F492003
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1232 | 627 | 2464 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10017269|Ga0182008_100172693 |
| Length | 377 |
| Sequence | MYRRTTCRSELARETRQDNAGIRTTRVIVDVHREQARSYTQNKEFAVKKLFGASLLAAGLALTSVAQAAPTLLNVSYDVMRDFYKDYNAAFQKHWQAEHNENITLQMSFGGSSKQARSVIDGLPADVITMNMATDINALADNGKLVPDNWVTLLPNHSAPFTSATVFIVRKGNPKALKDWPDLLKDGVQVIVPNPKTSGNGRYTYLSAWGYVLKNGGDENKAKAFVGKLFKQAPVLDTGGRAATTTFMTNQIGDVLVTFENEAEMIAREFGRDQFEVIYPSVSAEAEPPVAVVEKVVEKKGTRAAAEEYLKYLWSPEGQEIAAANYLRPRDPAVLAKYTDRFPKVDFLSVEKTFGDWRTVQKTHFNDGGIFDQIYAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 83 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 84 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 85 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 100 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 204 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 205 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 206 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 207 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 232 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 233 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 244 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 245 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 246 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 247 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 248 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 250 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 251 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 252 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 253 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 254 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 255 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 256 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 257 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 258 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 259 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 260 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 261 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 262 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 263 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 264 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 265 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 266 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 267 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 268 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 269 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 270 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 359 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 360 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 361 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 362 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 365 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 366 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 367 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 368 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 369 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 377 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 383 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 384 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 385 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 387 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 388 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 390 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 391 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 392 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 393 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 394 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 395 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 396 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 397 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 398 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 399 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 400 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 401 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 402 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 403 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 404 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 405 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 406 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 407 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 408 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 409 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 410 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 411 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 412 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 413 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 414 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 415 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 416 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 417 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 418 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 419 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 420 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 421 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 422 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 423 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 424 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 425 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 426 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 427 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 428 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 429 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 430 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 431 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 432 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 433 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 434 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 435 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 436 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 437 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 438 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 439 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 440 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 441 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 442 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 443 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 444 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 445 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 446 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 447 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 448 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 449 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 450 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 451 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 452 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 453 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 454 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 455 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 456 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 457 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 458 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 459 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 460 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 461 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 462 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 463 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 464 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 465 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 466 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 467 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 468 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 469 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 470 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 471 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 472 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 473 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 474 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 475 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 476 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 477 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 478 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 479 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 480 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 481 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 482 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 483 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 484 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 485 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 486 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 487 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 488 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 489 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 490 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 491 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 492 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 493 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 494 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 495 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 496 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 497 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 498 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 499 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 500 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 501 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 502 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 503 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 504 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 505 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 506 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 507 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 508 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 509 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 510 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 511 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 512 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 513 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 514 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 515 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 516 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 517 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 518 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 519 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 520 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 521 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 522 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 523 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 524 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 525 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 526 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 527 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 528 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 529 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 530 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 531 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 532 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 533 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 534 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 535 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 536 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 537 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 538 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 539 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 540 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 541 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 542 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 543 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 544 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 545 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 546 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 547 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 548 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 549 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 550 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 551 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 552 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 553 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 554 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 555 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 556 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 557 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 558 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 559 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 560 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 561 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 562 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 563 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 564 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 565 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 566 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 567 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 568 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 569 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 570 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 571 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 572 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 573 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 574 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 575 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 576 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 577 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 578 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 579 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 580 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 581 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 582 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 583 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 584 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 585 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 586 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 587 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 588 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 589 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 590 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 591 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 592 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 593 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 594 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 595 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 596 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 597 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 598 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 599 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 600 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 601 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 602 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 603 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 604 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 605 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 606 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 607 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 608 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 609 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 610 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 611 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 612 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 613 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 614 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 615 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 616 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 617 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 618 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 619 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 620 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 621 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 622 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 623 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 624 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 625 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 626 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 627 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.76 |
