_100116883 | 3300006880 | Bacteria | 2331 |
| 393 | Ga0068865_100000528 | 3300006881 | Bacteria | 21368 |
| 394 | Ga0068865_100014020 | 3300006881 | Bacteria | 5086 |
| 395 | Ga0068865_100066333 | 3300006881 | Bacteria | 2546 |
| 396 | Ga0097620_100000088 | 3300006931 | Bacteria | 84390 |
| 397 | Ga0097620_100004053 | 3300006931 | Bacteria | 14939 |
| 398 | Ga0097620_100004551 | 3300006931 | Bacteria | 14140 |
| 399 | Ga0097620_100008428 | 3300006931 | Bacteria | 10440 |
| 400 | Ga0097620_100011079 | 3300006931 | Bacteria | 9073 |
| 401 | Ga0097620_100014661 | 3300006931 | Bacteria | 7877 |
| 402 | Ga0097620_100018006 | 3300006931 | Bacteria | 7099 |
| 403 | Ga0097620_100041649 | 3300006931 | Bacteria | 4613 |
| 404 | Ga0097620_100072004 | 3300006931 | Bacteria | 3492 |
| 405 | Ga0097620_100106179 | 3300006931 | Bacteria | 2868 |
| 406 | Ga0097620_100255538 | 3300006931 | Bacteria | 1843 |
| 407 | Ga0075435_100091950 | 3300007076 | Bacteria | 2505 |
| 408 | Ga0105240_10018703 | 3300009093 | Bacteria | 9282 |
| 409 | Ga0105240_10026437 | 3300009093 | Bacteria | 7614 |
| 410 | Ga0105240_10273672 | 3300009093 | Bacteria | 1943 |
| 411 | Ga0111539_10037205 | 3300009094 | Bacteria | 5879 |
| 412 | Ga0111539_10119199 | 3300009094 | Bacteria | 3093 |
| 413 | Ga0105245_10000062 | 3300009098 | Bacteria | 115179 |
| 414 | Ga0105245_10002634 | 3300009098 | Bacteria | 16148 |
| 415 | Ga0105245_10020038 | 3300009098 | Bacteria | 5862 |
| 416 | Ga0105245_10031755 | 3300009098 | Bacteria | 4675 |
| 417 | Ga0105247_10012951 | 3300009101 | Bacteria | 5001 |
| 418 | Ga0105243_10013997 | 3300009148 | Bacteria | 6070 |
| 419 | Ga0105243_10224513 | 3300009148 | Bacteria | 1662 |
| 420 | Ga0105241_10040270 | 3300009174 | Bacteria | 3527 |
| 421 | Ga0105241_10266871 | 3300009174 | Bacteria | 1457 |
| 422 | Ga0105242_10151822 | 3300009176 | Bacteria | 2020 |
| 423 | Ga0105248_10000122 | 3300009177 | Bacteria | 89560 |
| 424 | Ga0105248_10000169 | 3300009177 | Bacteria | 75948 |
| 425 | Ga0105248_10000213 | 3300009177 | Bacteria | 66972 |
| 426 | Ga0105248_10000620 | 3300009177 | Bacteria | 40460 |
| 427 | Ga0105248_10001030 | 3300009177 | Bacteria | 30868 |
| 428 | Ga0105248_10003373 | 3300009177 | Bacteria | 17741 |
| 429 | Ga0105248_10003561 | 3300009177 | Bacteria | 17260 |
| 430 | Ga0105248_10023443 | 3300009177 | Bacteria | 6856 |
| 431 | Ga0105248_10039564 | 3300009177 | Bacteria | 5283 |
| 432 | Ga0105248_10039913 | 3300009177 | Bacteria | 5262 |
| 433 | Ga0105248_10047045 | 3300009177 | Bacteria | 4837 |
| 434 | Ga0105248_10048977 | 3300009177 | Bacteria | 4739 |
| 435 | Ga0105248_10056890 | 3300009177 | Bacteria | 4388 |
| 436 | Ga0105248_10105910 | 3300009177 | Bacteria | 3171 |
| 437 | Ga0105248_10156006 | 3300009177 | Bacteria | 2576 |
| 438 | Ga0105248_10194631 | 3300009177 | Bacteria | 2284 |
| 439 | Ga0105237_10010306 | 3300009545 | Bacteria | 9957 |
| 440 | Ga0105237_10030124 | 3300009545 | Bacteria | 5514 |
| 441 | Ga0105237_10191717 | 3300009545 | Bacteria | 2044 |
| 442 | Ga0105238_10044299 | 3300009551 | Bacteria | 4499 |
| 443 | Ga0105238_10066032 | 3300009551 | Bacteria | 3619 |
| 444 | Ga0105238_10228564 | 3300009551 | Bacteria | 1837 |
| 445 | Ga0105249_10005571 | 3300009553 | Bacteria | 10887 |
| 446 | Ga0105249_10014232 | 3300009553 | Bacteria | 7034 |
| 447 | Ga0105249_10177022 | 3300009553 | Bacteria | 2072 |
| 448 | Ga0105239_10000105 | 3300010375 | Bacteria | 117635 |
| 449 | Ga0105239_10028175 | 3300010375 | Bacteria | 6179 |
| 450 | Ga0105246_10037660 | 3300011119 | Bacteria | 3246 |
| 451 | Ga0105246_10163238 | 3300011119 | Bacteria | 1699 |
| 452 | Ga0157326_1001213 | 3300012513 | Bacteria | 2870 |
| 453 | Ga0157373_10012015 | 3300013100 | Bacteria | 6365 |
| 454 | Ga0157373_10014353 | 3300013100 | Bacteria | 5805 |
| 455 | Ga0157373_10115653 | 3300013100 | Bacteria | 1885 |
| 456 | Ga0157371_10000144 | 3300013102 | Bacteria | 103512 |
| 457 | Ga0157371_10001522 | 3300013102 | Bacteria | 23920 |
| 458 | Ga0157371_10004858 | 3300013102 | Bacteria | 11557 |
| 459 | Ga0157371_10022967 | 3300013102 | Bacteria | 4562 |
| 460 | Ga0157371_10043687 | 3300013102 | Bacteria | 3192 |
| 461 | Ga0157371_10049403 | 3300013102 | Bacteria | 2988 |
| 462 | Ga0157371_10079099 | 3300013102 | Bacteria | 2329 |
| 463 | Ga0157370_10000809 | 3300013104 | Bacteria | 39519 |
| 464 | Ga0157370_10015351 | 3300013104 | Bacteria | 7786 |
| 465 | Ga0157370_10030015 | 3300013104 | Bacteria | 5328 |
| 466 | Ga0157370_10030507 | 3300013104 | Bacteria | 5282 |
| 467 | Ga0157370_10212593 | 3300013104 | Bacteria | 1792 |
| 468 | Ga0157369_10003544 | 3300013105 | Bacteria | 18538 |
| 469 | Ga0157369_10022172 | 3300013105 | Bacteria | 7094 |
| 470 | Ga0157369_10045781 | 3300013105 | Bacteria | 4756 |
| 471 | Ga0157369_10170762 | 3300013105 | Bacteria | 2291 |
| 472 | Ga0157369_10245064 | 3300013105 | Bacteria | 1871 |
| 473 | Ga0157374_10004105 | 3300013296 | Bacteria | 12227 |
| 474 | Ga0157374_10005804 | 3300013296 | Bacteria | 10428 |
| 475 | Ga0157378_10000242 | 3300013297 | Bacteria | 53256 |
| 476 | Ga0157378_10059213 | 3300013297 | Bacteria | 3417 |
| 477 | Ga0157378_10137141 | 3300013297 | Bacteria | 2269 |
| 478 | Ga0163162_10012431 | 3300013306 | Bacteria | 8316 |
| 479 | Ga0163162_10015079 | 3300013306 | Bacteria | 7548 |
| 480 | Ga0163162_10024390 | 3300013306 | Bacteria | 5969 |
| 481 | Ga0163162_10120256 | 3300013306 | Bacteria | 2730 |
| 482 | Ga0157372_10011773 | 3300013307 | Bacteria | 9317 |
| 483 | Ga0157372_10033076 | 3300013307 | Bacteria | 5677 |
| 484 | Ga0157372_10394002 | 3300013307 | Bacteria | 1614 |
| 485 | Ga0157375_10013028 | 3300013308 | Bacteria | 7389 |
| 486 | Ga0157375_10017802 | 3300013308 | Bacteria | 6425 |
| 487 | Ga0157375_10163342 | 3300013308 | Bacteria | 2370 |
| 488 | Ga0157375_10250374 | 3300013308 | Bacteria | 1932 |
| 489 | Ga0163163_10001969 | 3300014325 | Bacteria | 17361 |
| 490 | Ga0163163_10005368 | 3300014325 | Bacteria | 11073 |
| 491 | Ga0163163_10161905 | 3300014325 | Bacteria | 2283 |
| 492 | Ga0163163_10187270 | 3300014325 | Bacteria | 2117 |
| 493 | Ga0157380_10000319 | 3300014326 | Bacteria | 29011 |
| 494 | Ga0157380_10000615 | 3300014326 | Bacteria | 21963 |
| 495 | Ga0157380_10001210 | 3300014326 | Bacteria | 16709 |
| 496 | Ga0157380_10086590 | 3300014326 | Bacteria | 2575 |
| 497 | Ga0182008_10048809 | 3300014497 | Bacteria | 2102 |
| 498 | Ga0157379_10003175 | 3300014968 | Bacteria | 13917 |
| 499 | Ga0157379_10024874 | 3300014968 | Bacteria | 5316 |
| 500 | Ga0157379_10089723 | 3300014968 | Bacteria | 2758 |
| 501 | Ga0157376_10029478 | 3300014969 | Bacteria | 4371 |
| 502 | Ga0183363_1003 | 3300015690 | Bacteria | 421263 |
| 503 | Ga0163161_10010209 | 3300017792 | Bacteria | 6501 |
| 504 | Ga0163161_10135001 | 3300017792 | Bacteria | 1864 |
| 505 | Ga0213875_10002752 | 3300021388 | Bacteria | 10382 |
| 506 | Ga0209233_1000140 | 3300025261 | Bacteria | 193274 |
| 507 | Ga0207697_10000002 | 3300025315 | Bacteria | 92560 |
| 508 | Ga0207697_10000459 | 3300025315 | Bacteria | 22944 |
| 509 | Ga0207697_10014994 | 3300025315 | Bacteria | 3207 |
| 510 | Ga0207697_10034563 | 3300025315 | Bacteria | 2069 |
| 511 | Ga0207656_10011826 | 3300025321 | Bacteria | 3304 |
| 512 | Ga0207656_10018930 | 3300025321 | Bacteria | 2717 |
| 513 | Ga0207656_10025070 | 3300025321 | Bacteria | 2418 |
| 514 | Ga0207656_10064844 | 3300025321 | Bacteria | 1611 |
| 515 | Ga0207696_1016889 | 3300025711 | Bacteria | 2430 |
| 516 | Ga0207682_10000549 | 3300025893 | Bacteria | 17276 |
| 517 | Ga0207682_10038342 | 3300025893 | Bacteria | 1944 |
| 518 | Ga0207642_10045487 | 3300025899 | Bacteria | 1949 |
| 519 | Ga0207688_10000185 | 3300025901 | Bacteria | 27678 |
| 520 | Ga0207688_10027109 | 3300025901 | Bacteria | 3151 |
| 521 | Ga0207688_10038030 | 3300025901 | Bacteria | 2670 |
| 522 | Ga0207680_10001036 | 3300025903 | Bacteria | 13117 |
| 523 | Ga0207680_10001868 | 3300025903 | Bacteria | 9878 |
| 524 | Ga0207680_10006130 | 3300025903 | Bacteria | 5796 |
| 525 | Ga0207680_10013590 | 3300025903 | Bacteria | 4188 |
| 526 | Ga0207680_10018753 | 3300025903 | Bacteria | 3686 |
| 527 | Ga0207647_10000095 | 3300025904 | Bacteria | 67884 |
| 528 | Ga0207647_10001001 | 3300025904 | Bacteria | 21921 |
| 529 | Ga0207647_10001765 | 3300025904 | Bacteria | 16596 |
| 530 | Ga0207647_10003254 | 3300025904 | Bacteria | 12193 |
| 531 | Ga0207647_10007018 | 3300025904 | Bacteria | 8169 |
| 532 | Ga0207647_10010152 | 3300025904 | Bacteria | 6654 |
| 533 | Ga0207647_10021448 | 3300025904 | Bacteria | 4312 |
| 534 | Ga0207645_10002989 | 3300025907 | Bacteria | 13069 |
| 535 | Ga0207645_10003442 | 3300025907 | Bacteria | 12023 |
| 536 | Ga0207645_10006844 | 3300025907 | Bacteria | 8133 |
| 537 | Ga0207645_10007529 | 3300025907 | Bacteria | 7683 |
| 538 | Ga0207645_10026224 | 3300025907 | Bacteria | 3766 |
| 539 | Ga0207645_10089707 | 3300025907 | Bacteria | 1977 |
| 540 | Ga0207645_10110375 | 3300025907 | Bacteria | 1780 |
| 541 | Ga0207643_10040672 | 3300025908 | Bacteria | 2618 |
| 542 | Ga0207643_10114558 | 3300025908 | Bacteria | 1591 |
| 543 | Ga0207705_10002520 | 3300025909 | Bacteria | 14113 |
| 544 | Ga0207705_10002578 | 3300025909 | Bacteria | 13924 |
| 545 | Ga0207705_10003350 | 3300025909 | Bacteria | 12181 |
| 546 | Ga0207705_10007626 | 3300025909 | Bacteria | 7958 |
| 547 | Ga0207705_10008207 | 3300025909 | Bacteria | 7639 |
| 548 | Ga0207705_10011652 | 3300025909 | Bacteria | 6352 |
| 549 | Ga0207705_10014418 | 3300025909 | Bacteria | 5689 |
| 550 | Ga0207705_10016347 | 3300025909 | Bacteria | 5320 |
| 551 | Ga0207705_10069286 | 3300025909 | Bacteria | 2555 |
| 552 | Ga0207705_10080184 | 3300025909 | Bacteria | 2378 |
| 553 | Ga0207705_10084349 | 3300025909 | Bacteria | 2319 |
| 554 | Ga0207705_10094710 | 3300025909 | Bacteria | 2190 |
| 555 | Ga0207705_10109353 | 3300025909 | Bacteria | 2041 |
| 556 | Ga0207654_10032054 | 3300025911 | Bacteria | 2899 |
| 557 | Ga0207707_10004641 | 3300025912 | Bacteria | 12067 |
| 558 | Ga0207707_10024672 | 3300025912 | Bacteria | 5262 |
| 559 | Ga0207707_10093825 | 3300025912 | Bacteria | 2622 |
| 560 | Ga0207707_10152364 | 3300025912 | Bacteria | 2021 |
| 561 | Ga0207695_10019266 | 3300025913 | Bacteria | 7858 |
| 562 | Ga0207695_10021749 | 3300025913 | Bacteria | 7309 |
| 563 | Ga0207695_10034582 | 3300025913 | Bacteria | 5493 |
| 564 | Ga0207695_10131488 | 3300025913 | Bacteria | 2460 |
| 565 | Ga0207671_10016350 | 3300025914 | Bacteria | 5770 |
| 566 | Ga0207671_10018784 | 3300025914 | Bacteria | 5297 |
| 567 | Ga0207660_10000593 | 3300025917 | Bacteria | 24452 |
| 568 | Ga0207660_10002867 | 3300025917 | Bacteria | 11272 |
| 569 | Ga0207660_10016140 | 3300025917 | Bacteria | 4939 |
| 570 | Ga0207660_10020986 | 3300025917 | Bacteria | 4389 |
| 571 | Ga0207660_10037625 | 3300025917 | Bacteria | 3373 |
| 572 | Ga0207660_10050818 | 3300025917 | Bacteria | 2945 |
| 573 | Ga0207660_10096886 | 3300025917 | Bacteria | 2197 |
| 574 | Ga0207657_10000276 | 3300025919 | Bacteria | 54727 |
| 575 | Ga0207657_10000594 | 3300025919 | Bacteria | 38336 |
| 576 | Ga0207657_10002671 | 3300025919 | Bacteria | 19229 |
| 577 | Ga0207657_10003798 | 3300025919 | Bacteria | 16059 |
| 578 | Ga0207657_10003856 | 3300025919 | Bacteria | 15923 |
| 579 | Ga0207657_10006981 | 3300025919 | Bacteria | 11626 |
| 580 | Ga0207657_10009402 | 3300025919 | Bacteria | 9828 |
| 581 | Ga0207657_10013132 | 3300025919 | Bacteria | 8134 |
| 582 | Ga0207657_10013533 | 3300025919 | Bacteria | 8001 |
| 583 | Ga0207657_10014084 | 3300025919 | Bacteria | 7826 |
| 584 | Ga0207657_10014211 | 3300025919 | Bacteria | 7784 |
| 585 | Ga0207657_10017472 | 3300025919 | Bacteria | 6875 |
| 586 | Ga0207657_10019175 | 3300025919 | Bacteria | 6504 |
| 587 | Ga0207657_10031010 | 3300025919 | Bacteria | 4847 |
