F492006

General Info

Members Datasets Scaffolds Average Seq Length
1232 544 2464 253

Family's Representative Sequence

Representative Sequence 3300042532|Ga0450893_0013104|Ga0450893_0013104_137_1012
Length 291
Sequence MDRLVLAAYDPSSLKRRSQMKTVLITGTSSGYGKATAETFLNQGWNVVATMRRPDESVLGGPNSRLRVVKLDVTDDVSIAAAISEGCSAFGNIDVLVNNAGIGLFSALEATPKQTIREVFETNTFGVMAMTQAIIPLMRESGDGTIINVTSSVCFAGMPLVAPYAASKWAIEGFTESLYFEMEAVGIRVRLVEPGYGPGTAFAANGMDRMNGLISAPYRAYAAQMLKQFGTPAAVTLPEQVAAAVYAAATDESEKLRFPAGPDSEHLSNARWNSTDARFLSGMRSMLRMQK

Samples

Sample ID Description Type Environment
1 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
156 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
158 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
232 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
243 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
244 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
245 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
246 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
247 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
248 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
249 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
250 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
253 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
254 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
263 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
264 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
270 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
271 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
276 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
277 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
278 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
279 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
280 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
281 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
282 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
283 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
284 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
285 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
286 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
287 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
288 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
289 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
290 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
291 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
292 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
293 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
294 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
295 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
296 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
300 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
301 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
302 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
303 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
304 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
305 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
306 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
307 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
308 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
309 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
310 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
311 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
312 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
313 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
314 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
315 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
316 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
317 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
318 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
319 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
320 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
321 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
324 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
325 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
326 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
327 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
328 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
329 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
330 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
331 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
332 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
333 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
334 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
335 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
338 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