| Metatranscriptomes | 0.08 |
| Isolates | 19.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.68 |
| Nodule | 2.44 |
| Rhizoplane | 6.49 |
| Rhizosphere | 75.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182008_10017269 | 3300014497 | Bacteria | 3744 |
| 2 | SwRhRL2b_contig_1502704 | 2162886007 | Bacteria | 2858 |
| 3 | SwRhRL2b_contig_713724 | 2162886007 | Bacteria | 1815 |
| 4 | JGI24739J22299_10006992 | 3300001989 | Bacteria | 4249 |
| 5 | JGI24737J22298_10000144 | 3300001990 | Bacteria | 22021 |
| 6 | JGI24737J22298_10002055 | 3300001990 | Bacteria | 7201 |
| 7 | JGI24737J22298_10013143 | 3300001990 | Bacteria | 2697 |
| 8 | JGI24737J22298_10013188 | 3300001990 | Bacteria | 2691 |
| 9 | JGI24738J21930_10000320 | 3300002075 | Bacteria | 13242 |
| 10 | JGI24738J21930_10002591 | 3300002075 | Bacteria | 4680 |
| 11 | JGI24751J29686_10001193 | 3300002459 | Bacteria | 5501 |
| 12 | JGI25162J39368_1000037 | 3300002737 | Bacteria | 179339 |
| 13 | JGI25162J39368_1000216 | 3300002737 | Bacteria | 60602 |
| 14 | JGI25154J39366_1005127 | 3300002738 | Bacteria | 2157 |
| 15 | JGI25164J39214_1000020 | 3300002772 | Bacteria | 179339 |
| 16 | JGI25164J39214_1000176 | 3300002772 | Bacteria | 59249 |
| 17 | JGI25165J46597_1000077 | 3300003214 | Bacteria | 179339 |
| 18 | JGI25165J46597_1000306 | 3300003214 | Bacteria | 60602 |
| 19 | Ga0055538_1000058 | 3300003751 | Bacteria | 112867 |
| 20 | Ga0055539_1000087 | 3300003752 | Bacteria | 114745 |
| 21 | Ga0055533_1000097 | 3300003756 | Bacteria | 112844 |
| 22 | Ga0055532_1000156 | 3300003758 | Bacteria | 60124 |
| 23 | Ga0055525_1000428 | 3300003759 | Bacteria | 25024 |
| 24 | Ga0055536_1000165 | 3300003781 | Bacteria | 56046 |
| 25 | Ga0055536_1000859 | 3300003781 | Bacteria | 19880 |
| 26 | Ga0055536_1000886 | 3300003781 | Bacteria | 19484 |
| 27 | Ga0055530_10000268 | 3300003791 | Bacteria | 47280 |
| 28 | Ga0055530_10000357 | 3300003791 | Bacteria | 41227 |
| 29 | Ga0055530_10002815 | 3300003791 | Bacteria | 10692 |
| 30 | Ga0055530_10003134 | 3300003791 | Bacteria | 9765 |
| 31 | Ga0055540_1000076 | 3300003792 | Bacteria | 114654 |
| 32 | Ga0055540_1000253 | 3300003792 | Bacteria | 48323 |
| 33 | Ga0055540_1006049 | 3300003792 | Bacteria | 4898 |
| 34 | Ga0055531_10000769 | 3300003794 | Bacteria | 26770 |
| 35 | Ga0055541_1000060 | 3300003841 | Bacteria | 112630 |
| 36 | Ga0065714_10000092 | 3300005288 | Bacteria | 11990 |
| 37 | Ga0065714_10003690 | 3300005288 | Bacteria | 9561 |
| 38 | Ga0065714_10006550 | 3300005288 | Bacteria | 9377 |
| 39 | Ga0065714_10006855 | 3300005288 | Bacteria | 6761 |
| 40 | Ga0065714_10014765 | 3300005288 | Bacteria | 2025 |
| 41 | Ga0065714_10064679 | 3300005288 | Bacteria | 23971 |
| 42 | Ga0065714_10067028 | 3300005288 | Bacteria | 5975 |
| 43 | Ga0065714_10079939 | 3300005288 | Bacteria | 2477 |
| 44 | Ga0065714_10081508 | 3300005288 | Bacteria | 2369 |
| 45 | Ga0065704_10073984 | 3300005289 | Bacteria | 6614 |
| 46 | Ga0065704_10086541 | 3300005289 | Bacteria | 3108 |
| 47 | Ga0065704_10086922 | 3300005289 | Bacteria | 3072 |
| 48 | Ga0065704_10096570 | 3300005289 | Bacteria | 2435 |
| 49 | Ga0065704_10136593 | 3300005289 | Bacteria | 1564 |
| 50 | Ga0065712_10068389 | 3300005290 | Bacteria | 11008 |
| 51 | Ga0065707_10083069 | 3300005295 | Bacteria | 10627 |
| 52 | Ga0070658_10000360 | 3300005327 | Bacteria | 39619 |
| 53 | Ga0070658_10118644 | 3300005327 | Bacteria | 2197 |
| 54 | Ga0070658_10434977 | 3300005327 | Bacteria | 1129 |
| 55 | Ga0070683_100011780 | 3300005329 | Bacteria | 7573 |
| 56 | Ga0070683_100059829 | 3300005329 | Bacteria | 3540 |
| 57 | Ga0070670_100000481 | 3300005331 | Bacteria | 32132 |
| 58 | Ga0070670_100001103 | 3300005331 | Bacteria | 21451 |
| 59 | Ga0070670_100002065 | 3300005331 | Bacteria | 16445 |
| 60 | Ga0070670_100025295 | 3300005331 | Bacteria | 5108 |
| 61 | Ga0070670_100033833 | 3300005331 | Bacteria | 4401 |
| 62 | Ga0070670_100067706 | 3300005331 | Bacteria | 3063 |
| 63 | Ga0070670_100073474 | 3300005331 | Bacteria | 2937 |
| 64 | Ga0070670_100131692 | 3300005331 | Bacteria | 2160 |
| 65 | Ga0070670_100298140 | 3300005331 | Bacteria | 1410 |
| 66 | Ga0070677_10003734 | 3300005333 | Bacteria | 4927 |
| 67 | Ga0070677_10036773 | 3300005333 | Bacteria | 1907 |
| 68 | Ga0068869_100019256 | 3300005334 | Bacteria | 4659 |
| 69 | Ga0068869_100073591 | 3300005334 | Bacteria | 2534 |
| 70 | Ga0070666_10000111 | 3300005335 | Bacteria | 56117 |
| 71 | Ga0070666_10001622 | 3300005335 | Bacteria | 13683 |
| 72 | Ga0070680_100438229 | 3300005336 | Bacteria | 1115 |
| 73 | Ga0070682_100016665 | 3300005337 | Bacteria | 4277 |
| 74 | Ga0070660_100000075 | 3300005339 | Bacteria | 59407 |
| 75 | Ga0070660_100073985 | 3300005339 | Bacteria | 2665 |
| 76 | Ga0070660_100099990 | 3300005339 | Bacteria | 2297 |
| 77 | Ga0070660_100313230 | 3300005339 | Bacteria | 1288 |
| 78 | Ga0070661_100000029 | 3300005344 | Bacteria | 117682 |
| 79 | Ga0070661_100000273 | 3300005344 | Bacteria | 41798 |
| 80 | Ga0070668_100006635 | 3300005347 | Bacteria | 8579 |
| 81 | Ga0070668_100301157 | 3300005347 | Bacteria | 1345 |
| 82 | Ga0070669_100000012 | 3300005353 | Bacteria | 211302 |
| 83 | Ga0070669_100011335 | 3300005353 | Bacteria | 6328 |
| 84 | Ga0070669_100070677 | 3300005353 | Bacteria | 2581 |
| 85 | Ga0070675_100003021 | 3300005354 | Bacteria | 12698 |
| 86 | Ga0070671_100000019 | 3300005355 | Bacteria | 132341 |
| 87 | Ga0070671_100043305 | 3300005355 | Bacteria | 3741 |
| 88 | Ga0070673_100198510 | 3300005364 | Bacteria | 1727 |
| 89 | Ga0070673_100291233 | 3300005364 | Bacteria | 1435 |
| 90 | Ga0070688_100094945 | 3300005365 | Bacteria | 1956 |
| 91 | Ga0070659_100000084 | 3300005366 | Bacteria | 71138 |
| 92 | Ga0070659_100072911 | 3300005366 | Bacteria | 2733 |
| 93 | Ga0070659_100242078 | 3300005366 | Bacteria | 1493 |
| 94 | Ga0070659_100341070 | 3300005366 | Bacteria | 1255 |
| 95 | Ga0070667_100035990 | 3300005367 | Bacteria | 4149 |
| 96 | Ga0070705_100011253 | 3300005440 | Bacteria | 4507 |
| 97 | Ga0070700_100045299 | 3300005441 | Bacteria | 2713 |
| 98 | Ga0070700_100091016 | 3300005441 | Bacteria | 1990 |
| 99 | Ga0070708_100324731 | 3300005445 | Bacteria | 1450 |
| 100 | Ga0070663_100029453 | 3300005455 | Bacteria | 3752 |
| 101 | Ga0070663_100055676 | 3300005455 | Bacteria | 2832 |
| 102 | Ga0070678_100224352 | 3300005456 | Bacteria | 1563 |
| 103 | Ga0070662_100001648 | 3300005457 | Bacteria | 13732 |
| 104 | Ga0070662_100223031 | 3300005457 | Bacteria | 1505 |
| 105 | Ga0070681_10050151 | 3300005458 | Bacteria | 4165 |
| 106 | Ga0070685_10281407 | 3300005466 | Bacteria | 1114 |
| 107 | Ga0070679_100031356 | 3300005530 | Bacteria | 5250 |
| 108 | Ga0068853_100000223 | 3300005539 | Bacteria | 40165 |
| 109 | Ga0068853_100063877 | 3300005539 | Bacteria | 3190 |
| 110 | Ga0070672_100042732 | 3300005543 | Bacteria | 3491 |
| 111 | Ga0070672_100044053 | 3300005543 | Bacteria | 3445 |
| 112 | Ga0070672_100050516 | 3300005543 | Bacteria | 3239 |
| 113 | Ga0070672_100127795 | 3300005543 | Bacteria | 2086 |
| 114 | Ga0070686_100053960 | 3300005544 | Bacteria | 2569 |
| 115 | Ga0070693_100002223 | 3300005547 | Bacteria | 8916 |
| 116 | Ga0070665_100015604 | 3300005548 | Bacteria | 7631 |
| 117 | Ga0070665_100030058 | 3300005548 | Bacteria | 5467 |
| 118 | Ga0070665_100151727 | 3300005548 | Bacteria | 2320 |
| 119 | Ga0070665_100283855 | 3300005548 | Bacteria | 1658 |
| 120 | Ga0070665_100391340 | 3300005548 | Bacteria | 1398 |
| 121 | Ga0068855_100004348 | 3300005563 | Bacteria | 17327 |
| 122 | Ga0068855_100014849 | 3300005563 | Bacteria | 9379 |
| 123 | Ga0070664_100000032 | 3300005564 | Bacteria | 88298 |
| 124 | Ga0070664_100000046 | 3300005564 | Bacteria | 74475 |
| 125 | Ga0070664_100083088 | 3300005564 | Bacteria | 2763 |
| 126 | Ga0070664_100098759 | 3300005564 | Bacteria | 2537 |
| 127 | Ga0070664_100103425 | 3300005564 | Bacteria | 2479 |
| 128 | Ga0068857_100001897 | 3300005577 | Bacteria | 16857 |
| 129 | Ga0068854_100000103 | 3300005578 | Bacteria | 59186 |
| 130 | Ga0068856_100000161 | 3300005614 | Bacteria | 69696 |
| 131 | Ga0068852_100002629 | 3300005616 | Bacteria | 12411 |
| 132 | Ga0068859_100021745 | 3300005617 | Bacteria | 6433 |
| 133 | Ga0068864_100000475 | 3300005618 | Bacteria | 34778 |
| 134 | Ga0068864_100011094 | 3300005618 | Bacteria | 7446 |
| 135 | Ga0068861_100007323 | 3300005719 | Bacteria | 7560 |
| 136 | Ga0068851_10000050 | 3300005834 | Bacteria | 72913 |
| 137 | Ga0068863_100013469 | 3300005841 | Bacteria | 7887 |
| 138 | Ga0068863_100022064 | 3300005841 | Bacteria | 6080 |
| 139 | Ga0068858_100000951 | 3300005842 | Bacteria | 29938 |
| 140 | Ga0068858_100022059 | 3300005842 | Bacteria | 5946 |
| 141 | Ga0068860_100005380 | 3300005843 | Bacteria | 12990 |
| 142 | Ga0068860_100102557 | 3300005843 | Bacteria | 2730 |
| 143 | Ga0068862_100000884 | 3300005844 | Bacteria | 29162 |
| 144 | Ga0068862_100100852 | 3300005844 | Bacteria | 2525 |
| 145 | Ga0081455_10002721 | 3300005937 | Bacteria | 20866 |
| 146 | Ga0075432_10017505 | 3300006058 | Bacteria | 2444 |
| 147 | Ga0075366_10076320 | 3300006195 | Bacteria | 2000 |
| 148 | Ga0097621_100062878 | 3300006237 | Bacteria | 3049 |
| 149 | Ga0097621_100071060 | 3300006237 | Bacteria | 2875 |
| 150 | Ga0097621_100108900 | 3300006237 | Bacteria | 2339 |
| 151 | Ga0068871_100187725 | 3300006358 | Bacteria | 1779 |
| 152 | Ga0068871_100361687 | 3300006358 | Bacteria | 1285 |
| 153 | Ga0075428_100001917 | 3300006844 | Bacteria | 22311 |
| 154 | Ga0075430_100069652 | 3300006846 | Bacteria | 2950 |
| 155 | Ga0075431_100000404 | 3300006847 | Bacteria | 34897 |
| 156 | Ga0075429_100220131 | 3300006880 | Bacteria | 1663 |
| 157 | Ga0068865_100059983 | 3300006881 | Bacteria | 2662 |
| 158 | Ga0097620_100021745 | 3300006931 | Bacteria | 6433 |
| 159 | Ga0099823_1000543 | 3300006944 | Bacteria | 25860 |
| 160 | Ga0079104_1000438 | 3300006946 | Bacteria | 47426 |
| 161 | Ga0079104_1000574 | 3300006946 | Bacteria | 37165 |
| 162 | Ga0079104_1005276 | 3300006946 | Bacteria | 5207 |
| 163 | Ga0099826_10044992 | 3300006948 | Bacteria | 3023 |
| 164 | Ga0105251_10000093 | 3300009011 | Bacteria | 86755 |
| 165 | Ga0105251_10001182 | 3300009011 | Bacteria | 22594 |
| 166 | Ga0105251_10003786 | 3300009011 | Bacteria | 10811 |
| 167 | Ga0105251_10005845 | 3300009011 | Bacteria | 7967 |
| 168 | Ga0105251_10009836 | 3300009011 | Bacteria | 5605 |
| 169 | Ga0105251_10010618 | 3300009011 | Bacteria | 5324 |
| 170 | Ga0105251_10024683 | 3300009011 | Bacteria | 3085 |
| 171 | Ga0105244_10000378 | 3300009036 | Bacteria | 41394 |
| 172 | Ga0105244_10000425 | 3300009036 | Bacteria | 39065 |
| 173 | Ga0105244_10000632 | 3300009036 | Bacteria | 31091 |
| 174 | Ga0105244_10003134 | 3300009036 | Bacteria | 12043 |
| 175 | Ga0105244_10015494 | 3300009036 | Bacteria | 4371 |
| 176 | Ga0105244_10021429 | 3300009036 | Bacteria | 3574 |
| 177 | Ga0105244_10029116 | 3300009036 | Bacteria | 2956 |
| 178 | Ga0105244_10043142 | 3300009036 | Bacteria | 2329 |
| 179 | Ga0105244_10043766 | 3300009036 | Bacteria | 2308 |
| 180 | Ga0105250_10000010 | 3300009092 | Bacteria | 298384 |
| 181 | Ga0105250_10000074 | 3300009092 | Bacteria | 91652 |
| 182 | Ga0105250_10000443 | 3300009092 | Bacteria | 29996 |
| 183 | Ga0105250_10004480 | 3300009092 | Bacteria | 6424 |
| 184 | Ga0105250_10004728 | 3300009092 | Bacteria | 6217 |
| 185 | Ga0105240_10000960 | 3300009093 | Bacteria | 51436 |
| 186 | Ga0105240_10002841 | 3300009093 | Bacteria | 27371 |
| 187 | Ga0105247_10002298 | 3300009101 | Bacteria | 13070 |
| 188 | Ga0105243_10000158 | 3300009148 | Bacteria | 77305 |
| 189 | Ga0105243_10000686 | 3300009148 | Bacteria | 33024 |
| 190 | Ga0105243_10024238 | 3300009148 | Bacteria | 4628 |
| 191 | Ga0105243_10198123 | 3300009148 | Bacteria | 1759 |
| 192 | Ga0105241_10016472 | 3300009174 | Bacteria | 5422 |
| 193 | Ga0105242_10002245 | 3300009176 | Bacteria | 15242 |
| 194 | Ga0105242_10068918 | 3300009176 | Bacteria | 2928 |
| 195 | Ga0105242_10104166 | 3300009176 | Bacteria | 2408 |
| 196 | Ga0105248_10000223 | 3300009177 | Bacteria | 65010 |
| 197 | Ga0105248_10004096 | 3300009177 | Bacteria | 16121 |
| 198 | Ga0105248_10040920 | 3300009177 | Bacteria | 5196 |
| 199 | Ga0105248_10625895 | 3300009177 | Bacteria | 1214 |
| 200 | Ga0105248_10641609 | 3300009177 | Bacteria | 1198 |
| 201 | Ga0105237_10001262 | 3300009545 | Bacteria | 33775 |
| 202 | Ga0105238_10001357 | 3300009551 | Bacteria | 24558 |
| 203 | Ga0105238_10022229 | 3300009551 | Bacteria | 6465 |
| 204 | Ga0105249_10001785 | 3300009553 | Bacteria | 18746 |
| 205 | Ga0105249_10251695 | 3300009553 | Bacteria | 1752 |
| 206 | Ga0105249_10272986 | 3300009553 | Bacteria | 1685 |
| 207 | Ga0105239_10002761 | 3300010375 | Bacteria | 22026 |
| 208 | Ga0105246_10000222 | 3300011119 | Bacteria | 28940 |
| 209 | Ga0105246_10004002 | 3300011119 | Bacteria | 8941 |
| 210 | Ga0105246_10032313 | 3300011119 | Bacteria | 3470 |
| 211 | Ga0105246_10104263 | 3300011119 | Bacteria | 2071 |
| 212 | Ga0105246_10320415 | 3300011119 | Bacteria | 1259 |
| 213 | Ga0157345_1000099 | 3300012498 | Bacteria | 17198 |
| 214 | Ga0157347_1002068 | 3300012502 | Bacteria | 1672 |
| 215 | Ga0157373_10001693 | 3300013100 | Bacteria | 16814 |
| 216 | Ga0157373_10002324 | 3300013100 | Bacteria | 14419 |
| 217 | Ga0157373_10005372 | 3300013100 | Bacteria | 9625 |
| 218 | Ga0157373_10012536 | 3300013100 | Bacteria | 6233 |
| 219 | Ga0157373_10062748 | 3300013100 | Bacteria | 2632 |
| 220 | Ga0157371_10000513 | 3300013102 | Bacteria | 46606 |
| 221 | Ga0157371_10000546 | 3300013102 | Bacteria | 44800 |
| 222 | Ga0157371_10003769 | 3300013102 | Bacteria | 13567 |
| 223 | Ga0157371_10005228 | 3300013102 | Bacteria | 11028 |
| 224 | Ga0157371_10097772 | 3300013102 | Bacteria | 2081 |
| 225 | Ga0157370_10001514 | 3300013104 | Bacteria | 28723 |
| 226 | Ga0157370_10043355 | 3300013104 | Bacteria | 4330 |
| 227 | Ga0157370_10058760 | 3300013104 | Bacteria | 3655 |
| 228 | Ga0157370_10274511 | 3300013104 | Bacteria | 1557 |
| 229 | Ga0157369_10010011 | 3300013105 | Bacteria | 10828 |
| 230 | Ga0157369_10030136 | 3300013105 | Bacteria | 5985 |
| 231 | Ga0157369_10046501 | 3300013105 | Bacteria | 4716 |
| 232 | Ga0157369_10050165 | 3300013105 | Bacteria | 4522 |
| 233 | Ga0157369_10337500 | 3300013105 | Bacteria | 1565 |
| 234 | Ga0157369_10345752 | 3300013105 | Bacteria | 1545 |
| 235 | Ga0157374_10005747 | 3300013296 | Bacteria | 10467 |
| 236 | Ga0163162_10002586 | 3300013306 | Bacteria | 17135 |
| 237 | Ga0163162_10003324 | 3300013306 | Bacteria | 15388 |
| 238 | Ga0163162_10006360 | 3300013306 | Bacteria | 11435 |
| 239 | Ga0157372_10002158 | 3300013307 | Bacteria | 21397 |
| 240 | Ga0157372_10004378 | 3300013307 | Bacteria | 15066 |
| 241 | Ga0157372_10010493 | 3300013307 | Bacteria | 9862 |
| 242 | Ga0157375_10003788 | 3300013308 | Bacteria | 13106 |
| 243 | Ga0157375_10024179 | 3300013308 | Bacteria | 5619 |
| 244 | Ga0157375_10581591 | 3300013308 | Bacteria | 1280 |
| 245 | Ga0157375_10589545 | 3300013308 | Bacteria | 1271 |
| 246 | Ga0163163_10000567 | 3300014325 | Bacteria | 32441 |
| 247 | Ga0163163_10039019 | 3300014325 | Bacteria | 4633 |
| 248 | Ga0163163_10451772 | 3300014325 | Bacteria | 1345 |
| 249 | Ga0163163_10531089 | 3300014325 | Bacteria | 1239 |
| 250 | Ga0157380_10047692 | 3300014326 | Bacteria | 3371 |
| 251 | Ga0182008_10000040 | 3300014497 | Bacteria | 120886 |
| 252 | Ga0182008_10004368 | 3300014497 | Bacteria | 8273 |
| 253 | Ga0182008_10014796 | 3300014497 | Bacteria | 4080 |