| 588 | Ga0207657_10031840 | 3300025919 | Bacteria | 4770 |
| 589 | Ga0207657_10044268 | 3300025919 | Bacteria | 3914 |
| 590 | Ga0207657_10048819 | 3300025919 | Bacteria | 3693 |
| 591 | Ga0207657_10052184 | 3300025919 | Bacteria | 3550 |
| 592 | Ga0207657_10066889 | 3300025919 | Bacteria | 3058 |
| 593 | Ga0207649_10000277 | 3300025920 | Bacteria | 40521 |
| 594 | Ga0207649_10006532 | 3300025920 | Bacteria | 6334 |
| 595 | Ga0207649_10008616 | 3300025920 | Bacteria | 5567 |
| 596 | Ga0207649_10010751 | 3300025920 | Bacteria | 5032 |
| 597 | Ga0207649_10024072 | 3300025920 | Bacteria | 3535 |
| 598 | Ga0207649_10042049 | 3300025920 | Bacteria | 2786 |
| 599 | Ga0207649_10049434 | 3300025920 | Bacteria | 2597 |
| 600 | Ga0207649_10052408 | 3300025920 | Bacteria | 2531 |
| 601 | Ga0207649_10109218 | 3300025920 | Bacteria | 1845 |
| 602 | Ga0207652_10006156 | 3300025921 | Bacteria | 9700 |
| 603 | Ga0207652_10014820 | 3300025921 | Bacteria | 6321 |
| 604 | Ga0207652_10067869 | 3300025921 | Bacteria | 3093 |
| 605 | Ga0207652_10097441 | 3300025921 | Bacteria | 2592 |
| 606 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 607 | Ga0207681_10000414 | 3300025923 | Bacteria | 29779 |
| 608 | Ga0207681_10004175 | 3300025923 | Bacteria | 8945 |
| 609 | Ga0207681_10009199 | 3300025923 | Bacteria | 6037 |
| 610 | Ga0207681_10013492 | 3300025923 | Bacteria | 5058 |
| 611 | Ga0207681_10025963 | 3300025923 | Bacteria | 3774 |
| 612 | Ga0207681_10077103 | 3300025923 | Bacteria | 2342 |
| 613 | Ga0207694_10000665 | 3300025924 | Bacteria | 30841 |
| 614 | Ga0207694_10007832 | 3300025924 | Bacteria | 8090 |
| 615 | Ga0207694_10021952 | 3300025924 | Bacteria | 4841 |
| 616 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 617 | Ga0207650_10004328 | 3300025925 | Bacteria | 9700 |
| 618 | Ga0207650_10006161 | 3300025925 | Bacteria | 8173 |
| 619 | Ga0207650_10010874 | 3300025925 | Bacteria | 6253 |
| 620 | Ga0207650_10019981 | 3300025925 | Bacteria | 4716 |
| 621 | Ga0207650_10033602 | 3300025925 | Bacteria | 3716 |
| 622 | Ga0207650_10041232 | 3300025925 | Bacteria | 3381 |
| 623 | Ga0207650_10043250 | 3300025925 | Bacteria | 3305 |
| 624 | Ga0207650_10047647 | 3300025925 | Bacteria | 3158 |
| 625 | Ga0207650_10073647 | 3300025925 | Bacteria | 2573 |
| 626 | Ga0207650_10092388 | 3300025925 | Bacteria | 2314 |
| 627 | Ga0207659_10000722 | 3300025926 | Bacteria | 19576 |
| 628 | Ga0207659_10005396 | 3300025926 | Bacteria | 7743 |
| 629 | Ga0207659_10013617 | 3300025926 | Bacteria | 5215 |
| 630 | Ga0207659_10060565 | 3300025926 | Bacteria | 2725 |
| 631 | Ga0207687_10000899 | 3300025927 | Bacteria | 20227 |
| 632 | Ga0207687_10018073 | 3300025927 | Bacteria | 4651 |
| 633 | Ga0207687_10026642 | 3300025927 | Bacteria | 3872 |
| 634 | Ga0207687_10075012 | 3300025927 | Bacteria | 2426 |
| 635 | Ga0207700_10015911 | 3300025928 | Bacteria | 4980 |
| 636 | Ga0207700_10031630 | 3300025928 | Bacteria | 3762 |
| 637 | Ga0207664_10003705 | 3300025929 | Bacteria | 10245 |
| 638 | Ga0207664_10045543 | 3300025929 | Bacteria | 3440 |
| 639 | Ga0207664_10143541 | 3300025929 | Bacteria | 2022 |
| 640 | Ga0207644_10000135 | 3300025931 | Bacteria | 53131 |
| 641 | Ga0207644_10000139 | 3300025931 | Bacteria | 51953 |
| 642 | Ga0207644_10002659 | 3300025931 | Bacteria | 11506 |
| 643 | Ga0207644_10003132 | 3300025931 | Bacteria | 10653 |
| 644 | Ga0207644_10005078 | 3300025931 | Bacteria | 8594 |
| 645 | Ga0207644_10013876 | 3300025931 | Bacteria | 5382 |
| 646 | Ga0207644_10015698 | 3300025931 | Bacteria | 5088 |
| 647 | Ga0207644_10019544 | 3300025931 | Bacteria | 4596 |
| 648 | Ga0207644_10028246 | 3300025931 | Bacteria | 3881 |
| 649 | Ga0207644_10032716 | 3300025931 | Bacteria | 3630 |
| 650 | Ga0207644_10033360 | 3300025931 | Bacteria | 3596 |
| 651 | Ga0207644_10042087 | 3300025931 | Bacteria | 3235 |
| 652 | Ga0207644_10075948 | 3300025931 | Bacteria | 2470 |
| 653 | Ga0207644_10094722 | 3300025931 | Bacteria | 2231 |
| 654 | Ga0207690_10000100 | 3300025932 | Bacteria | 71510 |
| 655 | Ga0207690_10003562 | 3300025932 | Bacteria | 9265 |
| 656 | Ga0207690_10004247 | 3300025932 | Bacteria | 8465 |
| 657 | Ga0207690_10005603 | 3300025932 | Bacteria | 7421 |
| 658 | Ga0207690_10005693 | 3300025932 | Bacteria | 7360 |
| 659 | Ga0207690_10006094 | 3300025932 | Bacteria | 7145 |
| 660 | Ga0207690_10011221 | 3300025932 | Bacteria | 5350 |
| 661 | Ga0207690_10018475 | 3300025932 | Bacteria | 4276 |
| 662 | Ga0207690_10042741 | 3300025932 | Bacteria | 2979 |
| 663 | Ga0207690_10042807 | 3300025932 | Bacteria | 2977 |
| 664 | Ga0207690_10070884 | 3300025932 | Bacteria | 2402 |
| 665 | Ga0207690_10094708 | 3300025932 | Bacteria | 2119 |
| 666 | Ga0207690_10123083 | 3300025932 | Bacteria | 1887 |
| 667 | Ga0207690_10123573 | 3300025932 | Bacteria | 1884 |
| 668 | Ga0207690_10208796 | 3300025932 | Bacteria | 1487 |
| 669 | Ga0207706_10000020 | 3300025933 | Bacteria | 162063 |
| 670 | Ga0207706_10000411 | 3300025933 | Bacteria | 45884 |
| 671 | Ga0207706_10000599 | 3300025933 | Bacteria | 38339 |
| 672 | Ga0207706_10001396 | 3300025933 | Bacteria | 24136 |
| 673 | Ga0207706_10002559 | 3300025933 | Bacteria | 17732 |
| 674 | Ga0207706_10003893 | 3300025933 | Bacteria | 14166 |
| 675 | Ga0207706_10006178 | 3300025933 | Bacteria | 11123 |
| 676 | Ga0207706_10007469 | 3300025933 | Bacteria | 10104 |
| 677 | Ga0207706_10009669 | 3300025933 | Bacteria | 8852 |
| 678 | Ga0207706_10010553 | 3300025933 | Bacteria | 8439 |
| 679 | Ga0207706_10017823 | 3300025933 | Bacteria | 6396 |
| 680 | Ga0207706_10025629 | 3300025933 | Bacteria | 5282 |
| 681 | Ga0207706_10037891 | 3300025933 | Bacteria | 4278 |
| 682 | Ga0207706_10042896 | 3300025933 | Bacteria | 4009 |
| 683 | Ga0207706_10153229 | 3300025933 | Bacteria | 2027 |
| 684 | Ga0207709_10056167 | 3300025935 | Bacteria | 2435 |
| 685 | Ga0207669_10007249 | 3300025937 | Bacteria | 5113 |
| 686 | Ga0207669_10009397 | 3300025937 | Bacteria | 4654 |
| 687 | Ga0207669_10046187 | 3300025937 | Bacteria | 2572 |
| 688 | Ga0207704_10007995 | 3300025938 | Bacteria | 5030 |
| 689 | Ga0207704_10060612 | 3300025938 | Bacteria | 2342 |
| 690 | Ga0207691_10000133 | 3300025940 | Bacteria | 68368 |
| 691 | Ga0207691_10001043 | 3300025940 | Bacteria | 27477 |
| 692 | Ga0207691_10006826 | 3300025940 | Bacteria | 11008 |
| 693 | Ga0207691_10007876 | 3300025940 | Bacteria | 10263 |
| 694 | Ga0207691_10013203 | 3300025940 | Bacteria | 7910 |
| 695 | Ga0207691_10034681 | 3300025940 | Bacteria | 4691 |
| 696 | Ga0207691_10082546 | 3300025940 | Bacteria | 2886 |
| 697 | Ga0207691_10122107 | 3300025940 | Bacteria | 2307 |
| 698 | Ga0207691_10167442 | 3300025940 | Bacteria | 1925 |
| 699 | Ga0207711_10000039 | 3300025941 | Bacteria | 162974 |
| 700 | Ga0207711_10000107 | 3300025941 | Bacteria | 87146 |
| 701 | Ga0207711_10000297 | 3300025941 | Bacteria | 53217 |
| 702 | Ga0207711_10001496 | 3300025941 | Bacteria | 21764 |
| 703 | Ga0207711_10001711 | 3300025941 | Bacteria | 20192 |
| 704 | Ga0207711_10002235 | 3300025941 | Bacteria | 17366 |
| 705 | Ga0207711_10003051 | 3300025941 | Bacteria | 14636 |
| 706 | Ga0207711_10004290 | 3300025941 | Bacteria | 12184 |
| 707 | Ga0207711_10004444 | 3300025941 | Bacteria | 11952 |
| 708 | Ga0207711_10005938 | 3300025941 | Bacteria | 10321 |
| 709 | Ga0207711_10015796 | 3300025941 | Bacteria | 6263 |
| 710 | Ga0207711_10025644 | 3300025941 | Bacteria | 4944 |
| 711 | Ga0207711_10031486 | 3300025941 | Bacteria | 4478 |
| 712 | Ga0207711_10103102 | 3300025941 | Bacteria | 2526 |
| 713 | Ga0207711_10234961 | 3300025941 | Bacteria | 1680 |
| 714 | Ga0207689_10000002 | 3300025942 | Bacteria | 198437 |
| 715 | Ga0207689_10003262 | 3300025942 | Bacteria | 14871 |
| 716 | Ga0207661_10003511 | 3300025944 | Bacteria | 10890 |
| 717 | Ga0207661_10013868 | 3300025944 | Bacteria | 5889 |
| 718 | Ga0207679_10000377 | 3300025945 | Bacteria | 32363 |
| 719 | Ga0207679_10005368 | 3300025945 | Bacteria | 8035 |
| 720 | Ga0207679_10018970 | 3300025945 | Bacteria | 4616 |
| 721 | Ga0207679_10021378 | 3300025945 | Bacteria | 4387 |
| 722 | Ga0207679_10025915 | 3300025945 | Bacteria | 4038 |
| 723 | Ga0207679_10027093 | 3300025945 | Bacteria | 3960 |
| 724 | Ga0207679_10047253 | 3300025945 | Bacteria | 3126 |
| 725 | Ga0207679_10072397 | 3300025945 | Bacteria | 2603 |
| 726 | Ga0207679_10258923 | 3300025945 | Bacteria | 1483 |
| 727 | Ga0207667_10013227 | 3300025949 | Bacteria | 9461 |
| 728 | Ga0207667_10023065 | 3300025949 | Bacteria | 6858 |
| 729 | Ga0207667_10033651 | 3300025949 | Bacteria | 5509 |
| 730 | Ga0207667_10055648 | 3300025949 | Bacteria | 4158 |
| 731 | Ga0207667_10064721 | 3300025949 | Bacteria | 3816 |
| 732 | Ga0207667_10102337 | 3300025949 | Bacteria | 2955 |
| 733 | Ga0207667_10263674 | 3300025949 | Bacteria | 1762 |
| 734 | Ga0207651_10001472 | 3300025960 | Bacteria | 10708 |
| 735 | Ga0207651_10002855 | 3300025960 | Bacteria | 8324 |
| 736 | Ga0207651_10015655 | 3300025960 | Bacteria | 4415 |
| 737 | Ga0207651_10021994 | 3300025960 | Bacteria | 3889 |
| 738 | Ga0207651_10027291 | 3300025960 | Bacteria | 3584 |
| 739 | Ga0207712_10000195 | 3300025961 | Bacteria | 62560 |
| 740 | Ga0207712_10016124 | 3300025961 | Bacteria | 4832 |
| 741 | Ga0207668_10000012 | 3300025972 | Bacteria | 182541 |
| 742 | Ga0207668_10000176 | 3300025972 | Bacteria | 43587 |
| 743 | Ga0207668_10000205 | 3300025972 | Bacteria | 40046 |
| 744 | Ga0207668_10017116 | 3300025972 | Bacteria | 4536 |
| 745 | Ga0207668_10023073 | 3300025972 | Bacteria | 3994 |
| 746 | Ga0207668_10083595 | 3300025972 | Bacteria | 2323 |
| 747 | Ga0207668_10094100 | 3300025972 | Bacteria | 2209 |
| 748 | Ga0207668_10204987 | 3300025972 | Bacteria | 1573 |
| 749 | Ga0207640_10002155 | 3300025981 | Bacteria | 10581 |
| 750 | Ga0207640_10007188 | 3300025981 | Bacteria | 6136 |
| 751 | Ga0207640_10008423 | 3300025981 | Bacteria | 5729 |
| 752 | Ga0207640_10010785 | 3300025981 | Bacteria | 5157 |
| 753 | Ga0207640_10037689 | 3300025981 | Bacteria | 3044 |
| 754 | Ga0207640_10155185 | 3300025981 | Bacteria | 1687 |
| 755 | Ga0207658_10000011 | 3300025986 | Bacteria | 239620 |
| 756 | Ga0207658_10002281 | 3300025986 | Bacteria | 14178 |
| 757 | Ga0207658_10002784 | 3300025986 | Bacteria | 12585 |
| 758 | Ga0207658_10004177 | 3300025986 | Bacteria | 10062 |
| 759 | Ga0207658_10004754 | 3300025986 | Bacteria | 9401 |
| 760 | Ga0207658_10013979 | 3300025986 | Bacteria | 5494 |
| 761 | Ga0207658_10016379 | 3300025986 | Bacteria | 5098 |
| 762 | Ga0207658_10016952 | 3300025986 | Bacteria | 5013 |
| 763 | Ga0207658_10022229 | 3300025986 | Bacteria | 4414 |
| 764 | Ga0207658_10044301 | 3300025986 | Bacteria | 3239 |
| 765 | Ga0207658_10056616 | 3300025986 | Bacteria | 2910 |
| 766 | Ga0207677_10002392 | 3300026023 | Bacteria | 9830 |
| 767 | Ga0207677_10007754 | 3300026023 | Bacteria | 5958 |
| 768 | Ga0207677_10045368 | 3300026023 | Bacteria | 2935 |
| 769 | Ga0207677_10135991 | 3300026023 | Bacteria | 1874 |
| 770 | Ga0207703_10000241 | 3300026035 | Bacteria | 62119 |
| 771 | Ga0207703_10000327 | 3300026035 | Bacteria | 51797 |
| 772 | Ga0207703_10000529 | 3300026035 | Bacteria | 39299 |
| 773 | Ga0207703_10001701 | 3300026035 | Bacteria | 19778 |
| 774 | Ga0207703_10010833 | 3300026035 | Bacteria | 7112 |
| 775 | Ga0207703_10010847 | 3300026035 | Bacteria | 7105 |
| 776 | Ga0207703_10015361 | 3300026035 | Bacteria | 5972 |
| 777 | Ga0207703_10060851 | 3300026035 | Bacteria | 3089 |
| 778 | Ga0207703_10069636 | 3300026035 | Bacteria | 2902 |
| 779 | Ga0207639_10000162 | 3300026041 | Bacteria | 51395 |
| 780 | Ga0207639_10000987 | 3300026041 | Bacteria | 19374 |
| 781 | Ga0207639_10010227 | 3300026041 | Bacteria | 6492 |
| 782 | Ga0207639_10043264 | 3300026041 | Bacteria | 3380 |
| 783 | Ga0207639_10101055 | 3300026041 | Bacteria | 2331 |