339 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
340 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
341 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
342 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
343 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
344 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
348 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
351 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
352 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
355 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
356 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
357 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
358 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
359 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
360 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
363 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
364 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
365 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
366 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
367 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
368 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
369 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
370 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
371 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
372 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
375 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
376 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
377 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
378 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
379 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
380 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
381 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
382 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
383 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
386 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
387 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
388 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
389 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
390 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
391 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
398 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
399 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
400 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
401 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
402 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
403 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
404 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
405 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
406 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
407 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
408 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
409 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
410 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
411 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
412 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
413 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
414 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
415 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
418 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
419 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
420 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
421 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
422 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
423 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
426 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
427 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
428 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
429 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
430 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
431 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
432 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
433 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
434 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
435 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
436 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
437 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
438 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
439 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
440 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
441 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
442 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
443 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
444 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
445 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
446 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
447 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
448 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
449 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
450 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
451 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
452 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
453 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
454 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
455 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
456 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
457 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
458 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
459 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
460 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
461 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
462 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
463 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
464 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
465 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
466 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
467 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
468 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
469 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
470 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
471 2643221618 Ensifer sp. Root231 Isolate Unclassified
472 2643221626 Ensifer sp. Root31 Isolate Unclassified
473 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
474 2643221655 Ensifer sp. Root1252 Isolate Unclassified
475 2643221659 Ensifer sp. Root127 Isolate Unclassified
476 2643221660 Methylibium sp. Root1272 Isolate Unclassified
477 2643221698 Ensifer sp. Root142 Isolate Unclassified
478 2643221712 Ensifer sp. Root258 Isolate Unclassified
479 2643221718 Rhizobium sp. Root268 Isolate Unclassified
480 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
481 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
482 2738541300 Massilia sp. GV016 Isolate Unclassified
483 2738541307 Variovorax sp. GV008 Isolate Unclassified
484 2738541337 Pelomonas sp. BT06 Isolate Unclassified
485 2738543012 Acidovorax sp. CF301 Isolate Unclassified
486 2738543018 Massilia sp. GV045 Isolate Unclassified
487 2738543024 Aminobacter sp. AP02 Isolate Unclassified
488 2738543030 Massilia sp. GV097 Isolate Unclassified
489 2739367700 Dyella sp. YR388 Isolate Unclassified
490 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
491 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
492 2816332133 Acidovorax radicis 2721A Isolate Unclassified
493 2818991446 Variovorax sp. 1180 Isolate Unclassified
494 2818991457 Xanthomonas translucens 569 Isolate Unclassified
495 2821131069 Duganella sp. 1224 Isolate Unclassified
496 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
497 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
498 2844163670 Ensifer sp. 1H6 Isolate Unclassified
499 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
500 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
501 2857558681 Duganella sp. R-74565 Isolate Unclassified
502 2857564685 Duganella sp. R-74599 Isolate Unclassified
503 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
504 2885198086 Variovorax sp. 679 Isolate Unclassified
505 2885211737 Variovorax sp. 553 Isolate Unclassified
506 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
507 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
508 2899924645 Variovorax sp. 369 Isolate Unclassified
509 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
510 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
511 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
512 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
513 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
514 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
515 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
516 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
517 2928037797 Variovorax sp. 1126 Isolate Unclassified
518 2928044640 Variovorax sp. 1128 Isolate Unclassified
519 2928051484 Variovorax sp. 1133 Isolate Unclassified
520 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
521 2928070936 Variovorax gossypii 1167 Isolate Unclassified
522 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
523 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
524 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
525 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
526 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
527 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
528 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
529 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
530 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