| 254 | Ga0157379_10000049 | 3300014968 | Bacteria | 74565 |
| 255 | Ga0157379_10024931 | 3300014968 | Bacteria | 5308 |
| 256 | Ga0157379_10170438 | 3300014968 | Bacteria | 1965 |
| 257 | Ga0157376_10258783 | 3300014969 | Bacteria | 1629 |
| 258 | Ga0182006_1001260 | 3300015261 | Bacteria | 15641 |
| 259 | Ga0182006_1001580 | 3300015261 | Bacteria | 13511 |
| 260 | Ga0182006_1002995 | 3300015261 | Bacteria | 8886 |
| 261 | Ga0182006_1020636 | 3300015261 | Bacteria | 2758 |
| 262 | Ga0182007_10000438 | 3300015262 | Bacteria | 25362 |
| 263 | Ga0182007_10002369 | 3300015262 | Bacteria | 9426 |
| 264 | Ga0182007_10027291 | 3300015262 | Bacteria | 1970 |
| 265 | Ga0182005_1000372 | 3300015265 | Bacteria | 24749 |
| 266 | Ga0163161_10004558 | 3300017792 | Bacteria | 9648 |
| 267 | Ga0163161_10098225 | 3300017792 | Bacteria | 2176 |
| 268 | Ga0206350_10761995 | 3300020080 | Bacteria | 1219 |
| 269 | Ga0213875_10001424 | 3300021388 | Bacteria | 15538 |
| 270 | Ga0209435_101655 | 3300025206 | Bacteria | 2730 |
| 271 | Ga0209760_100011 | 3300025207 | Bacteria | 197221 |
| 272 | Ga0209760_100053 | 3300025207 | Bacteria | 103438 |
| 273 | Ga0209784_100040 | 3300025224 | Bacteria | 231812 |
| 274 | Ga0209566_100051 | 3300025225 | Bacteria | 231920 |
| 275 | Ga0209674_100072 | 3300025226 | Bacteria | 231812 |
| 276 | Ga0209147_100067 | 3300025229 | Bacteria | 231812 |
| 277 | Ga0209563_100073 | 3300025230 | Bacteria | 231920 |
| 278 | Ga0209563_100269 | 3300025230 | Bacteria | 22412 |
| 279 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 280 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 281 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 282 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 283 | Ga0209258_101387 | 3300025242 | Bacteria | 8742 |
| 284 | Ga0209646_1000455 | 3300025246 | Bacteria | 21348 |
| 285 | Ga0209677_100063 | 3300025253 | Bacteria | 151440 |
| 286 | Ga0209759_1003641 | 3300025256 | Bacteria | 6065 |
| 287 | Ga0209759_1012272 | 3300025256 | Bacteria | 2382 |
| 288 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 289 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 290 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 291 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 292 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 293 | Ga0209676_1001957 | 3300025292 | Bacteria | 16534 |
| 294 | Ga0209676_1005986 | 3300025292 | Bacteria | 6145 |
| 295 | Ga0209676_1006018 | 3300025292 | Bacteria | 6119 |
| 296 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 297 | Ga0209050_1000235 | 3300025298 | Bacteria | 121420 |
| 298 | Ga0209050_1000595 | 3300025298 | Bacteria | 57712 |
| 299 | Ga0209050_1003490 | 3300025298 | Bacteria | 11523 |
| 300 | Ga0209051_1000043 | 3300025303 | Bacteria | 305473 |
| 301 | Ga0209051_1000123 | 3300025303 | Bacteria | 144298 |
| 302 | Ga0209051_1000407 | 3300025303 | Bacteria | 59487 |
| 303 | Ga0209257_1000098 | 3300025304 | Bacteria | 256390 |
| 304 | Ga0209257_1022723 | 3300025304 | Bacteria | 2227 |
| 305 | Ga0207697_10000003 | 3300025315 | Bacteria | 90538 |
| 306 | Ga0207697_10019883 | 3300025315 | Bacteria | 2751 |
| 307 | Ga0207656_10000390 | 3300025321 | Bacteria | 14756 |
| 308 | Ga0207696_1000010 | 3300025711 | Bacteria | 534681 |
| 309 | Ga0207696_1000045 | 3300025711 | Bacteria | 296484 |
| 310 | Ga0207696_1000101 | 3300025711 | Bacteria | 170899 |
| 311 | Ga0207696_1000133 | 3300025711 | Bacteria | 131987 |
| 312 | Ga0207696_1000171 | 3300025711 | Bacteria | 102599 |
| 313 | Ga0207696_1005619 | 3300025711 | Bacteria | 5175 |
| 314 | Ga0207696_1006182 | 3300025711 | Bacteria | 4868 |
| 315 | Ga0207696_1006507 | 3300025711 | Bacteria | 4702 |
| 316 | Ga0207696_1007381 | 3300025711 | Bacteria | 4311 |
| 317 | Ga0207655_1000019 | 3300025728 | Bacteria | 536324 |
| 318 | Ga0207655_1000337 | 3300025728 | Bacteria | 68266 |
| 319 | Ga0207655_1000461 | 3300025728 | Bacteria | 53372 |
| 320 | Ga0207655_1000619 | 3300025728 | Bacteria | 42670 |
| 321 | Ga0207655_1000645 | 3300025728 | Bacteria | 41696 |
| 322 | Ga0207655_1001070 | 3300025728 | Bacteria | 27170 |
| 323 | Ga0207655_1003393 | 3300025728 | Bacteria | 11893 |
| 324 | Ga0207655_1004760 | 3300025728 | Bacteria | 9470 |
| 325 | Ga0207655_1006166 | 3300025728 | Bacteria | 7996 |
| 326 | Ga0207655_1006508 | 3300025728 | Bacteria | 7728 |
| 327 | Ga0207655_1013543 | 3300025728 | Bacteria | 4675 |
| 328 | Ga0207655_1016020 | 3300025728 | Bacteria | 4127 |
| 329 | Ga0207655_1023541 | 3300025728 | Bacteria | 3050 |
| 330 | Ga0207655_1028263 | 3300025728 | Bacteria | 2648 |
| 331 | Ga0207713_1000030 | 3300025735 | Bacteria | 284027 |
| 332 | Ga0207713_1000150 | 3300025735 | Bacteria | 105170 |
| 333 | Ga0207713_1000802 | 3300025735 | Bacteria | 29111 |
| 334 | Ga0207713_1001465 | 3300025735 | Bacteria | 18733 |
| 335 | Ga0207713_1001551 | 3300025735 | Bacteria | 18072 |
| 336 | Ga0207713_1004378 | 3300025735 | Bacteria | 9176 |
| 337 | Ga0207713_1004594 | 3300025735 | Bacteria | 8925 |
| 338 | Ga0207713_1006237 | 3300025735 | Bacteria | 7298 |
| 339 | Ga0207713_1009012 | 3300025735 | Bacteria | 5673 |
| 340 | Ga0207713_1015668 | 3300025735 | Bacteria | 3878 |
| 341 | Ga0207713_1019916 | 3300025735 | Bacteria | 3267 |
| 342 | Ga0207713_1022117 | 3300025735 | Bacteria | 3028 |
| 343 | Ga0207713_1030814 | 3300025735 | Bacteria | 2383 |
| 344 | Ga0207682_10001869 | 3300025893 | Bacteria | 9592 |
| 345 | Ga0207682_10006962 | 3300025893 | Bacteria | 4533 |
| 346 | Ga0207682_10050258 | 3300025893 | Bacteria | 1723 |
| 347 | Ga0207710_10001155 | 3300025900 | Bacteria | 13432 |
| 348 | Ga0207688_10069600 | 3300025901 | Bacteria | 1994 |
| 349 | Ga0207680_10000144 | 3300025903 | Bacteria | 34034 |
| 350 | Ga0207680_10016502 | 3300025903 | Bacteria | 3878 |
| 351 | Ga0207680_10037264 | 3300025903 | Bacteria | 2807 |
| 352 | Ga0207647_10008997 | 3300025904 | Bacteria | 7115 |
| 353 | Ga0207647_10029649 | 3300025904 | Bacteria | 3537 |
| 354 | Ga0207645_10023195 | 3300025907 | Bacteria | 4033 |
| 355 | Ga0207643_10005840 | 3300025908 | Bacteria | 6573 |
| 356 | Ga0207705_10002254 | 3300025909 | Bacteria | 14918 |
| 357 | Ga0207705_10037331 | 3300025909 | Bacteria | 3476 |
| 358 | Ga0207705_10056220 | 3300025909 | Bacteria | 2837 |
| 359 | Ga0207707_10000165 | 3300025912 | Bacteria | 69371 |
| 360 | Ga0207695_10018974 | 3300025913 | Bacteria | 7932 |
| 361 | Ga0207671_10000287 | 3300025914 | Bacteria | 74587 |
| 362 | Ga0207660_10017010 | 3300025917 | Bacteria | 4824 |
| 363 | Ga0207657_10000164 | 3300025919 | Bacteria | 67184 |
| 364 | Ga0207649_10000068 | 3300025920 | Bacteria | 91623 |
| 365 | Ga0207649_10000580 | 3300025920 | Bacteria | 25006 |
| 366 | Ga0207649_10186007 | 3300025920 | Bacteria | 1457 |
| 367 | Ga0207652_10002078 | 3300025921 | Bacteria | 17253 |
| 368 | Ga0207652_10041853 | 3300025921 | Bacteria | 3896 |
| 369 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 370 | Ga0207681_10009998 | 3300025923 | Bacteria | 5807 |
| 371 | Ga0207681_10048896 | 3300025923 | Bacteria | 2856 |
| 372 | Ga0207681_10160101 | 3300025923 | Bacteria | 1696 |
| 373 | Ga0207694_10037804 | 3300025924 | Bacteria | 3710 |
| 374 | Ga0207650_10000174 | 3300025925 | Bacteria | 75634 |
| 375 | Ga0207650_10000405 | 3300025925 | Bacteria | 38683 |
| 376 | Ga0207650_10007930 | 3300025925 | Bacteria | 7236 |
| 377 | Ga0207650_10013387 | 3300025925 | Bacteria | 5680 |
| 378 | Ga0207650_10081984 | 3300025925 | Bacteria | 2448 |
| 379 | Ga0207650_10093167 | 3300025925 | Bacteria | 2306 |
| 380 | Ga0207659_10004712 | 3300025926 | Bacteria | 8269 |
| 381 | Ga0207659_10145607 | 3300025926 | Bacteria | 1844 |
| 382 | Ga0207644_10000031 | 3300025931 | Bacteria | 134402 |
| 383 | Ga0207644_10005888 | 3300025931 | Bacteria | 7995 |
| 384 | Ga0207690_10000800 | 3300025932 | Bacteria | 20216 |
| 385 | Ga0207690_10109788 | 3300025932 | Bacteria | 1985 |
| 386 | Ga0207690_10130880 | 3300025932 | Bacteria | 1836 |
| 387 | Ga0207706_10000196 | 3300025933 | Bacteria | 67184 |
| 388 | Ga0207706_10000922 | 3300025933 | Bacteria | 30101 |
| 389 | Ga0207706_10015788 | 3300025933 | Bacteria | 6826 |
| 390 | Ga0207706_10037199 | 3300025933 | Bacteria | 4323 |
| 391 | Ga0207706_10218476 | 3300025933 | Bacteria | 1669 |
| 392 | Ga0207706_10258473 | 3300025933 | Bacteria | 1521 |
| 393 | Ga0207686_10003119 | 3300025934 | Bacteria | 8910 |
| 394 | Ga0207686_10084879 | 3300025934 | Bacteria | 2076 |
| 395 | Ga0207709_10000053 | 3300025935 | Bacteria | 225514 |
| 396 | Ga0207709_10001914 | 3300025935 | Bacteria | 13713 |
| 397 | Ga0207709_10010049 | 3300025935 | Bacteria | 5214 |
| 398 | Ga0207709_10012305 | 3300025935 | Bacteria | 4715 |
| 399 | Ga0207669_10038650 | 3300025937 | Bacteria | 2750 |
| 400 | Ga0207669_10251129 | 3300025937 | Bacteria | 1317 |
| 401 | Ga0207704_10217314 | 3300025938 | Bacteria | 1411 |
| 402 | Ga0207691_10056697 | 3300025940 | Bacteria | 3568 |
| 403 | Ga0207691_10057327 | 3300025940 | Bacteria | 3545 |
| 404 | Ga0207691_10061719 | 3300025940 | Bacteria | 3404 |
| 405 | Ga0207691_10105271 | 3300025940 | Bacteria | 2513 |
| 406 | Ga0207691_10127219 | 3300025940 | Bacteria | 2253 |
| 407 | Ga0207691_10141275 | 3300025940 | Bacteria | 2122 |
| 408 | Ga0207711_10000123 | 3300025941 | Bacteria | 80861 |
| 409 | Ga0207711_10000698 | 3300025941 | Bacteria | 33120 |
| 410 | Ga0207689_10074496 | 3300025942 | Bacteria | 2789 |
| 411 | Ga0207661_10007562 | 3300025944 | Bacteria | 7728 |
| 412 | Ga0207661_10167228 | 3300025944 | Bacteria | 1912 |
| 413 | Ga0207679_10000018 | 3300025945 | Bacteria | 238375 |
| 414 | Ga0207679_10001145 | 3300025945 | Bacteria | 16891 |
| 415 | Ga0207679_10248713 | 3300025945 | Bacteria | 1510 |
| 416 | Ga0207667_10001975 | 3300025949 | Bacteria | 25689 |
| 417 | Ga0207667_10002663 | 3300025949 | Bacteria | 22069 |
| 418 | Ga0207651_10283270 | 3300025960 | Bacteria | 1371 |
| 419 | Ga0207651_10283632 | 3300025960 | Bacteria | 1370 |
| 420 | Ga0207668_10002124 | 3300025972 | Bacteria | 11562 |
| 421 | Ga0207640_10000333 | 3300025981 | Bacteria | 31425 |
| 422 | Ga0207658_10004817 | 3300025986 | Bacteria | 9333 |
| 423 | Ga0207703_10024596 | 3300026035 | Bacteria | 4737 |
| 424 | Ga0207703_10111778 | 3300026035 | Bacteria | 2333 |
| 425 | Ga0207639_10036655 | 3300026041 | Bacteria | 3636 |
| 426 | Ga0207639_10119862 | 3300026041 | Bacteria | 2160 |
| 427 | Ga0207678_10031160 | 3300026067 | Bacteria | 4652 |
| 428 | Ga0207678_10073345 | 3300026067 | Bacteria | 2933 |
| 429 | Ga0207678_10148066 | 3300026067 | Bacteria | 2004 |
| 430 | Ga0207708_10007541 | 3300026075 | Bacteria | 8046 |
| 431 | Ga0207708_10069841 | 3300026075 | Bacteria | 2689 |
| 432 | Ga0207702_10000435 | 3300026078 | Bacteria | 47593 |
| 433 | Ga0207641_10002235 | 3300026088 | Bacteria | 18106 |
| 434 | Ga0207641_10006526 | 3300026088 | Bacteria | 9814 |
| 435 | Ga0207641_10074108 | 3300026088 | Bacteria | 2935 |
| 436 | Ga0207676_10003318 | 3300026095 | Bacteria | 11425 |
| 437 | Ga0207676_10007039 | 3300026095 | Bacteria | 7970 |
| 438 | Ga0207674_10001036 | 3300026116 | Bacteria | 36260 |
| 439 | Ga0207674_10010161 | 3300026116 | Bacteria | 10701 |
| 440 | Ga0207675_100001371 | 3300026118 | Bacteria | 24423 |
| 441 | Ga0207675_100005252 | 3300026118 | Bacteria | 12466 |
| 442 | Ga0207683_10175804 | 3300026121 | Bacteria | 1940 |
| 443 | Ga0207698_10003125 | 3300026142 | Bacteria | 9926 |
| 444 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 445 | Ga0209281_1000174 | 3300027111 | Bacteria | 151659 |
| 446 | Ga0209281_1003018 | 3300027111 | Bacteria | 5960 |
| 447 | Ga0209389_1000018 | 3300027296 | Bacteria | 179898 |
| 448 | Ga0209371_1000666 | 3300027312 | Bacteria | 29975 |
| 449 | Ga0209282_1092395 | 3300027666 | Bacteria | 1581 |
| 450 | Ga0209974_10025277 | 3300027876 | Bacteria | 1965 |
| 451 | Ga0207428_10038918 | 3300027907 | Bacteria | 3862 |
| 452 | Ga0207428_10210306 | 3300027907 | Bacteria | 1462 |
| 453 | Ga0268266_10009597 | 3300028379 | Bacteria | 8511 |
| 454 | Ga0268266_10098604 | 3300028379 | Bacteria | 2571 |
| 455 | Ga0268265_10000525 | 3300028380 | Bacteria | 39061 |
| 456 | Ga0268264_10004731 | 3300028381 | Bacteria | 11562 |
| 457 | Ga0265326_10005086 | 3300028558 | Bacteria | 4162 |
| 458 | Ga0265334_10010136 | 3300028573 | Bacteria | 3978 |
| 459 | Ga0265334_10025593 | 3300028573 | Bacteria | 2388 |
| 460 | Ga0265318_10000008 | 3300028577 | Bacteria | 279221 |
| 461 | Ga0265338_10025529 | 3300028800 | Bacteria | 5993 |
| 462 | Ga0265338_10053233 | 3300028800 | Bacteria | 3623 |
| 463 | Ga0265338_10190987 | 3300028800 | Bacteria | 1553 |
| 464 | Ga0268256_1006739 | 3300030500 | Bacteria | 4220 |
| 465 | Ga0307511_10036182 | 3300030521 | Bacteria | 4293 |
| 466 | Ga0316177_1096918 | 3300030731 | Bacteria | 1709 |
| 467 | Ga0316178_1171693 | 3300030735 | Bacteria | 22825 |
| 468 | Ga0316183_1154612 | 3300030742 | Bacteria | 1255 |
| 469 | Ga0265330_10000038 | 3300031235 | Bacteria | 120147 |
| 470 | Ga0265332_10000580 | 3300031238 | Bacteria | 24285 |
| 471 | Ga0265328_10006062 | 3300031239 | Bacteria | 5146 |
| 472 | Ga0265328_10013427 | 3300031239 | Bacteria | 3243 |
| 473 | Ga0265320_10000066 | 3300031240 | Bacteria | 95235 |
| 474 | Ga0265339_10058964 | 3300031249 | Bacteria | 2071 |
| 475 | Ga0265331_10000004 | 3300031250 | Bacteria | 476985 |
| 476 | Ga0265327_10001809 | 3300031251 | Bacteria | 25053 |
| 477 | Ga0265327_10009028 | 3300031251 | Bacteria | 7292 |
| 478 | Ga0265316_10004013 | 3300031344 | Bacteria | 14741 |
| 479 | Ga0265316_10015639 | 3300031344 | Bacteria | 6625 |
| 480 | Ga0307513_10060130 | 3300031456 | Bacteria | 4029 |
| 481 | Ga0307513_10124889 | 3300031456 | Bacteria | 2532 |
| 482 | Ga0307509_10060191 | 3300031507 | Bacteria | 4015 |
| 483 | Ga0307408_100001830 | 3300031548 | Bacteria | 15493 |
| 484 | Ga0307408_100349426 | 3300031548 | Bacteria | 1254 |
| 485 | Ga0265313_10000005 | 3300031595 | Bacteria | 187978 |
| 486 | Ga0265314_10000190 | 3300031711 | Bacteria | 91400 |
| 487 | Ga0265314_10013707 | 3300031711 | Bacteria | 6535 |
| 488 | Ga0265314_10014743 | 3300031711 | Bacteria | 6235 |
| 489 | Ga0265314_10015721 | 3300031711 | Bacteria | 5997 |
| 490 | Ga0265314_10029861 | 3300031711 | Bacteria | 4045 |
| 491 | Ga0265342_10005640 | 3300031712 | Bacteria | 9474 |
| 492 | Ga0307405_10000107 | 3300031731 | Bacteria | 34106 |
| 493 | Ga0307405_10015722 | 3300031731 | Bacteria | 4106 |
| 494 | Ga0307405_10043467 | 3300031731 | Bacteria | 2741 |
| 495 | Ga0307413_10007527 | 3300031824 | Bacteria | 5064 |
| 496 | Ga0307413_10141250 | 3300031824 | Bacteria | 1664 |
| 497 | Ga0307410_10065880 | 3300031852 | Bacteria | 2493 |
| 498 | Ga0307410_10324048 | 3300031852 | Bacteria | 1223 |
| 499 | Ga0307406_10017310 | 3300031901 | Bacteria | 4197 |
| 500 | Ga0307407_10004576 | 3300031903 | Bacteria | 5889 |
| 501 | Ga0307407_10114176 | 3300031903 | Bacteria | 1701 |
| 502 | Ga0307412_10098674 | 3300031911 | Bacteria | 2060 |
| 503 | Ga0307412_10395577 | 3300031911 | Bacteria | 1123 |
| 504 | Ga0307409_100017705 | 3300031995 | Bacteria | 4760 |
| 505 | Ga0307409_100022534 | 3300031995 | Bacteria | 4345 |
| 506 | Ga0307409_100055596 | 3300031995 | Bacteria | 3057 |
| 507 | Ga0307409_100181141 | 3300031995 | Bacteria | 1865 |
| 508 | Ga0307416_100023426 | 3300032002 | Bacteria | 4480 |
| 509 | Ga0307416_100264452 | 3300032002 | Bacteria | 1684 |
| 510 | Ga0307414_10041243 | 3300032004 | Bacteria | 3124 |
| 511 | Ga0307414_10115171 | 3300032004 | Bacteria | 2055 |
| 512 | Ga0307414_10144610 | 3300032004 | Bacteria | 1866 |
| 513 | Ga0307411_10005061 | 3300032005 | Bacteria | 6419 |
| 514 | Ga0307411_10009214 | 3300032005 | Bacteria | 5173 |
| 515 | Ga0307411_10027505 | 3300032005 | Bacteria | 3442 |
| 516 | Ga0307411_10092078 | 3300032005 | Bacteria | 2119 |
| 517 | Ga0307415_100244843 | 3300032126 | Bacteria | 1453 |
| 518 | Ga0307510_10004157 | 3300033180 | Bacteria | 16998 |
| 519 | Ga0373951_0005210 | 3300035091 | Bacteria | 3034 |
| 520 | Ga0373960_0025634 | 3300035121 | Bacteria | 1605 |
| 521 | Ga0395899_0017029 | 3300037312 | Bacteria | 5537 |
| 522 | Ga0395899_0037603 | 3300037312 | Bacteria | 3629 |
| 523 | Ga0395899_0046212 | 3300037312 | Bacteria | 3243 |
| 524 | Ga0395900_0005203 | 3300037418 | Bacteria | 13656 |
| 525 | Ga0395900_0099235 | 3300037418 | Bacteria | 2991 |
| 526 | Ga0395900_0167625 | 3300037418 | Bacteria | 2237 |
| 527 | Ga0395898_0027737 | 3300037466 | Bacteria | 5679 |