| 784 | Ga0207639_10176622 | 3300026041 | Bacteria | 1813 |
| 785 | Ga0207678_10002193 | 3300026067 | Bacteria | 17637 |
| 786 | Ga0207678_10004189 | 3300026067 | Bacteria | 12946 |
| 787 | Ga0207678_10004258 | 3300026067 | Bacteria | 12830 |
| 788 | Ga0207678_10005341 | 3300026067 | Bacteria | 11504 |
| 789 | Ga0207678_10005694 | 3300026067 | Bacteria | 11127 |
| 790 | Ga0207678_10010475 | 3300026067 | Bacteria | 8143 |
| 791 | Ga0207678_10014855 | 3300026067 | Bacteria | 6850 |
| 792 | Ga0207678_10032074 | 3300026067 | Bacteria | 4580 |
| 793 | Ga0207678_10071779 | 3300026067 | Bacteria | 2968 |
| 794 | Ga0207678_10074012 | 3300026067 | Bacteria | 2919 |
| 795 | Ga0207678_10140740 | 3300026067 | Bacteria | 2059 |
| 796 | Ga0207702_10000208 | 3300026078 | Bacteria | 69979 |
| 797 | Ga0207702_10003777 | 3300026078 | Bacteria | 13675 |
| 798 | Ga0207702_10017062 | 3300026078 | Bacteria | 6006 |
| 799 | Ga0207702_10017313 | 3300026078 | Bacteria | 5962 |
| 800 | Ga0207702_10019757 | 3300026078 | Bacteria | 5578 |
| 801 | Ga0207702_10043132 | 3300026078 | Bacteria | 3786 |
| 802 | Ga0207702_10084995 | 3300026078 | Bacteria | 2756 |
| 803 | Ga0207641_10000115 | 3300026088 | Bacteria | 118497 |
| 804 | Ga0207641_10000138 | 3300026088 | Bacteria | 106531 |
| 805 | Ga0207641_10007958 | 3300026088 | Bacteria | 8783 |
| 806 | Ga0207641_10021529 | 3300026088 | Bacteria | 5298 |
| 807 | Ga0207641_10023493 | 3300026088 | Bacteria | 5078 |
| 808 | Ga0207641_10030122 | 3300026088 | Bacteria | 4493 |
| 809 | Ga0207641_10031155 | 3300026088 | Bacteria | 4422 |
| 810 | Ga0207641_10039934 | 3300026088 | Bacteria | 3926 |
| 811 | Ga0207641_10128784 | 3300026088 | Bacteria | 2270 |
| 812 | Ga0207648_10000088 | 3300026089 | Bacteria | 86596 |
| 813 | Ga0207648_10006357 | 3300026089 | Bacteria | 11746 |
| 814 | Ga0207648_10007110 | 3300026089 | Bacteria | 11043 |
| 815 | Ga0207648_10016876 | 3300026089 | Bacteria | 6657 |
| 816 | Ga0207648_10027000 | 3300026089 | Bacteria | 5099 |
| 817 | Ga0207648_10037362 | 3300026089 | Bacteria | 4277 |
| 818 | Ga0207648_10038815 | 3300026089 | Bacteria | 4190 |
| 819 | Ga0207648_10087335 | 3300026089 | Bacteria | 2722 |
| 820 | Ga0207676_10000071 | 3300026095 | Bacteria | 104095 |
| 821 | Ga0207676_10000245 | 3300026095 | Bacteria | 47297 |
| 822 | Ga0207676_10002838 | 3300026095 | Bacteria | 12331 |
| 823 | Ga0207676_10003364 | 3300026095 | Bacteria | 11313 |
| 824 | Ga0207676_10006133 | 3300026095 | Bacteria | 8486 |
| 825 | Ga0207676_10008157 | 3300026095 | Bacteria | 7449 |
| 826 | Ga0207676_10023132 | 3300026095 | Bacteria | 4579 |
| 827 | Ga0207676_10025219 | 3300026095 | Bacteria | 4411 |
| 828 | Ga0207676_10034569 | 3300026095 | Bacteria | 3828 |
| 829 | Ga0207676_10062812 | 3300026095 | Bacteria | 2947 |
| 830 | Ga0207676_10123456 | 3300026095 | Bacteria | 2188 |
| 831 | Ga0207676_10271828 | 3300026095 | Bacteria | 1535 |
| 832 | Ga0207674_10000065 | 3300026116 | Bacteria | 109485 |
| 833 | Ga0207674_10002644 | 3300026116 | Bacteria | 22388 |
| 834 | Ga0207674_10004380 | 3300026116 | Bacteria | 17015 |
| 835 | Ga0207674_10004467 | 3300026116 | Bacteria | 16817 |
| 836 | Ga0207674_10009197 | 3300026116 | Bacteria | 11325 |
| 837 | Ga0207674_10009547 | 3300026116 | Bacteria | 11069 |
| 838 | Ga0207674_10015599 | 3300026116 | Bacteria | 8342 |
| 839 | Ga0207674_10030869 | 3300026116 | Bacteria | 5632 |
| 840 | Ga0207674_10034986 | 3300026116 | Bacteria | 5245 |
| 841 | Ga0207674_10056446 | 3300026116 | Bacteria | 3988 |
| 842 | Ga0207674_10064174 | 3300026116 | Bacteria | 3705 |
| 843 | Ga0207674_10068536 | 3300026116 | Bacteria | 3570 |
| 844 | Ga0207674_10089067 | 3300026116 | Bacteria | 3079 |
| 845 | Ga0207674_10234697 | 3300026116 | Bacteria | 1782 |
| 846 | Ga0207675_100001970 | 3300026118 | Bacteria | 20462 |
| 847 | Ga0207675_100006756 | 3300026118 | Bacteria | 10851 |
| 848 | Ga0207675_100056247 | 3300026118 | Bacteria | 3669 |
| 849 | Ga0207675_100084588 | 3300026118 | Bacteria | 2977 |
| 850 | Ga0207675_100187429 | 3300026118 | Bacteria | 1983 |
| 851 | Ga0207683_10003574 | 3300026121 | Bacteria | 13560 |
| 852 | Ga0207683_10005286 | 3300026121 | Bacteria | 11078 |
| 853 | Ga0207683_10029343 | 3300026121 | Bacteria | 4762 |
| 854 | Ga0207698_10000701 | 3300026142 | Bacteria | 19473 |
| 855 | Ga0207698_10000788 | 3300026142 | Bacteria | 18477 |
| 856 | Ga0207698_10000985 | 3300026142 | Bacteria | 16510 |
| 857 | Ga0207698_10003393 | 3300026142 | Bacteria | 9589 |
| 858 | Ga0207698_10004864 | 3300026142 | Bacteria | 8233 |
| 859 | Ga0207698_10005578 | 3300026142 | Bacteria | 7784 |
| 860 | Ga0207698_10027671 | 3300026142 | Bacteria | 4029 |
| 861 | Ga0207698_10033398 | 3300026142 | Bacteria | 3739 |
| 862 | Ga0207698_10047308 | 3300026142 | Bacteria | 3257 |
| 863 | Ga0207698_10056097 | 3300026142 | Bacteria | 3040 |
| 864 | Ga0207698_10057552 | 3300026142 | Bacteria | 3008 |
| 865 | Ga0207698_10069464 | 3300026142 | Bacteria | 2786 |
| 866 | Ga0207698_10131788 | 3300026142 | Bacteria | 2137 |
| 867 | Ga0207428_10072926 | 3300027907 | Bacteria | 2694 |
| 868 | Ga0268266_10000332 | 3300028379 | Bacteria | 74181 |
| 869 | Ga0268266_10004925 | 3300028379 | Bacteria | 12651 |
| 870 | Ga0268266_10005388 | 3300028379 | Bacteria | 11942 |
| 871 | Ga0268266_10011599 | 3300028379 | Bacteria | 7650 |
| 872 | Ga0268266_10026708 | 3300028379 | Bacteria | 4912 |
| 873 | Ga0268266_10026832 | 3300028379 | Bacteria | 4901 |
| 874 | Ga0268266_10038203 | 3300028379 | Bacteria | 4088 |
| 875 | Ga0268266_10051672 | 3300028379 | Bacteria | 3528 |
| 876 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 877 | Ga0268265_10002150 | 3300028380 | Bacteria | 15263 |
| 878 | Ga0268265_10002289 | 3300028380 | Bacteria | 14577 |
| 879 | Ga0268265_10002345 | 3300028380 | Bacteria | 14358 |
| 880 | Ga0268265_10003839 | 3300028380 | Bacteria | 10635 |
| 881 | Ga0268265_10009036 | 3300028380 | Bacteria | 6739 |
| 882 | Ga0268265_10019559 | 3300028380 | Bacteria | 4709 |
| 883 | Ga0268265_10020542 | 3300028380 | Bacteria | 4609 |
| 884 | Ga0268265_10107865 | 3300028380 | Bacteria | 2265 |
| 885 | Ga0268265_10182277 | 3300028380 | Bacteria | 1805 |
| 886 | Ga0268264_10000089 | 3300028381 | Bacteria | 234760 |
| 887 | Ga0268264_10000644 | 3300028381 | Bacteria | 41159 |
| 888 | Ga0268264_10006587 | 3300028381 | Bacteria | 9771 |
| 889 | Ga0268264_10018719 | 3300028381 | Bacteria | 5663 |
| 890 | Ga0268264_10021969 | 3300028381 | Bacteria | 5207 |
| 891 | Ga0268264_10090476 | 3300028381 | Bacteria | 2637 |
| 892 | Ga0268264_10113947 | 3300028381 | Bacteria | 2373 |
| 893 | Ga0316178_1008507 | 3300030735 | Bacteria | 2073 |
| 894 | Ga0307408_100012733 | 3300031548 | Bacteria | 5577 |
| 895 | Ga0307408_100043916 | 3300031548 | Bacteria | 3182 |
| 896 | Ga0307408_100063622 | 3300031548 | Bacteria | 2699 |
| 897 | Ga0307408_100102477 | 3300031548 | Bacteria | 2183 |
| 898 | Ga0307408_100242400 | 3300031548 | Bacteria | 1482 |
| 899 | Ga0307508_10000126 | 3300031616 | Bacteria | 91143 |
| 900 | Ga0307405_10004269 | 3300031731 | Bacteria | 6728 |
| 901 | Ga0307405_10014276 | 3300031731 | Bacteria | 4266 |
| 902 | Ga0307405_10022975 | 3300031731 | Bacteria | 3535 |
| 903 | Ga0307405_10035433 | 3300031731 | Bacteria | 2980 |
| 904 | Ga0307405_10055462 | 3300031731 | Bacteria | 2480 |
| 905 | Ga0307405_10068191 | 3300031731 | Bacteria | 2275 |
| 906 | Ga0307405_10141754 | 3300031731 | Bacteria | 1677 |
| 907 | Ga0307413_10003122 | 3300031824 | Bacteria | 6901 |
| 908 | Ga0307413_10033488 | 3300031824 | Bacteria | 2926 |
| 909 | Ga0307413_10043258 | 3300031824 | Bacteria | 2653 |
| 910 | Ga0307413_10141471 | 3300031824 | Bacteria | 1663 |
| 911 | Ga0307410_10000196 | 3300031852 | Bacteria | 22538 |
| 912 | Ga0307410_10014899 | 3300031852 | Bacteria | 4593 |
| 913 | Ga0307410_10031915 | 3300031852 | Bacteria | 3384 |
| 914 | Ga0307410_10039852 | 3300031852 | Bacteria | 3087 |
| 915 | Ga0307410_10049658 | 3300031852 | Bacteria | 2817 |
| 916 | Ga0307410_10061889 | 3300031852 | Bacteria | 2562 |
| 917 | Ga0307410_10065729 | 3300031852 | Bacteria | 2495 |
| 918 | Ga0307410_10069626 | 3300031852 | Bacteria | 2434 |
| 919 | Ga0307406_10013772 | 3300031901 | Bacteria | 4640 |
| 920 | Ga0307406_10030657 | 3300031901 | Bacteria | 3267 |
| 921 | Ga0307406_10038025 | 3300031901 | Bacteria | 2977 |
| 922 | Ga0307406_10038519 | 3300031901 | Bacteria | 2959 |
| 923 | Ga0307406_10078199 | 3300031901 | Bacteria | 2190 |
| 924 | Ga0307406_10084185 | 3300031901 | Bacteria | 2123 |
| 925 | Ga0307406_10096102 | 3300031901 | Bacteria | 2006 |
| 926 | Ga0307406_10131883 | 3300031901 | Bacteria | 1755 |
| 927 | Ga0307406_10149722 | 3300031901 | Bacteria | 1663 |
| 928 | Ga0307407_10012482 | 3300031903 | Bacteria | 4084 |
| 929 | Ga0307412_10015961 | 3300031911 | Bacteria | 4462 |
| 930 | Ga0307412_10019902 | 3300031911 | Bacteria | 4074 |
| 931 | Ga0307412_10025925 | 3300031911 | Bacteria | 3637 |
| 932 | Ga0307412_10034747 | 3300031911 | Bacteria | 3215 |
| 933 | Ga0307409_100004899 | 3300031995 | Bacteria | 7614 |
| 934 | Ga0307409_100005795 | 3300031995 | Bacteria | 7166 |
| 935 | Ga0307409_100020912 | 3300031995 | Bacteria | 4473 |
| 936 | Ga0307409_100030212 | 3300031995 | Bacteria | 3890 |
| 937 | Ga0307409_100058264 | 3300031995 | Bacteria | 2999 |
| 938 | Ga0307409_100063628 | 3300031995 | Bacteria | 2893 |
| 939 | Ga0307409_100122965 | 3300031995 | Bacteria | 2202 |
| 940 | Ga0307409_100200913 | 3300031995 | Bacteria | 1783 |
| 941 | Ga0307409_100222891 | 3300031995 | Bacteria | 1703 |
| 942 | Ga0307416_100007621 | 3300032002 | Bacteria | 6906 |
| 943 | Ga0307416_100022623 | 3300032002 | Bacteria | 4541 |
| 944 | Ga0307414_10000550 | 3300032004 | Bacteria | 19583 |
| 945 | Ga0307414_10009672 | 3300032004 | Bacteria | 5551 |
| 946 | Ga0307414_10012159 | 3300032004 | Bacteria | 5078 |
| 947 | Ga0307414_10014505 | 3300032004 | Bacteria | 4727 |
| 948 | Ga0307414_10182197 | 3300032004 | Bacteria | 1690 |
| 949 | Ga0307411_10001878 | 3300032005 | Bacteria | 8950 |
| 950 | Ga0307411_10005963 | 3300032005 | Bacteria | 6054 |
| 951 | Ga0307411_10020177 | 3300032005 | Bacteria | 3869 |
| 952 | Ga0307411_10035032 | 3300032005 | Bacteria | 3129 |
| 953 | Ga0307411_10046502 | 3300032005 | Bacteria | 2798 |
| 954 | Ga0307411_10091027 | 3300032005 | Bacteria | 2129 |
| 955 | Ga0307411_10114641 | 3300032005 | Bacteria | 1937 |
| 956 | Ga0307411_10133241 | 3300032005 | Bacteria | 1819 |
| 957 | Ga0307415_100002988 | 3300032126 | Bacteria | 8502 |
| 958 | Ga0307415_100011414 | 3300032126 | Bacteria | 5083 |
| 959 | Ga0307415_100056829 | 3300032126 | Bacteria | 2685 |
| 960 | Ga0307415_100082537 | 3300032126 | Bacteria | 2300 |
| 961 | Ga0373955_0001400 | 3300035172 | Bacteria | 10266 |
| 962 | Ga0373931_0011146 | 3300035691 | Bacteria | 4338 |
| 963 | Ga0373935_0007844 | 3300035692 | Bacteria | 6402 |
| 964 | Ga0373935_0119924 | 3300035692 | Bacteria | 1756 |
| 965 | Ga0373937_0003288 | 3300036401 | Bacteria | 13564 |
| 966 | Ga0373925_0004938 | 3300037068 | Bacteria | 10027 |
| 967 | Ga0395899_0000113 | 3300037312 | Bacteria | 136163 |
| 968 | Ga0395899_0003120 | 3300037312 | Bacteria | 13202 |
| 969 | Ga0395899_0007898 | 3300037312 | Bacteria | 8195 |
| 970 | Ga0395899_0016688 | 3300037312 | Bacteria | 5598 |
| 971 | Ga0395899_0017080 | 3300037312 | Bacteria | 5528 |
| 972 | Ga0395899_0019273 | 3300037312 | Bacteria | 5184 |
| 973 | Ga0395899_0024928 | 3300037312 | Bacteria | 4517 |
| 974 | Ga0395899_0027196 | 3300037312 | Bacteria | 4313 |
| 975 | Ga0395899_0029122 | 3300037312 | Bacteria | 4152 |
| 976 | Ga0395899_0029502 | 3300037312 | Bacteria | 4126 |
| 977 | Ga0395899_0036867 | 3300037312 | Bacteria | 3667 |
| 978 | Ga0395899_0046810 | 3300037312 | Bacteria | 3221 |