531 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
532 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
533 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
534 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
535 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
536 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
537 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
538 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
539 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
540 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
541 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
542 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
543 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
544 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0.16
Isolates 6.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.91
Nodule 1.7
Rhizoplane 5.76
Rhizosphere 64.29
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450893_0013104 3300042532 Bacteria 1380
2 SwRhRL2b_contig_2860078 2162886007 Bacteria 3122
3 JGI24744J21845_10039697 3300002077 Bacteria 883
4 JGI25162J39368_1000325 3300002737 Bacteria 41858
5 JGI25152J39213_1004868 3300002773 Bacteria 4095
6 JGI25152J39213_1005264 3300002773 Bacteria 3830
7 JGI25150J39212_1001022 3300002774 Bacteria 8624
8 JGI25159J45721_1005249 3300002987 Bacteria 4095
9 JGI25159J45721_1009606 3300002987 Bacteria 2538
10 JGI25151J46595_10000769 3300003187 Bacteria 25987
11 JGI25151J46595_10001831 3300003187 Bacteria 13709
12 JGI25151J46595_10011357 3300003187 Bacteria 4095
13 JGI25151J46595_10035102 3300003187 Bacteria 1909
14 JGI25165J46597_1000025 3300003214 Bacteria 333075
15 JGI25165J46597_1000093 3300003214 Bacteria 164901
16 JGI25153J46596_10007130 3300003215 Bacteria 5545
17 JGI25153J46596_10010807 3300003215 Bacteria 4095
18 rootH1_10059477 3300003316 Bacteria 2752
19 rootH2_10080573 3300003320 Bacteria 2003
20 rootL2_10019734 3300003322 Bacteria 1533
21 rootL2_10173320 3300003322 Bacteria 2715
22 rootL2_10287941 3300003322 Bacteria 1218
23 rootL2_10304017 3300003322 Bacteria 1861
24 rootH1_10089564 3300003323 Bacteria 3592
25 rootH1_10181815 3300003323 Bacteria 5931
26 rootH1_10294441 3300003323 Bacteria 1638
27 JGI25160J50197_1007920 3300003354 Bacteria 4095
28 JGI25160J50197_1021648 3300003354 Bacteria 1903
29 JGI25161J50226_1002500 3300003374 Bacteria 4680
30 JGI25161J50226_1002906 3300003374 Bacteria 4163
31 Ga0006562J51391_1022014 3300003578 Bacteria 3490
32 Ga0006562J51391_1022018 3300003578 Bacteria 1230
33 Ga0055532_1002928 3300003758 Bacteria 3207
34 Ga0055535_1000075 3300003761 Bacteria 111667
35 Ga0055535_1012050 3300003761 Bacteria 1336
36 Ga0055542_1000010 3300003762 Bacteria 414813
37 Ga0055542_1000059 3300003762 Bacteria 162670
38 Ga0055526_1000049 3300003771 Bacteria 118394
39 Ga0055526_1002029 3300003771 Bacteria 13928
40 Ga0055526_1002541 3300003771 Bacteria 12251
41 Ga0055526_1011134 3300003771 Bacteria 4095
42 Ga0055537_1004302 3300003773 Bacteria 4095
43 Ga0055524_1000010 3300003775 Bacteria 282893
44 Ga0055524_1000945 3300003775 Bacteria 18480
45 Ga0055524_1009016 3300003775 Bacteria 4095
46 Ga0055536_1001372 3300003781 Bacteria 14798
47 Ga0055534_1004396 3300003784 Bacteria 4095
48 Ga0055528_1009372 3300003790 Bacteria 4095
49 Ga0055530_10000110 3300003791 Bacteria 71015
50 Ga0055540_1000041 3300003792 Bacteria 157379
51 Ga0055540_1001203 3300003792 Bacteria 15940
52 Ga0055540_1010275 3300003792 Bacteria 3128
53 Ga0055540_1013272 3300003792 Bacteria 2528
54 Ga0055531_10001413 3300003794 Bacteria 17732
55 Ga0055531_10015183 3300003794 Bacteria 3415
56 Ga0058692_1000049 3300003856 Bacteria 108875
57 Ga0055543_1000644 3300004625 Bacteria 18672
58 Ga0055543_1001425 3300004625 Bacteria 9508
59 Ga0055543_1004012 3300004625 Bacteria 4133
60 Ga0065165_1000270 3300005262 Bacteria 88828
61 Ga0065165_1009374 3300005262 Bacteria 4400
62 Ga0065165_1010028 3300005262 Bacteria 4162
63 Ga0065714_10072403 3300005288 Bacteria 3359
64 Ga0065714_10112334 3300005288 Bacteria 1457
65 Ga0065704_10071092 3300005289 Bacteria 13225
66 Ga0065712_10069451 3300005290 Bacteria 7244
67 Ga0065715_10098321 3300005293 Bacteria 3564
68 Ga0065715_10119915 3300005293 Bacteria 2273
69 Ga0065707_10092842 3300005295 Bacteria 3709
70 Ga0065707_10121741 3300005295 Bacteria 2103
71 Ga0065707_10145648 3300005295 Bacteria 1717
72 Ga0065707_10208077 3300005295 Bacteria 1278
73 Ga0070658_10003035 3300005327 Bacteria 13893
74 Ga0070676_10025716 3300005328 Bacteria 3329
75 Ga0070676_10117849 3300005328 Bacteria 1662
76 Ga0070683_100133310 3300005329 Bacteria 2351
77 Ga0070690_100000538 3300005330 Bacteria 18981
78 Ga0070690_100422631 3300005330 Bacteria 983
79 Ga0070670_100004373 3300005331 Bacteria 11827
80 Ga0070670_100169575 3300005331 Bacteria 1893
81 Ga0070677_10028182 3300005333 Bacteria 2120