| 528 | Ga0395898_0073387 | 3300037466 | Bacteria | 3305 |
| 529 | Ga0395898_0078397 | 3300037466 | Bacteria | 3187 |
| 530 | Ga0395898_0107967 | 3300037466 | Bacteria | 2669 |
| 531 | Ga0395905_0008044 | 3300037471 | Bacteria | 10417 |
| 532 | Ga0395905_0020138 | 3300037471 | Bacteria | 6320 |
| 533 | Ga0395905_0067377 | 3300037471 | Bacteria | 3353 |
| 534 | Ga0395905_0287729 | 3300037471 | Bacteria | 1530 |
| 535 | Ga0395905_0360195 | 3300037471 | Bacteria | 1347 |
| 536 | Ga0436364_0615540 | 3300037853 | Bacteria | 2605 |
| 537 | Ga0436364_1297263 | 3300037853 | Bacteria | 8797 |
| 538 | Ga0395901_0004097 | 3300038443 | Bacteria | 14691 |
| 539 | Ga0395901_0008125 | 3300038443 | Bacteria | 10597 |
| 540 | Ga0395901_0022011 | 3300038443 | Bacteria | 6534 |
| 541 | Ga0395901_0145098 | 3300038443 | Bacteria | 2495 |
| 542 | Ga0237819_03304 | 3300038705 | Bacteria | 2905 |
| 543 | Ga0436365_0051966 | 3300039437 | Bacteria | 3208 |
| 544 | Ga0436365_1101983 | 3300039437 | Bacteria | 2087 |
| 545 | Ga0436360_0339290 | 3300039438 | Bacteria | 1311 |
| 546 | Ga0439438_000675 | 3300041405 | Bacteria | 15287 |
| 547 | Ga0439438_000927 | 3300041405 | Bacteria | 13088 |
| 548 | Ga0439438_001315 | 3300041405 | Bacteria | 10996 |
| 549 | Ga0439438_003331 | 3300041405 | Bacteria | 6525 |
| 550 | Ga0439438_005045 | 3300041405 | Bacteria | 4924 |
| 551 | Ga0439447_000654 | 3300041407 | Bacteria | 12846 |
| 552 | Ga0439447_001834 | 3300041407 | Bacteria | 7784 |
| 553 | Ga0439447_002740 | 3300041407 | Bacteria | 6366 |
| 554 | Ga0439447_021080 | 3300041407 | Bacteria | 1720 |
| 555 | Ga0439447_043942 | 3300041407 | Bacteria | 1081 |
| 556 | Ga0439466_0000795 | 3300041411 | Bacteria | 12006 |
| 557 | Ga0439466_0002004 | 3300041411 | Bacteria | 7988 |
| 558 | Ga0439466_0008094 | 3300041411 | Bacteria | 3963 |
| 559 | Ga0439466_0009060 | 3300041411 | Bacteria | 3735 |
| 560 | Ga0439466_0015044 | 3300041411 | Bacteria | 2812 |
| 561 | Ga0439466_0019075 | 3300041411 | Bacteria | 2456 |
| 562 | Ga0439465_0008046 | 3300041413 | Bacteria | 3336 |
| 563 | Ga0451807_0574609 | 3300041486 | Bacteria | 2323 |
| 564 | Ga0451851_1064913 | 3300041507 | Bacteria | 2297 |
| 565 | Ga0439431_0002741 | 3300041997 | Bacteria | 3870 |
| 566 | Ga0439432_000252 | 3300042006 | Bacteria | 19276 |
| 567 | Ga0439432_001213 | 3300042006 | Bacteria | 9754 |
| 568 | Ga0439432_003374 | 3300042006 | Bacteria | 5925 |
| 569 | Ga0439432_006221 | 3300042006 | Bacteria | 4273 |
| 570 | Ga0439451_000817 | 3300042009 | Bacteria | 5954 |
| 571 | Ga0439451_002274 | 3300042009 | Bacteria | 3871 |
| 572 | Ga0439451_013599 | 3300042009 | Bacteria | 1644 |
| 573 | Ga0439452_000874 | 3300042010 | Bacteria | 13926 |
| 574 | Ga0439452_001032 | 3300042010 | Bacteria | 12322 |
| 575 | Ga0439452_020841 | 3300042010 | Bacteria | 1714 |
| 576 | Ga0439452_029297 | 3300042010 | Bacteria | 1367 |
| 577 | Ga0439456_000996 | 3300042013 | Bacteria | 5632 |
| 578 | Ga0439456_004800 | 3300042013 | Bacteria | 2737 |
| 579 | Ga0439456_038039 | 3300042013 | Bacteria | 1039 |
| 580 | Ga0439463_003580 | 3300042016 | Bacteria | 3917 |
| 581 | Ga0439463_022787 | 3300042016 | Bacteria | 1568 |
| 582 | Ga0450911_001009 | 3300042115 | Bacteria | 7200 |
| 583 | Ga0450920_001811 | 3300042122 | Bacteria | 3586 |
| 584 | Ga0450900_001470 | 3300042136 | Bacteria | 2303 |
| 585 | Ga0450902_004301 | 3300042137 | Bacteria | 2113 |
| 586 | Ga0450902_009190 | 3300042137 | Bacteria | 1555 |
| 587 | Ga0450903_002895 | 3300042138 | Bacteria | 2999 |
| 588 | Ga0450906_002716 | 3300042145 | Bacteria | 3850 |
| 589 | Ga0450907_000141 | 3300042146 | Bacteria | 27526 |
| 590 | Ga0450907_000988 | 3300042146 | Bacteria | 6700 |
| 591 | Ga0450907_001547 | 3300042146 | Bacteria | 4898 |
| 592 | Ga0439446_0002864 | 3300042156 | Bacteria | 4205 |
| 593 | Ga0439458_0001847 | 3300042157 | Bacteria | 5265 |
| 594 | Ga0450909_007823 | 3300042185 | Bacteria | 1549 |
| 595 | Ga0439434_0000583 | 3300042435 | Bacteria | 10544 |
| 596 | Ga0439434_0003892 | 3300042435 | Bacteria | 4362 |
| 597 | Ga0439460_0006603 | 3300042461 | Bacteria | 2884 |
| 598 | Ga0450901_000361 | 3300042533 | Bacteria | 5508 |
| 599 | Ga0451577_0001050 | 3300042876 | Bacteria | 39884 |
| 600 | Ga0451577_0008580 | 3300042876 | Bacteria | 9936 |
| 601 | Ga0453683_0000847 | 3300044673 | Bacteria | 29561 |
| 602 | Ga0453683_0056423 | 3300044673 | Bacteria | 2458 |
| 603 | Ga0453683_0099808 | 3300044673 | Bacteria | 1823 |
| 604 | Ga0466961_0038996 | 3300044693 | Bacteria | 3046 |
| 605 | Ga0466963_0001361 | 3300044694 | Bacteria | 13074 |
| 606 | Ga0466963_0117505 | 3300044694 | Bacteria | 1828 |
| 607 | Ga0466964_0110724 | 3300044706 | Bacteria | 1224 |
| 608 | Ga0453684_0000045 | 3300044712 | Bacteria | 582917 |
| 609 | Ga0453684_0020465 | 3300044712 | Bacteria | 9975 |
| 610 | Ga0453684_0037032 | 3300044712 | Bacteria | 6704 |
| 611 | Ga0453684_0079004 | 3300044712 | Bacteria | 4114 |
| 612 | Ga0453684_0089632 | 3300044712 | Bacteria | 3803 |
| 613 | Ga0453684_0258022 | 3300044712 | Bacteria | 1998 |
| 614 | Ga0466957_0128760 | 3300044842 | Bacteria | 1619 |
| 615 | Ga0451576_0418595 | 3300045051 | Bacteria | 1405 |
| 616 | Ga0466967_0045449 | 3300045976 | Bacteria | 3815 |
| 617 | Ga0466967_0072830 | 3300045976 | Bacteria | 3081 |
| 618 | Ga0466967_0165531 | 3300045976 | Bacteria | 2078 |
| 619 | Ga0495617_000345 | 3300046452 | Bacteria | 25597 |
| 620 | Ga0495617_002825 | 3300046452 | Bacteria | 6689 |
| 621 | Ga0495617_026558 | 3300046452 | Bacteria | 1949 |
| 622 | Ga0495617_030501 | 3300046452 | Bacteria | 1812 |
| 623 | Ga0495627_000013 | 3300046453 | Bacteria | 332765 |
| 624 | Ga0495627_001904 | 3300046453 | Bacteria | 10929 |
| 625 | Ga0495627_005567 | 3300046453 | Bacteria | 5050 |
| 626 | Ga0495627_009397 | 3300046453 | Bacteria | 3600 |
| 627 | Ga0495603_0002522 | 3300046455 | Bacteria | 10776 |
| 628 | Ga0495590_0000407 | 3300046457 | Bacteria | 21710 |
| 629 | Ga0495590_0001959 | 3300046457 | Bacteria | 8690 |
| 630 | Ga0495590_0007686 | 3300046457 | Bacteria | 4142 |
| 631 | Ga0495591_000020 | 3300046458 | Bacteria | 217845 |
| 632 | Ga0495591_000349 | 3300046458 | Bacteria | 40818 |
| 633 | Ga0495591_001049 | 3300046458 | Bacteria | 18589 |
| 634 | Ga0495591_001436 | 3300046458 | Bacteria | 14793 |
| 635 | Ga0495591_001838 | 3300046458 | Bacteria | 12517 |
| 636 | Ga0495591_002568 | 3300046458 | Bacteria | 9988 |
| 637 | Ga0495591_002636 | 3300046458 | Bacteria | 9815 |
| 638 | Ga0495591_005454 | 3300046458 | Bacteria | 5887 |
| 639 | Ga0495591_012978 | 3300046458 | Bacteria | 3072 |
| 640 | Ga0495591_016575 | 3300046458 | Bacteria | 2559 |
| 641 | Ga0495638_0002181 | 3300046460 | Bacteria | 16404 |
| 642 | Ga0495638_0052232 | 3300046460 | Bacteria | 2546 |
| 643 | Ga0495653_0001454 | 3300046463 | Bacteria | 18475 |
| 644 | Ga0495653_0004003 | 3300046463 | Bacteria | 11899 |
| 645 | Ga0495653_0013243 | 3300046463 | Bacteria | 6724 |
| 646 | Ga0495650_0000221 | 3300046471 | Bacteria | 118284 |
| 647 | Ga0495650_0006197 | 3300046471 | Bacteria | 7509 |
| 648 | Ga0495650_0008084 | 3300046471 | Bacteria | 6203 |
| 649 | Ga0495650_0055089 | 3300046471 | Bacteria | 1619 |
| 650 | Ga0495605_0000032 | 3300046474 | Bacteria | 210550 |
| 651 | Ga0495605_0000047 | 3300046474 | Bacteria | 171270 |
| 652 | Ga0495605_0000525 | 3300046474 | Bacteria | 32358 |
| 653 | Ga0495605_0002797 | 3300046474 | Bacteria | 10605 |
| 654 | Ga0495605_0008007 | 3300046474 | Bacteria | 5983 |
| 655 | Ga0495605_0024913 | 3300046474 | Bacteria | 3123 |
| 656 | Ga0495605_0027044 | 3300046474 | Bacteria | 2975 |
| 657 | Ga0495639_0000195 | 3300046475 | Bacteria | 31876 |
| 658 | Ga0495584_0000849 | 3300046491 | Bacteria | 19736 |
| 659 | Ga0495584_0001600 | 3300046491 | Bacteria | 13369 |
| 660 | Ga0495584_0003281 | 3300046491 | Bacteria | 8966 |
| 661 | Ga0495584_0005082 | 3300046491 | Bacteria | 6988 |
| 662 | Ga0495584_0011003 | 3300046491 | Bacteria | 4640 |
| 663 | Ga0495584_0015313 | 3300046491 | Bacteria | 3907 |
| 664 | Ga0495585_0000816 | 3300046492 | Bacteria | 26990 |
| 665 | Ga0495585_0000979 | 3300046492 | Bacteria | 23943 |
| 666 | Ga0495585_0007722 | 3300046492 | Bacteria | 6556 |
| 667 | Ga0495585_0081194 | 3300046492 | Bacteria | 1756 |
| 668 | Ga0495585_0161749 | 3300046492 | Bacteria | 1161 |
| 669 | Ga0495594_0016969 | 3300046499 | Bacteria | 3841 |
| 670 | Ga0495596_0000188 | 3300046500 | Bacteria | 42728 |
| 671 | Ga0495596_0025851 | 3300046500 | Bacteria | 2370 |
| 672 | Ga0495596_0082935 | 3300046500 | Bacteria | 1244 |
| 673 | Ga0495607_0000307 | 3300046501 | Bacteria | 51080 |
| 674 | Ga0495607_0000518 | 3300046501 | Bacteria | 37977 |
| 675 | Ga0495607_0000888 | 3300046501 | Bacteria | 27904 |
| 676 | Ga0495607_0001496 | 3300046501 | Bacteria | 20713 |
| 677 | Ga0495607_0002088 | 3300046501 | Bacteria | 16692 |
| 678 | Ga0495607_0003685 | 3300046501 | Bacteria | 11629 |
| 679 | Ga0495607_0004568 | 3300046501 | Bacteria | 10150 |
| 680 | Ga0495607_0012848 | 3300046501 | Bacteria | 5506 |
| 681 | Ga0495607_0016204 | 3300046501 | Bacteria | 4813 |
| 682 | Ga0495607_0017130 | 3300046501 | Bacteria | 4660 |
| 683 | Ga0495607_0026067 | 3300046501 | Bacteria | 3629 |
| 684 | Ga0495583_0000052 | 3300046506 | Bacteria | 211902 |
| 685 | Ga0495583_0001288 | 3300046506 | Bacteria | 26166 |
| 686 | Ga0495583_0002315 | 3300046506 | Bacteria | 16595 |
| 687 | Ga0495583_0002464 | 3300046506 | Bacteria | 15784 |
| 688 | Ga0495583_0002664 | 3300046506 | Bacteria | 14863 |
| 689 | Ga0495606_0000177 | 3300046507 | Bacteria | 112843 |
| 690 | Ga0495606_0000698 | 3300046507 | Bacteria | 52041 |
| 691 | Ga0495606_0003087 | 3300046507 | Bacteria | 18150 |
| 692 | Ga0495606_0003285 | 3300046507 | Bacteria | 17312 |
| 693 | Ga0495606_0007692 | 3300046507 | Bacteria | 9552 |
| 694 | Ga0495606_0009175 | 3300046507 | Bacteria | 8411 |
| 695 | Ga0495606_0030861 | 3300046507 | Bacteria | 3736 |
| 696 | Ga0495606_0057270 | 3300046507 | Bacteria | 2510 |
| 697 | Ga0495606_0060955 | 3300046507 | Bacteria | 2414 |
| 698 | Ga0495606_0159792 | 3300046507 | Bacteria | 1315 |
| 699 | Ga0495610_0002714 | 3300046512 | Bacteria | 14573 |
| 700 | Ga0495610_0005051 | 3300046512 | Bacteria | 9524 |
| 701 | Ga0495610_0016472 | 3300046512 | Bacteria | 4252 |
| 702 | Ga0495610_0017586 | 3300046512 | Bacteria | 4071 |
| 703 | Ga0495610_0019566 | 3300046512 | Bacteria | 3783 |
| 704 | Ga0495610_0025406 | 3300046512 | Bacteria | 3179 |
| 705 | Ga0495610_0025525 | 3300046512 | Bacteria | 3169 |
| 706 | Ga0495610_0069099 | 3300046512 | Bacteria | 1654 |
| 707 | Ga0495616_0001260 | 3300046513 | Bacteria | 17821 |
| 708 | Ga0495616_0003456 | 3300046513 | Bacteria | 10106 |
| 709 | Ga0495616_0004343 | 3300046513 | Bacteria | 8945 |
| 710 | Ga0495616_0004770 | 3300046513 | Bacteria | 8494 |
| 711 | Ga0495616_0016215 | 3300046513 | Bacteria | 4127 |
| 712 | Ga0495616_0029309 | 3300046513 | Bacteria | 2907 |
| 713 | Ga0495620_0000200 | 3300046515 | Bacteria | 45504 |
| 714 | Ga0495620_0000443 | 3300046515 | Bacteria | 27700 |
| 715 | Ga0495620_0000681 | 3300046515 | Bacteria | 21016 |
| 716 | Ga0495620_0001210 | 3300046515 | Bacteria | 15801 |
| 717 | Ga0495620_0002805 | 3300046515 | Bacteria | 10017 |
| 718 | Ga0495620_0020271 | 3300046515 | Bacteria | 3249 |
| 719 | Ga0495630_0181281 | 3300046517 | Bacteria | 1606 |
| 720 | Ga0495631_0000584 | 3300046518 | Bacteria | 24206 |
| 721 | Ga0495631_0003644 | 3300046518 | Bacteria | 8408 |
| 722 | Ga0495631_0008646 | 3300046518 | Bacteria | 5125 |
| 723 | Ga0495632_0000867 | 3300046519 | Bacteria | 26585 |
| 724 | Ga0495632_0003750 | 3300046519 | Bacteria | 10632 |
| 725 | Ga0495632_0004797 | 3300046519 | Bacteria | 9096 |
| 726 | Ga0495632_0005986 | 3300046519 | Bacteria | 7916 |
| 727 | Ga0495632_0006804 | 3300046519 | Bacteria | 7295 |
| 728 | Ga0495632_0007695 | 3300046519 | Bacteria | 6728 |
| 729 | Ga0495632_0021091 | 3300046519 | Bacteria | 3515 |
| 730 | Ga0495632_0103920 | 3300046519 | Bacteria | 1337 |
| 731 | Ga0495637_0000023 | 3300046520 | Bacteria | 172407 |
| 732 | Ga0495637_0000525 | 3300046520 | Bacteria | 27890 |
| 733 | Ga0495637_0000546 | 3300046520 | Bacteria | 27049 |
| 734 | Ga0495637_0002263 | 3300046520 | Bacteria | 10690 |
| 735 | Ga0495637_0003734 | 3300046520 | Bacteria | 8040 |
| 736 | Ga0495637_0004177 | 3300046520 | Bacteria | 7505 |
| 737 | Ga0495637_0005110 | 3300046520 | Bacteria | 6729 |
| 738 | Ga0495637_0022170 | 3300046520 | Bacteria | 2900 |
| 739 | Ga0495643_0000451 | 3300046522 | Bacteria | 52778 |
| 740 | Ga0495643_0000488 | 3300046522 | Bacteria | 50207 |
| 741 | Ga0495643_0005064 | 3300046522 | Bacteria | 9017 |
| 742 | Ga0495643_0008953 | 3300046522 | Bacteria | 6289 |
| 743 | Ga0495643_0024069 | 3300046522 | Bacteria | 3456 |
| 744 | Ga0495643_0032884 | 3300046522 | Bacteria | 2874 |
| 745 | Ga0495644_0000782 | 3300046523 | Bacteria | 13076 |
| 746 | Ga0495644_0038491 | 3300046523 | Bacteria | 1803 |
| 747 | Ga0495648_0001343 | 3300046524 | Bacteria | 24306 |
| 748 | Ga0495648_0005022 | 3300046524 | Bacteria | 11117 |
| 749 | Ga0495648_0006283 | 3300046524 | Bacteria | 9717 |
| 750 | Ga0495648_0006286 | 3300046524 | Bacteria | 9714 |
| 751 | Ga0495648_0016773 | 3300046524 | Bacteria | 5266 |
| 752 | Ga0495648_0021238 | 3300046524 | Bacteria | 4501 |
| 753 | Ga0495648_0021466 | 3300046524 | Bacteria | 4469 |
| 754 | Ga0495648_0042835 | 3300046524 | Bacteria | 2845 |
| 755 | Ga0495648_0052500 | 3300046524 | Bacteria | 2475 |
| 756 | Ga0495642_0001232 | 3300046528 | Bacteria | 11752 |
| 757 | Ga0495642_0002892 | 3300046528 | Bacteria | 6851 |
| 758 | Ga0495654_0000639 | 3300046530 | Bacteria | 27630 |
| 759 | Ga0495654_0001505 | 3300046530 | Bacteria | 15933 |
| 760 | Ga0495654_0005517 | 3300046530 | Bacteria | 7330 |
| 761 | Ga0495654_0006449 | 3300046530 | Bacteria | 6667 |
| 762 | Ga0495654_0007599 | 3300046530 | Bacteria | 6040 |
| 763 | Ga0495654_0038626 | 3300046530 | Bacteria | 2386 |
| 764 | Ga0495654_0085948 | 3300046530 | Bacteria | 1466 |
| 765 | Ga0495654_0111113 | 3300046530 | Bacteria | 1250 |
| 766 | Ga0495587_0019948 | 3300046536 | Bacteria | 4142 |
| 767 | Ga0495609_0000032 | 3300046538 | Bacteria | 211021 |
| 768 | Ga0495609_0000382 | 3300046538 | Bacteria | 37599 |
| 769 | Ga0495609_0000807 | 3300046538 | Bacteria | 23434 |
| 770 | Ga0495609_0007314 | 3300046538 | Bacteria | 5525 |
| 771 | Ga0495609_0009135 | 3300046538 | Bacteria | 4809 |
| 772 | Ga0495609_0050132 | 3300046538 | Bacteria | 1862 |
| 773 | Ga0495597_0000004 | 3300046542 | Bacteria | 307496 |
| 774 | Ga0495597_0003084 | 3300046542 | Bacteria | 10027 |
| 775 | Ga0495597_0005556 | 3300046542 | Bacteria | 6660 |
| 776 | Ga0495622_0000791 | 3300046557 | Bacteria | 17614 |
| 777 | Ga0495622_0001063 | 3300046557 | Bacteria | 14552 |
| 778 | Ga0495622_0001940 | 3300046557 | Bacteria | 10167 |
| 779 | Ga0495622_0008116 | 3300046557 | Bacteria | 4865 |
| 780 | Ga0495633_0000040 | 3300046558 | Bacteria | 177876 |
| 781 | Ga0495633_0005133 | 3300046558 | Bacteria | 8119 |
| 782 | Ga0495633_0018311 | 3300046558 | Bacteria | 3559 |
| 783 | Ga0495656_0173130 | 3300046615 | Bacteria | 1057 |
| 784 | Ga0495668_0003132 | 3300046616 | Bacteria | 12768 |
| 785 | Ga0495668_0030519 | 3300046616 | Bacteria | 3043 |
| 786 | Ga0495668_0102992 | 3300046616 | Bacteria | 1561 |
| 787 | Ga0495611_0000527 | 3300046648 | Bacteria | 22716 |
| 788 | Ga0495611_0006866 | 3300046648 | Bacteria | 4836 |
| 789 | Ga0495611_0009167 | 3300046648 | Bacteria | 4179 |
| 790 | Ga0495611_0020480 | 3300046648 | Bacteria | 2847 |
| 791 | Ga0495625_0000010 | 3300046660 | Bacteria | 381775 |
| 792 | Ga0495625_0017989 | 3300046660 | Bacteria | 5523 |
| 793 | Ga0495625_0047587 | 3300046660 | Bacteria | 3092 |
| 794 | Ga0495625_0056805 | 3300046660 | Bacteria | 2784 |
| 795 | Ga0495625_0084865 | 3300046660 | Bacteria | 2199 |
| 796 | Ga0495635_0001759 | 3300046663 | Bacteria | 14613 |
| 797 | Ga0495659_0000675 | 3300046664 | Bacteria | 12407 |
| 798 | Ga0495661_0000020 | 3300046665 | Bacteria | 196901 |
| 799 | Ga0495661_0000037 | 3300046665 | Bacteria | 164234 |
| 800 | Ga0495661_0000095 | 3300046665 | Bacteria | 109100 |
| 801 | Ga0495661_0000921 | 3300046665 | Bacteria | 26890 |
| 802 | Ga0495661_0053173 | 3300046665 | Bacteria | 2437 |
| 803 | Ga0495661_0128567 | 3300046665 | Bacteria | 1391 |
| 804 | Ga0495588_0058612 | 3300046674 | Bacteria | 1990 |
| 805 | Ga0495646_0025834 | 3300046680 | Bacteria | 3691 |