| 979 | Ga0395899_0056088 | 3300037312 | Bacteria | 2912 |
| 980 | Ga0395899_0071140 | 3300037312 | Bacteria | 2546 |
| 981 | Ga0395899_0078417 | 3300037312 | Bacteria | 2407 |
| 982 | Ga0395899_0101022 | 3300037312 | Bacteria | 2082 |
| 983 | Ga0395900_0000365 | 3300037418 | Bacteria | 65054 |
| 984 | Ga0395900_0004188 | 3300037418 | Bacteria | 15315 |
| 985 | Ga0395900_0008210 | 3300037418 | Bacteria | 10747 |
| 986 | Ga0395900_0009559 | 3300037418 | Bacteria | 9940 |
| 987 | Ga0395900_0012564 | 3300037418 | Bacteria | 8664 |
| 988 | Ga0395900_0014673 | 3300037418 | Bacteria | 7992 |
| 989 | Ga0395900_0016111 | 3300037418 | Bacteria | 7614 |
| 990 | Ga0395900_0017358 | 3300037418 | Bacteria | 7347 |
| 991 | Ga0395900_0019504 | 3300037418 | Bacteria | 6913 |
| 992 | Ga0395900_0032817 | 3300037418 | Bacteria | 5341 |
| 993 | Ga0395900_0045715 | 3300037418 | Bacteria | 4509 |
| 994 | Ga0395900_0070692 | 3300037418 | Bacteria | 3588 |
| 995 | Ga0395900_0111004 | 3300037418 | Bacteria | 2816 |
| 996 | Ga0395900_0118870 | 3300037418 | Bacteria | 2712 |
| 997 | Ga0395900_0123342 | 3300037418 | Bacteria | 2657 |
| 998 | Ga0395900_0124036 | 3300037418 | Bacteria | 2649 |
| 999 | Ga0395900_0125049 | 3300037418 | Bacteria | 2637 |
| 1000 | Ga0395900_0132027 | 3300037418 | Bacteria | 2559 |
| 1001 | Ga0395900_0143930 | 3300037418 | Bacteria | 2439 |
| 1002 | Ga0395900_0157709 | 3300037418 | Bacteria | 2317 |
| 1003 | Ga0395900_0165823 | 3300037418 | Bacteria | 2251 |
| 1004 | Ga0395900_0168430 | 3300037418 | Bacteria | 2231 |
| 1005 | Ga0395900_0229543 | 3300037418 | Bacteria | 1867 |
| 1006 | Ga0395898_0000306 | 3300037466 | Bacteria | 115940 |
| 1007 | Ga0395898_0001326 | 3300037466 | Bacteria | 35892 |
| 1008 | Ga0395898_0002464 | 3300037466 | Bacteria | 21836 |
| 1009 | Ga0395898_0009109 | 3300037466 | Bacteria | 10455 |
| 1010 | Ga0395898_0009147 | 3300037466 | Bacteria | 10437 |
| 1011 | Ga0395898_0009764 | 3300037466 | Bacteria | 10057 |
| 1012 | Ga0395898_0018562 | 3300037466 | Bacteria | 7090 |
| 1013 | Ga0395898_0030913 | 3300037466 | Bacteria | 5356 |
| 1014 | Ga0395898_0073432 | 3300037466 | Bacteria | 3304 |
| 1015 | Ga0395898_0087582 | 3300037466 | Bacteria | 2999 |
| 1016 | Ga0395898_0126909 | 3300037466 | Bacteria | 2444 |
| 1017 | Ga0395898_0247220 | 3300037466 | Bacteria | 1701 |
| 1018 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 1019 | Ga0395905_0000793 | 3300037471 | Bacteria | 41518 |
| 1020 | Ga0395905_0000886 | 3300037471 | Bacteria | 39025 |
| 1021 | Ga0395905_0000958 | 3300037471 | Bacteria | 37063 |
| 1022 | Ga0395905_0002845 | 3300037471 | Bacteria | 18933 |
| 1023 | Ga0395905_0004516 | 3300037471 | Bacteria | 14418 |
| 1024 | Ga0395905_0006083 | 3300037471 | Bacteria | 12197 |
| 1025 | Ga0395905_0007674 | 3300037471 | Bacteria | 10705 |
| 1026 | Ga0395905_0008116 | 3300037471 | Bacteria | 10374 |
| 1027 | Ga0395905_0009274 | 3300037471 | Bacteria | 9626 |
| 1028 | Ga0395905_0010495 | 3300037471 | Bacteria | 9008 |
| 1029 | Ga0395905_0012159 | 3300037471 | Bacteria | 8290 |
| 1030 | Ga0395905_0020726 | 3300037471 | Bacteria | 6223 |
| 1031 | Ga0395905_0023572 | 3300037471 | Bacteria | 5815 |
| 1032 | Ga0395905_0024182 | 3300037471 | Bacteria | 5733 |
| 1033 | Ga0395905_0029421 | 3300037471 | Bacteria | 5175 |
| 1034 | Ga0395905_0032596 | 3300037471 | Bacteria | 4899 |
| 1035 | Ga0395905_0043384 | 3300037471 | Bacteria | 4219 |
| 1036 | Ga0395905_0044096 | 3300037471 | Bacteria | 4185 |
| 1037 | Ga0395905_0047990 | 3300037471 | Bacteria | 4001 |
| 1038 | Ga0395905_0050649 | 3300037471 | Bacteria | 3890 |
| 1039 | Ga0395905_0089254 | 3300037471 | Bacteria | 2889 |
| 1040 | Ga0395905_0092485 | 3300037471 | Bacteria | 2836 |
| 1041 | Ga0395905_0137911 | 3300037471 | Bacteria | 2295 |
| 1042 | Ga0395905_0162809 | 3300037471 | Bacteria | 2096 |
| 1043 | Ga0395905_0190055 | 3300037471 | Bacteria | 1926 |
| 1044 | Ga0395905_0210295 | 3300037471 | Bacteria | 1822 |
| 1045 | Ga0395905_0231069 | 3300037471 | Bacteria | 1729 |
| 1046 | Ga0395905_0271580 | 3300037471 | Bacteria | 1581 |
| 1047 | Ga0395905_0338660 | 3300037471 | Bacteria | 1395 |
| 1048 | Ga0436364_0512909 | 3300037853 | Bacteria | 13452 |
| 1049 | Ga0395901_0000589 | 3300038443 | Bacteria | 42319 |
| 1050 | Ga0395901_0000647 | 3300038443 | Bacteria | 40233 |
| 1051 | Ga0395901_0000988 | 3300038443 | Bacteria | 30688 |
| 1052 | Ga0395901_0001342 | 3300038443 | Bacteria | 25807 |
| 1053 | Ga0395901_0004930 | 3300038443 | Bacteria | 13470 |
| 1054 | Ga0395901_0005101 | 3300038443 | Bacteria | 13266 |
| 1055 | Ga0395901_0006716 | 3300038443 | Bacteria | 11626 |
| 1056 | Ga0395901_0017008 | 3300038443 | Bacteria | 7412 |
| 1057 | Ga0395901_0025684 | 3300038443 | Bacteria | 6047 |
| 1058 | Ga0395901_0029337 | 3300038443 | Bacteria | 5663 |
| 1059 | Ga0395901_0034057 | 3300038443 | Bacteria | 5259 |
| 1060 | Ga0395901_0037318 | 3300038443 | Bacteria | 5025 |
| 1061 | Ga0395901_0040667 | 3300038443 | Bacteria | 4816 |
| 1062 | Ga0395901_0042542 | 3300038443 | Bacteria | 4710 |
| 1063 | Ga0395901_0044056 | 3300038443 | Bacteria | 4628 |
| 1064 | Ga0395901_0047070 | 3300038443 | Bacteria | 4479 |
| 1065 | Ga0395901_0050961 | 3300038443 | Bacteria | 4301 |
| 1066 | Ga0395901_0053254 | 3300038443 | Bacteria | 4205 |
| 1067 | Ga0395901_0058928 | 3300038443 | Bacteria | 3994 |
| 1068 | Ga0395901_0062882 | 3300038443 | Bacteria | 3862 |
| 1069 | Ga0395901_0074852 | 3300038443 | Bacteria | 3532 |
| 1070 | Ga0395901_0118904 | 3300038443 | Bacteria | 2776 |
| 1071 | Ga0395901_0400834 | 3300038443 | Bacteria | 1409 |
| 1072 | Ga0436365_1036392 | 3300039437 | Bacteria | 7696 |
| 1073 | Ga0439437_003193 | 3300042000 | Bacteria | 1766 |
| 1074 | Ga0439445_0015536 | 3300042004 | Bacteria | 1865 |
| 1075 | Ga0439432_012800 | 3300042006 | Bacteria | 2861 |
| 1076 | Ga0450889_000018 | 3300042144 | Bacteria | 14192 |
| 1077 | Ga0439446_0031503 | 3300042156 | Bacteria | 1535 |
| 1078 | Ga0439458_0000959 | 3300042157 | Bacteria | 7429 |
| 1079 | Ga0439458_0006714 | 3300042157 | Bacteria | 2565 |
| 1080 | Ga0466969_0034940 | 3300044656 | Bacteria | 2545 |
| 1081 | Ga0466972_0016893 | 3300044658 | Bacteria | 3650 |
| 1082 | Ga0466966_0026090 | 3300044684 | Bacteria | 3815 |
| 1083 | Ga0466966_0040600 | 3300044684 | Bacteria | 2994 |
| 1084 | Ga0466966_0044210 | 3300044684 | Bacteria | 2852 |
| 1085 | Ga0466961_0021720 | 3300044693 | Bacteria | 4129 |
| 1086 | Ga0466961_0095042 | 3300044693 | Bacteria | 1880 |
| 1087 | Ga0466963_0009052 | 3300044694 | Bacteria | 5983 |
| 1088 | Ga0466963_0012160 | 3300044694 | Bacteria | 5261 |
| 1089 | Ga0466963_0036333 | 3300044694 | Bacteria | 3212 |
| 1090 | Ga0466963_0037658 | 3300044694 | Bacteria | 3160 |
| 1091 | Ga0466963_0090491 | 3300044694 | Bacteria | 2083 |
| 1092 | Ga0466964_0046727 | 3300044706 | Bacteria | 1765 |
| 1093 | Ga0466971_0083073 | 3300044719 | Bacteria | 1462 |
| 1094 | Ga0466968_0008164 | 3300044735 | Bacteria | 4003 |
| 1095 | Ga0466970_0003366 | 3300044765 | Bacteria | 7781 |
| 1096 | Ga0466970_0030289 | 3300044765 | Bacteria | 2853 |
| 1097 | Ga0466970_0073426 | 3300044765 | Bacteria | 1841 |
| 1098 | Ga0466957_0005837 | 3300044842 | Bacteria | 6931 |
| 1099 | Ga0466957_0005960 | 3300044842 | Bacteria | 6872 |
| 1100 | Ga0466957_0009323 | 3300044842 | Bacteria | 5600 |
| 1101 | Ga0466957_0106162 | 3300044842 | Bacteria | 1776 |
| 1102 | Ga0466959_0003226 | 3300045049 | Bacteria | 10610 |
| 1103 | Ga0466959_0167452 | 3300045049 | Bacteria | 1542 |
| 1104 | Ga0466958_0005124 | 3300045836 | Bacteria | 7005 |
| 1105 | Ga0466958_0011900 | 3300045836 | Bacteria | 4913 |
| 1106 | Ga0466958_0060356 | 3300045836 | Bacteria | 2308 |
| 1107 | Ga0466967_0003854 | 3300045976 | Bacteria | 9933 |
| 1108 | Ga0466967_0009691 | 3300045976 | Bacteria | 7168 |
| 1109 | Ga0466967_0012914 | 3300045976 | Bacteria | 6422 |
| 1110 | Ga0466967_0053133 | 3300045976 | Bacteria | 3560 |
| 1111 | Ga0466967_0054946 | 3300045976 | Bacteria | 3507 |
| 1112 | Ga0466967_0066457 | 3300045976 | Bacteria | 3213 |
| 1113 | Ga0466967_0214381 | 3300045976 | Bacteria | 1827 |
| 1114 | Ga0495585_0021091 | 3300046492 | Bacteria | 3742 |
| 1115 | Ga0495607_0002441 | 3300046501 | Bacteria | 15144 |
| 1116 | Ga0495637_0037293 | 3300046520 | Bacteria | 2111 |
| 1117 | Ga0495663_0023073 | 3300046525 | Bacteria | 1800 |
| 1118 | Ga0495642_0045250 | 3300046528 | Bacteria | 1799 |
| 1119 | Ga0495598_0013334 | 3300046537 | Bacteria | 2035 |
| 1120 | Ga0495621_0000067 | 3300046539 | Bacteria | 20406 |
| 1121 | Ga0495621_0006751 | 3300046539 | Bacteria | 3365 |
| 1122 | Ga0495621_0029415 | 3300046539 | Bacteria | 1873 |
| 1123 | Ga0495621_0043678 | 3300046539 | Bacteria | 1581 |
| 1124 | Ga0495621_0068227 | 3300046539 | Bacteria | 1304 |
| 1125 | Ga0495597_0007971 | 3300046542 | Bacteria | 5333 |
| 1126 | Ga0495668_0008525 | 3300046616 | Bacteria | 6383 |
| 1127 | Ga0495668_0071391 | 3300046616 | Bacteria | 1908 |
| 1128 | Ga0495668_0075428 | 3300046616 | Bacteria | 1852 |
| 1129 | Ga0495669_0002139 | 3300046684 | Bacteria | 8108 |
| 1130 | Ga0495669_0003874 | 3300046684 | Bacteria | 6155 |
| 1131 | Ga0495669_0004828 | 3300046684 | Bacteria | 5593 |
| 1132 | Ga0495670_0001717 | 3300046691 | Bacteria | 10783 |
| 1133 | Ga0495670_0013921 | 3300046691 | Bacteria | 3957 |
| 1134 | Ga0495671_0011659 | 3300046692 | Bacteria | 4824 |
| 1135 | Ga0495686_0000323 | 3300047472 | Bacteria | 79635 |
| 1136 | Ga0496100_0004354 | 3300048903 | Bacteria | 7497 |
| 1137 | Ga0496101_0003296 | 3300048904 | Bacteria | 10044 |
| 1138 | Ga0496101_0004146 | 3300048904 | Bacteria | 9079 |
| 1139 | Ga0496101_0075177 | 3300048904 | Bacteria | 2486 |
| 1140 | Ga0496101_0097464 | 3300048904 | Bacteria | 2196 |
| 1141 | Ga0496102_0020505 | 3300048905 | Bacteria | 5841 |
| 1142 | Ga0496102_0043391 | 3300048905 | Bacteria | 4078 |
| 1143 | Ga0496102_0071241 | 3300048905 | Bacteria | 3191 |
| 1144 | Ga0496103_0010484 | 3300048906 | Bacteria | 5485 |
| 1145 | Ga0496103_0053704 | 3300048906 | Bacteria | 2497 |
| 1146 | Ga0496104_0071008 | 3300048907 | Bacteria | 3311 |
| 1147 | Ga0496104_0077669 | 3300048907 | Bacteria | 3163 |
| 1148 | Ga0496104_0156051 | 3300048907 | Bacteria | 2190 |
| 1149 | Ga0496105_0007221 | 3300048908 | Bacteria | 8579 |
| 1150 | Ga0496105_0027136 | 3300048908 | Bacteria | 4675 |
| 1151 | Ga0496107_0001984 | 3300048910 | Bacteria | 13030 |
| 1152 | Ga0496107_0002320 | 3300048910 | Bacteria | 12289 |
| 1153 | Ga0496107_0010084 | 3300048910 | Bacteria | 6553 |
| 1154 | Ga0496108_0000946 | 3300048911 | Bacteria | 22575 |
| 1155 | Ga0496108_0003253 | 3300048911 | Bacteria | 13057 |
| 1156 | Ga0496108_0008368 | 3300048911 | Bacteria | 8392 |
| 1157 | Ga0496108_0015004 | 3300048911 | Bacteria | 6324 |
| 1158 | Ga0496109_0014987 | 3300048912 | Bacteria | 6747 |
| 1159 | Ga0496109_0015922 | 3300048912 | Bacteria | 6567 |
| 1160 | Ga0496109_0017156 | 3300048912 | Bacteria | 6339 |
| 1161 | Ga0496109_0019073 | 3300048912 | Bacteria | 6039 |
| 1162 | Ga0496109_0049473 | 3300048912 | Bacteria | 3826 |
| 1163 | Ga0496109_0161827 | 3300048912 | Bacteria | 2097 |
| 1164 | Ga0496110_0003761 | 3300048913 | Bacteria | 11691 |
| 1165 | Ga0496110_0028524 | 3300048913 | Bacteria | 4795 |
| 1166 | Ga0496110_0048552 | 3300048913 | Bacteria | 3721 |
| 1167 | Ga0496110_0083936 | 3300048913 | Bacteria | 2842 |
| 1168 | Ga0496111_0002605 | 3300048914 | Bacteria | 10918 |
| 1169 | Ga0496111_0006647 | 3300048914 | Bacteria | 7523 |
| 1170 | Ga0496111_0012157 | 3300048914 | Bacteria | 5822 |
| 1171 | Ga0496111_0017519 | 3300048914 | Bacteria | 4953 |
| 1172 | Ga0496112_0004475 | 3300048915 | Bacteria | 11855 |
| 1173 | Ga0496112_0015539 | 3300048915 | Bacteria | 7108 |
| 1174 | Ga0496112_0021838 | 3300048915 | Bacteria | 6090 |
| 1175 | Ga0496112_0026334 | 3300048915 | Bacteria | 5593 |