82 Ga0070677_10034722 3300005333 Bacteria 1950
83 Ga0068869_100003866 3300005334 Bacteria 9242
84 Ga0068869_100033771 3300005334 Bacteria 3614
85 Ga0068869_100129209 3300005334 Bacteria 1940
86 Ga0068869_100459705 3300005334 Unclassified 1056
87 Ga0070666_10001802 3300005335 Bacteria 13044
88 Ga0070666_10025039 3300005335 Bacteria 3889
89 Ga0070680_100161241 3300005336 Bacteria 1884
90 Ga0070682_100002484 3300005337 Bacteria 10184
91 Ga0070682_100129428 3300005337 Bacteria 1706
92 Ga0068868_100000766 3300005338 Bacteria 21697
93 Ga0068868_100001742 3300005338 Bacteria 14916
94 Ga0070660_100145029 3300005339 Bacteria 1906
95 Ga0070689_100005140 3300005340 Bacteria 8899
96 Ga0070689_100013198 3300005340 Bacteria 5973
97 Ga0070689_100051022 3300005340 Bacteria 3196
98 Ga0070689_100350364 3300005340 Bacteria 1238
99 Ga0070691_10002694 3300005341 Bacteria 7914
100 Ga0070691_10039606 3300005341 Bacteria 2227
101 Ga0070687_100008149 3300005343 Bacteria 4419
102 Ga0070661_100009036 3300005344 Bacteria 6894
103 Ga0070668_100102560 3300005347 Bacteria 2268
104 Ga0070668_100224697 3300005347 Bacteria 1550
105 Ga0070668_100229761 3300005347 Bacteria 1533
106 Ga0070668_100502268 3300005347 Bacteria 1050
107 Ga0070669_100044658 3300005353 Bacteria 3228
108 Ga0070669_100095142 3300005353 Bacteria 2239
109 Ga0070669_100149107 3300005353 Bacteria 1809
110 Ga0070669_100244735 3300005353 Bacteria 1426
111 Ga0070669_100534876 3300005353 Bacteria 976
112 Ga0070675_100000010 3300005354 Bacteria 243396
113 Ga0070675_100000445 3300005354 Bacteria 28157
114 Ga0070675_100005604 3300005354 Bacteria 9611
115 Ga0070675_100013366 3300005354 Bacteria 6451
116 Ga0070671_100009551 3300005355 Bacteria 7792
117 Ga0070671_100118845 3300005355 Bacteria 2224
118 Ga0070671_100159471 3300005355 Bacteria 1907
119 Ga0070674_100001117 3300005356 Bacteria 14084
120 Ga0070674_100267646 3300005356 Bacteria 1349
121 Ga0070674_100311939 3300005356 Bacteria 1258
122 Ga0070674_100466206 3300005356 Bacteria 1045
123 Ga0070673_100003356 3300005364 Bacteria 9953
124 Ga0070688_100029427 3300005365 Bacteria 3289
125 Ga0070688_100236372 3300005365 Bacteria 1295
126 Ga0070667_100000477 3300005367 Bacteria 41141
127 Ga0070667_100024156 3300005367 Bacteria 5048
128 Ga0070667_100030777 3300005367 Bacteria 4476
129 Ga0070667_100047983 3300005367 Bacteria 3594
130 Ga0070667_100092158 3300005367 Bacteria 2607
131 Ga0070710_10097224 3300005437 Bacteria 1747
132 Ga0070701_10009549 3300005438 Bacteria 4255
133 Ga0070700_100002314 3300005441 Bacteria 9694
134 Ga0070694_100002558 3300005444 Bacteria 10748
135 Ga0070694_100026473 3300005444 Bacteria 3759
136 Ga0070694_100043861 3300005444 Bacteria 2992
137 Ga0070694_100424505 3300005444 Bacteria 1045
138 Ga0070663_100031606 3300005455 Bacteria 3640
139 Ga0070663_100257649 3300005455 Bacteria 1383
140 Ga0070678_100000859 3300005456 Bacteria 15492
141 Ga0070678_100011676 3300005456 Bacteria 5430
142 Ga0070678_100098686 3300005456 Bacteria 2259
143 Ga0070678_100207796 3300005456 Bacteria 1620
144 Ga0070678_100646979 3300005456 Bacteria 948
145 Ga0070662_100032332 3300005457 Bacteria 3677
146 Ga0070662_100197030 3300005457 Bacteria 1596
147 Ga0070662_100323700 3300005457 Bacteria 1257
148 Ga0070662_100400524 3300005457 Bacteria 1133
149 Ga0068867_100015597 3300005459 Bacteria 5392
150 Ga0068867_100113402 3300005459 Bacteria 2085
151 Ga0068867_100151957 3300005459 Bacteria 1819
152 Ga0068867_100265589 3300005459 Bacteria 1401
153 Ga0070685_10059909 3300005466 Bacteria 2224
154 Ga0070685_10414690 3300005466 Bacteria 936
155 Ga0070707_100026233 3300005468 Bacteria 5531
156 Ga0070699_100000005 3300005518 Bacteria 384287
157 Ga0070699_100444215 3300005518 Bacteria 1175
158 Ga0070684_100000954 3300005535 Bacteria 20603
159 Ga0070684_100019611 3300005535 Bacteria 5596
160 Ga0070697_100042621 3300005536 Bacteria 3673
161 Ga0070697_100285845 3300005536 Bacteria 1416
162 Ga0070697_100347549 3300005536 Bacteria 1280
163 Ga0068853_100016895 3300005539 Bacteria 6013
164 Ga0068853_100491929 3300005539 Unclassified 1157
165 Ga0070672_100003091 3300005543 Bacteria 10742
166 Ga0070672_100020071 3300005543 Bacteria 4868
167 Ga0070672_100384514 3300005543 Bacteria 1201
168 Ga0070686_100000293 3300005544 Bacteria 33629
169 Ga0070686_100077926 3300005544 Bacteria 2187
170 Ga0070686_100084831 3300005544 Bacteria 2106
171 Ga0070695_100010663 3300005545 Bacteria 5490
172 Ga0070695_100195142 3300005545 Bacteria 1443
173 Ga0070696_100006584 3300005546 Bacteria 7756
174 Ga0070696_100045880 3300005546 Bacteria 3029
175 Ga0070696_100067455 3300005546 Bacteria 2510
176 Ga0070696_100242352 3300005546 Bacteria 1360
177 Ga0070665_100007771 3300005548 Bacteria 10891
178 Ga0070665_100008646 3300005548 Bacteria 10306
179 Ga0070665_100016371 3300005548 Bacteria 7436
180 Ga0070665_100047277 3300005548 Bacteria 4319
181 Ga0070665_100052014 3300005548 Bacteria 4109