| 806 | Ga0495669_0006605 | 3300046684 | Bacteria | 4850 |
| 807 | Ga0495669_0012660 | 3300046684 | Bacteria | 3592 |
| 808 | Ga0495624_0002940 | 3300046690 | Bacteria | 12751 |
| 809 | Ga0495670_0000928 | 3300046691 | Bacteria | 14157 |
| 810 | Ga0495670_0001942 | 3300046691 | Bacteria | 10191 |
| 811 | Ga0495670_0002786 | 3300046691 | Bacteria | 8644 |
| 812 | Ga0495671_0001090 | 3300046692 | Bacteria | 18793 |
| 813 | Ga0495671_0003041 | 3300046692 | Bacteria | 10421 |
| 814 | Ga0495671_0015645 | 3300046692 | Bacteria | 4059 |
| 815 | Ga0495671_0016760 | 3300046692 | Bacteria | 3906 |
| 816 | Ga0495671_0030983 | 3300046692 | Bacteria | 2736 |
| 817 | Ga0495671_0051076 | 3300046692 | Bacteria | 2057 |
| 818 | Ga0495649_0000531 | 3300046694 | Bacteria | 32369 |
| 819 | Ga0495649_0000534 | 3300046694 | Bacteria | 32323 |
| 820 | Ga0495649_0000953 | 3300046694 | Bacteria | 22833 |
| 821 | Ga0495649_0031232 | 3300046694 | Bacteria | 2937 |
| 822 | Ga0495649_0074885 | 3300046694 | Bacteria | 1813 |
| 823 | Ga0495649_0105221 | 3300046694 | Bacteria | 1498 |
| 824 | Ga0495589_0000618 | 3300046794 | Bacteria | 23818 |
| 825 | Ga0495589_0000885 | 3300046794 | Bacteria | 18594 |
| 826 | Ga0495589_0002107 | 3300046794 | Bacteria | 11235 |
| 827 | Ga0495589_0002763 | 3300046794 | Bacteria | 9709 |
| 828 | Ga0495589_0090345 | 3300046794 | Bacteria | 1487 |
| 829 | Ga0495600_0045524 | 3300046809 | Bacteria | 2863 |
| 830 | Ga0495600_0133864 | 3300046809 | Bacteria | 1610 |
| 831 | Ga0495660_0000768 | 3300046810 | Bacteria | 24134 |
| 832 | Ga0495660_0000771 | 3300046810 | Bacteria | 24010 |
| 833 | Ga0495660_0002602 | 3300046810 | Bacteria | 11466 |
| 834 | Ga0495660_0003259 | 3300046810 | Bacteria | 10083 |
| 835 | Ga0495660_0039397 | 3300046810 | Bacteria | 2624 |
| 836 | Ga0495660_0075012 | 3300046810 | Bacteria | 1785 |
| 837 | Ga0495604_0003047 | 3300047317 | Bacteria | 13391 |
| 838 | Ga0495604_0129174 | 3300047317 | Bacteria | 1818 |
| 839 | Ga0495636_0023031 | 3300047318 | Bacteria | 2519 |
| 840 | Ga0495636_0061655 | 3300047318 | Bacteria | 1586 |
| 841 | Ga0495672_0001771 | 3300047320 | Bacteria | 20762 |
| 842 | Ga0495672_0002491 | 3300047320 | Bacteria | 16843 |
| 843 | Ga0495672_0002948 | 3300047320 | Bacteria | 14994 |
| 844 | Ga0495672_0003375 | 3300047320 | Bacteria | 13729 |
| 845 | Ga0495672_0003580 | 3300047320 | Bacteria | 13213 |
| 846 | Ga0495672_0003938 | 3300047320 | Bacteria | 12442 |
| 847 | Ga0495672_0005314 | 3300047320 | Bacteria | 10249 |
| 848 | Ga0495672_0006139 | 3300047320 | Bacteria | 9375 |
| 849 | Ga0495672_0015757 | 3300047320 | Bacteria | 5119 |
| 850 | Ga0495672_0016349 | 3300047320 | Bacteria | 5004 |
| 851 | Ga0495672_0073518 | 3300047320 | Bacteria | 1927 |
| 852 | Ga0495676_0000002 | 3300047321 | Bacteria | 373918 |
| 853 | Ga0495676_0042205 | 3300047321 | Bacteria | 3746 |
| 854 | Ga0495680_0007103 | 3300047322 | Bacteria | 10313 |
| 855 | Ga0495680_0019899 | 3300047322 | Bacteria | 5657 |
| 856 | Ga0495680_0052058 | 3300047322 | Bacteria | 3193 |
| 857 | Ga0495680_0108292 | 3300047322 | Bacteria | 2062 |
| 858 | Ga0495683_0000011 | 3300047323 | Bacteria | 212053 |
| 859 | Ga0495683_0000519 | 3300047323 | Bacteria | 29556 |
| 860 | Ga0495683_0000718 | 3300047323 | Bacteria | 24136 |
| 861 | Ga0495683_0006302 | 3300047323 | Bacteria | 6488 |
| 862 | Ga0495683_0007561 | 3300047323 | Bacteria | 5859 |
| 863 | Ga0495687_010330 | 3300047443 | Bacteria | 5126 |
| 864 | Ga0495675_0001939 | 3300047444 | Bacteria | 12334 |
| 865 | Ga0495677_0001720 | 3300047445 | Bacteria | 8781 |
| 866 | Ga0495679_000126 | 3300047446 | Bacteria | 68027 |
| 867 | Ga0495679_001091 | 3300047446 | Bacteria | 16421 |
| 868 | Ga0495679_005567 | 3300047446 | Bacteria | 5556 |
| 869 | Ga0495673_0000563 | 3300047469 | Bacteria | 37758 |
| 870 | Ga0495673_0000756 | 3300047469 | Bacteria | 30629 |
| 871 | Ga0495673_0001439 | 3300047469 | Bacteria | 18987 |
| 872 | Ga0495673_0001621 | 3300047469 | Bacteria | 17438 |
| 873 | Ga0495673_0001970 | 3300047469 | Bacteria | 15194 |
| 874 | Ga0495673_0003378 | 3300047469 | Bacteria | 10551 |
| 875 | Ga0495673_0006887 | 3300047469 | Bacteria | 6623 |
| 876 | Ga0495673_0007767 | 3300047469 | Bacteria | 6117 |
| 877 | Ga0495673_0008715 | 3300047469 | Bacteria | 5668 |
| 878 | Ga0495673_0010471 | 3300047469 | Bacteria | 5037 |
| 879 | Ga0495673_0036989 | 3300047469 | Bacteria | 2234 |
| 880 | Ga0495673_0044780 | 3300047469 | Bacteria | 1971 |
| 881 | Ga0495681_0000621 | 3300047470 | Bacteria | 26997 |
| 882 | Ga0495681_0002873 | 3300047470 | Bacteria | 12171 |
| 883 | Ga0495681_0002922 | 3300047470 | Bacteria | 12072 |
| 884 | Ga0495681_0003184 | 3300047470 | Bacteria | 11454 |
| 885 | Ga0495681_0003366 | 3300047470 | Bacteria | 11124 |
| 886 | Ga0495681_0003624 | 3300047470 | Bacteria | 10743 |
| 887 | Ga0495681_0004146 | 3300047470 | Bacteria | 9950 |
| 888 | Ga0495681_0030713 | 3300047470 | Bacteria | 2731 |
| 889 | Ga0495686_0014292 | 3300047472 | Bacteria | 5468 |
| 890 | Ga0495686_0179329 | 3300047472 | Bacteria | 1228 |
| 891 | Ga0495593_0084687 | 3300047673 | Bacteria | 1636 |
| 892 | Ga0495602_0008233 | 3300048088 | Bacteria | 10888 |
| 893 | Ga0495602_0156768 | 3300048088 | Bacteria | 1782 |
| 894 | Ga0495626_0000007 | 3300048091 | Bacteria | 276374 |
| 895 | Ga0495626_0000781 | 3300048091 | Bacteria | 28964 |
| 896 | Ga0495626_0000797 | 3300048091 | Bacteria | 28539 |
| 897 | Ga0495626_0001164 | 3300048091 | Bacteria | 21936 |
| 898 | Ga0495626_0001500 | 3300048091 | Bacteria | 18405 |
| 899 | Ga0495626_0001690 | 3300048091 | Bacteria | 16964 |
| 900 | Ga0495626_0006100 | 3300048091 | Bacteria | 6917 |
| 901 | Ga0495626_0006819 | 3300048091 | Bacteria | 6447 |
| 902 | Ga0495626_0013391 | 3300048091 | Bacteria | 4261 |
| 903 | Ga0495626_0017937 | 3300048091 | Bacteria | 3567 |
| 904 | Ga0495626_0059893 | 3300048091 | Bacteria | 1736 |
| 905 | Ga0495626_0074656 | 3300048091 | Bacteria | 1516 |
| 906 | Ga0495626_0085399 | 3300048091 | Bacteria | 1395 |
| 907 | Ga0496101_0007202 | 3300048904 | Bacteria | 7200 |
| 908 | Ga0496102_0003978 | 3300048905 | Bacteria | 12520 |
| 909 | Ga0496104_0177396 | 3300048907 | Bacteria | 2041 |
| 910 | Ga0496105_0173126 | 3300048908 | Bacteria | 1769 |
| 911 | Ga0496106_0058248 | 3300048909 | Bacteria | 2924 |
| 912 | Ga0496106_0103707 | 3300048909 | Bacteria | 2208 |
| 913 | Ga0496107_0023371 | 3300048910 | Bacteria | 4371 |
| 914 | Ga0496108_0022808 | 3300048911 | Bacteria | 5150 |
| 915 | Ga0496109_0003591 | 3300048912 | Bacteria | 12952 |
| 916 | Ga0496110_0002942 | 3300048913 | Bacteria | 12904 |
| 917 | Ga0496111_0020343 | 3300048914 | Bacteria | 4620 |
| 918 | Ga0496112_0007709 | 3300048915 | Bacteria | 9576 |
| 919 | Ga0496113_0002270 | 3300048916 | Bacteria | 11090 |
| 920 | Ga0496114_0004290 | 3300048917 | Bacteria | 11034 |
| 921 | Ga0496114_0020811 | 3300048917 | Bacteria | 5326 |
| 922 | Ga0496116_0000085 | 3300048919 | Bacteria | 219553 |
| 923 | Ga0496116_0003914 | 3300048919 | Bacteria | 14507 |
| 924 | Ga0496116_0006839 | 3300048919 | Bacteria | 10247 |
| 925 | Ga0496117_0001083 | 3300048920 | Bacteria | 41245 |
| 926 | Ga0496117_0002358 | 3300048920 | Bacteria | 24144 |
| 927 | Ga0496117_0004322 | 3300048920 | Bacteria | 15803 |
| 928 | Ga0496117_0173301 | 3300048920 | Bacteria | 1249 |
| 929 | Ga0496118_0009700 | 3300048921 | Bacteria | 9668 |
| 930 | Ga0496118_0062969 | 3300048921 | Bacteria | 2732 |
| 931 | Ga0496119_0000541 | 3300048922 | Bacteria | 51479 |
| 932 | Ga0496119_0104444 | 3300048922 | Bacteria | 1585 |
| 933 | Ga0496120_0004162 | 3300048923 | Bacteria | 12424 |
| 934 | Ga0496120_0029700 | 3300048923 | Bacteria | 3333 |
| 935 | Ga0496120_0078933 | 3300048923 | Bacteria | 1788 |
| 936 | Ga0496121_0000505 | 3300048924 | Bacteria | 74599 |
| 937 | Ga0496121_0005098 | 3300048924 | Bacteria | 17123 |
| 938 | Ga0496121_0007632 | 3300048924 | Bacteria | 13001 |
| 939 | Ga0496121_0011923 | 3300048924 | Bacteria | 9568 |
| 940 | Ga0496122_0001401 | 3300048925 | Bacteria | 39147 |
| 941 | Ga0496122_0001761 | 3300048925 | Bacteria | 33221 |
| 942 | Ga0496122_0018748 | 3300048925 | Bacteria | 6366 |
| 943 | Ga0496122_0037920 | 3300048925 | Bacteria | 3870 |
| 944 | Ga0496123_0000087 | 3300048926 | Bacteria | 182994 |
| 945 | Ga0496123_0000437 | 3300048926 | Bacteria | 74882 |
| 946 | Ga0496123_0002183 | 3300048926 | Bacteria | 24932 |
| 947 | Ga0496123_0038198 | 3300048926 | Bacteria | 3378 |
| 948 | Ga0496123_0050249 | 3300048926 | Bacteria | 2787 |
| 949 | Ga0496124_0004536 | 3300048927 | Bacteria | 16166 |
| 950 | Ga0496124_0008936 | 3300048927 | Bacteria | 10381 |
| 951 | Ga0496124_0027679 | 3300048927 | Bacteria | 5082 |
| 952 | Ga0496124_0043945 | 3300048927 | Bacteria | 3837 |
| 953 | Ga0496124_0053822 | 3300048927 | Bacteria | 3409 |
| 954 | Ga0496125_0002759 | 3300048928 | Bacteria | 22224 |
| 955 | Ga0496125_0005425 | 3300048928 | Bacteria | 14185 |
| 956 | Ga0496125_0009623 | 3300048928 | Bacteria | 9884 |
| 957 | Ga0496126_0053490 | 3300048929 | Bacteria | 3663 |
| 958 | Ga0496126_0063867 | 3300048929 | Bacteria | 3299 |
| 959 | Ga0495678_000033 | 3300049459 | Bacteria | 211804 |
| 960 | Ga0495678_000702 | 3300049459 | Bacteria | 30428 |
| 961 | Ga0495678_000787 | 3300049459 | Bacteria | 28437 |
| 962 | Ga0495678_001749 | 3300049459 | Bacteria | 16126 |
| 963 | Ga0495678_007090 | 3300049459 | Bacteria | 5861 |
| 964 | Ga0495678_008645 | 3300049459 | Bacteria | 5117 |
| 965 | Ga0495678_013895 | 3300049459 | Bacteria | 3764 |
| 966 | Ga0495678_074174 | 3300049459 | Bacteria | 1238 |
| 967 | Ga0495682_0000050 | 3300049460 | Bacteria | 110280 |
| 968 | Ga0495682_0001194 | 3300049460 | Bacteria | 14764 |
| 969 | Ga0495682_0002875 | 3300049460 | Bacteria | 7920 |
| 970 | Ga0495682_0051130 | 3300049460 | Bacteria | 1503 |
| 971 | Ga0501034_0000084 | 3300049571 | Bacteria | 168283 |
| 972 | Ga0501034_0041358 | 3300049571 | Bacteria | 4663 |
| 973 | Ga0501042_0225654 | 3300049578 | Bacteria | 1351 |
| 974 | Ga0501047_0000845 | 3300049581 | Bacteria | 31608 |
| 975 | Ga0501074_0020569 | 3300049590 | Bacteria | 4797 |
| 976 | Ga0501080_0069035 | 3300049742 | Bacteria | 3287 |
| 977 | Ga0501241_000495 | 3300049758 | Bacteria | 8494 |
| 978 | nmdc:mga0k408_52644_c1 | 3300050493 | Bacteria | 2359 |
| 979 | nmdc:mga09592_146115_c1 | 3300050508 | Bacteria | 2039 |
| 980 | nmdc:mga0qj67_12029_c1 | 3300050509 | Bacteria | 6505 |
| 981 | nmdc:mga06r32_1736_c1 | 3300050510 | Bacteria | 19590 |
| 982 | Ga0495619_0109851 | 3300053085 | Bacteria | 1883 |
| 983 | Ga0500643_000861 | 3300053087 | Bacteria | 19306 |
| 984 | Ga0500643_005050 | 3300053087 | Bacteria | 5772 |
| 985 | Ga0500583_0109755 | 3300053092 | Bacteria | 1358 |
| 986 | Ga0500641_0004410 | 3300053096 | Bacteria | 4975 |
| 987 | Ga0500556_0058222 | 3300053104 | Bacteria | 1416 |
| 988 | Ga0500655_024570 | 3300053133 | Bacteria | 1141 |
| 989 | Ga0500568_0012910 | 3300053139 | Bacteria | 3824 |
| 990 | Ga0500616_0043392 | 3300053153 | Bacteria | 2403 |
| 991 | Ga0500616_0056895 | 3300053153 | Bacteria | 2040 |
| 992 | Ga0500622_0001897 | 3300053156 | Bacteria | 15781 |
| 993 | Ga0500622_0006129 | 3300053156 | Bacteria | 7059 |
| 994 | Ga0500622_0035128 | 3300053156 | Bacteria | 2624 |
| 995 | Ga0500637_0007182 | 3300053178 | Bacteria | 5552 |
| 996 | Ga0500645_003365 | 3300053730 | Bacteria | 6548 |
| 997 | 2511252494 | 2511231004 | Bacteria | 6669789 |
| 998 | 2511263703 | 2511231006 | Bacteria | 6794709 |
| 999 | 2511272385 | 2511231007 | Bacteria | 6306603 |
| 1000 | 2511278627 | 2511231008 | Bacteria | 6624100 |
| 1001 | 2511292554 | 2511231010 | Bacteria | 6373152 |
| 1002 | 2511293814 | 2511231011 | Bacteria | 6149768 |
| 1003 | 2511299922 | 2511231012 | Bacteria | 6738011 |
| 1004 | 2511312163 | 2511231014 | Bacteria | 6462302 |
| 1005 | 2511320226 | 2511231015 | Bacteria | 6598026 |
| 1006 | 2511329379 | 2511231016 | Bacteria | 6704427 |
| 1007 | 2511334064 | 2511231017 | Bacteria | 6503007 |
| 1008 | 2511337258 | 2511231018 | Bacteria | 6436256 |
| 1009 | 2511344290 | 2511231019 | Bacteria | 6520662 |
| 1010 | 2511352112 | 2511231020 | Bacteria | 6115223 |
| 1011 | 2511357487 | 2511231021 | Bacteria | 7302637 |
| 1012 | 2511363901 | 2511231022 | Bacteria | 6719296 |
| 1013 | 2511370085 | 2511231023 | Bacteria | 6808468 |
| 1014 | 2511376417 | 2511231024 | Bacteria | 5835885 |
| 1015 | 2511416286 | 2511231031 | Bacteria | 6558529 |
| 1016 | 2511826253 | 2511231156 | Bacteria | 6845832 |
| 1017 | 2512324886 | 2512047018 | Bacteria | 6663241 |
| 1018 | 2554816240 | 2554235132 | Bacteria | 6772433 |
| 1019 | 2555249242 | 2554235231 | Bacteria | 5215788 |
| 1020 | 2555668674 | 2554235341 | Bacteria | 6867980 |
| 1021 | 2583791012 | 2582580891 | Bacteria | 6800976 |
| 1022 | 2597856843 | 2597489887 | Bacteria | 6666321 |
| 1023 | 2597863055 | 2597489888 | Bacteria | 6179543 |
| 1024 | 2597868848 | 2597489889 | Bacteria | 6297495 |
| 1025 | 2599330493 | 2599185155 | Bacteria | 5827168 |
| 1026 | 2599357045 | 2599185160 | Bacteria | 6844013 |
| 1027 | 2599362168 | 2599185161 | Bacteria | 6960462 |
| 1028 | 2599368488 | 2599185162 | Bacteria | 6957254 |
| 1029 | 2599375277 | 2599185163 | Bacteria | 6995158 |
| 1030 | 2599382150 | 2599185164 | Bacteria | 6841688 |
| 1031 | 2599388597 | 2599185165 | Bacteria | 6843250 |
| 1032 | 2599394135 | 2599185166 | Bacteria | 6959206 |
| 1033 | 2599401638 | 2599185167 | Bacteria | 6353609 |
| 1034 | 2599405900 | 2599185168 | Bacteria | 6997636 |
| 1035 | 2599451820 | 2599185179 | Bacteria | 6611171 |
| 1036 | 2599464450 | 2599185181 | Bacteria | 6844519 |
| 1037 | 2599468774 | 2599185182 | Bacteria | 6883168 |
| 1038 | 2599483870 | 2599185185 | Bacteria | 6652270 |
| 1039 | 2599493473 | 2599185186 | Bacteria | 6831633 |
| 1040 | 2599509596 | 2599185189 | Bacteria | 5862825 |
| 1041 | 2599514883 | 2599185190 | Bacteria | 6285678 |
| 1042 | 2599520980 | 2599185191 | Bacteria | 6297582 |
| 1043 | 2599613485 | 2599185212 | Bacteria | 6765997 |
| 1044 | 2599772392 | 2599185248 | Bacteria | 6696816 |
| 1045 | 2599801516 | 2599185257 | Bacteria | 6492581 |
| 1046 | 2599882230 | 2599185288 | Bacteria | 6666191 |
| 1047 | 2599888887 | 2599185289 | Bacteria | 6778765 |
| 1048 | 2599894320 | 2599185290 | Bacteria | 6289611 |
| 1049 | 2599900516 | 2599185291 | Bacteria | 6775623 |
| 1050 | 2599944011 | 2599185302 | Bacteria | 5954930 |
| 1051 | 2599951530 | 2599185303 | Bacteria | 6512725 |
| 1052 | 2599955777 | 2599185304 | Bacteria | 5951361 |
| 1053 | 2599961412 | 2599185305 | Bacteria | 6748700 |
| 1054 | 2599967262 | 2599185306 | Bacteria | 6637356 |
| 1055 | 2599971598 | 2599185307 | Bacteria | 6194719 |
| 1056 | 2599979343 | 2599185308 | Bacteria | 6621546 |
| 1057 | 2599985578 | 2599185309 | Bacteria | 5969593 |
| 1058 | 2599989451 | 2599185310 | Bacteria | 6014457 |
| 1059 | 2599994375 | 2599185311 | Bacteria | 6354990 |
| 1060 | 2600000153 | 2599185312 | Bacteria | 5912071 |
| 1061 | 2600008403 | 2599185313 | Bacteria | 6658188 |
| 1062 | 2600013228 | 2599185314 | Bacteria | 6621749 |
| 1063 | 2600019646 | 2599185315 | Bacteria | 6771107 |
| 1064 | 2600023669 | 2599185316 | Bacteria | 6320029 |
| 1065 | 2600032313 | 2599185317 | Bacteria | 6435722 |
| 1066 | 2600038757 | 2599185318 | Bacteria | 6961590 |
| 1067 | 2600044202 | 2599185319 | Bacteria | 6637840 |
| 1068 | 2600048460 | 2599185320 | Bacteria | 5963263 |
| 1069 | 2600054156 | 2599185321 | Bacteria | 6764560 |
| 1070 | 2600060374 | 2599185322 | Bacteria | 6763055 |
| 1071 | 2600066533 | 2599185323 | Bacteria | 6688755 |
| 1072 | 2600073400 | 2599185324 | Bacteria | 6590677 |
| 1073 | 2600078156 | 2599185325 | Bacteria | 6324919 |
| 1074 | 2600216727 | 2599185356 | Bacteria | 6843884 |
| 1075 | 2600361875 | 2600254930 | Bacteria | 6431253 |
| 1076 | 2600365812 | 2600254931 | Bacteria | 6734225 |
| 1077 | 2601625160 | 2600255283 | Bacteria | 6061572 |
| 1078 | 2601694234 | 2600255296 | Bacteria | 5784754 |
| 1079 | 2601776676 | 2600255313 | Bacteria | 6842543 |
| 1080 | 2601795499 | 2600255318 | Bacteria | 6383414 |
| 1081 | 2606075569 | 2603880185 | Bacteria | 6379190 |
| 1082 | 2606128520 | 2603880199 | Bacteria | 6377649 |
| 1083 | 2608380358 | 2606217733 | Bacteria | 6360972 |
| 1084 | 2621300869 | 2619619299 | Bacteria | 6649820 |
| 1085 | 2624479435 | 2623620443 | Bacteria | 6427864 |
| 1086 | 2624493575 | 2623620446 | Bacteria | 6500345 |
| 1087 | 2643841755 | 2643221565 | Bacteria | 6216018 |