| 1176 | Ga0496112_0030327 | 3300048915 | Bacteria | 5232 |
| 1177 | Ga0496112_0032803 | 3300048915 | Bacteria | 5042 |
| 1178 | Ga0496112_0050656 | 3300048915 | Bacteria | 4073 |
| 1179 | Ga0496112_0113941 | 3300048915 | Bacteria | 2675 |
| 1180 | Ga0496113_0001095 | 3300048916 | Bacteria | 14658 |
| 1181 | Ga0496113_0004673 | 3300048916 | Bacteria | 8451 |
| 1182 | Ga0496113_0018811 | 3300048916 | Bacteria | 4818 |
| 1183 | Ga0496113_0028721 | 3300048916 | Bacteria | 4004 |
| 1184 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 1185 | Ga0496115_0001032 | 3300048918 | Bacteria | 20227 |
| 1186 | Ga0496121_0000319 | 3300048924 | Bacteria | 100692 |
| 1187 | Ga0496121_0003131 | 3300048924 | Bacteria | 23873 |
| 1188 | Ga0501043_0008649 | 3300049579 | Bacteria | 8023 |
| 1189 | Ga0501046_0121411 | 3300049580 | Bacteria | 1988 |
| 1190 | Ga0501047_0002258 | 3300049581 | Bacteria | 18443 |
| 1191 | Ga0501073_0145052 | 3300049589 | Bacteria | 1645 |
| 1192 | Ga0501202_009672 | 3300049652 | Bacteria | 1778 |
| 1193 | Ga0501216_002908 | 3300049660 | Bacteria | 2465 |
| 1194 | Ga0501230_005126 | 3300049667 | Bacteria | 1837 |
| 1195 | Ga0501233_007707 | 3300049668 | Bacteria | 2056 |
| 1196 | Ga0501249_012673 | 3300049679 | Bacteria | 1784 |
| 1197 | Ga0501249_013096 | 3300049679 | Bacteria | 1759 |
| 1198 | Ga0501257_013806 | 3300049686 | Bacteria | 1854 |
| 1199 | Ga0501221_008054 | 3300049704 | Bacteria | 1824 |
| 1200 | Ga0501225_0022125 | 3300049705 | Bacteria | 1755 |
| 1201 | Ga0501044_0069133 | 3300049823 | Bacteria | 3596 |
| 1202 | nmdc:mga09592_123032_c1 | 3300050508 | Bacteria | 2229 |
| 1203 | nmdc:mga06r32_15032_c1 | 3300050510 | Bacteria | 7027 |
| 1204 | nmdc:mga08y16_231545_c1 | 3300050511 | Bacteria | 1911 |
| 1205 | nmdc:mga08y16_43971_c1 | 3300050511 | Bacteria | 4680 |
| 1206 | Ga0495612_0012597 | 3300053078 | Bacteria | 3409 |
| 1207 | Ga0500643_001588 | 3300053087 | Bacteria | 12854 |
| 1208 | Ga0500647_0041597 | 3300053091 | Bacteria | 2205 |
| 1209 | Ga0500594_0005423 | 3300053118 | Bacteria | 2830 |
| 1210 | Ga0500614_005071 | 3300053123 | Bacteria | 2767 |
| 1211 | Ga0500655_000355 | 3300053133 | Bacteria | 9945 |
| 1212 | Ga0500658_0000022 | 3300053134 | Bacteria | 129341 |
| 1213 | Ga0500559_0009170 | 3300053136 | Bacteria | 4296 |
| 1214 | Ga0500590_001560 | 3300053148 | Bacteria | 9529 |
| 1215 | Ga0500639_011183 | 3300053163 | Bacteria | 4707 |
| 1216 | Ga0500636_0082786 | 3300053177 | Bacteria | 1847 |
| 1217 | Ga0500570_001325 | 3300053724 | Bacteria | 11287 |
| 1218 | Ga0466962_0015068 | 3300061719 | Bacteria | 3727 |
| 1219 | 2585262161 | 2582581305 | Bacteria | 4895574 |
| 1220 | 2600202315 | 2599185354 | Bacteria | 4398675 |
| 1221 | 2643726983 | 2643221541 | Bacteria | 5498788 |
| 1222 | 2644040459 | 2643221605 | Bacteria | 4772303 |
| 1223 | 2644045976 | 2643221606 | Bacteria | 5588032 |
| 1224 | 2644393213 | 2643221671 | Bacteria | 5496681 |
| 1225 | 2753766074 | 2751185897 | Bacteria | 5322941 |
| 1226 | 2885428913 | 2885427238 | Bacteria | 2291351 |
| 1227 | 2885432576 | 2885429604 | Bacteria | 3642894 |
| 1228 | 2896431354 | 2896429255 | Bacteria | 2557483 |
| 1229 | 2928029070 | 2928027323 | Bacteria | 4382488 |
| 1230 | 2984556031 | 2984555340 | Bacteria | 4247089 |
| 1231 | 2984565862 | 2984564862 | Bacteria | 4339992 |
| 1232 | 2993356872 | 2993356040 | Bacteria | 4247105 |
| 1233 | JGI24741J21665_1006087 | |||
| 1234 | JGI24736J21556_1003968 | |||
| 1235 | JGI24741J21665_1008603 | |||
| 1236 | JGI24740J21852_10000927 | |||
| 1237 | JGI24740J21852_10001189 | |||
| 1238 | JGI24740J21852_10001263 | |||
| 1239 | JGI24740J21852_10001800 | |||
| 1240 | JGI24740J21852_10014355 | |||
| 1241 | JGI24740J21852_10018268 | |||
| 1242 | JGI24739J22299_10001567 | |||
| 1243 | JGI24739J22299_10003804 | |||
| 1244 | JGI24739J22299_10012475 | |||
| 1245 | JGI24737J22298_10000009 | |||
| 1246 | JGI24737J22298_10002710 | |||
| 1247 | JGI24737J22298_10003580 | |||
| 1248 | JGI24737J22298_10025723 | |||
| 1249 | JGI24743J22301_10000629 | |||
| 1250 | JGI24743J22301_10001193 | |||
| 1251 | JGI24735J21928_10003960 | |||
| 1252 | JGI24735J21928_10005379 | |||
| 1253 | JGI24735J21928_10019115 | |||
| 1254 | JGI24748J21848_1002691 | |||
| 1255 | JGI24738J21930_10000008 | |||
| 1256 | JGI24738J21930_10000903 | |||
| 1257 | JGI24738J21930_10004882 | |||
| 1258 | JGI24749J21850_1001519 | |||
| 1259 | JGI24744J21845_10000141 | |||
| 1260 | JGI24751J29686_10000224 | |||
| 1261 | JGI25165J46597_1000071 | |||
| 1262 | Ga0065715_10022832 | |||
| 1263 | Ga0065715_10025490 | |||
| 1264 | Ga0065715_10110992 | |||
| 1265 | Ga0065707_10100179 | |||
| 1266 | Ga0070658_10000216 | |||
| 1267 | Ga0070658_10012639 | |||
| 1268 | Ga0070658_10015071 | |||
| 1269 | Ga0070658_10019319 | |||
| 1270 | Ga0070658_10019384 | |||
| 1271 | Ga0070658_10023479 | |||
| 1272 | Ga0070658_10024170 | |||
| 1273 | Ga0070658_10027449 | |||
| 1274 | Ga0070658_10027839 | |||
| 1275 | Ga0070658_10049499 | |||
| 1276 | Ga0070658_10095899 | |||
| 1277 | Ga0070676_10004565 | |||
| 1278 | Ga0070676_10016885 | |||
| 1279 | Ga0070683_100000646 | |||
| 1280 | Ga0070683_100013737 | |||
| 1281 | Ga0070683_100022790 | |||
| 1282 | Ga0070683_100055685 | |||
| 1283 | Ga0070690_100006006 | |||
| 1284 | Ga0070690_100028084 | |||
| 1285 | Ga0070690_100102055 | |||
| 1286 | Ga0070670_100000069 | |||
| 1287 | Ga0070670_100001019 | |||
| 1288 | Ga0070670_100002391 | |||
| 1289 | Ga0070670_100007469 | |||
| 1290 | Ga0070670_100007705 | |||
| 1291 | Ga0070670_100010185 | |||
| 1292 | Ga0070670_100011249 | |||
| 1293 | Ga0070670_100029796 | |||
| 1294 | Ga0070670_100035495 | |||
| 1295 | Ga0070670_100038151 | |||
| 1296 | Ga0070677_10001871 | |||
| 1297 | Ga0068869_100000682 | |||
| 1298 | Ga0068869_100071253 | |||
| 1299 | Ga0070666_10000693 | |||
| 1300 | Ga0070666_10000884 | |||
| 1301 | Ga0070666_10032931 | |||
| 1302 | Ga0070680_100002395 | |||
| 1303 | Ga0070680_100007267 | |||
| 1304 | Ga0070680_100011270 | |||
| 1305 | Ga0070680_100038995 | |||
| 1306 | Ga0070682_100001991 | |||
| 1307 | Ga0070682_100023692 | |||
| 1308 | Ga0070682_100113916 | |||
| 1309 | Ga0068868_100001982 | |||
| 1310 | Ga0068868_100002627 | |||
| 1311 | Ga0068868_100040265 | |||
| 1312 | Ga0070660_100000250 | |||
| 1313 | Ga0070660_100004492 | |||
| 1314 | Ga0070660_100006146 | |||
| 1315 | Ga0070660_100011977 | |||
| 1316 | Ga0070660_100015407 | |||
| 1317 | Ga0070660_100017761 | |||
| 1318 | Ga0070660_100019076 | |||
| 1319 | Ga0070660_100024759 | |||
| 1320 | Ga0070660_100032717 | |||
| 1321 | Ga0070660_100037586 | |||
| 1322 | Ga0070660_100040869 | |||
| 1323 | Ga0070660_100044133 | |||
| 1324 | Ga0070660_100057377 | |||
| 1325 | Ga0070660_100067904 | |||
| 1326 | Ga0070660_100122387 | |||
| 1327 | Ga0070660_100126353 | |||
| 1328 | Ga0070660_100150720 | |||
| 1329 | Ga0070661_100001054 | |||
| 1330 | Ga0070661_100003112 | |||
| 1331 | Ga0070661_100003236 | |||
| 1332 | Ga0070661_100003585 | |||
| 1333 | Ga0070661_100007914 | |||
| 1334 | Ga0070661_100014629 | |||
| 1335 | Ga0070661_100017757 | |||
| 1336 | Ga0070661_100019951 | |||
| 1337 | Ga0070661_100033185 | |||
| 1338 | Ga0070661_100050044 | |||
| 1339 | Ga0070661_100050521 | |||
| 1340 | Ga0070661_100081534 | |||
| 1341 | Ga0070661_100113712 | |||
| 1342 | Ga0070692_10010120 | |||
| 1343 | Ga0070668_100000015 | |||
| 1344 | Ga0070668_100000324 | |||
| 1345 | Ga0070668_100004919 | |||
| 1346 | Ga0070668_100004964 | |||
| 1347 | Ga0070668_100081744 | |||
| 1348 | Ga0070668_100103118 | |||
| 1349 | Ga0070669_100000105 | |||
| 1350 | Ga0070669_100000128 | |||
| 1351 | Ga0070669_100001383 | |||
| 1352 | Ga0070669_100023566 | |||
| 1353 | Ga0070669_100044334 | |||
| 1354 | Ga0070669_100046214 | |||
| 1355 | Ga0070675_100001581 | |||
| 1356 | Ga0070675_100008335 | |||
| 1357 | Ga0070675_100019332 | |||
| 1358 | Ga0070671_100000247 | |||
| 1359 | Ga0070671_100001057 | |||
| 1360 | Ga0070671_100001903 | |||
| 1361 | Ga0070671_100004394 | |||
| 1362 | Ga0070671_100005300 | |||
| 1363 | Ga0070671_100007225 | |||
| 1364 | Ga0070671_100007523 | |||
| 1365 | Ga0070671_100007827 | |||
| 1366 | Ga0070671_100009536 | |||
| 1367 | Ga0070671_100021226 | |||
| 1368 | Ga0070671_100021586 | |||
| 1369 | Ga0070671_100029626 | |||
| 1370 | Ga0070671_100030377 | |||
| 1371 | Ga0070671_100040392 | |||
| 1372 | Ga0070671_100041609 | |||
| 1373 | Ga0070671_100078873 | |||
| 1374 | Ga0070671_100140273 | |||
| 1375 | Ga0070671_100252564 | |||
| 1376 | Ga0070674_100016533 | |||
| 1377 | Ga0070674_100021244 | |||
| 1378 | Ga0070674_100073676 | |||
| 1379 | Ga0070673_100000204 | |||
| 1380 | Ga0070673_100000590 | |||
| 1381 | Ga0070673_100004070 | |||
| 1382 | Ga0070673_100006278 | |||
| 1383 | Ga0070673_100014748 | |||
| 1384 | Ga0070673_100036630 | |||
| 1385 | Ga0070673_100044398 | |||
| 1386 | Ga0070673_100095019 | |||
| 1387 | Ga0070659_100000086 | |||
| 1388 | Ga0070659_100006587 | |||
| 1389 | Ga0070659_100013059 | |||
| 1390 | Ga0070659_100014971 | |||
| 1391 | Ga0070659_100017011 | |||
| 1392 | Ga0070659_100018067 | |||
| 1393 | Ga0070659_100018589 | |||
| 1394 | Ga0070659_100021833 | |||
| 1395 | Ga0070659_100023101 | |||
| 1396 | Ga0070659_100023963 | |||
| 1397 | Ga0070659_100030394 | |||
| 1398 | Ga0070659_100046010 | |||
| 1399 | Ga0070659_100057300 | |||
| 1400 | Ga0070659_100107184 | |||
| 1401 | Ga0070667_100000017 | |||
| 1402 | Ga0070667_100001539 | |||
| 1403 | Ga0070667_100001793 | |||
| 1404 | Ga0070667_100004350 | |||
| 1405 | Ga0070667_100005340 | |||
| 1406 | Ga0070667_100007452 | |||
| 1407 | Ga0070667_100010364 | |||
| 1408 | Ga0070667_100013709 | |||
| 1409 | Ga0070667_100030024 | |||
| 1410 | Ga0070667_100041572 | |||
| 1411 | Ga0070667_100043677 | |||
| 1412 | Ga0070667_100046554 | |||
| 1413 | Ga0070667_100058499 | |||
| 1414 | Ga0070667_100211550 | |||
| 1415 | Ga0070714_100031716 | |||
| 1416 | Ga0070714_100060591 | |||
| 1417 | Ga0070714_100203485 | |||
| 1418 | Ga0070713_100003021 | |||
| 1419 | Ga0070713_100013750 | |||
| 1420 | Ga0070663_100003483 | |||
| 1421 | Ga0070663_100016740 | |||
| 1422 | Ga0070663_100037899 | |||
| 1423 | Ga0070663_100074038 | |||
| 1424 | Ga0070663_100089051 | |||
| 1425 | Ga0070678_100013101 | |||
| 1426 | Ga0070678_100050898 | |||
| 1427 | Ga0070678_100059215 | |||
| 1428 | Ga0070662_100000082 | |||
| 1429 | Ga0070662_100000287 | |||
| 1430 | Ga0070662_100002026 | |||
| 1431 | Ga0070662_100009542 | |||
| 1432 | Ga0070662_100011887 | |||
| 1433 | Ga0070662_100020460 | |||
| 1434 | Ga0070662_100024689 | |||
| 1435 | Ga0070662_100026880 | |||
| 1436 | Ga0070662_100029073 | |||
| 1437 | Ga0070662_100037083 | |||
| 1438 | Ga0070662_100174891 | |||
| 1439 | Ga0070681_10012374 | |||
| 1440 | Ga0070681_10014887 | |||
| 1441 | Ga0070681_10113814 | |||
| 1442 | Ga0070681_10180918 | |||
| 1443 | Ga0068867_100000045 | |||
| 1444 | Ga0068867_100003377 | |||
| 1445 | Ga0068867_100015007 | |||
| 1446 | Ga0068867_100018334 | |||
| 1447 | Ga0068867_100019003 | |||
| 1448 | Ga0068867_100020790 | |||
| 1449 | Ga0068867_100067164 | |||
| 1450 | Ga0068867_100147944 | |||
| 1451 | Ga0070679_100015808 | |||
| 1452 | Ga0070679_100020657 | |||
| 1453 | Ga0070679_100025380 | |||
| 1454 | Ga0070679_100069452 | |||
| 1455 | Ga0070679_100105752 | |||
| 1456 | Ga0070684_100002928 | |||
| 1457 | Ga0070684_100006344 | |||
| 1458 | Ga0070684_100010464 | |||
| 1459 | Ga0070684_100021814 | |||
| 1460 | Ga0070684_100196347 | |||
| 1461 | Ga0068853_100000151 | |||
| 1462 | Ga0068853_100000162 | |||
| 1463 | Ga0068853_100009683 | |||
| 1464 | Ga0068853_100014738 | |||
| 1465 | Ga0068853_100023556 | |||
| 1466 | Ga0068853_100024862 | |||
| 1467 | Ga0068853_100051655 | |||
| 1468 | Ga0070672_100000041 | |||
| 1469 | Ga0070672_100001502 | |||
| 1470 | Ga0070672_100004463 | |||