182 Ga0070665_100076080 3300005548 Bacteria 3364
183 Ga0070665_100134571 3300005548 Bacteria 2474
184 Ga0070665_100204752 3300005548 Bacteria 1974
185 Ga0070665_100351479 3300005548 Bacteria 1479
186 Ga0070665_100901571 3300005548 Bacteria 897
187 Ga0070704_100016389 3300005549 Bacteria 4681
188 Ga0070704_100308255 3300005549 Bacteria 1322
189 Ga0068855_100000077 3300005563 Bacteria 117961
190 Ga0070664_100000870 3300005564 Bacteria 23371
191 Ga0070664_100089956 3300005564 Bacteria 2656
192 Ga0070664_100379291 3300005564 Bacteria 1290
193 Ga0068857_100009521 3300005577 Bacteria 8437
194 Ga0068857_100571779 3300005577 Bacteria 1066
195 Ga0070702_100000359 3300005615 Bacteria 15921
196 Ga0068852_100005804 3300005616 Bacteria 8863
197 Ga0068852_100040908 3300005616 Bacteria 3915
198 Ga0068852_100065512 3300005616 Bacteria 3170
199 Ga0068852_100127346 3300005616 Bacteria 2340
200 Ga0068852_100859147 3300005616 Bacteria 923
201 Ga0068859_100001990 3300005617 Bacteria 20858
202 Ga0068859_100003719 3300005617 Bacteria 15552
203 Ga0068859_100095148 3300005617 Bacteria 3031
204 Ga0068859_101147594 3300005617 Bacteria 855
205 Ga0068864_100000330 3300005618 Bacteria 41727
206 Ga0068864_100000771 3300005618 Bacteria 26901
207 Ga0068864_100012546 3300005618 Bacteria 7006
208 Ga0068864_100013570 3300005618 Bacteria 6755
209 Ga0068864_100042425 3300005618 Bacteria 3893
210 Ga0068864_100227085 3300005618 Bacteria 1725
211 Ga0068866_10115752 3300005718 Bacteria 1503
212 Ga0068861_100023885 3300005719 Bacteria 4415
213 Ga0068861_100051231 3300005719 Bacteria 3133
214 Ga0068861_100117001 3300005719 Bacteria 2144
215 Ga0068861_100284524 3300005719 Bacteria 1425
216 Ga0068851_10011636 3300005834 Bacteria 4130
217 Ga0068851_10014003 3300005834 Bacteria 3801
218 Ga0068870_10007021 3300005840 Bacteria 4997
219 Ga0068870_10344054 3300005840 Bacteria 955
220 Ga0068863_100000715 3300005841 Bacteria 33387
221 Ga0068863_100002278 3300005841 Bacteria 19076
222 Ga0068863_100109709 3300005841 Bacteria 2627
223 Ga0068858_100000900 3300005842 Bacteria 30822
224 Ga0068858_100061781 3300005842 Bacteria 3464
225 Ga0068858_100145143 3300005842 Bacteria 2228
226 Ga0068860_100028701 3300005843 Bacteria 5356
227 Ga0068860_100427383 3300005843 Bacteria 1314
228 Ga0068860_100506913 3300005843 Unclassified 1205
229 Ga0068862_100002820 3300005844 Bacteria 15243
230 Ga0068862_100009212 3300005844 Bacteria 8177
231 Ga0068862_100010797 3300005844 Bacteria 7541
232 Ga0068862_100071412 3300005844 Bacteria 2997
233 Ga0068862_100249552 3300005844 Bacteria 1617
234 Ga0068862_100480852 3300005844 Bacteria 1176
235 Ga0081455_10004533 3300005937 Bacteria 15519
236 Ga0081455_10094267 3300005937 Bacteria 2418
237 Ga0075365_10057951 3300006038 Bacteria 2578
238 Ga0075365_10137495 3300006038 Bacteria 1694
239 Ga0075365_10288003 3300006038 Bacteria 1156
240 Ga0075368_10001221 3300006042 Bacteria 8124
241 Ga0075368_10103606 3300006042 Bacteria 1170
242 Ga0075363_100026753 3300006048 Bacteria 2953
243 Ga0075363_100060155 3300006048 Bacteria 2044
244 Ga0075363_100064279 3300006048 Bacteria 1982
245 Ga0075363_100073288 3300006048 Bacteria 1863
246 Ga0075364_10003984 3300006051 Bacteria 8476
247 Ga0075364_10036900 3300006051 Bacteria 3162
248 Ga0075364_10053196 3300006051 Bacteria 2647
249 Ga0075364_10064607 3300006051 Bacteria 2402
250 Ga0075364_10315933 3300006051 Bacteria 1064
251 Ga0075364_10393514 3300006051 Bacteria 945
252 Ga0070712_100020126 3300006175 Bacteria 4363
253 Ga0075362_10004385 3300006177 Bacteria 5063
254 Ga0075362_10016898 3300006177 Bacteria 2997
255 Ga0075367_10003652 3300006178 Bacteria 7380
256 Ga0075367_10028294 3300006178 Bacteria 3196
257 Ga0075367_10097951 3300006178 Bacteria 1790
258 Ga0075369_10002867 3300006186 Bacteria 6216
259 Ga0075369_10002939 3300006186 Bacteria 6153
260 Ga0075369_10005309 3300006186 Bacteria 4804
261 Ga0075369_10049960 3300006186 Bacteria 1807
262 Ga0075369_10053629 3300006186 Bacteria 1750
263 Ga0075369_10066226 3300006186 Bacteria 1584
264 Ga0075366_10002636 3300006195 Bacteria 9237
265 Ga0075366_10007101 3300006195 Bacteria 6167
266 Ga0075366_10007693 3300006195 Bacteria 5966
267 Ga0075366_10033232 3300006195 Bacteria 3038
268 Ga0075366_10070189 3300006195 Bacteria 2086
269 Ga0075366_10141003 3300006195 Bacteria 1457
270 Ga0075366_10196740 3300006195 Bacteria 1225
271 Ga0097621_100173674 3300006237 Bacteria 1859
272 Ga0075370_10028180 3300006353 Bacteria 3120
273 Ga0075370_10073990 3300006353 Bacteria 1952
274 Ga0075370_10100650 3300006353 Bacteria 1672
275 Ga0068871_100021706 3300006358 Bacteria 4940
276 Ga0075428_100037285 3300006844 Bacteria 5353
277 Ga0075428_100132773 3300006844 Bacteria 2707
278 Ga0075428_100135898 3300006844 Bacteria 2673
279 Ga0075428_100230150 3300006844 Bacteria 2000
280 Ga0075428_100445885 3300006844 Bacteria 1386
281 Ga0075428_100615346 3300006844 Bacteria 1159