| 1088 | 2643871827 | 2643221571 | Bacteria | 6228673 |
| 1089 | 2643952572 | 2643221589 | Bacteria | 6250934 |
| 1090 | 2644022334 | 2643221602 | Bacteria | 6249926 |
| 1091 | 2644187154 | 2643221633 | Bacteria | 6733554 |
| 1092 | 2644286103 | 2643221650 | Bacteria | 7029547 |
| 1093 | 2644623121 | 2643221713 | Bacteria | 6554480 |
| 1094 | 2652547578 | 2651869719 | Bacteria | 6047974 |
| 1095 | 2671093177 | 2667528170 | Bacteria | 6786960 |
| 1096 | 2671098807 | 2667528171 | Bacteria | 6900659 |
| 1097 | 2671128956 | 2667528176 | Bacteria | 6724917 |
| 1098 | 2671768465 | 2671180172 | Bacteria | 6495783 |
| 1099 | 2677898235 | 2675903420 | Bacteria | 6247433 |
| 1100 | 2678264593 | 2675903515 | Bacteria | 6580491 |
| 1101 | 2715753829 | 2713897148 | Bacteria | 5883533 |
| 1102 | 2715757702 | 2713897149 | Bacteria | 6506249 |
| 1103 | 2718633283 | 2718217725 | Bacteria | 5758958 |
| 1104 | 2723247873 | 2721755607 | Bacteria | 5841722 |
| 1105 | 2738670506 | 2738541265 | Bacteria | 6594665 |
| 1106 | 2738691736 | 2738541271 | Bacteria | 5657310 |
| 1107 | 2738748899 | 2738541282 | Bacteria | 6593925 |
| 1108 | 2738810883 | 2738541294 | Bacteria | 6925949 |
| 1109 | 2738857941 | 2738541303 | Bacteria | 6591772 |
| 1110 | 2738898243 | 2738541309 | Bacteria | 6926455 |
| 1111 | 2739200857 | 2738543004 | Bacteria | 6381073 |
| 1112 | 2739261109 | 2738543015 | Bacteria | 6750701 |
| 1113 | 2739267510 | 2738543016 | Bacteria | 5657564 |
| 1114 | 2739316020 | 2738543025 | Bacteria | 6600348 |
| 1115 | 2743736271 | 2740892503 | Bacteria | 6855563 |
| 1116 | 2745005047 | 2744054620 | Bacteria | 6551379 |
| 1117 | 2765582840 | 2765235841 | Bacteria | 6137024 |
| 1118 | 2774122877 | 2773857670 | Bacteria | 6407454 |
| 1119 | 2774137593 | 2773857673 | Bacteria | 6513460 |
| 1120 | 2784265658 | 2784132063 | Bacteria | 6262788 |
| 1121 | 2784315235 | 2784132072 | Bacteria | 6596533 |
| 1122 | 2794595091 | 2791355520 | Bacteria | 5948615 |
| 1123 | 2807409421 | 2806310737 | Bacteria | 5751088 |
| 1124 | 2807457723 | 2806310745 | Bacteria | 5742165 |
| 1125 | 2808857046 | 2808606361 | Bacteria | 6136259 |
| 1126 | 2808926991 | 2808606376 | Bacteria | 6248667 |
| 1127 | 2808927363 | 2808606377 | Bacteria | 6646337 |
| 1128 | 2808937118 | 2808606378 | Bacteria | 6177535 |
| 1129 | 2808949075 | 2808606380 | Bacteria | 6248705 |
| 1130 | 2808950098 | 2808606381 | Bacteria | 6646461 |
| 1131 | 2808957685 | 2808606382 | Bacteria | 6841132 |
| 1132 | 2808965434 | 2808606383 | Bacteria | 6138645 |
| 1133 | 2808979404 | 2808606385 | Bacteria | 6711065 |
| 1134 | 2808995328 | 2808606388 | Bacteria | 6706662 |
| 1135 | 2809000325 | 2808606389 | Bacteria | 6138126 |
| 1136 | 2809216372 | 2808606445 | Bacteria | 6057339 |
| 1137 | 2812365921 | 2811994881 | Bacteria | 6298475 |
| 1138 | 2817489830 | 2816332298 | Bacteria | 6852809 |
| 1139 | 2819654010 | 2818991456 | Bacteria | 6123676 |
| 1140 | 2819703928 | 2818991464 | Bacteria | 6907494 |
| 1141 | 2825656462 | 2825651385 | Bacteria | 6715909 |
| 1142 | 2826585229 | 2826581358 | Bacteria | 5963467 |
| 1143 | 2834029705 | 2834028612 | Bacteria | 6354979 |
| 1144 | 2842818836 | 2842815866 | Bacteria | 5947510 |
| 1145 | 2842832188 | 2842826826 | Bacteria | 5974129 |
| 1146 | 2842832694 | 2842832357 | Bacteria | 5959113 |
| 1147 | 2842841521 | 2842837860 | Bacteria | 6066181 |
| 1148 | 2842848221 | 2842843487 | Bacteria | 6004777 |
| 1149 | 2842853570 | 2842849001 | Bacteria | 5924277 |
| 1150 | 2842856849 | 2842854478 | Bacteria | 6143501 |
| 1151 | 2844669175 | 2844665904 | Bacteria | 6817974 |
| 1152 | 2852618411 | 2852612431 | Bacteria | 6885235 |
| 1153 | 2852658919 | 2852657418 | Bacteria | 6472974 |
| 1154 | 2852673453 | 2852667396 | Bacteria | 6885555 |
| 1155 | 2860340022 | 2860339153 | Bacteria | 6846989 |
| 1156 | 2860869700 | 2860867994 | Bacteria | 5645326 |
| 1157 | 2878031439 | 2878029506 | Bacteria | 6418441 |
| 1158 | 2880232309 | 2880230671 | Bacteria | 6140320 |
| 1159 | 2904521800 | 2904518522 | Bacteria | 6068986 |
| 1160 | 2904553196 | 2904550169 | Bacteria | 6221258 |
| 1161 | 2908448635 | 2908446538 | Bacteria | 6829095 |
| 1162 | 2912965389 | 2912963787 | Bacteria | 5646108 |
| 1163 | 2913041069 | 2913036834 | Bacteria | 6704877 |
| 1164 | 2917072446 | 2917070673 | Bacteria | 6868303 |
| 1165 | 2917835495 | 2917832318 | Bacteria | 5346010 |
| 1166 | 2919064091 | 2919063839 | Bacteria | 6302690 |
| 1167 | 2919157767 | 2919155634 | Bacteria | 4860545 |
| 1168 | 2919386402 | 2919385768 | Bacteria | 5897293 |
| 1169 | 2919457113 | 2919456309 | Bacteria | 6586567 |
| 1170 | 2919486173 | 2919481497 | Bacteria | 6907839 |
| 1171 | 2919491315 | 2919487758 | Bacteria | 5929766 |
| 1172 | 2919702875 | 2919697872 | Bacteria | 6553725 |
| 1173 | 2923155285 | 2923153595 | Bacteria | 6870622 |
| 1174 | 2923519942 | 2923519811 | Bacteria | 6298479 |
| 1175 | 2923529144 | 2923525760 | Bacteria | 4472324 |
| 1176 | 2923590107 | 2923586266 | Bacteria | 6565975 |
| 1177 | 2929148573 | 2929144301 | Bacteria | 6622272 |
| 1178 | 2929191673 | 2929189879 | Bacteria | 5930554 |
| 1179 | 2931373987 | 2931369376 | Bacteria | 6847892 |
| 1180 | 2931392775 | 2931390751 | Bacteria | 6273349 |
| 1181 | 2931400087 | 2931396565 | Bacteria | 7251677 |
| 1182 | 2935354610 | 2935353572 | Unclassified | 6955622 |
| 1183 | 2939639743 | 2939636861 | Bacteria | 6297853 |
| 1184 | 2939655223 | 2939651529 | Bacteria | 5895393 |
| 1185 | 2945928894 | 2945928738 | Bacteria | 6053221 |
| 1186 | 2945965162 | 2945961074 | Bacteria | 7342064 |
| 1187 | 2946011099 | 2946006987 | Bacteria | 6705746 |
| 1188 | 2946029955 | 2946027586 | Bacteria | 6049274 |
| 1189 | 2947236528 | 2947233263 | Bacteria | 6439278 |
| 1190 | 2969306221 | 2969304461 | Bacteria | 6601805 |
| 1191 | 2974292126 | 2974289157 | Bacteria | 6080362 |
| 1192 | 2984290753 | 2984286254 | Bacteria | 6702062 |
| 1193 | 2988730164 | 2988728565 | Bacteria | 6124362 |
| 1194 | 2998141617 | 2998139840 | Bacteria | 6073514 |
| 1195 | 3007400825 | 3007395558 | Bacteria | 6755444 |
| 1196 | 3007421282 | 3007419365 | Bacteria | 7026924 |
| 1197 | 3007513015 | 3007511990 | Bacteria | 6481491 |
| 1198 | 3007617582 | 3007614139 | Bacteria | 6053559 |
| 1199 | 3007622345 | 3007619802 | Bacteria | 6411688 |
| 1200 | 3007723328 | 3007718800 | Bacteria | 5971527 |
| 1201 | 3007803594 | 3007803356 | Bacteria | 5931491 |
| 1202 | 3007856208 | 3007855910 | Bacteria | 5637581 |
| 1203 | 3007863144 | 3007861166 | Bacteria | 6045338 |
| 1204 | 3007870510 | 3007866637 | Bacteria | 5899198 |
| 1205 | 3007873197 | 3007872151 | Bacteria | 5268868 |
| 1206 | 637319033 | 637000220 | Bacteria | 7074893 |
| 1207 | 8015689503 | 8015687852 | Bacteria | 6613826 |
| 1208 | 8019774088 | 8019769354 | Bacteria | 6924660 |
| 1209 | 8019780244 | 8019775933 | Bacteria | 6858656 |
| 1210 | 8029999139 | 8029995093 | Bacteria | 5990776 |
| 1211 | 8052498428 | 8052494512 | Bacteria | 5765634 |
| 1212 | 8054288024 | 8054285046 | Bacteria | 6919322 |
| 1213 | 8054352130 | 8054347763 | Bacteria | 5901107 |
| 1214 | 8054505276 | 8054503363 | Bacteria | 6101651 |
| 1215 | 8054930080 | 8054929484 | Bacteria | 5599761 |
| 1216 | 8055772640 | 8055770955 | Bacteria | 6827675 |
| 1217 | 8055819832 | 8055817908 | Bacteria | 6609162 |
| 1218 | 8055878977 | 8055878733 | Bacteria | 5907058 |
| 1219 | 8056119705 | 8056115690 | Bacteria | 5527654 |
| 1220 | 8056122408 | 8056120720 | Bacteria | 5758328 |
| 1221 | 8056130187 | 8056125926 | Bacteria | 6228218 |
| 1222 | 8056133599 | 8056131705 | Bacteria | 6107031 |
| 1223 | 8056141360 | 8056137416 | Bacteria | 6147080 |
| 1224 | 8056144805 | 8056143049 | Bacteria | 6307666 |
| 1225 | 8056150508 | 8056148874 | Bacteria | 6479865 |
| 1226 | 8056156233 | 8056155041 | Bacteria | 6486948 |
| 1227 | 8056165022 | 8056161164 | Bacteria | 6106669 |
| 1228 | 8056169374 | 8056166840 | Bacteria | 5820959 |
| 1229 | 8056175559 | 8056172158 | Bacteria | 6133900 |
| 1230 | 8056181143 | 8056177738 | Bacteria | 6748268 |
| 1231 | 8056573228 | 8056569372 | Bacteria | 5997322 |
| 1232 | 8057799068 | 8057798959 | Bacteria | 6713499 |
| 1233 | Ga0182008_10017269 | |||
| 1234 | SwRhRL2b_contig_1502704 | |||
| 1235 | SwRhRL2b_contig_713724 | |||
| 1236 | JGI24739J22299_10006992 | |||
| 1237 | JGI24737J22298_10000144 | |||
| 1238 | JGI24737J22298_10002055 | |||
| 1239 | JGI24737J22298_10013143 | |||
| 1240 | JGI24737J22298_10013188 | |||
| 1241 | JGI24738J21930_10000320 | |||
| 1242 | JGI24738J21930_10002591 | |||
| 1243 | JGI24751J29686_10001193 | |||
| 1244 | JGI25162J39368_1000037 | |||
| 1245 | JGI25162J39368_1000216 | |||
| 1246 | JGI25154J39366_1005127 | |||
| 1247 | JGI25164J39214_1000020 | |||
| 1248 | JGI25164J39214_1000176 | |||
| 1249 | JGI25165J46597_1000077 | |||
| 1250 | JGI25165J46597_1000306 | |||
| 1251 | Ga0055538_1000058 | |||
| 1252 | Ga0055539_1000087 | |||
| 1253 | Ga0055533_1000097 | |||
| 1254 | Ga0055532_1000156 | |||
| 1255 | Ga0055525_1000428 | |||
| 1256 | Ga0055536_1000165 | |||
| 1257 | Ga0055536_1000859 | |||
| 1258 | Ga0055536_1000886 | |||
| 1259 | Ga0055530_10000268 | |||
| 1260 | Ga0055530_10000357 | |||
| 1261 | Ga0055530_10002815 | |||
| 1262 | Ga0055530_10003134 | |||
| 1263 | Ga0055540_1000076 | |||
| 1264 | Ga0055540_1000253 | |||
| 1265 | Ga0055540_1006049 | |||
| 1266 | Ga0055531_10000769 | |||
| 1267 | Ga0055541_1000060 | |||
| 1268 | Ga0065714_10000092 | |||
| 1269 | Ga0065714_10003690 | |||
| 1270 | Ga0065714_10006550 | |||
| 1271 | Ga0065714_10006855 | |||
| 1272 | Ga0065714_10014765 | |||
| 1273 | Ga0065714_10064679 | |||
| 1274 | Ga0065714_10067028 | |||
| 1275 | Ga0065714_10079939 | |||
| 1276 | Ga0065714_10081508 | |||
| 1277 | Ga0065704_10073984 | |||
| 1278 | Ga0065704_10086541 | |||
| 1279 | Ga0065704_10086922 | |||
| 1280 | Ga0065704_10096570 | |||
| 1281 | Ga0065704_10136593 | |||
| 1282 | Ga0065712_10068389 | |||
| 1283 | Ga0065707_10083069 | |||
| 1284 | Ga0070658_10000360 | |||
| 1285 | Ga0070658_10118644 | |||
| 1286 | Ga0070658_10434977 | |||
| 1287 | Ga0070683_100011780 | |||
| 1288 | Ga0070683_100059829 | |||
| 1289 | Ga0070670_100000481 | |||
| 1290 | Ga0070670_100001103 | |||
| 1291 | Ga0070670_100002065 | |||
| 1292 | Ga0070670_100025295 | |||
| 1293 | Ga0070670_100033833 | |||
| 1294 | Ga0070670_100067706 | |||
| 1295 | Ga0070670_100073474 | |||
| 1296 | Ga0070670_100131692 | |||
| 1297 | Ga0070670_100298140 | |||
| 1298 | Ga0070677_10003734 | |||
| 1299 | Ga0070677_10036773 | |||
| 1300 | Ga0068869_100019256 | |||
| 1301 | Ga0068869_100073591 | |||
| 1302 | Ga0070666_10000111 | |||
| 1303 | Ga0070666_10001622 | |||
| 1304 | Ga0070680_100438229 | |||
| 1305 | Ga0070682_100016665 | |||
| 1306 | Ga0070660_100000075 | |||
| 1307 | Ga0070660_100073985 | |||
| 1308 | Ga0070660_100099990 | |||
| 1309 | Ga0070660_100313230 | |||
| 1310 | Ga0070661_100000029 | |||
| 1311 | Ga0070661_100000273 | |||
| 1312 | Ga0070668_100006635 | |||
| 1313 | Ga0070668_100301157 | |||
| 1314 | Ga0070669_100000012 | |||
| 1315 | Ga0070669_100011335 | |||
| 1316 | Ga0070669_100070677 | |||
| 1317 | Ga0070675_100003021 | |||
| 1318 | Ga0070671_100000019 | |||
| 1319 | Ga0070671_100043305 | |||
| 1320 | Ga0070673_100198510 | |||
| 1321 | Ga0070673_100291233 | |||
| 1322 | Ga0070688_100094945 | |||
| 1323 | Ga0070659_100000084 | |||
| 1324 | Ga0070659_100072911 | |||
| 1325 | Ga0070659_100242078 | |||
| 1326 | Ga0070659_100341070 | |||
| 1327 | Ga0070667_100035990 | |||
| 1328 | Ga0070705_100011253 | |||
| 1329 | Ga0070700_100045299 | |||
| 1330 | Ga0070700_100091016 | |||
| 1331 | Ga0070708_100324731 | |||
| 1332 | Ga0070663_100029453 | |||
| 1333 | Ga0070663_100055676 | |||
| 1334 | Ga0070678_100224352 | |||
| 1335 | Ga0070662_100001648 | |||
| 1336 | Ga0070662_100223031 | |||
| 1337 | Ga0070681_10050151 | |||
| 1338 | Ga0070685_10281407 | |||
| 1339 | Ga0070679_100031356 | |||
| 1340 | Ga0068853_100000223 | |||
| 1341 | Ga0068853_100063877 | |||
| 1342 | Ga0070672_100042732 | |||
| 1343 | Ga0070672_100044053 | |||
| 1344 | Ga0070672_100050516 | |||
| 1345 | Ga0070672_100127795 | |||
| 1346 | Ga0070686_100053960 | |||
| 1347 | Ga0070693_100002223 | |||
| 1348 | Ga0070665_100015604 | |||
| 1349 | Ga0070665_100030058 | |||
| 1350 | Ga0070665_100151727 | |||
| 1351 | Ga0070665_100283855 | |||
| 1352 | Ga0070665_100391340 | |||
| 1353 | Ga0068855_100004348 | |||
| 1354 | Ga0068855_100014849 | |||
| 1355 | Ga0070664_100000032 | |||
| 1356 | Ga0070664_100000046 | |||
| 1357 | Ga0070664_100083088 | |||
| 1358 | Ga0070664_100098759 | |||
| 1359 | Ga0070664_100103425 | |||
| 1360 | Ga0068857_100001897 | |||
| 1361 | Ga0068854_100000103 | |||
| 1362 | Ga0068856_100000161 | |||
| 1363 | Ga0068852_100002629 | |||
| 1364 | Ga0068859_100021745 | |||
| 1365 | Ga0068864_100000475 | |||
| 1366 | Ga0068864_100011094 | |||
| 1367 | Ga0068861_100007323 | |||
| 1368 | Ga0068851_10000050 | |||
| 1369 | Ga0068863_100013469 | |||
| 1370 | Ga0068863_100022064 | |||
| 1371 | Ga0068858_100000951 | |||
| 1372 | Ga0068858_100022059 | |||
| 1373 | Ga0068860_100005380 | |||
| 1374 | Ga0068860_100102557 | |||
| 1375 | Ga0068862_100000884 | |||
| 1376 | Ga0068862_100100852 | |||
| 1377 | Ga0081455_10002721 | |||
| 1378 | Ga0075432_10017505 | |||
| 1379 | Ga0075366_10076320 | |||
| 1380 | Ga0097621_100062878 | |||
| 1381 | Ga0097621_100071060 | |||
| 1382 | Ga0097621_100108900 | |||
| 1383 | Ga0068871_100187725 | |||
| 1384 | Ga0068871_100361687 | |||
| 1385 | Ga0075428_100001917 | |||
| 1386 | Ga0075430_100069652 | |||
| 1387 | Ga0075431_100000404 | |||
| 1388 | Ga0075429_100220131 | |||
| 1389 | Ga0068865_100059983 | |||
| 1390 | Ga0097620_100021745 | |||
| 1391 | Ga0099823_1000543 | |||
| 1392 | Ga0079104_1000438 | |||
| 1393 | Ga0079104_1000574 | |||
| 1394 | Ga0079104_1005276 | |||
| 1395 | Ga0099826_10044992 | |||
| 1396 | Ga0105251_10000093 | |||
| 1397 | Ga0105251_10001182 | |||
| 1398 | Ga0105251_10003786 | |||
| 1399 | Ga0105251_10005845 | |||
| 1400 | Ga0105251_10009836 | |||
| 1401 | Ga0105251_10010618 | |||
| 1402 | Ga0105251_10024683 | |||
| 1403 | Ga0105244_10000378 | |||
| 1404 | Ga0105244_10000425 | |||
| 1405 | Ga0105244_10000632 | |||
| 1406 | Ga0105244_10003134 | |||
| 1407 | Ga0105244_10015494 | |||
| 1408 | Ga0105244_10021429 | |||
| 1409 | Ga0105244_10029116 | |||
| 1410 | Ga0105244_10043142 | |||
| 1411 | Ga0105244_10043766 | |||
| 1412 | Ga0105250_10000010 | |||
| 1413 | Ga0105250_10000074 | |||
| 1414 | Ga0105250_10000443 | |||
| 1415 | Ga0105250_10004480 | |||
| 1416 | Ga0105250_10004728 | |||
| 1417 | Ga0105240_10000960 | |||
| 1418 | Ga0105240_10002841 | |||
| 1419 | Ga0105247_10002298 | |||
| 1420 | Ga0105243_10000158 | |||
| 1421 | Ga0105243_10000686 | |||
| 1422 | Ga0105243_10024238 | |||
| 1423 | Ga0105243_10198123 | |||
| 1424 | Ga0105241_10016472 | |||
| 1425 | Ga0105242_10002245 | |||
| 1426 | Ga0105242_10068918 | |||
| 1427 | Ga0105242_10104166 | |||
| 1428 | Ga0105248_10000223 | |||
| 1429 | Ga0105248_10004096 | |||
| 1430 | Ga0105248_10040920 | |||
| 1431 | Ga0105248_10625895 | |||
| 1432 | Ga0105248_10641609 | |||
| 1433 | Ga0105237_10001262 | |||
| 1434 | Ga0105238_10001357 | |||
| 1435 | Ga0105238_10022229 | |||
| 1436 | Ga0105249_10001785 | |||
| 1437 | Ga0105249_10251695 | |||
| 1438 | Ga0105249_10272986 | |||
| 1439 | Ga0105239_10002761 | |||
| 1440 | Ga0105246_10000222 | |||
| 1441 | Ga0105246_10004002 | |||
| 1442 | Ga0105246_10032313 | |||
| 1443 | Ga0105246_10104263 | |||
| 1444 | Ga0105246_10320415 | |||
| 1445 | Ga0157345_1000099 | |||
| 1446 | Ga0157347_1002068 | |||
| 1447 | Ga0157373_10001693 | |||
| 1448 | Ga0157373_10002324 | |||
| 1449 | Ga0157373_10005372 | |||
| 1450 | Ga0157373_10012536 | |||
| 1451 | Ga0157373_10062748 | |||
| 1452 | Ga0157371_10000513 | |||
| 1453 | Ga0157371_10000546 | |||
| 1454 | Ga0157371_10003769 | |||
| 1455 | Ga0157371_10005228 | |||
| 1456 | Ga0157371_10097772 | |||
| 1457 | Ga0157370_10001514 | |||
| 1458 | Ga0157370_10043355 | |||
| 1459 | Ga0157370_10058760 | |||
| 1460 | Ga0157370_10274511 | |||
| 1461 | Ga0157369_10010011 | |||
| 1462 | Ga0157369_10030136 | |||
| 1463 | Ga0157369_10046501 | |||
| 1464 | Ga0157369_10050165 | |||
| 1465 | Ga0157369_10337500 | |||
| 1466 | Ga0157369_10345752 | |||
| 1467 | Ga0157374_10005747 | |||
| 1468 | Ga0163162_10002586 | |||
| 1469 | Ga0163162_10003324 | |||
| 1470 | Ga0163162_10006360 | |||
| 1471 | Ga0157372_10002158 | |||
| 1472 | Ga0157372_10004378 | |||