| 1471 | Ga0070672_100009120 | |||
| 1472 | Ga0070672_100039229 | |||
| 1473 | Ga0070672_100040941 | |||
| 1474 | Ga0070686_100038761 | |||
| 1475 | Ga0070696_100005700 | |||
| 1476 | Ga0070696_100017850 | |||
| 1477 | Ga0070693_100001450 | |||
| 1478 | Ga0070693_100011985 | |||
| 1479 | Ga0070693_100017906 | |||
| 1480 | Ga0070665_100000670 | |||
| 1481 | Ga0070665_100002033 | |||
| 1482 | Ga0070665_100005768 | |||
| 1483 | Ga0070665_100026211 | |||
| 1484 | Ga0070665_100058238 | |||
| 1485 | Ga0070665_100101401 | |||
| 1486 | Ga0070665_100149292 | |||
| 1487 | Ga0068855_100000742 | |||
| 1488 | Ga0068855_100018216 | |||
| 1489 | Ga0068855_100023878 | |||
| 1490 | Ga0068855_100025338 | |||
| 1491 | Ga0068855_100097713 | |||
| 1492 | Ga0068855_100104893 | |||
| 1493 | Ga0068855_100144783 | |||
| 1494 | Ga0068855_100150977 | |||
| 1495 | Ga0068855_100230041 | |||
| 1496 | Ga0070664_100000113 | |||
| 1497 | Ga0070664_100001064 | |||
| 1498 | Ga0070664_100002825 | |||
| 1499 | Ga0070664_100003970 | |||
| 1500 | Ga0070664_100009109 | |||
| 1501 | Ga0070664_100011044 | |||
| 1502 | Ga0070664_100016775 | |||
| 1503 | Ga0070664_100021362 | |||
| 1504 | Ga0070664_100027914 | |||
| 1505 | Ga0070664_100078203 | |||
| 1506 | Ga0068857_100001542 | |||
| 1507 | Ga0068857_100008535 | |||
| 1508 | Ga0068857_100008558 | |||
| 1509 | Ga0068857_100009896 | |||
| 1510 | Ga0068857_100015197 | |||
| 1511 | Ga0068857_100020339 | |||
| 1512 | Ga0068857_100022916 | |||
| 1513 | Ga0068857_100038155 | |||
| 1514 | Ga0068857_100096943 | |||
| 1515 | Ga0068854_100000542 | |||
| 1516 | Ga0068854_100001932 | |||
| 1517 | Ga0068854_100005841 | |||
| 1518 | Ga0068854_100007038 | |||
| 1519 | Ga0068854_100008980 | |||
| 1520 | Ga0068854_100042581 | |||
| 1521 | Ga0068854_100061529 | |||
| 1522 | Ga0068854_100072161 | |||
| 1523 | Ga0068856_100000159 | |||
| 1524 | Ga0068856_100029169 | |||
| 1525 | Ga0068856_100074129 | |||
| 1526 | Ga0068856_100096782 | |||
| 1527 | Ga0068856_100207352 | |||
| 1528 | Ga0068856_100221472 | |||
| 1529 | Ga0068852_100001609 | |||
| 1530 | Ga0068852_100001650 | |||
| 1531 | Ga0068852_100001814 | |||
| 1532 | Ga0068852_100002219 | |||
| 1533 | Ga0068852_100002795 | |||
| 1534 | Ga0068852_100006345 | |||
| 1535 | Ga0068852_100007134 | |||
| 1536 | Ga0068852_100010580 | |||
| 1537 | Ga0068852_100020995 | |||
| 1538 | Ga0068852_100021738 | |||
| 1539 | Ga0068852_100025430 | |||
| 1540 | Ga0068852_100026465 | |||
| 1541 | Ga0068859_100000088 | |||
| 1542 | Ga0068859_100004053 | |||
| 1543 | Ga0068859_100004551 | |||
| 1544 | Ga0068859_100008428 | |||
| 1545 | Ga0068859_100011079 | |||
| 1546 | Ga0068859_100014660 | |||
| 1547 | Ga0068859_100018006 | |||
| 1548 | Ga0068859_100041650 | |||
| 1549 | Ga0068859_100072008 | |||
| 1550 | Ga0068859_100106176 | |||
| 1551 | Ga0068859_100255522 | |||
| 1552 | Ga0068864_100000047 | |||
| 1553 | Ga0068864_100000079 | |||
| 1554 | Ga0068864_100000136 | |||
| 1555 | Ga0068864_100001503 | |||
| 1556 | Ga0068864_100002002 | |||
| 1557 | Ga0068864_100004809 | |||
| 1558 | Ga0068864_100006405 | |||
| 1559 | Ga0068864_100020446 | |||
| 1560 | Ga0068864_100058935 | |||
| 1561 | Ga0068864_100061173 | |||
| 1562 | Ga0068864_100083533 | |||
| 1563 | Ga0068864_100127424 | |||
| 1564 | Ga0068864_100183765 | |||
| 1565 | Ga0068866_10003876 | |||
| 1566 | Ga0068866_10004832 | |||
| 1567 | Ga0068866_10004933 | |||
| 1568 | Ga0068861_100004950 | |||
| 1569 | Ga0068861_100012530 | |||
| 1570 | Ga0068861_100059987 | |||
| 1571 | Ga0068851_10002427 | |||
| 1572 | Ga0068851_10008521 | |||
| 1573 | Ga0068851_10009986 | |||
| 1574 | Ga0068851_10012686 | |||
| 1575 | Ga0068851_10017180 | |||
| 1576 | Ga0068851_10052314 | |||
| 1577 | Ga0068851_10053316 | |||
| 1578 | Ga0068870_10027095 | |||
| 1579 | Ga0068863_100000289 | |||
| 1580 | Ga0068863_100001560 | |||
| 1581 | Ga0068863_100003406 | |||
| 1582 | Ga0068863_100005004 | |||
| 1583 | Ga0068863_100009191 | |||
| 1584 | Ga0068863_100009866 | |||
| 1585 | Ga0068863_100108263 | |||
| 1586 | Ga0068863_100168842 | |||
| 1587 | Ga0068858_100000063 | |||
| 1588 | Ga0068858_100000093 | |||
| 1589 | Ga0068858_100000303 | |||
| 1590 | Ga0068858_100000631 | |||
| 1591 | Ga0068858_100000855 | |||
| 1592 | Ga0068858_100009554 | |||
| 1593 | Ga0068858_100013046 | |||
| 1594 | Ga0068858_100015178 | |||
| 1595 | Ga0068858_100020829 | |||
| 1596 | Ga0068858_100082795 | |||
| 1597 | Ga0068858_100112515 | |||
| 1598 | Ga0068860_100000056 | |||
| 1599 | Ga0068860_100005063 | |||
| 1600 | Ga0068860_100006008 | |||
| 1601 | Ga0068860_100019484 | |||
| 1602 | Ga0068860_100027709 | |||
| 1603 | Ga0068860_100036953 | |||
| 1604 | Ga0068860_100142572 | |||
| 1605 | Ga0068862_100000033 | |||
| 1606 | Ga0068862_100000108 | |||
| 1607 | Ga0068862_100002790 | |||
| 1608 | Ga0068862_100002942 | |||
| 1609 | Ga0068862_100008241 | |||
| 1610 | Ga0068862_100024321 | |||
| 1611 | Ga0068862_100088529 | |||
| 1612 | Ga0070717_10142196 | |||
| 1613 | Ga0070717_10150657 | |||
| 1614 | Ga0075366_10011282 | |||
| 1615 | Ga0097621_100025055 | |||
| 1616 | Ga0097621_100106120 | |||
| 1617 | Ga0097621_100129764 | |||
| 1618 | Ga0068871_100003697 | |||
| 1619 | Ga0068871_100019814 | |||
| 1620 | Ga0068871_100021709 | |||
| 1621 | Ga0068871_100060412 | |||
| 1622 | Ga0075428_100062026 | |||
| 1623 | Ga0075433_10118970 | |||
| 1624 | Ga0075429_100116883 | |||
| 1625 | Ga0068865_100000528 | |||
| 1626 | Ga0068865_100014020 | |||
| 1627 | Ga0068865_100066333 | |||
| 1628 | Ga0097620_100000088 | |||
| 1629 | Ga0097620_100004053 | |||
| 1630 | Ga0097620_100004551 | |||
| 1631 | Ga0097620_100008428 | |||
| 1632 | Ga0097620_100011079 | |||
| 1633 | Ga0097620_100014661 | |||
| 1634 | Ga0097620_100018006 | |||
| 1635 | Ga0097620_100041649 | |||
| 1636 | Ga0097620_100072004 | |||
| 1637 | Ga0097620_100106179 | |||
| 1638 | Ga0097620_100255538 | |||
| 1639 | Ga0075435_100091950 | |||
| 1640 | Ga0105240_10018703 | |||
| 1641 | Ga0105240_10026437 | |||
| 1642 | Ga0105240_10273672 | |||
| 1643 | Ga0111539_10037205 | |||
| 1644 | Ga0111539_10119199 | |||
| 1645 | Ga0105245_10000062 | |||
| 1646 | Ga0105245_10002634 | |||
| 1647 | Ga0105245_10020038 | |||
| 1648 | Ga0105245_10031755 | |||
| 1649 | Ga0105247_10012951 | |||
| 1650 | Ga0105243_10013997 | |||
| 1651 | Ga0105243_10224513 | |||
| 1652 | Ga0105241_10040270 | |||
| 1653 | Ga0105241_10266871 | |||
| 1654 | Ga0105242_10151822 | |||
| 1655 | Ga0105248_10000122 | |||
| 1656 | Ga0105248_10000169 | |||
| 1657 | Ga0105248_10000213 | |||
| 1658 | Ga0105248_10000620 | |||
| 1659 | Ga0105248_10001030 | |||
| 1660 | Ga0105248_10003373 | |||
| 1661 | Ga0105248_10003561 | |||
| 1662 | Ga0105248_10023443 | |||
| 1663 | Ga0105248_10039564 | |||
| 1664 | Ga0105248_10039913 | |||
| 1665 | Ga0105248_10047045 | |||
| 1666 | Ga0105248_10048977 | |||
| 1667 | Ga0105248_10056890 | |||
| 1668 | Ga0105248_10105910 | |||
| 1669 | Ga0105248_10156006 | |||
| 1670 | Ga0105248_10194631 | |||
| 1671 | Ga0105237_10010306 | |||
| 1672 | Ga0105237_10030124 | |||
| 1673 | Ga0105237_10191717 | |||
| 1674 | Ga0105238_10044299 | |||
| 1675 | Ga0105238_10066032 | |||
| 1676 | Ga0105238_10228564 | |||
| 1677 | Ga0105249_10005571 | |||
| 1678 | Ga0105249_10014232 | |||
| 1679 | Ga0105249_10177022 | |||
| 1680 | Ga0105239_10000105 | |||
| 1681 | Ga0105239_10028175 | |||
| 1682 | Ga0105246_10037660 | |||
| 1683 | Ga0105246_10163238 | |||
| 1684 | Ga0157326_1001213 | |||
| 1685 | Ga0157373_10012015 | |||
| 1686 | Ga0157373_10014353 | |||
| 1687 | Ga0157373_10115653 | |||
| 1688 | Ga0157371_10000144 | |||
| 1689 | Ga0157371_10001522 | |||
| 1690 | Ga0157371_10004858 | |||
| 1691 | Ga0157371_10022967 | |||
| 1692 | Ga0157371_10043687 | |||
| 1693 | Ga0157371_10049403 | |||
| 1694 | Ga0157371_10079099 | |||
| 1695 | Ga0157370_10000809 | |||
| 1696 | Ga0157370_10015351 | |||
| 1697 | Ga0157370_10030015 | |||
| 1698 | Ga0157370_10030507 | |||
| 1699 | Ga0157370_10212593 | |||
| 1700 | Ga0157369_10003544 | |||
| 1701 | Ga0157369_10022172 | |||
| 1702 | Ga0157369_10045781 | |||
| 1703 | Ga0157369_10170762 | |||
| 1704 | Ga0157369_10245064 | |||
| 1705 | Ga0157374_10004105 | |||
| 1706 | Ga0157374_10005804 | |||
| 1707 | Ga0157378_10000242 | |||
| 1708 | Ga0157378_10059213 | |||
| 1709 | Ga0157378_10137141 | |||
| 1710 | Ga0163162_10012431 | |||
| 1711 | Ga0163162_10015079 | |||
| 1712 | Ga0163162_10024390 | |||
| 1713 | Ga0163162_10120256 | |||
| 1714 | Ga0157372_10011773 | |||
| 1715 | Ga0157372_10033076 | |||
| 1716 | Ga0157372_10394002 | |||
| 1717 | Ga0157375_10013028 | |||
| 1718 | Ga0157375_10017802 | |||
| 1719 | Ga0157375_10163342 | |||
| 1720 | Ga0157375_10250374 | |||
| 1721 | Ga0163163_10001969 | |||
| 1722 | Ga0163163_10005368 | |||
| 1723 | Ga0163163_10161905 | |||
| 1724 | Ga0163163_10187270 | |||
| 1725 | Ga0157380_10000319 | |||
| 1726 | Ga0157380_10000615 | |||
| 1727 | Ga0157380_10001210 | |||
| 1728 | Ga0157380_10086590 | |||
| 1729 | Ga0182008_10048809 | |||
| 1730 | Ga0157379_10003175 | |||
| 1731 | Ga0157379_10024874 | |||
| 1732 | Ga0157379_10089723 | |||
| 1733 | Ga0157376_10029478 | |||
| 1734 | Ga0183363_1003 | |||
| 1735 | Ga0163161_10010209 | |||
| 1736 | Ga0163161_10135001 | |||
| 1737 | Ga0213875_10002752 | |||
| 1738 | Ga0209233_1000140 | |||
| 1739 | Ga0207697_10000002 | |||
| 1740 | Ga0207697_10000459 | |||
| 1741 | Ga0207697_10014994 | |||
| 1742 | Ga0207697_10034563 | |||
| 1743 | Ga0207656_10011826 | |||
| 1744 | Ga0207656_10018930 | |||
| 1745 | Ga0207656_10025070 | |||
| 1746 | Ga0207656_10064844 | |||
| 1747 | Ga0207696_1016889 | |||
| 1748 | Ga0207682_10000549 | |||
| 1749 | Ga0207682_10038342 | |||
| 1750 | Ga0207642_10045487 | |||
| 1751 | Ga0207688_10000185 | |||
| 1752 | Ga0207688_10027109 | |||
| 1753 | Ga0207688_10038030 | |||
| 1754 | Ga0207680_10001036 | |||
| 1755 | Ga0207680_10001868 | |||
| 1756 | Ga0207680_10006130 | |||
| 1757 | Ga0207680_10013590 | |||
| 1758 | Ga0207680_10018753 | |||
| 1759 | Ga0207647_10000095 | |||
| 1760 | Ga0207647_10001001 | |||
| 1761 | Ga0207647_10001765 | |||
| 1762 | Ga0207647_10003254 | |||
| 1763 | Ga0207647_10007018 | |||
| 1764 | Ga0207647_10010152 | |||
| 1765 | Ga0207647_10021448 | |||
| 1766 | Ga0207645_10002989 | |||
| 1767 | Ga0207645_10003442 | |||
| 1768 | Ga0207645_10006844 | |||
| 1769 | Ga0207645_10007529 | |||
| 1770 | Ga0207645_10026224 | |||
| 1771 | Ga0207645_10089707 | |||
| 1772 | Ga0207645_10110375 | |||
| 1773 | Ga0207643_10040672 | |||
| 1774 | Ga0207643_10114558 | |||
| 1775 | Ga0207705_10002520 | |||
| 1776 | Ga0207705_10002578 | |||
| 1777 | Ga0207705_10003350 | |||
| 1778 | Ga0207705_10007626 | |||
| 1779 | Ga0207705_10008207 | |||
| 1780 | Ga0207705_10011652 | |||
| 1781 | Ga0207705_10014418 | |||
| 1782 | Ga0207705_10016347 | |||
| 1783 | Ga0207705_10069286 | |||
| 1784 | Ga0207705_10080184 | |||
| 1785 | Ga0207705_10084349 | |||
| 1786 | Ga0207705_10094710 | |||
| 1787 | Ga0207705_10109353 | |||
| 1788 | Ga0207654_10032054 | |||
| 1789 | Ga0207707_10004641 | |||
| 1790 | Ga0207707_10024672 | |||
| 1791 | Ga0207707_10093825 | |||
| 1792 | Ga0207707_10152364 | |||
| 1793 | Ga0207695_10019266 | |||
| 1794 | Ga0207695_10021749 | |||
| 1795 | Ga0207695_10034582 | |||
| 1796 | Ga0207695_10131488 | |||
| 1797 | Ga0207671_10016350 | |||
| 1798 | Ga0207671_10018784 | |||
| 1799 | Ga0207660_10000593 | |||
| 1800 | Ga0207660_10002867 | |||
| 1801 | Ga0207660_10016140 | |||
| 1802 | Ga0207660_10020986 | |||
| 1803 | Ga0207660_10037625 | |||
| 1804 | Ga0207660_10050818 | |||
| 1805 | Ga0207660_10096886 | |||
| 1806 | Ga0207657_10000276 | |||
| 1807 | Ga0207657_10000594 | |||
| 1808 | Ga0207657_10002671 | |||
| 1809 | Ga0207657_10003798 | |||
| 1810 | Ga0207657_10003856 | |||
| 1811 | Ga0207657_10006981 | |||
| 1812 | Ga0207657_10009402 | |||
| 1813 | Ga0207657_10013132 | |||