282 Ga0075430_100001045 3300006846 Bacteria 21885
283 Ga0075430_100008633 3300006846 Bacteria 8594
284 Ga0075430_100014112 3300006846 Bacteria 6812
285 Ga0075430_100014280 3300006846 Bacteria 6769
286 Ga0075430_100117464 3300006846 Bacteria 2217
287 Ga0075430_100143657 3300006846 Bacteria 1987
288 Ga0075430_100223467 3300006846 Bacteria 1562
289 Ga0075431_100015676 3300006847 Bacteria 7684
290 Ga0075431_100048191 3300006847 Bacteria 4394
291 Ga0075431_100048314 3300006847 Bacteria 4389
292 Ga0075431_100079161 3300006847 Bacteria 3393
293 Ga0075431_100178512 3300006847 Bacteria 2180
294 Ga0075431_100183113 3300006847 Bacteria 2149
295 Ga0075431_100184627 3300006847 Bacteria 2139
296 Ga0075431_100231265 3300006847 Bacteria 1883
297 Ga0075431_100272041 3300006847 Bacteria 1716
298 Ga0075431_100580635 3300006847 Bacteria 1106
299 Ga0075431_100580814 3300006847 Bacteria 1106
300 Ga0075434_100698364 3300006871 Bacteria 1032
301 Ga0075429_100021249 3300006880 Bacteria 5626
302 Ga0075429_100023365 3300006880 Bacteria 5364
303 Ga0075429_100026043 3300006880 Bacteria 5077
304 Ga0075429_100034391 3300006880 Bacteria 4404
305 Ga0075429_100037388 3300006880 Bacteria 4226
306 Ga0075429_100144021 3300006880 Bacteria 2086
307 Ga0075429_100158868 3300006880 Bacteria 1979
308 Ga0068865_100013232 3300006881 Bacteria 5210
309 Ga0068865_100015253 3300006881 Bacteria 4898
310 Ga0068865_100034091 3300006881 Bacteria 3413
311 Ga0068865_100228347 3300006881 Bacteria 1459
312 Ga0068865_100692454 3300006881 Bacteria 870
313 Ga0097620_100001990 3300006931 Bacteria 20858
314 Ga0097620_100003719 3300006931 Bacteria 15552
315 Ga0097620_100095154 3300006931 Bacteria 3031
316 Ga0097620_100424970 3300006931 Bacteria 1425
317 Ga0097620_101147597 3300006931 Bacteria 855
318 Ga0099826_10000002 3300006948 Bacteria 1125830
319 Ga0075435_100067997 3300007076 Bacteria 2901
320 Ga0075435_100091437 3300007076 Bacteria 2511
321 Ga0075435_100150936 3300007076 Bacteria 1953
322 Ga0075435_100492769 3300007076 Bacteria 1059
323 Ga0105251_10001457 3300009011 Bacteria 20342
324 Ga0105244_10024505 3300009036 Bacteria 3292
325 Ga0105244_10034561 3300009036 Bacteria 2660
326 Ga0105240_10000866 3300009093 Bacteria 54504
327 Ga0111539_10001718 3300009094 Bacteria 29157
328 Ga0111539_10007550 3300009094 Bacteria 13900
329 Ga0111539_10018738 3300009094 Bacteria 8568
330 Ga0111539_10042091 3300009094 Bacteria 5488
331 Ga0111539_10160902 3300009094 Bacteria 2626
332 Ga0111539_10182497 3300009094 Bacteria 2450
333 Ga0111539_10442133 3300009094 Bacteria 1514
334 Ga0111539_10498400 3300009094 Bacteria 1418
335 Ga0111539_10602268 3300009094 Bacteria 1280
336 Ga0111539_10911764 3300009094 Bacteria 1022
337 Ga0111539_10929380 3300009094 Bacteria 1011
338 Ga0105245_10003688 3300009098 Bacteria 13675
339 Ga0105245_10179174 3300009098 Bacteria 2023
340 Ga0105245_10275307 3300009098 Bacteria 1643
341 Ga0105245_10855686 3300009098 Bacteria 949
342 Ga0105245_10937138 3300009098 Bacteria 908
343 Ga0105247_10071502 3300009101 Bacteria 2170
344 Ga0105247_10095325 3300009101 Bacteria 1895
345 Ga0114129_10003317 3300009147 Bacteria 22611
346 Ga0114129_10029934 3300009147 Bacteria 7710
347 Ga0114129_10055009 3300009147 Bacteria 5578
348 Ga0114129_10066596 3300009147 Bacteria 5024
349 Ga0114129_10069466 3300009147 Bacteria 4910
350 Ga0114129_10076662 3300009147 Bacteria 4654
351 Ga0114129_10180181 3300009147 Bacteria 2876
352 Ga0105243_10000269 3300009148 Bacteria 58482
353 Ga0105243_10005736 3300009148 Bacteria 9640
354 Ga0105243_10163931 3300009148 Bacteria 1919
355 Ga0105243_10176467 3300009148 Bacteria 1855
356 Ga0105243_10877601 3300009148 Bacteria 890
357 Ga0105241_10001426 3300009174 Bacteria 18332
358 Ga0105242_10053019 3300009176 Bacteria 3311
359 Ga0105242_10256565 3300009176 Bacteria 1578
360 Ga0105248_10002894 3300009177 Bacteria 19051
361 Ga0105248_10004935 3300009177 Bacteria 14737
362 Ga0105248_10123754 3300009177 Unclassified 2917
363 Ga0105248_10129471 3300009177 Bacteria 2847
364 Ga0105237_10001081 3300009545 Bacteria 36547
365 Ga0105237_10044367 3300009545 Bacteria 4476
366 Ga0105237_10816030 3300009545 Bacteria 940
367 Ga0105238_10009507 3300009551 Bacteria 9729
368 Ga0105238_10020386 3300009551 Bacteria 6749
369 Ga0105238_10179088 3300009551 Unclassified 2097
370 Ga0105238_10462170 3300009551 Bacteria 1267
371 Ga0105238_10893032 3300009551 Bacteria 907
372 Ga0105249_10002448 3300009553 Bacteria 16116
373 Ga0105249_10134939 3300009553 Bacteria 2360
374 Ga0105249_10309268 3300009553 Bacteria 1588
375 Ga0105249_10400765 3300009553 Bacteria 1402
376 Ga0105249_10860948 3300009553 Bacteria 972
377 Ga0105239_10002017 3300010375 Bacteria 26336
378 Ga0105239_10031239 3300010375 Bacteria 5859
379 Ga0105239_10038062 3300010375 Bacteria 5270
380 Ga0105239_10279743 3300010375 Bacteria 1878
381 Ga0105239_10540877 3300010375 Bacteria 1326