| 1473 | Ga0157372_10010493 | |||
| 1474 | Ga0157375_10003788 | |||
| 1475 | Ga0157375_10024179 | |||
| 1476 | Ga0157375_10581591 | |||
| 1477 | Ga0157375_10589545 | |||
| 1478 | Ga0163163_10000567 | |||
| 1479 | Ga0163163_10039019 | |||
| 1480 | Ga0163163_10451772 | |||
| 1481 | Ga0163163_10531089 | |||
| 1482 | Ga0157380_10047692 | |||
| 1483 | Ga0182008_10000040 | |||
| 1484 | Ga0182008_10004368 | |||
| 1485 | Ga0182008_10014796 | |||
| 1486 | Ga0157379_10000049 | |||
| 1487 | Ga0157379_10024931 | |||
| 1488 | Ga0157379_10170438 | |||
| 1489 | Ga0157376_10258783 | |||
| 1490 | Ga0182006_1001260 | |||
| 1491 | Ga0182006_1001580 | |||
| 1492 | Ga0182006_1002995 | |||
| 1493 | Ga0182006_1020636 | |||
| 1494 | Ga0182007_10000438 | |||
| 1495 | Ga0182007_10002369 | |||
| 1496 | Ga0182007_10027291 | |||
| 1497 | Ga0182005_1000372 | |||
| 1498 | Ga0163161_10004558 | |||
| 1499 | Ga0163161_10098225 | |||
| 1500 | Ga0206350_10761995 | |||
| 1501 | Ga0213875_10001424 | |||
| 1502 | Ga0209435_101655 | |||
| 1503 | Ga0209760_100011 | |||
| 1504 | Ga0209760_100053 | |||
| 1505 | Ga0209784_100040 | |||
| 1506 | Ga0209566_100051 | |||
| 1507 | Ga0209674_100072 | |||
| 1508 | Ga0209147_100067 | |||
| 1509 | Ga0209563_100073 | |||
| 1510 | Ga0209563_100269 | |||
| 1511 | Ga0207427_100001 | |||
| 1512 | Ga0207427_100008 | |||
| 1513 | Ga0209437_100003 | |||
| 1514 | Ga0209437_100014 | |||
| 1515 | Ga0209258_101387 | |||
| 1516 | Ga0209646_1000455 | |||
| 1517 | Ga0209677_100063 | |||
| 1518 | Ga0209759_1003641 | |||
| 1519 | Ga0209759_1012272 | |||
| 1520 | Ga0209233_1000007 | |||
| 1521 | Ga0209233_1000008 | |||
| 1522 | Ga0209676_1000016 | |||
| 1523 | Ga0209676_1000021 | |||
| 1524 | Ga0209676_1000033 | |||
| 1525 | Ga0209676_1001957 | |||
| 1526 | Ga0209676_1005986 | |||
| 1527 | Ga0209676_1006018 | |||
| 1528 | Ga0209050_1000036 | |||
| 1529 | Ga0209050_1000235 | |||
| 1530 | Ga0209050_1000595 | |||
| 1531 | Ga0209050_1003490 | |||
| 1532 | Ga0209051_1000043 | |||
| 1533 | Ga0209051_1000123 | |||
| 1534 | Ga0209051_1000407 | |||
| 1535 | Ga0209257_1000098 | |||
| 1536 | Ga0209257_1022723 | |||
| 1537 | Ga0207697_10000003 | |||
| 1538 | Ga0207697_10019883 | |||
| 1539 | Ga0207656_10000390 | |||
| 1540 | Ga0207696_1000010 | |||
| 1541 | Ga0207696_1000045 | |||
| 1542 | Ga0207696_1000101 | |||
| 1543 | Ga0207696_1000133 | |||
| 1544 | Ga0207696_1000171 | |||
| 1545 | Ga0207696_1005619 | |||
| 1546 | Ga0207696_1006182 | |||
| 1547 | Ga0207696_1006507 | |||
| 1548 | Ga0207696_1007381 | |||
| 1549 | Ga0207655_1000019 | |||
| 1550 | Ga0207655_1000337 | |||
| 1551 | Ga0207655_1000461 | |||
| 1552 | Ga0207655_1000619 | |||
| 1553 | Ga0207655_1000645 | |||
| 1554 | Ga0207655_1001070 | |||
| 1555 | Ga0207655_1003393 | |||
| 1556 | Ga0207655_1004760 | |||
| 1557 | Ga0207655_1006166 | |||
| 1558 | Ga0207655_1006508 | |||
| 1559 | Ga0207655_1013543 | |||
| 1560 | Ga0207655_1016020 | |||
| 1561 | Ga0207655_1023541 | |||
| 1562 | Ga0207655_1028263 | |||
| 1563 | Ga0207713_1000030 | |||
| 1564 | Ga0207713_1000150 | |||
| 1565 | Ga0207713_1000802 | |||
| 1566 | Ga0207713_1001465 | |||
| 1567 | Ga0207713_1001551 | |||
| 1568 | Ga0207713_1004378 | |||
| 1569 | Ga0207713_1004594 | |||
| 1570 | Ga0207713_1006237 | |||
| 1571 | Ga0207713_1009012 | |||
| 1572 | Ga0207713_1015668 | |||
| 1573 | Ga0207713_1019916 | |||
| 1574 | Ga0207713_1022117 | |||
| 1575 | Ga0207713_1030814 | |||
| 1576 | Ga0207682_10001869 | |||
| 1577 | Ga0207682_10006962 | |||
| 1578 | Ga0207682_10050258 | |||
| 1579 | Ga0207710_10001155 | |||
| 1580 | Ga0207688_10069600 | |||
| 1581 | Ga0207680_10000144 | |||
| 1582 | Ga0207680_10016502 | |||
| 1583 | Ga0207680_10037264 | |||
| 1584 | Ga0207647_10008997 | |||
| 1585 | Ga0207647_10029649 | |||
| 1586 | Ga0207645_10023195 | |||
| 1587 | Ga0207643_10005840 | |||
| 1588 | Ga0207705_10002254 | |||
| 1589 | Ga0207705_10037331 | |||
| 1590 | Ga0207705_10056220 | |||
| 1591 | Ga0207707_10000165 | |||
| 1592 | Ga0207695_10018974 | |||
| 1593 | Ga0207671_10000287 | |||
| 1594 | Ga0207660_10017010 | |||
| 1595 | Ga0207657_10000164 | |||
| 1596 | Ga0207649_10000068 | |||
| 1597 | Ga0207649_10000580 | |||
| 1598 | Ga0207649_10186007 | |||
| 1599 | Ga0207652_10002078 | |||
| 1600 | Ga0207652_10041853 | |||
| 1601 | Ga0207681_10000004 | |||
| 1602 | Ga0207681_10009998 | |||
| 1603 | Ga0207681_10048896 | |||
| 1604 | Ga0207681_10160101 | |||
| 1605 | Ga0207694_10037804 | |||
| 1606 | Ga0207650_10000174 | |||
| 1607 | Ga0207650_10000405 | |||
| 1608 | Ga0207650_10007930 | |||
| 1609 | Ga0207650_10013387 | |||
| 1610 | Ga0207650_10081984 | |||
| 1611 | Ga0207650_10093167 | |||
| 1612 | Ga0207659_10004712 | |||
| 1613 | Ga0207659_10145607 | |||
| 1614 | Ga0207644_10000031 | |||
| 1615 | Ga0207644_10005888 | |||
| 1616 | Ga0207690_10000800 | |||
| 1617 | Ga0207690_10109788 | |||
| 1618 | Ga0207690_10130880 | |||
| 1619 | Ga0207706_10000196 | |||
| 1620 | Ga0207706_10000922 | |||
| 1621 | Ga0207706_10015788 | |||
| 1622 | Ga0207706_10037199 | |||
| 1623 | Ga0207706_10218476 | |||
| 1624 | Ga0207706_10258473 | |||
| 1625 | Ga0207686_10003119 | |||
| 1626 | Ga0207686_10084879 | |||
| 1627 | Ga0207709_10000053 | |||
| 1628 | Ga0207709_10001914 | |||
| 1629 | Ga0207709_10010049 | |||
| 1630 | Ga0207709_10012305 | |||
| 1631 | Ga0207669_10038650 | |||
| 1632 | Ga0207669_10251129 | |||
| 1633 | Ga0207704_10217314 | |||
| 1634 | Ga0207691_10056697 | |||
| 1635 | Ga0207691_10057327 | |||
| 1636 | Ga0207691_10061719 | |||
| 1637 | Ga0207691_10105271 | |||
| 1638 | Ga0207691_10127219 | |||
| 1639 | Ga0207691_10141275 | |||
| 1640 | Ga0207711_10000123 | |||
| 1641 | Ga0207711_10000698 | |||
| 1642 | Ga0207689_10074496 | |||
| 1643 | Ga0207661_10007562 | |||
| 1644 | Ga0207661_10167228 | |||
| 1645 | Ga0207679_10000018 | |||
| 1646 | Ga0207679_10001145 | |||
| 1647 | Ga0207679_10248713 | |||
| 1648 | Ga0207667_10001975 | |||
| 1649 | Ga0207667_10002663 | |||
| 1650 | Ga0207651_10283270 | |||
| 1651 | Ga0207651_10283632 | |||
| 1652 | Ga0207668_10002124 | |||
| 1653 | Ga0207640_10000333 | |||
| 1654 | Ga0207658_10004817 | |||
| 1655 | Ga0207703_10024596 | |||
| 1656 | Ga0207703_10111778 | |||
| 1657 | Ga0207639_10036655 | |||
| 1658 | Ga0207639_10119862 | |||
| 1659 | Ga0207678_10031160 | |||
| 1660 | Ga0207678_10073345 | |||
| 1661 | Ga0207678_10148066 | |||
| 1662 | Ga0207708_10007541 | |||
| 1663 | Ga0207708_10069841 | |||
| 1664 | Ga0207702_10000435 | |||
| 1665 | Ga0207641_10002235 | |||
| 1666 | Ga0207641_10006526 | |||
| 1667 | Ga0207641_10074108 | |||
| 1668 | Ga0207676_10003318 | |||
| 1669 | Ga0207676_10007039 | |||
| 1670 | Ga0207674_10001036 | |||
| 1671 | Ga0207674_10010161 | |||
| 1672 | Ga0207675_100001371 | |||
| 1673 | Ga0207675_100005252 | |||
| 1674 | Ga0207683_10175804 | |||
| 1675 | Ga0207698_10003125 | |||
| 1676 | Ga0209281_1000010 | |||
| 1677 | Ga0209281_1000174 | |||
| 1678 | Ga0209281_1003018 | |||
| 1679 | Ga0209389_1000018 | |||
| 1680 | Ga0209371_1000666 | |||
| 1681 | Ga0209282_1092395 | |||
| 1682 | Ga0209974_10025277 | |||
| 1683 | Ga0207428_10038918 | |||
| 1684 | Ga0207428_10210306 | |||
| 1685 | Ga0268266_10009597 | |||
| 1686 | Ga0268266_10098604 | |||
| 1687 | Ga0268265_10000525 | |||
| 1688 | Ga0268264_10004731 | |||
| 1689 | Ga0265326_10005086 | |||
| 1690 | Ga0265334_10010136 | |||
| 1691 | Ga0265334_10025593 | |||
| 1692 | Ga0265318_10000008 | |||
| 1693 | Ga0265338_10025529 | |||
| 1694 | Ga0265338_10053233 | |||
| 1695 | Ga0265338_10190987 | |||
| 1696 | Ga0268256_1006739 | |||
| 1697 | Ga0307511_10036182 | |||
| 1698 | Ga0316177_1096918 | |||
| 1699 | Ga0316178_1171693 | |||
| 1700 | Ga0316183_1154612 | |||
| 1701 | Ga0265330_10000038 | |||
| 1702 | Ga0265332_10000580 | |||
| 1703 | Ga0265328_10006062 | |||
| 1704 | Ga0265328_10013427 | |||
| 1705 | Ga0265320_10000066 | |||
| 1706 | Ga0265339_10058964 | |||
| 1707 | Ga0265331_10000004 | |||
| 1708 | Ga0265327_10001809 | |||
| 1709 | Ga0265327_10009028 | |||
| 1710 | Ga0265316_10004013 | |||
| 1711 | Ga0265316_10015639 | |||
| 1712 | Ga0307513_10060130 | |||
| 1713 | Ga0307513_10124889 | |||
| 1714 | Ga0307509_10060191 | |||
| 1715 | Ga0307408_100001830 | |||
| 1716 | Ga0307408_100349426 | |||
| 1717 | Ga0265313_10000005 | |||
| 1718 | Ga0265314_10000190 | |||
| 1719 | Ga0265314_10013707 | |||
| 1720 | Ga0265314_10014743 | |||
| 1721 | Ga0265314_10015721 | |||
| 1722 | Ga0265314_10029861 | |||
| 1723 | Ga0265342_10005640 | |||
| 1724 | Ga0307405_10000107 | |||
| 1725 | Ga0307405_10015722 | |||
| 1726 | Ga0307405_10043467 | |||
| 1727 | Ga0307413_10007527 | |||
| 1728 | Ga0307413_10141250 | |||
| 1729 | Ga0307410_10065880 | |||
| 1730 | Ga0307410_10324048 | |||
| 1731 | Ga0307406_10017310 | |||
| 1732 | Ga0307407_10004576 | |||
| 1733 | Ga0307407_10114176 | |||
| 1734 | Ga0307412_10098674 | |||
| 1735 | Ga0307412_10395577 | |||
| 1736 | Ga0307409_100017705 | |||
| 1737 | Ga0307409_100022534 | |||
| 1738 | Ga0307409_100055596 | |||
| 1739 | Ga0307409_100181141 | |||
| 1740 | Ga0307416_100023426 | |||
| 1741 | Ga0307416_100264452 | |||
| 1742 | Ga0307414_10041243 | |||
| 1743 | Ga0307414_10115171 | |||
| 1744 | Ga0307414_10144610 | |||
| 1745 | Ga0307411_10005061 | |||
| 1746 | Ga0307411_10009214 | |||
| 1747 | Ga0307411_10027505 | |||
| 1748 | Ga0307411_10092078 | |||
| 1749 | Ga0307415_100244843 | |||
| 1750 | Ga0307510_10004157 | |||
| 1751 | Ga0373951_0005210 | |||
| 1752 | Ga0373960_0025634 | |||
| 1753 | Ga0395899_0017029 | |||
| 1754 | Ga0395899_0037603 | |||
| 1755 | Ga0395899_0046212 | |||
| 1756 | Ga0395900_0005203 | |||
| 1757 | Ga0395900_0099235 | |||
| 1758 | Ga0395900_0167625 | |||
| 1759 | Ga0395898_0027737 | |||
| 1760 | Ga0395898_0073387 | |||
| 1761 | Ga0395898_0078397 | |||
| 1762 | Ga0395898_0107967 | |||
| 1763 | Ga0395905_0008044 | |||
| 1764 | Ga0395905_0020138 | |||
| 1765 | Ga0395905_0067377 | |||
| 1766 | Ga0395905_0287729 | |||
| 1767 | Ga0395905_0360195 | |||
| 1768 | Ga0436364_0615540 | |||
| 1769 | Ga0436364_1297263 | |||
| 1770 | Ga0395901_0004097 | |||
| 1771 | Ga0395901_0008125 | |||
| 1772 | Ga0395901_0022011 | |||
| 1773 | Ga0395901_0145098 | |||
| 1774 | Ga0237819_03304 | |||
| 1775 | Ga0436365_0051966 | |||
| 1776 | Ga0436365_1101983 | |||
| 1777 | Ga0436360_0339290 | |||
| 1778 | Ga0439438_000675 | |||
| 1779 | Ga0439438_000927 | |||
| 1780 | Ga0439438_001315 | |||
| 1781 | Ga0439438_003331 | |||
| 1782 | Ga0439438_005045 | |||
| 1783 | Ga0439447_000654 | |||
| 1784 | Ga0439447_001834 | |||
| 1785 | Ga0439447_002740 | |||
| 1786 | Ga0439447_021080 | |||
| 1787 | Ga0439447_043942 | |||
| 1788 | Ga0439466_0000795 | |||
| 1789 | Ga0439466_0002004 | |||
| 1790 | Ga0439466_0008094 | |||
| 1791 | Ga0439466_0009060 | |||
| 1792 | Ga0439466_0015044 | |||
| 1793 | Ga0439466_0019075 | |||
| 1794 | Ga0439465_0008046 | |||
| 1795 | Ga0451807_0574609 | |||
| 1796 | Ga0451851_1064913 | |||
| 1797 | Ga0439431_0002741 | |||
| 1798 | Ga0439432_000252 | |||
| 1799 | Ga0439432_001213 | |||
| 1800 | Ga0439432_003374 | |||
| 1801 | Ga0439432_006221 | |||
| 1802 | Ga0439451_000817 | |||
| 1803 | Ga0439451_002274 | |||
| 1804 | Ga0439451_013599 | |||
| 1805 | Ga0439452_000874 | |||
| 1806 | Ga0439452_001032 | |||
| 1807 | Ga0439452_020841 | |||
| 1808 | Ga0439452_029297 | |||
| 1809 | Ga0439456_000996 | |||
| 1810 | Ga0439456_004800 | |||
| 1811 | Ga0439456_038039 | |||
| 1812 | Ga0439463_003580 | |||
| 1813 | Ga0439463_022787 | |||
| 1814 | Ga0450911_001009 | |||
| 1815 | Ga0450920_001811 | |||
| 1816 | Ga0450900_001470 | |||
| 1817 | Ga0450902_004301 | |||
| 1818 | Ga0450902_009190 | |||
| 1819 | Ga0450903_002895 | |||
| 1820 | Ga0450906_002716 | |||
| 1821 | Ga0450907_000141 | |||
| 1822 | Ga0450907_000988 | |||
| 1823 | Ga0450907_001547 | |||
| 1824 | Ga0439446_0002864 | |||
| 1825 | Ga0439458_0001847 | |||
| 1826 | Ga0450909_007823 | |||
| 1827 | Ga0439434_0000583 | |||
| 1828 | Ga0439434_0003892 | |||
| 1829 | Ga0439460_0006603 | |||
| 1830 | Ga0450901_000361 | |||
| 1831 | Ga0451577_0001050 | |||
| 1832 | Ga0451577_0008580 | |||
| 1833 | Ga0453683_0000847 | |||
| 1834 | Ga0453683_0056423 | |||
| 1835 | Ga0453683_0099808 | |||
| 1836 | Ga0466961_0038996 | |||
| 1837 | Ga0466963_0001361 | |||
| 1838 | Ga0466963_0117505 | |||
| 1839 | Ga0466964_0110724 | |||
| 1840 | Ga0453684_0000045 | |||
| 1841 | Ga0453684_0020465 | |||
| 1842 | Ga0453684_0037032 | |||
| 1843 | Ga0453684_0079004 | |||
| 1844 | Ga0453684_0089632 | |||
| 1845 | Ga0453684_0258022 | |||
| 1846 | Ga0466957_0128760 | |||
| 1847 | Ga0451576_0418595 | |||
| 1848 | Ga0466967_0045449 | |||
| 1849 | Ga0466967_0072830 | |||
| 1850 | Ga0466967_0165531 | |||
| 1851 | Ga0495617_000345 | |||
| 1852 | Ga0495617_002825 | |||
| 1853 | Ga0495617_026558 | |||
| 1854 | Ga0495617_030501 | |||
| 1855 | Ga0495627_000013 | |||
| 1856 | Ga0495627_001904 | |||
| 1857 | Ga0495627_005567 | |||
| 1858 | Ga0495627_009397 | |||
| 1859 | Ga0495603_0002522 | |||
| 1860 | Ga0495590_0000407 | |||
| 1861 | Ga0495590_0001959 | |||
| 1862 | Ga0495590_0007686 | |||
| 1863 | Ga0495591_000020 | |||
| 1864 | Ga0495591_000349 | |||
| 1865 | Ga0495591_001049 | |||
| 1866 | Ga0495591_001436 | |||
| 1867 | Ga0495591_001838 | |||
| 1868 | Ga0495591_002568 | |||
| 1869 | Ga0495591_002636 | |||
| 1870 | Ga0495591_005454 | |||
| 1871 | Ga0495591_012978 | |||
| 1872 | Ga0495591_016575 | |||
| 1873 | Ga0495638_0002181 | |||
| 1874 | Ga0495638_0052232 | |||
| 1875 | Ga0495653_0001454 | |||
| 1876 | Ga0495653_0004003 | |||
| 1877 | Ga0495653_0013243 | |||
| 1878 | Ga0495650_0000221 | |||
| 1879 | Ga0495650_0006197 | |||
| 1880 | Ga0495650_0008084 | |||
| 1881 | Ga0495650_0055089 | |||
| 1882 | Ga0495605_0000032 | |||
| 1883 | Ga0495605_0000047 | |||
| 1884 | Ga0495605_0000525 | |||
| 1885 | Ga0495605_0002797 | |||
| 1886 | Ga0495605_0008007 | |||
| 1887 | Ga0495605_0024913 | |||
| 1888 | Ga0495605_0027044 | |||
| 1889 | Ga0495639_0000195 | |||
| 1890 | Ga0495584_0000849 | |||
| 1891 | Ga0495584_0001600 | |||
| 1892 | Ga0495584_0003281 | |||
| 1893 | Ga0495584_0005082 | |||
| 1894 | Ga0495584_0011003 | |||
| 1895 | Ga0495584_0015313 | |||
| 1896 | Ga0495585_0000816 | |||
| 1897 | Ga0495585_0000979 | |||
| 1898 | Ga0495585_0007722 | |||
| 1899 | Ga0495585_0081194 | |||
| 1900 | Ga0495585_0161749 | |||
| 1901 | Ga0495594_0016969 | |||
| 1902 | Ga0495596_0000188 | |||
| 1903 | Ga0495596_0025851 | |||
| 1904 | Ga0495596_0082935 | |||
| 1905 | Ga0495607_0000307 | |||
| 1906 | Ga0495607_0000518 | |||
| 1907 | Ga0495607_0000888 | |||
| 1908 | Ga0495607_0001496 | |||
| 1909 | Ga0495607_0002088 | |||
| 1910 | Ga0495607_0003685 | |||
| 1911 | Ga0495607_0004568 | |||
| 1912 | Ga0495607_0012848 | |||
| 1913 | Ga0495607_0016204 | |||
| 1914 | Ga0495607_0017130 | |||
| 1915 | Ga0495607_0026067 | |||
| 1916 | Ga0495583_0000052 | |||
| 1917 | Ga0495583_0001288 | |||
| 1918 | Ga0495583_0002315 | |||
| 1919 | Ga0495583_0002464 | |||
| 1920 | Ga0495583_0002664 | |||
| 1921 | Ga0495606_0000177 | |||
| 1922 | Ga0495606_0000698 | |||
| 1923 | Ga0495606_0003087 | |||
| 1924 | Ga0495606_0003285 | |||
| 1925 | Ga0495606_0007692 | |||
| 1926 | Ga0495606_0009175 | |||
| 1927 | Ga0495606_0030861 | |||
| 1928 | Ga0495606_0057270 | |||
| 1929 | Ga0495606_0060955 | |||
| 1930 | Ga0495606_0159792 | |||
| 1931 | Ga0495610_0002714 | |||
| 1932 | Ga0495610_0005051 | |||
| 1933 | Ga0495610_0016472 | |||
| 1934 | Ga0495610_0017586 | |||
| 1935 | Ga0495610_0019566 | |||
| 1936 | Ga0495610_0025406 | |||
| 1937 | Ga0495610_0025525 | |||
| 1938 | Ga0495610_0069099 | |||
| 1939 | Ga0495616_0001260 | |||
| 1940 | Ga0495616_0003456 | |||
| 1941 | Ga0495616_0004343 | |||
| 1942 | Ga0495616_0004770 | |||
| 1943 | Ga0495616_0016215 | |||
| 1944 | Ga0495616_0029309 | |||
| 1945 | Ga0495620_0000200 | |||
| 1946 | Ga0495620_0000443 | |||
| 1947 | Ga0495620_0000681 | |||
| 1948 | Ga0495620_0001210 | |||
| 1949 | Ga0495620_0002805 | |||
| 1950 | Ga0495620_0020271 | |||
| 1951 | Ga0495630_0181281 | |||
| 1952 | Ga0495631_0000584 | |||
| 1953 | Ga0495631_0003644 | |||
| 1954 | Ga0495631_0008646 | |||
| 1955 | Ga0495632_0000867 | |||
| 1956 | Ga0495632_0003750 | |||
| 1957 | Ga0495632_0004797 | |||
| 1958 | Ga0495632_0005986 | |||
| 1959 | Ga0495632_0006804 | |||
| 1960 | Ga0495632_0007695 | |||
| 1961 | Ga0495632_0021091 | |||
| 1962 | Ga0495632_0103920 | |||
| 1963 | Ga0495637_0000023 | |||
| 1964 | Ga0495637_0000525 | |||
| 1965 | Ga0495637_0000546 | |||
| 1966 | Ga0495637_0002263 | |||
| 1967 | Ga0495637_0003734 | |||