| 1814 | Ga0207657_10013533 | |||
| 1815 | Ga0207657_10014084 | |||
| 1816 | Ga0207657_10014211 | |||
| 1817 | Ga0207657_10017472 | |||
| 1818 | Ga0207657_10019175 | |||
| 1819 | Ga0207657_10031010 | |||
| 1820 | Ga0207657_10031840 | |||
| 1821 | Ga0207657_10044268 | |||
| 1822 | Ga0207657_10048819 | |||
| 1823 | Ga0207657_10052184 | |||
| 1824 | Ga0207657_10066889 | |||
| 1825 | Ga0207649_10000277 | |||
| 1826 | Ga0207649_10006532 | |||
| 1827 | Ga0207649_10008616 | |||
| 1828 | Ga0207649_10010751 | |||
| 1829 | Ga0207649_10024072 | |||
| 1830 | Ga0207649_10042049 | |||
| 1831 | Ga0207649_10049434 | |||
| 1832 | Ga0207649_10052408 | |||
| 1833 | Ga0207649_10109218 | |||
| 1834 | Ga0207652_10006156 | |||
| 1835 | Ga0207652_10014820 | |||
| 1836 | Ga0207652_10067869 | |||
| 1837 | Ga0207652_10097441 | |||
| 1838 | Ga0207681_10000014 | |||
| 1839 | Ga0207681_10000414 | |||
| 1840 | Ga0207681_10004175 | |||
| 1841 | Ga0207681_10009199 | |||
| 1842 | Ga0207681_10013492 | |||
| 1843 | Ga0207681_10025963 | |||
| 1844 | Ga0207681_10077103 | |||
| 1845 | Ga0207694_10000665 | |||
| 1846 | Ga0207694_10007832 | |||
| 1847 | Ga0207694_10021952 | |||
| 1848 | Ga0207650_10000015 | |||
| 1849 | Ga0207650_10004328 | |||
| 1850 | Ga0207650_10006161 | |||
| 1851 | Ga0207650_10010874 | |||
| 1852 | Ga0207650_10019981 | |||
| 1853 | Ga0207650_10033602 | |||
| 1854 | Ga0207650_10041232 | |||
| 1855 | Ga0207650_10043250 | |||
| 1856 | Ga0207650_10047647 | |||
| 1857 | Ga0207650_10073647 | |||
| 1858 | Ga0207650_10092388 | |||
| 1859 | Ga0207659_10000722 | |||
| 1860 | Ga0207659_10005396 | |||
| 1861 | Ga0207659_10013617 | |||
| 1862 | Ga0207659_10060565 | |||
| 1863 | Ga0207687_10000899 | |||
| 1864 | Ga0207687_10018073 | |||
| 1865 | Ga0207687_10026642 | |||
| 1866 | Ga0207687_10075012 | |||
| 1867 | Ga0207700_10015911 | |||
| 1868 | Ga0207700_10031630 | |||
| 1869 | Ga0207664_10003705 | |||
| 1870 | Ga0207664_10045543 | |||
| 1871 | Ga0207664_10143541 | |||
| 1872 | Ga0207644_10000135 | |||
| 1873 | Ga0207644_10000139 | |||
| 1874 | Ga0207644_10002659 | |||
| 1875 | Ga0207644_10003132 | |||
| 1876 | Ga0207644_10005078 | |||
| 1877 | Ga0207644_10013876 | |||
| 1878 | Ga0207644_10015698 | |||
| 1879 | Ga0207644_10019544 | |||
| 1880 | Ga0207644_10028246 | |||
| 1881 | Ga0207644_10032716 | |||
| 1882 | Ga0207644_10033360 | |||
| 1883 | Ga0207644_10042087 | |||
| 1884 | Ga0207644_10075948 | |||
| 1885 | Ga0207644_10094722 | |||
| 1886 | Ga0207690_10000100 | |||
| 1887 | Ga0207690_10003562 | |||
| 1888 | Ga0207690_10004247 | |||
| 1889 | Ga0207690_10005603 | |||
| 1890 | Ga0207690_10005693 | |||
| 1891 | Ga0207690_10006094 | |||
| 1892 | Ga0207690_10011221 | |||
| 1893 | Ga0207690_10018475 | |||
| 1894 | Ga0207690_10042741 | |||
| 1895 | Ga0207690_10042807 | |||
| 1896 | Ga0207690_10070884 | |||
| 1897 | Ga0207690_10094708 | |||
| 1898 | Ga0207690_10123083 | |||
| 1899 | Ga0207690_10123573 | |||
| 1900 | Ga0207690_10208796 | |||
| 1901 | Ga0207706_10000020 | |||
| 1902 | Ga0207706_10000411 | |||
| 1903 | Ga0207706_10000599 | |||
| 1904 | Ga0207706_10001396 | |||
| 1905 | Ga0207706_10002559 | |||
| 1906 | Ga0207706_10003893 | |||
| 1907 | Ga0207706_10006178 | |||
| 1908 | Ga0207706_10007469 | |||
| 1909 | Ga0207706_10009669 | |||
| 1910 | Ga0207706_10010553 | |||
| 1911 | Ga0207706_10017823 | |||
| 1912 | Ga0207706_10025629 | |||
| 1913 | Ga0207706_10037891 | |||
| 1914 | Ga0207706_10042896 | |||
| 1915 | Ga0207706_10153229 | |||
| 1916 | Ga0207709_10056167 | |||
| 1917 | Ga0207669_10007249 | |||
| 1918 | Ga0207669_10009397 | |||
| 1919 | Ga0207669_10046187 | |||
| 1920 | Ga0207704_10007995 | |||
| 1921 | Ga0207704_10060612 | |||
| 1922 | Ga0207691_10000133 | |||
| 1923 | Ga0207691_10001043 | |||
| 1924 | Ga0207691_10006826 | |||
| 1925 | Ga0207691_10007876 | |||
| 1926 | Ga0207691_10013203 | |||
| 1927 | Ga0207691_10034681 | |||
| 1928 | Ga0207691_10082546 | |||
| 1929 | Ga0207691_10122107 | |||
| 1930 | Ga0207691_10167442 | |||
| 1931 | Ga0207711_10000039 | |||
| 1932 | Ga0207711_10000107 | |||
| 1933 | Ga0207711_10000297 | |||
| 1934 | Ga0207711_10001496 | |||
| 1935 | Ga0207711_10001711 | |||
| 1936 | Ga0207711_10002235 | |||
| 1937 | Ga0207711_10003051 | |||
| 1938 | Ga0207711_10004290 | |||
| 1939 | Ga0207711_10004444 | |||
| 1940 | Ga0207711_10005938 | |||
| 1941 | Ga0207711_10015796 | |||
| 1942 | Ga0207711_10025644 | |||
| 1943 | Ga0207711_10031486 | |||
| 1944 | Ga0207711_10103102 | |||
| 1945 | Ga0207711_10234961 | |||
| 1946 | Ga0207689_10000002 | |||
| 1947 | Ga0207689_10003262 | |||
| 1948 | Ga0207661_10003511 | |||
| 1949 | Ga0207661_10013868 | |||
| 1950 | Ga0207679_10000377 | |||
| 1951 | Ga0207679_10005368 | |||
| 1952 | Ga0207679_10018970 | |||
| 1953 | Ga0207679_10021378 | |||
| 1954 | Ga0207679_10025915 | |||
| 1955 | Ga0207679_10027093 | |||
| 1956 | Ga0207679_10047253 | |||
| 1957 | Ga0207679_10072397 | |||
| 1958 | Ga0207679_10258923 | |||
| 1959 | Ga0207667_10013227 | |||
| 1960 | Ga0207667_10023065 | |||
| 1961 | Ga0207667_10033651 | |||
| 1962 | Ga0207667_10055648 | |||
| 1963 | Ga0207667_10064721 | |||
| 1964 | Ga0207667_10102337 | |||
| 1965 | Ga0207667_10263674 | |||
| 1966 | Ga0207651_10001472 | |||
| 1967 | Ga0207651_10002855 | |||
| 1968 | Ga0207651_10015655 | |||
| 1969 | Ga0207651_10021994 | |||
| 1970 | Ga0207651_10027291 | |||
| 1971 | Ga0207712_10000195 | |||
| 1972 | Ga0207712_10016124 | |||
| 1973 | Ga0207668_10000012 | |||
| 1974 | Ga0207668_10000176 | |||
| 1975 | Ga0207668_10000205 | |||
| 1976 | Ga0207668_10017116 | |||
| 1977 | Ga0207668_10023073 | |||
| 1978 | Ga0207668_10083595 | |||
| 1979 | Ga0207668_10094100 | |||
| 1980 | Ga0207668_10204987 | |||
| 1981 | Ga0207640_10002155 | |||
| 1982 | Ga0207640_10007188 | |||
| 1983 | Ga0207640_10008423 | |||
| 1984 | Ga0207640_10010785 | |||
| 1985 | Ga0207640_10037689 | |||
| 1986 | Ga0207640_10155185 | |||
| 1987 | Ga0207658_10000011 | |||
| 1988 | Ga0207658_10002281 | |||
| 1989 | Ga0207658_10002784 | |||
| 1990 | Ga0207658_10004177 | |||
| 1991 | Ga0207658_10004754 | |||
| 1992 | Ga0207658_10013979 | |||
| 1993 | Ga0207658_10016379 | |||
| 1994 | Ga0207658_10016952 | |||
| 1995 | Ga0207658_10022229 | |||
| 1996 | Ga0207658_10044301 | |||
| 1997 | Ga0207658_10056616 | |||
| 1998 | Ga0207677_10002392 | |||
| 1999 | Ga0207677_10007754 | |||
| 2000 | Ga0207677_10045368 | |||
| 2001 | Ga0207677_10135991 | |||
| 2002 | Ga0207703_10000241 | |||
| 2003 | Ga0207703_10000327 | |||
| 2004 | Ga0207703_10000529 | |||
| 2005 | Ga0207703_10001701 | |||
| 2006 | Ga0207703_10010833 | |||
| 2007 | Ga0207703_10010847 | |||
| 2008 | Ga0207703_10015361 | |||
| 2009 | Ga0207703_10060851 | |||
| 2010 | Ga0207703_10069636 | |||
| 2011 | Ga0207639_10000162 | |||
| 2012 | Ga0207639_10000987 | |||
| 2013 | Ga0207639_10010227 | |||
| 2014 | Ga0207639_10043264 | |||
| 2015 | Ga0207639_10101055 | |||
| 2016 | Ga0207639_10176622 | |||
| 2017 | Ga0207678_10002193 | |||
| 2018 | Ga0207678_10004189 | |||
| 2019 | Ga0207678_10004258 | |||
| 2020 | Ga0207678_10005341 | |||
| 2021 | Ga0207678_10005694 | |||
| 2022 | Ga0207678_10010475 | |||
| 2023 | Ga0207678_10014855 | |||
| 2024 | Ga0207678_10032074 | |||
| 2025 | Ga0207678_10071779 | |||
| 2026 | Ga0207678_10074012 | |||
| 2027 | Ga0207678_10140740 | |||
| 2028 | Ga0207702_10000208 | |||
| 2029 | Ga0207702_10003777 | |||
| 2030 | Ga0207702_10017062 | |||
| 2031 | Ga0207702_10017313 | |||
| 2032 | Ga0207702_10019757 | |||
| 2033 | Ga0207702_10043132 | |||
| 2034 | Ga0207702_10084995 | |||
| 2035 | Ga0207641_10000115 | |||
| 2036 | Ga0207641_10000138 | |||
| 2037 | Ga0207641_10007958 | |||
| 2038 | Ga0207641_10021529 | |||
| 2039 | Ga0207641_10023493 | |||
| 2040 | Ga0207641_10030122 | |||
| 2041 | Ga0207641_10031155 | |||
| 2042 | Ga0207641_10039934 | |||
| 2043 | Ga0207641_10128784 | |||
| 2044 | Ga0207648_10000088 | |||
| 2045 | Ga0207648_10006357 | |||
| 2046 | Ga0207648_10007110 | |||
| 2047 | Ga0207648_10016876 | |||
| 2048 | Ga0207648_10027000 | |||
| 2049 | Ga0207648_10037362 | |||
| 2050 | Ga0207648_10038815 | |||
| 2051 | Ga0207648_10087335 | |||
| 2052 | Ga0207676_10000071 | |||
| 2053 | Ga0207676_10000245 | |||
| 2054 | Ga0207676_10002838 | |||
| 2055 | Ga0207676_10003364 | |||
| 2056 | Ga0207676_10006133 | |||
| 2057 | Ga0207676_10008157 | |||
| 2058 | Ga0207676_10023132 | |||
| 2059 | Ga0207676_10025219 | |||
| 2060 | Ga0207676_10034569 | |||
| 2061 | Ga0207676_10062812 | |||
| 2062 | Ga0207676_10123456 | |||
| 2063 | Ga0207676_10271828 | |||
| 2064 | Ga0207674_10000065 | |||
| 2065 | Ga0207674_10002644 | |||
| 2066 | Ga0207674_10004380 | |||
| 2067 | Ga0207674_10004467 | |||
| 2068 | Ga0207674_10009197 | |||
| 2069 | Ga0207674_10009547 | |||
| 2070 | Ga0207674_10015599 | |||
| 2071 | Ga0207674_10030869 | |||
| 2072 | Ga0207674_10034986 | |||
| 2073 | Ga0207674_10056446 | |||
| 2074 | Ga0207674_10064174 | |||
| 2075 | Ga0207674_10068536 | |||
| 2076 | Ga0207674_10089067 | |||
| 2077 | Ga0207674_10234697 | |||
| 2078 | Ga0207675_100001970 | |||
| 2079 | Ga0207675_100006756 | |||
| 2080 | Ga0207675_100056247 | |||
| 2081 | Ga0207675_100084588 | |||
| 2082 | Ga0207675_100187429 | |||
| 2083 | Ga0207683_10003574 | |||
| 2084 | Ga0207683_10005286 | |||
| 2085 | Ga0207683_10029343 | |||
| 2086 | Ga0207698_10000701 | |||
| 2087 | Ga0207698_10000788 | |||
| 2088 | Ga0207698_10000985 | |||
| 2089 | Ga0207698_10003393 | |||
| 2090 | Ga0207698_10004864 | |||
| 2091 | Ga0207698_10005578 | |||
| 2092 | Ga0207698_10027671 | |||
| 2093 | Ga0207698_10033398 | |||
| 2094 | Ga0207698_10047308 | |||
| 2095 | Ga0207698_10056097 | |||
| 2096 | Ga0207698_10057552 | |||
| 2097 | Ga0207698_10069464 | |||
| 2098 | Ga0207698_10131788 | |||
| 2099 | Ga0207428_10072926 | |||
| 2100 | Ga0268266_10000332 | |||
| 2101 | Ga0268266_10004925 | |||
| 2102 | Ga0268266_10005388 | |||
| 2103 | Ga0268266_10011599 | |||
| 2104 | Ga0268266_10026708 | |||
| 2105 | Ga0268266_10026832 | |||
| 2106 | Ga0268266_10038203 | |||
| 2107 | Ga0268266_10051672 | |||
| 2108 | Ga0268265_10000013 | |||
| 2109 | Ga0268265_10002150 | |||
| 2110 | Ga0268265_10002289 | |||
| 2111 | Ga0268265_10002345 | |||
| 2112 | Ga0268265_10003839 | |||
| 2113 | Ga0268265_10009036 | |||
| 2114 | Ga0268265_10019559 | |||
| 2115 | Ga0268265_10020542 | |||
| 2116 | Ga0268265_10107865 | |||
| 2117 | Ga0268265_10182277 | |||
| 2118 | Ga0268264_10000089 | |||
| 2119 | Ga0268264_10000644 | |||
| 2120 | Ga0268264_10006587 | |||
| 2121 | Ga0268264_10018719 | |||
| 2122 | Ga0268264_10021969 | |||
| 2123 | Ga0268264_10090476 | |||
| 2124 | Ga0268264_10113947 | |||
| 2125 | Ga0316178_1008507 | |||
| 2126 | Ga0307408_100012733 | |||
| 2127 | Ga0307408_100043916 | |||
| 2128 | Ga0307408_100063622 | |||
| 2129 | Ga0307408_100102477 | |||
| 2130 | Ga0307408_100242400 | |||
| 2131 | Ga0307508_10000126 | |||
| 2132 | Ga0307405_10004269 | |||
| 2133 | Ga0307405_10014276 | |||
| 2134 | Ga0307405_10022975 | |||
| 2135 | Ga0307405_10035433 | |||
| 2136 | Ga0307405_10055462 | |||
| 2137 | Ga0307405_10068191 | |||
| 2138 | Ga0307405_10141754 | |||
| 2139 | Ga0307413_10003122 | |||
| 2140 | Ga0307413_10033488 | |||
| 2141 | Ga0307413_10043258 | |||
| 2142 | Ga0307413_10141471 | |||
| 2143 | Ga0307410_10000196 | |||
| 2144 | Ga0307410_10014899 | |||
| 2145 | Ga0307410_10031915 | |||
| 2146 | Ga0307410_10039852 | |||
| 2147 | Ga0307410_10049658 | |||
| 2148 | Ga0307410_10061889 | |||
| 2149 | Ga0307410_10065729 | |||
| 2150 | Ga0307410_10069626 | |||
| 2151 | Ga0307406_10013772 | |||
| 2152 | Ga0307406_10030657 | |||
| 2153 | Ga0307406_10038025 | |||
| 2154 | Ga0307406_10038519 | |||
| 2155 | Ga0307406_10078199 | |||
| 2156 | Ga0307406_10084185 | |||
| 2157 | Ga0307406_10096102 | |||
| 2158 | Ga0307406_10131883 | |||
| 2159 | Ga0307406_10149722 | |||
| 2160 | Ga0307407_10012482 | |||
| 2161 | Ga0307412_10015961 | |||
| 2162 | Ga0307412_10019902 | |||
| 2163 | Ga0307412_10025925 | |||
| 2164 | Ga0307412_10034747 | |||
| 2165 | Ga0307409_100004899 | |||
| 2166 | Ga0307409_100005795 | |||
| 2167 | Ga0307409_100020912 | |||
| 2168 | Ga0307409_100030212 | |||
| 2169 | Ga0307409_100058264 | |||
| 2170 | Ga0307409_100063628 | |||
| 2171 | Ga0307409_100122965 | |||
| 2172 | Ga0307409_100200913 | |||
| 2173 | Ga0307409_100222891 | |||
| 2174 | Ga0307416_100007621 | |||
| 2175 | Ga0307416_100022623 | |||
| 2176 | Ga0307414_10000550 | |||
| 2177 | Ga0307414_10009672 | |||
| 2178 | Ga0307414_10012159 | |||
| 2179 | Ga0307414_10014505 | |||
| 2180 | Ga0307414_10182197 | |||
| 2181 | Ga0307411_10001878 | |||
| 2182 | Ga0307411_10005963 | |||
| 2183 | Ga0307411_10020177 | |||
| 2184 | Ga0307411_10035032 | |||
| 2185 | Ga0307411_10046502 | |||
| 2186 | Ga0307411_10091027 | |||
| 2187 | Ga0307411_10114641 | |||
| 2188 | Ga0307411_10133241 | |||
| 2189 | Ga0307415_100002988 | |||
| 2190 | Ga0307415_100011414 | |||
| 2191 | Ga0307415_100056829 | |||
| 2192 | Ga0307415_100082537 | |||
| 2193 | Ga0373955_0001400 | |||
| 2194 | Ga0373931_0011146 | |||
| 2195 | Ga0373935_0007844 | |||
| 2196 | Ga0373935_0119924 | |||
| 2197 | Ga0373937_0003288 | |||
| 2198 | Ga0373925_0004938 | |||
| 2199 | Ga0395899_0000113 | |||
| 2200 | Ga0395899_0003120 | |||
| 2201 | Ga0395899_0007898 | |||
| 2202 | Ga0395899_0016688 | |||
| 2203 | Ga0395899_0017080 | |||
| 2204 | Ga0395899_0019273 | |||
| 2205 | Ga0395899_0024928 | |||
| 2206 | Ga0395899_0027196 | |||
| 2207 | Ga0395899_0029122 | |||
| 2208 | Ga0395899_0029502 | |||
| 2209 | Ga0395899_0036867 | |||
| 2210 | Ga0395899_0046810 | |||
| 2211 | Ga0395899_0056088 | |||
| 2212 | Ga0395899_0071140 | |||
| 2213 | Ga0395899_0078417 | |||
| 2214 | Ga0395899_0101022 | |||
| 2215 | Ga0395900_0000365 | |||
| 2216 | Ga0395900_0004188 | |||
| 2217 | Ga0395900_0008210 | |||
| 2218 | Ga0395900_0009559 | |||
| 2219 | Ga0395900_0012564 | |||
| 2220 | Ga0395900_0014673 | |||
| 2221 | Ga0395900_0016111 | |||
| 2222 | Ga0395900_0017358 | |||
| 2223 | Ga0395900_0019504 | |||
| 2224 | Ga0395900_0032817 | |||
| 2225 | Ga0395900_0045715 | |||
| 2226 | Ga0395900_0070692 | |||
| 2227 | Ga0395900_0111004 | |||
| 2228 | Ga0395900_0118870 | |||
| 2229 | Ga0395900_0123342 | |||
| 2230 | Ga0395900_0124036 | |||
| 2231 | Ga0395900_0125049 | |||
| 2232 | Ga0395900_0132027 | |||
| 2233 | Ga0395900_0143930 | |||
| 2234 | Ga0395900_0157709 | |||
| 2235 | Ga0395900_0165823 | |||
| 2236 | Ga0395900_0168430 | |||
| 2237 | Ga0395900_0229543 | |||
| 2238 | Ga0395898_0000306 | |||
| 2239 | Ga0395898_0001326 | |||
| 2240 | Ga0395898_0002464 | |||
| 2241 | Ga0395898_0009109 | |||
| 2242 | Ga0395898_0009147 | |||
| 2243 | Ga0395898_0009764 | |||
| 2244 | Ga0395898_0018562 | |||
| 2245 | Ga0395898_0030913 | |||
| 2246 | Ga0395898_0073432 | |||
| 2247 | Ga0395898_0087582 | |||
| 2248 | Ga0395898_0126909 | |||
| 2249 | Ga0395898_0247220 | |||
| 2250 | Ga0395905_0000005 | |||
| 2251 | Ga0395905_0000793 | |||
| 2252 | Ga0395905_0000886 | |||
| 2253 | Ga0395905_0000958 | |||
| 2254 | Ga0395905_0002845 | |||
| 2255 | Ga0395905_0004516 | |||
| 2256 | Ga0395905_0006083 | |||
| 2257 | Ga0395905_0007674 | |||
| 2258 | Ga0395905_0008116 | |||
| 2259 | Ga0395905_0009274 | |||
| 2260 | Ga0395905_0010495 | |||
| 2261 | Ga0395905_0012159 | |||
| 2262 | Ga0395905_0020726 | |||
| 2263 | Ga0395905_0023572 | |||
| 2264 | Ga0395905_0024182 | |||
| 2265 | Ga0395905_0029421 | |||
| 2266 | Ga0395905_0032596 | |||
| 2267 | Ga0395905_0043384 | |||
| 2268 | Ga0395905_0044096 | |||
| 2269 | Ga0395905_0047990 | |||
| 2270 | Ga0395905_0050649 | |||
| 2271 | Ga0395905_0089254 | |||
| 2272 | Ga0395905_0092485 | |||
| 2273 | Ga0395905_0137911 | |||
| 2274 | Ga0395905_0162809 | |||
| 2275 | Ga0395905_0190055 | |||
| 2276 | Ga0395905_0210295 | |||
| 2277 | Ga0395905_0231069 | |||
| 2278 | Ga0395905_0271580 | |||
| 2279 | Ga0395905_0338660 | |||
| 2280 | Ga0436364_0512909 | |||
| 2281 | Ga0395901_0000589 | |||
| 2282 | Ga0395901_0000647 | |||
| 2283 | Ga0395901_0000988 | |||
| 2284 | Ga0395901_0001342 | |||
| 2285 | Ga0395901_0004930 | |||
| 2286 | Ga0395901_0005101 | |||
| 2287 | Ga0395901_0006716 | |||
| 2288 | Ga0395901_0017008 | |||
| 2289 | Ga0395901_0025684 | |||
| 2290 | Ga0395901_0029337 | |||
| 2291 | Ga0395901_0034057 | |||
| 2292 | Ga0395901_0037318 | |||
| 2293 | Ga0395901_0040667 | |||
| 2294 | Ga0395901_0042542 | |||
| 2295 | Ga0395901_0044056 | |||
| 2296 | Ga0395901_0047070 | |||
| 2297 | Ga0395901_0050961 | |||
| 2298 | Ga0395901_0053254 | |||
| 2299 | Ga0395901_0058928 | |||
| 2300 | Ga0395901_0062882 | |||
| 2301 | Ga0395901_0074852 | |||
| 2302 | Ga0395901_0118904 | |||
| 2303 | Ga0395901_0400834 | |||
| 2304 | Ga0436365_1036392 | |||
| 2305 | Ga0439437_003193 | |||
| 2306 | Ga0439445_0015536 | |||
| 2307 | Ga0439432_012800 | |||
| 2308 | Ga0450889_000018 | |||
| 2309 | Ga0439446_0031503 | |||
| 2310 | Ga0439458_0000959 | |||
| 2311 | Ga0439458_0006714 | |||
| 2312 | Ga0466969_0034940 | |||
| 2313 | Ga0466972_0016893 | |||
| 2314 | Ga0466966_0026090 | |||
| 2315 | Ga0466966_0040600 | |||
| 2316 | Ga0466966_0044210 | |||
| 2317 | Ga0466961_0021720 | |||
| 2318 | Ga0466961_0095042 | |||
| 2319 | Ga0466963_0009052 | |||
| 2320 | Ga0466963_0012160 | |||
| 2321 | Ga0466963_0036333 | |||
| 2322 | Ga0466963_0037658 | |||
| 2323 | Ga0466963_0090491 | |||
| 2324 | Ga0466964_0046727 | |||
| 2325 | Ga0466971_0083073 | |||
| 2326 | Ga0466968_0008164 | |||
| 2327 | Ga0466970_0003366 | |||
| 2328 | Ga0466970_0030289 | |||
| 2329 | Ga0466970_0073426 | |||
| 2330 | Ga0466957_0005837 | |||
| 2331 | Ga0466957_0005960 | |||
| 2332 | Ga0466957_0009323 | |||
| 2333 | Ga0466957_0106162 | |||
| 2334 | Ga0466959_0003226 | |||
| 2335 | Ga0466959_0167452 | |||
| 2336 | Ga0466958_0005124 | |||
| 2337 | Ga0466958_0011900 | |||
| 2338 | Ga0466958_0060356 | |||
| 2339 | Ga0466967_0003854 | |||
| 2340 | Ga0466967_0009691 | |||
| 2341 | Ga0466967_0012914 | |||
| 2342 | Ga0466967_0053133 | |||
| 2343 | Ga0466967_0054946 | |||
| 2344 | Ga0466967_0066457 | |||
| 2345 | Ga0466967_0214381 | |||
| 2346 | Ga0495585_0021091 | |||
| 2347 | Ga0495607_0002441 | |||
| 2348 | Ga0495637_0037293 | |||
| 2349 | Ga0495663_0023073 | |||
| 2350 | Ga0495642_0045250 | |||
| 2351 | Ga0495598_0013334 | |||
| 2352 | Ga0495621_0000067 | |||
| 2353 | Ga0495621_0006751 | |||
| 2354 | Ga0495621_0029415 | |||
| 2355 | Ga0495621_0043678 | |||
| 2356 | Ga0495621_0068227 | |||
| 2357 | Ga0495597_0007971 | |||
| 2358 | Ga0495668_0008525 | |||
| 2359 | Ga0495668_0071391 | |||
| 2360 | Ga0495668_0075428 | |||
| 2361 | Ga0495669_0002139 | |||
| 2362 | Ga0495669_0003874 | |||
| 2363 | Ga0495669_0004828 | |||
| 2364 | Ga0495670_0001717 | |||
| 2365 | Ga0495670_0013921 | |||
| 2366 | Ga0495671_0011659 | |||
| 2367 | Ga0495686_0000323 | |||
| 2368 | Ga0496100_0004354 | |||
| 2369 | Ga0496101_0003296 | |||
| 2370 | Ga0496101_0004146 | |||
| 2371 | Ga0496101_0075177 | |||
| 2372 | Ga0496101_0097464 | |||
| 2373 | Ga0496102_0020505 | |||
| 2374 | Ga0496102_0043391 | |||
| 2375 | Ga0496102_0071241 | |||
| 2376 | Ga0496103_0010484 | |||
| 2377 | Ga0496103_0053704 | |||
| 2378 | Ga0496104_0071008 | |||
| 2379 | Ga0496104_0077669 | |||
| 2380 | Ga0496104_0156051 | |||
| 2381 | Ga0496105_0007221 | |||
| 2382 | Ga0496105_0027136 | |||
| 2383 | Ga0496107_0001984 | |||
| 2384 | Ga0496107_0002320 | |||
| 2385 | Ga0496107_0010084 | |||
| 2386 | Ga0496108_0000946 | |||
| 2387 | Ga0496108_0003253 | |||
| 2388 | Ga0496108_0008368 | |||
| 2389 | Ga0496108_0015004 | |||
| 2390 | Ga0496109_0014987 | |||
| 2391 | Ga0496109_0015922 | |||
| 2392 | Ga0496109_0017156 | |||
| 2393 | Ga0496109_0019073 | |||
| 2394 | Ga0496109_0049473 | |||
| 2395 | Ga0496109_0161827 | |||
| 2396 | Ga0496110_0003761 | |||
| 2397 | Ga0496110_0028524 | |||
| 2398 | Ga0496110_0048552 | |||
| 2399 | Ga0496110_0083936 | |||
| 2400 | Ga0496111_0002605 | |||
| 2401 | Ga0496111_0006647 | |||
| 2402 | Ga0496111_0012157 | |||
| 2403 | Ga0496111_0017519 | |||
| 2404 | Ga0496112_0004475 | |||
| 2405 | Ga0496112_0015539 | |||
| 2406 | Ga0496112_0021838 | |||
| 2407 | Ga0496112_0026334 | |||
| 2408 | Ga0496112_0030327 | |||
| 2409 | Ga0496112_0032803 | |||
| 2410 | Ga0496112_0050656 | |||
| 2411 | Ga0496112_0113941 | |||
| 2412 | Ga0496113_0001095 | |||
| 2413 | Ga0496113_0004673 | |||
| 2414 | Ga0496113_0018811 | |||
| 2415 | Ga0496113_0028721 | |||
| 2416 | Ga0496114_0000006 | |||
| 2417 | Ga0496115_0001032 | |||
| 2418 | Ga0496121_0000319 | |||
| 2419 | Ga0496121_0003131 | |||
| 2420 | Ga0501043_0008649 | |||
| 2421 | Ga0501046_0121411 | |||
| 2422 | Ga0501047_0002258 | |||
| 2423 | Ga0501073_0145052 | |||
| 2424 | Ga0501202_009672 | |||
| 2425 | Ga0501216_002908 | |||
| 2426 | Ga0501230_005126 | |||
| 2427 | Ga0501233_007707 | |||
| 2428 | Ga0501249_012673 | |||
| 2429 | Ga0501249_013096 | |||
| 2430 | Ga0501257_013806 | |||
| 2431 | Ga0501221_008054 | |||
| 2432 | Ga0501225_0022125 | |||
| 2433 | Ga0501044_0069133 | |||
| 2434 | nmdc:mga09592_123032_c1 | |||
| 2435 | nmdc:mga06r32_15032_c1 | |||
| 2436 | nmdc:mga08y16_231545_c1 | |||
| 2437 | nmdc:mga08y16_43971_c1 | |||
| 2438 | Ga0495612_0012597 | |||
| 2439 | Ga0500643_001588 | |||
| 2440 | Ga0500647_0041597 | |||
| 2441 | Ga0500594_0005423 | |||
| 2442 | Ga0500614_005071 | |||
| 2443 | Ga0500655_000355 | |||
| 2444 | Ga0500658_0000022 | |||
| 2445 | Ga0500559_0009170 | |||
| 2446 | Ga0500590_001560 | |||
| 2447 | Ga0500639_011183 | |||
| 2448 | Ga0500636_0082786 | |||
| 2449 | Ga0500570_001325 | |||
| 2450 | Ga0466962_0015068 | |||
| 2451 | 2585262161 | |||
| 2452 | 2600202315 | |||
| 2453 | 2643726983 | |||
| 2454 | 2644040459 | |||
| 2455 | 2644045976 | |||
| 2456 | 2644393213 | |||
| 2457 | 2753766074 | |||
| 2458 | 2885428913 | |||
| 2459 | 2885432576 | |||
| 2460 | 2896431354 | |||
| 2461 | 2928029070 | |||
| 2462 | 2984556031 | |||
| 2463 | 2984565862 | |||
| 2464 | 2993356872 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qtu-assembly1.cif.gz_B | structural biology of the ns1 avian influenza protein subversion on the scribble cell polarity module | 0.8855 | 99 | 166 |
| 6bxg-assembly1.cif.gz_A | 1.45 angstrom resolution crystal structure of pdz domain of carboxy-terminal protease from vibrio cholerae in complex with peptide. | 0.8775 | 95 | 184 |
| 2m0u-assembly1.cif.gz_A | complex structure of c-terminal cftr peptide and extended pdz1 domain from nherf1 | 0.8706 | 98 | 167 |
| 8b8o-assembly1.cif.gz_B | crystal structure of scribble pdz1 with human papillomavirus strain 16 e6 peptide | 0.8648 | 98 | 151 |
| 5g1e-assembly1.cif.gz_B | the complex structure of syntenin-1 pdz domain with c-terminal extension | 0.8586 | 94 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8MNT0_420_501_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9476 | 98 | 152 | 2.30.42.10 |
| af_Q5ZA08_147_239_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9453 | 98 | 182 | 2.30.42.10 |
| 1fc6A02 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9164 | 98 | 184 | 2.30.42.10 |
| af_O23614_210_301_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9022 | 98 | 184 | 2.30.42.10 |
| 3wkmB02 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8834 | 111 | 178 | 2.30.42.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H0DLI1-F1-model_v4 | PDZ domain-containing protein | 0.9454 | 95 | 181 |
|
| AF-A0A7S0YHU7-F1-model_v4 | PDZ domain-containing protein | 0.9355 | 98 | 184 |
|
| AF-A0A538Q8G7-F1-model_v4 | PDZ domain-containing protein | 0.9294 | 95 | 182 |
GO:0030246
|
| AF-A0A1G2Z8K7-F1-model_v4 | PDZ domain-containing protein | 0.9147 | 94 | 182 |
GO:0004252
GO:0006508 GO:0007165 GO:0030288 |
| AF-A0A7W9W928-F1-model_v4 | PDZ domain-containing protein | 0.904 | 95 | 183 |
|