| 1968 | Ga0495637_0004177 | |||
| 1969 | Ga0495637_0005110 | |||
| 1970 | Ga0495637_0022170 | |||
| 1971 | Ga0495643_0000451 | |||
| 1972 | Ga0495643_0000488 | |||
| 1973 | Ga0495643_0005064 | |||
| 1974 | Ga0495643_0008953 | |||
| 1975 | Ga0495643_0024069 | |||
| 1976 | Ga0495643_0032884 | |||
| 1977 | Ga0495644_0000782 | |||
| 1978 | Ga0495644_0038491 | |||
| 1979 | Ga0495648_0001343 | |||
| 1980 | Ga0495648_0005022 | |||
| 1981 | Ga0495648_0006283 | |||
| 1982 | Ga0495648_0006286 | |||
| 1983 | Ga0495648_0016773 | |||
| 1984 | Ga0495648_0021238 | |||
| 1985 | Ga0495648_0021466 | |||
| 1986 | Ga0495648_0042835 | |||
| 1987 | Ga0495648_0052500 | |||
| 1988 | Ga0495642_0001232 | |||
| 1989 | Ga0495642_0002892 | |||
| 1990 | Ga0495654_0000639 | |||
| 1991 | Ga0495654_0001505 | |||
| 1992 | Ga0495654_0005517 | |||
| 1993 | Ga0495654_0006449 | |||
| 1994 | Ga0495654_0007599 | |||
| 1995 | Ga0495654_0038626 | |||
| 1996 | Ga0495654_0085948 | |||
| 1997 | Ga0495654_0111113 | |||
| 1998 | Ga0495587_0019948 | |||
| 1999 | Ga0495609_0000032 | |||
| 2000 | Ga0495609_0000382 | |||
| 2001 | Ga0495609_0000807 | |||
| 2002 | Ga0495609_0007314 | |||
| 2003 | Ga0495609_0009135 | |||
| 2004 | Ga0495609_0050132 | |||
| 2005 | Ga0495597_0000004 | |||
| 2006 | Ga0495597_0003084 | |||
| 2007 | Ga0495597_0005556 | |||
| 2008 | Ga0495622_0000791 | |||
| 2009 | Ga0495622_0001063 | |||
| 2010 | Ga0495622_0001940 | |||
| 2011 | Ga0495622_0008116 | |||
| 2012 | Ga0495633_0000040 | |||
| 2013 | Ga0495633_0005133 | |||
| 2014 | Ga0495633_0018311 | |||
| 2015 | Ga0495656_0173130 | |||
| 2016 | Ga0495668_0003132 | |||
| 2017 | Ga0495668_0030519 | |||
| 2018 | Ga0495668_0102992 | |||
| 2019 | Ga0495611_0000527 | |||
| 2020 | Ga0495611_0006866 | |||
| 2021 | Ga0495611_0009167 | |||
| 2022 | Ga0495611_0020480 | |||
| 2023 | Ga0495625_0000010 | |||
| 2024 | Ga0495625_0017989 | |||
| 2025 | Ga0495625_0047587 | |||
| 2026 | Ga0495625_0056805 | |||
| 2027 | Ga0495625_0084865 | |||
| 2028 | Ga0495635_0001759 | |||
| 2029 | Ga0495659_0000675 | |||
| 2030 | Ga0495661_0000020 | |||
| 2031 | Ga0495661_0000037 | |||
| 2032 | Ga0495661_0000095 | |||
| 2033 | Ga0495661_0000921 | |||
| 2034 | Ga0495661_0053173 | |||
| 2035 | Ga0495661_0128567 | |||
| 2036 | Ga0495588_0058612 | |||
| 2037 | Ga0495646_0025834 | |||
| 2038 | Ga0495669_0006605 | |||
| 2039 | Ga0495669_0012660 | |||
| 2040 | Ga0495624_0002940 | |||
| 2041 | Ga0495670_0000928 | |||
| 2042 | Ga0495670_0001942 | |||
| 2043 | Ga0495670_0002786 | |||
| 2044 | Ga0495671_0001090 | |||
| 2045 | Ga0495671_0003041 | |||
| 2046 | Ga0495671_0015645 | |||
| 2047 | Ga0495671_0016760 | |||
| 2048 | Ga0495671_0030983 | |||
| 2049 | Ga0495671_0051076 | |||
| 2050 | Ga0495649_0000531 | |||
| 2051 | Ga0495649_0000534 | |||
| 2052 | Ga0495649_0000953 | |||
| 2053 | Ga0495649_0031232 | |||
| 2054 | Ga0495649_0074885 | |||
| 2055 | Ga0495649_0105221 | |||
| 2056 | Ga0495589_0000618 | |||
| 2057 | Ga0495589_0000885 | |||
| 2058 | Ga0495589_0002107 | |||
| 2059 | Ga0495589_0002763 | |||
| 2060 | Ga0495589_0090345 | |||
| 2061 | Ga0495600_0045524 | |||
| 2062 | Ga0495600_0133864 | |||
| 2063 | Ga0495660_0000768 | |||
| 2064 | Ga0495660_0000771 | |||
| 2065 | Ga0495660_0002602 | |||
| 2066 | Ga0495660_0003259 | |||
| 2067 | Ga0495660_0039397 | |||
| 2068 | Ga0495660_0075012 | |||
| 2069 | Ga0495604_0003047 | |||
| 2070 | Ga0495604_0129174 | |||
| 2071 | Ga0495636_0023031 | |||
| 2072 | Ga0495636_0061655 | |||
| 2073 | Ga0495672_0001771 | |||
| 2074 | Ga0495672_0002491 | |||
| 2075 | Ga0495672_0002948 | |||
| 2076 | Ga0495672_0003375 | |||
| 2077 | Ga0495672_0003580 | |||
| 2078 | Ga0495672_0003938 | |||
| 2079 | Ga0495672_0005314 | |||
| 2080 | Ga0495672_0006139 | |||
| 2081 | Ga0495672_0015757 | |||
| 2082 | Ga0495672_0016349 | |||
| 2083 | Ga0495672_0073518 | |||
| 2084 | Ga0495676_0000002 | |||
| 2085 | Ga0495676_0042205 | |||
| 2086 | Ga0495680_0007103 | |||
| 2087 | Ga0495680_0019899 | |||
| 2088 | Ga0495680_0052058 | |||
| 2089 | Ga0495680_0108292 | |||
| 2090 | Ga0495683_0000011 | |||
| 2091 | Ga0495683_0000519 | |||
| 2092 | Ga0495683_0000718 | |||
| 2093 | Ga0495683_0006302 | |||
| 2094 | Ga0495683_0007561 | |||
| 2095 | Ga0495687_010330 | |||
| 2096 | Ga0495675_0001939 | |||
| 2097 | Ga0495677_0001720 | |||
| 2098 | Ga0495679_000126 | |||
| 2099 | Ga0495679_001091 | |||
| 2100 | Ga0495679_005567 | |||
| 2101 | Ga0495673_0000563 | |||
| 2102 | Ga0495673_0000756 | |||
| 2103 | Ga0495673_0001439 | |||
| 2104 | Ga0495673_0001621 | |||
| 2105 | Ga0495673_0001970 | |||
| 2106 | Ga0495673_0003378 | |||
| 2107 | Ga0495673_0006887 | |||
| 2108 | Ga0495673_0007767 | |||
| 2109 | Ga0495673_0008715 | |||
| 2110 | Ga0495673_0010471 | |||
| 2111 | Ga0495673_0036989 | |||
| 2112 | Ga0495673_0044780 | |||
| 2113 | Ga0495681_0000621 | |||
| 2114 | Ga0495681_0002873 | |||
| 2115 | Ga0495681_0002922 | |||
| 2116 | Ga0495681_0003184 | |||
| 2117 | Ga0495681_0003366 | |||
| 2118 | Ga0495681_0003624 | |||
| 2119 | Ga0495681_0004146 | |||
| 2120 | Ga0495681_0030713 | |||
| 2121 | Ga0495686_0014292 | |||
| 2122 | Ga0495686_0179329 | |||
| 2123 | Ga0495593_0084687 | |||
| 2124 | Ga0495602_0008233 | |||
| 2125 | Ga0495602_0156768 | |||
| 2126 | Ga0495626_0000007 | |||
| 2127 | Ga0495626_0000781 | |||
| 2128 | Ga0495626_0000797 | |||
| 2129 | Ga0495626_0001164 | |||
| 2130 | Ga0495626_0001500 | |||
| 2131 | Ga0495626_0001690 | |||
| 2132 | Ga0495626_0006100 | |||
| 2133 | Ga0495626_0006819 | |||
| 2134 | Ga0495626_0013391 | |||
| 2135 | Ga0495626_0017937 | |||
| 2136 | Ga0495626_0059893 | |||
| 2137 | Ga0495626_0074656 | |||
| 2138 | Ga0495626_0085399 | |||
| 2139 | Ga0496101_0007202 | |||
| 2140 | Ga0496102_0003978 | |||
| 2141 | Ga0496104_0177396 | |||
| 2142 | Ga0496105_0173126 | |||
| 2143 | Ga0496106_0058248 | |||
| 2144 | Ga0496106_0103707 | |||
| 2145 | Ga0496107_0023371 | |||
| 2146 | Ga0496108_0022808 | |||
| 2147 | Ga0496109_0003591 | |||
| 2148 | Ga0496110_0002942 | |||
| 2149 | Ga0496111_0020343 | |||
| 2150 | Ga0496112_0007709 | |||
| 2151 | Ga0496113_0002270 | |||
| 2152 | Ga0496114_0004290 | |||
| 2153 | Ga0496114_0020811 | |||
| 2154 | Ga0496116_0000085 | |||
| 2155 | Ga0496116_0003914 | |||
| 2156 | Ga0496116_0006839 | |||
| 2157 | Ga0496117_0001083 | |||
| 2158 | Ga0496117_0002358 | |||
| 2159 | Ga0496117_0004322 | |||
| 2160 | Ga0496117_0173301 | |||
| 2161 | Ga0496118_0009700 | |||
| 2162 | Ga0496118_0062969 | |||
| 2163 | Ga0496119_0000541 | |||
| 2164 | Ga0496119_0104444 | |||
| 2165 | Ga0496120_0004162 | |||
| 2166 | Ga0496120_0029700 | |||
| 2167 | Ga0496120_0078933 | |||
| 2168 | Ga0496121_0000505 | |||
| 2169 | Ga0496121_0005098 | |||
| 2170 | Ga0496121_0007632 | |||
| 2171 | Ga0496121_0011923 | |||
| 2172 | Ga0496122_0001401 | |||
| 2173 | Ga0496122_0001761 | |||
| 2174 | Ga0496122_0018748 | |||
| 2175 | Ga0496122_0037920 | |||
| 2176 | Ga0496123_0000087 | |||
| 2177 | Ga0496123_0000437 | |||
| 2178 | Ga0496123_0002183 | |||
| 2179 | Ga0496123_0038198 | |||
| 2180 | Ga0496123_0050249 | |||
| 2181 | Ga0496124_0004536 | |||
| 2182 | Ga0496124_0008936 | |||
| 2183 | Ga0496124_0027679 | |||
| 2184 | Ga0496124_0043945 | |||
| 2185 | Ga0496124_0053822 | |||
| 2186 | Ga0496125_0002759 | |||
| 2187 | Ga0496125_0005425 | |||
| 2188 | Ga0496125_0009623 | |||
| 2189 | Ga0496126_0053490 | |||
| 2190 | Ga0496126_0063867 | |||
| 2191 | Ga0495678_000033 | |||
| 2192 | Ga0495678_000702 | |||
| 2193 | Ga0495678_000787 | |||
| 2194 | Ga0495678_001749 | |||
| 2195 | Ga0495678_007090 | |||
| 2196 | Ga0495678_008645 | |||
| 2197 | Ga0495678_013895 | |||
| 2198 | Ga0495678_074174 | |||
| 2199 | Ga0495682_0000050 | |||
| 2200 | Ga0495682_0001194 | |||
| 2201 | Ga0495682_0002875 | |||
| 2202 | Ga0495682_0051130 | |||
| 2203 | Ga0501034_0000084 | |||
| 2204 | Ga0501034_0041358 | |||
| 2205 | Ga0501042_0225654 | |||
| 2206 | Ga0501047_0000845 | |||
| 2207 | Ga0501074_0020569 | |||
| 2208 | Ga0501080_0069035 | |||
| 2209 | Ga0501241_000495 | |||
| 2210 | nmdc:mga0k408_52644_c1 | |||
| 2211 | nmdc:mga09592_146115_c1 | |||
| 2212 | nmdc:mga0qj67_12029_c1 | |||
| 2213 | nmdc:mga06r32_1736_c1 | |||
| 2214 | Ga0495619_0109851 | |||
| 2215 | Ga0500643_000861 | |||
| 2216 | Ga0500643_005050 | |||
| 2217 | Ga0500583_0109755 | |||
| 2218 | Ga0500641_0004410 | |||
| 2219 | Ga0500556_0058222 | |||
| 2220 | Ga0500655_024570 | |||
| 2221 | Ga0500568_0012910 | |||
| 2222 | Ga0500616_0043392 | |||
| 2223 | Ga0500616_0056895 | |||
| 2224 | Ga0500622_0001897 | |||
| 2225 | Ga0500622_0006129 | |||
| 2226 | Ga0500622_0035128 | |||
| 2227 | Ga0500637_0007182 | |||
| 2228 | Ga0500645_003365 | |||
| 2229 | 2511252494 | |||
| 2230 | 2511263703 | |||
| 2231 | 2511272385 | |||
| 2232 | 2511278627 | |||
| 2233 | 2511292554 | |||
| 2234 | 2511293814 | |||
| 2235 | 2511299922 | |||
| 2236 | 2511312163 | |||
| 2237 | 2511320226 | |||
| 2238 | 2511329379 | |||
| 2239 | 2511334064 | |||
| 2240 | 2511337258 | |||
| 2241 | 2511344290 | |||
| 2242 | 2511352112 | |||
| 2243 | 2511357487 | |||
| 2244 | 2511363901 | |||
| 2245 | 2511370085 | |||
| 2246 | 2511376417 | |||
| 2247 | 2511416286 | |||
| 2248 | 2511826253 | |||
| 2249 | 2512324886 | |||
| 2250 | 2554816240 | |||
| 2251 | 2555249242 | |||
| 2252 | 2555668674 | |||
| 2253 | 2583791012 | |||
| 2254 | 2597856843 | |||
| 2255 | 2597863055 | |||
| 2256 | 2597868848 | |||
| 2257 | 2599330493 | |||
| 2258 | 2599357045 | |||
| 2259 | 2599362168 | |||
| 2260 | 2599368488 | |||
| 2261 | 2599375277 | |||
| 2262 | 2599382150 | |||
| 2263 | 2599388597 | |||
| 2264 | 2599394135 | |||
| 2265 | 2599401638 | |||
| 2266 | 2599405900 | |||
| 2267 | 2599451820 | |||
| 2268 | 2599464450 | |||
| 2269 | 2599468774 | |||
| 2270 | 2599483870 | |||
| 2271 | 2599493473 | |||
| 2272 | 2599509596 | |||
| 2273 | 2599514883 | |||
| 2274 | 2599520980 | |||
| 2275 | 2599613485 | |||
| 2276 | 2599772392 | |||
| 2277 | 2599801516 | |||
| 2278 | 2599882230 | |||
| 2279 | 2599888887 | |||
| 2280 | 2599894320 | |||
| 2281 | 2599900516 | |||
| 2282 | 2599944011 | |||
| 2283 | 2599951530 | |||
| 2284 | 2599955777 | |||
| 2285 | 2599961412 | |||
| 2286 | 2599967262 | |||
| 2287 | 2599971598 | |||
| 2288 | 2599979343 | |||
| 2289 | 2599985578 | |||
| 2290 | 2599989451 | |||
| 2291 | 2599994375 | |||
| 2292 | 2600000153 | |||
| 2293 | 2600008403 | |||
| 2294 | 2600013228 | |||
| 2295 | 2600019646 | |||
| 2296 | 2600023669 | |||
| 2297 | 2600032313 | |||
| 2298 | 2600038757 | |||
| 2299 | 2600044202 | |||
| 2300 | 2600048460 | |||
| 2301 | 2600054156 | |||
| 2302 | 2600060374 | |||
| 2303 | 2600066533 | |||
| 2304 | 2600073400 | |||
| 2305 | 2600078156 | |||
| 2306 | 2600216727 | |||
| 2307 | 2600361875 | |||
| 2308 | 2600365812 | |||
| 2309 | 2601625160 | |||
| 2310 | 2601694234 | |||
| 2311 | 2601776676 | |||
| 2312 | 2601795499 | |||
| 2313 | 2606075569 | |||
| 2314 | 2606128520 | |||
| 2315 | 2608380358 | |||
| 2316 | 2621300869 | |||
| 2317 | 2624479435 | |||
| 2318 | 2624493575 | |||
| 2319 | 2643841755 | |||
| 2320 | 2643871827 | |||
| 2321 | 2643952572 | |||
| 2322 | 2644022334 | |||
| 2323 | 2644187154 | |||
| 2324 | 2644286103 | |||
| 2325 | 2644623121 | |||
| 2326 | 2652547578 | |||
| 2327 | 2671093177 | |||
| 2328 | 2671098807 | |||
| 2329 | 2671128956 | |||
| 2330 | 2671768465 | |||
| 2331 | 2677898235 | |||
| 2332 | 2678264593 | |||
| 2333 | 2715753829 | |||
| 2334 | 2715757702 | |||
| 2335 | 2718633283 | |||
| 2336 | 2723247873 | |||
| 2337 | 2738670506 | |||
| 2338 | 2738691736 | |||
| 2339 | 2738748899 | |||
| 2340 | 2738810883 | |||
| 2341 | 2738857941 | |||
| 2342 | 2738898243 | |||
| 2343 | 2739200857 | |||
| 2344 | 2739261109 | |||
| 2345 | 2739267510 | |||
| 2346 | 2739316020 | |||
| 2347 | 2743736271 | |||
| 2348 | 2745005047 | |||
| 2349 | 2765582840 | |||
| 2350 | 2774122877 | |||
| 2351 | 2774137593 | |||
| 2352 | 2784265658 | |||
| 2353 | 2784315235 | |||
| 2354 | 2794595091 | |||
| 2355 | 2807409421 | |||
| 2356 | 2807457723 | |||
| 2357 | 2808857046 | |||
| 2358 | 2808926991 | |||
| 2359 | 2808927363 | |||
| 2360 | 2808937118 | |||
| 2361 | 2808949075 | |||
| 2362 | 2808950098 | |||
| 2363 | 2808957685 | |||
| 2364 | 2808965434 | |||
| 2365 | 2808979404 | |||
| 2366 | 2808995328 | |||
| 2367 | 2809000325 | |||
| 2368 | 2809216372 | |||
| 2369 | 2812365921 | |||
| 2370 | 2817489830 | |||
| 2371 | 2819654010 | |||
| 2372 | 2819703928 | |||
| 2373 | 2825656462 | |||
| 2374 | 2826585229 | |||
| 2375 | 2834029705 | |||
| 2376 | 2842818836 | |||
| 2377 | 2842832188 | |||
| 2378 | 2842832694 | |||
| 2379 | 2842841521 | |||
| 2380 | 2842848221 | |||
| 2381 | 2842853570 | |||
| 2382 | 2842856849 | |||
| 2383 | 2844669175 | |||
| 2384 | 2852618411 | |||
| 2385 | 2852658919 | |||
| 2386 | 2852673453 | |||
| 2387 | 2860340022 | |||
| 2388 | 2860869700 | |||
| 2389 | 2878031439 | |||
| 2390 | 2880232309 | |||
| 2391 | 2904521800 | |||
| 2392 | 2904553196 | |||
| 2393 | 2908448635 | |||
| 2394 | 2912965389 | |||
| 2395 | 2913041069 | |||
| 2396 | 2917072446 | |||
| 2397 | 2917835495 | |||
| 2398 | 2919064091 | |||
| 2399 | 2919157767 | |||
| 2400 | 2919386402 | |||
| 2401 | 2919457113 | |||
| 2402 | 2919486173 | |||
| 2403 | 2919491315 | |||
| 2404 | 2919702875 | |||
| 2405 | 2923155285 | |||
| 2406 | 2923519942 | |||
| 2407 | 2923529144 | |||
| 2408 | 2923590107 | |||
| 2409 | 2929148573 | |||
| 2410 | 2929191673 | |||
| 2411 | 2931373987 | |||
| 2412 | 2931392775 | |||
| 2413 | 2931400087 | |||
| 2414 | 2935354610 | |||
| 2415 | 2939639743 | |||
| 2416 | 2939655223 | |||
| 2417 | 2945928894 | |||
| 2418 | 2945965162 | |||
| 2419 | 2946011099 | |||
| 2420 | 2946029955 | |||
| 2421 | 2947236528 | |||
| 2422 | 2969306221 | |||
| 2423 | 2974292126 | |||
| 2424 | 2984290753 | |||
| 2425 | 2988730164 | |||
| 2426 | 2998141617 | |||
| 2427 | 3007400825 | |||
| 2428 | 3007421282 | |||
| 2429 | 3007513015 | |||
| 2430 | 3007617582 | |||
| 2431 | 3007622345 | |||
| 2432 | 3007723328 | |||
| 2433 | 3007803594 | |||
| 2434 | 3007856208 | |||
| 2435 | 3007863144 | |||
| 2436 | 3007870510 | |||
| 2437 | 3007873197 | |||
| 2438 | 637319033 | |||
| 2439 | 8015689503 | |||
| 2440 | 8019774088 | |||
| 2441 | 8019780244 | |||
| 2442 | 8029999139 | |||
| 2443 | 8052498428 | |||
| 2444 | 8054288024 | |||
| 2445 | 8054352130 | |||
| 2446 | 8054505276 | |||
| 2447 | 8054930080 | |||
| 2448 | 8055772640 | |||
| 2449 | 8055819832 | |||
| 2450 | 8055878977 | |||
| 2451 | 8056119705 | |||
| 2452 | 8056122408 | |||
| 2453 | 8056130187 | |||
| 2454 | 8056133599 | |||
| 2455 | 8056141360 | |||
| 2456 | 8056144805 | |||
| 2457 | 8056150508 | |||
| 2458 | 8056156233 | |||
| 2459 | 8056165022 | |||
| 2460 | 8056169374 | |||
| 2461 | 8056175559 | |||
| 2462 | 8056181143 | |||
| 2463 | 8056573228 | |||
| 2464 | 8057799068 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sbp-assembly1.cif.gz_A | 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding | 0.9306 | 23 | 328 |
| 5um2-assembly1.cif.gz_A | functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri | 0.924 | 23 | 332 |
| 1sbp-assembly1.cif.gz_A | 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding | 0.9191 | 23 | 328 |
| 6ddn-assembly2.cif.gz_B | the sulfate-binding protein subi from mycobacterium tuberculosis h37rv | 0.9111 | 24 | 316 |
| 5um2-assembly1.cif.gz_A | functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri | 0.9046 | 23 | 332 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P16700_28_100_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9818 | 26 | 96 | 3.40.190.10 |
| 1sbpA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.979 | 23 | 297 | 3.40.190.10 |
| 1sbpA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9662 | 23 | 297 | 3.40.190.10 |
| af_P16700_120_332_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.958 | 117 | 327 | 3.40.190.10 |
| af_P16700_16_293_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9492 | 19 | 288 | 3.40.50.1100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M2ZTF6-F1-model_v4 | Sulfate ABC transporter periplasmic sulfate-binding protein | 1.001 | 65 | 332 |
GO:0042597
GO:1902358 |
| AF-A0A3M2ZTF6-F1-model_v4 | Sulfate ABC transporter periplasmic sulfate-binding protein | 0.9969 | 65 | 332 |
GO:0042597
GO:1902358 |
| AF-A0A0P9GN89-F1-model_v4 | deleted | 0.9953 | 18 | 332 |
|
| AF-A0A5E7VYV4-F1-model_v4 | Sulfate-binding protein | 0.9946 | 19 | 332 |
GO:0042597
GO:1902358 |
| AF-A0A5E7VYV4-F1-model_v4 | Sulfate-binding protein | 0.9915 | 19 | 332 |
GO:0042597
GO:1902358 |