382 Ga0105239_11073771 3300010375 Bacteria 926
383 Ga0105246_10043914 3300011119 Bacteria 3035
384 Ga0105246_10149512 3300011119 Bacteria 1766
385 Ga0105246_10206212 3300011119 Bacteria 1532
386 Ga0105246_10270955 3300011119 Bacteria 1357
387 Ga0157373_10128857 3300013100 Bacteria 1779
388 Ga0157369_10095638 3300013105 Bacteria 3169
389 Ga0157374_10005513 3300013296 Bacteria 10634
390 Ga0157374_10006819 3300013296 Bacteria 9715
391 Ga0157374_10010575 3300013296 Bacteria 7942
392 Ga0157378_10000005 3300013297 Bacteria 197893
393 Ga0157378_10047975 3300013297 Bacteria 3797
394 Ga0157378_10207074 3300013297 Bacteria 1858
395 Ga0163162_10000532 3300013306 Bacteria 35291
396 Ga0163162_10030738 3300013306 Bacteria 5322
397 Ga0163162_10050483 3300013306 Bacteria 4171
398 Ga0163162_10075086 3300013306 Bacteria 3440
399 Ga0163162_10342632 3300013306 Unclassified 1627
400 Ga0163162_10505735 3300013306 Bacteria 1338
401 Ga0157372_10005141 3300013307 Bacteria 13908
402 Ga0157372_10382757 3300013307 Bacteria 1639
403 Ga0157372_10928023 3300013307 Bacteria 1009
404 Ga0157372_11122086 3300013307 Bacteria 909
405 Ga0157375_10005292 3300013308 Bacteria 11206
406 Ga0163163_10000548 3300014325 Bacteria 32947
407 Ga0163163_10012440 3300014325 Bacteria 7752
408 Ga0163163_10017005 3300014325 Bacteria 6773
409 Ga0163163_10020181 3300014325 Bacteria 6272
410 Ga0163163_10141575 3300014325 Bacteria 2448
411 Ga0157380_10004116 3300014326 Bacteria 10043
412 Ga0157380_10039432 3300014326 Bacteria 3673
413 Ga0157380_10052291 3300014326 Bacteria 3234
414 Ga0157380_10111234 3300014326 Bacteria 2302
415 Ga0157380_10248300 3300014326 Bacteria 1609
416 Ga0157380_10405512 3300014326 Bacteria 1295
417 Ga0157380_10578466 3300014326 Bacteria 1107
418 Ga0157377_10018645 3300014745 Bacteria 3609
419 Ga0157377_10045121 3300014745 Bacteria 2461
420 Ga0157377_10066405 3300014745 Bacteria 2074
421 Ga0157379_10005632 3300014968 Bacteria 10760
422 Ga0157379_10047884 3300014968 Bacteria 3815
423 Ga0157379_10068694 3300014968 Bacteria 3168
424 Ga0157379_10106642 3300014968 Bacteria 2515
425 Ga0157376_10019577 3300014969 Bacteria 5220
426 Ga0157376_10035557 3300014969 Bacteria 4030
427 Ga0157376_10073320 3300014969 Bacteria 2915
428 Ga0157376_10092852 3300014969 Bacteria 2618
429 Ga0182005_1005701 3300015265 Bacteria 3868
430 Ga0182005_1028840 3300015265 Bacteria 1513
431 Ga0163161_10003745 3300017792 Bacteria 10653
432 Ga0163161_10035379 3300017792 Bacteria 3574
433 Ga0213876_10033493 3300021384 Bacteria 2709
434 Ga0209436_105446 3300025208 Bacteria 2929
435 Ga0209674_100439 3300025226 Bacteria 19443
436 Ga0209672_101737 3300025228 Bacteria 6918
437 Ga0209147_100323 3300025229 Bacteria 36564
438 Ga0207427_101019 3300025231 Bacteria 11712
439 Ga0209437_100180 3300025233 Bacteria 133661
440 Ga0209258_100078 3300025242 Bacteria 263996
441 Ga0209258_100718 3300025242 Bacteria 22152
442 Ga0207425_1000180 3300025245 Bacteria 52117
443 Ga0207425_1000946 3300025245 Bacteria 13795
444 Ga0207425_1002402 3300025245 Bacteria 6605
445 Ga0209148_1000005 3300025254 Bacteria 1806504
446 Ga0209148_1000086 3300025254 Bacteria 263996
447 Ga0209129_1000111 3300025258 Bacteria 148853
448 Ga0209129_1000775 3300025258 Bacteria 20252
449 Ga0209129_1016589 3300025258 Bacteria 1472
450 Ga0209233_1000053 3300025261 Bacteria 444909
451 Ga0209565_1000110 3300025263 Bacteria 119879
452 Ga0209565_1010429 3300025263 Bacteria 2304
453 Ga0209565_1021475 3300025263 Bacteria 1349
454 Ga0209565_1022415 3300025263 Bacteria 1307
455 Ga0209673_1000426 3300025273 Bacteria 73424
456 Ga0209673_1000814 3300025273 Bacteria 41220
457 Ga0209673_1021519 3300025273 Bacteria 2253
458 Ga0209130_1000205 3300025284 Bacteria 79260
459 Ga0209130_1000468 3300025284 Bacteria 41796
460 Ga0209130_1001259 3300025284 Bacteria 17670
461 Ga0209675_1000192 3300025291 Bacteria 66905
462 Ga0209675_1001500 3300025291 Bacteria 13390
463 Ga0209676_1000125 3300025292 Bacteria 191565
464 Ga0209676_1000162 3300025292 Bacteria 159931
465 Ga0209676_1009638 3300025292 Bacteria 4139
466 Ga0209025_1000116 3300025294 Bacteria 218293
467 Ga0209025_1000238 3300025294 Bacteria 128478
468 Ga0209025_1000641 3300025294 Bacteria 61686
469 Ga0209025_1005201 3300025294 Bacteria 10744
470 Ga0209564_1000015 3300025295 Bacteria 615324
471 Ga0209564_1000046 3300025295 Bacteria 373787
472 Ga0209564_1000155 3300025295 Bacteria 165859
473 Ga0209564_1000833 3300025295 Bacteria 41796
474 Ga0209758_1000107 3300025297 Bacteria 218293
475 Ga0209758_1000285 3300025297 Bacteria 99959
476 Ga0209758_1003948 3300025297 Bacteria 12884
477 Ga0209758_1056280 3300025297 Bacteria 1330
478 Ga0209050_1000012 3300025298 Bacteria 813717
479 Ga0209256_1000007 3300025299 Bacteria 1136599
480 Ga0209256_1000087 3300025299 Bacteria 218290
481 Ga0209256_1000764 3300025299 Bacteria 41796
482 Ga0209256_1054571 3300025299 Bacteria 952
483 Ga0207426_1000123 3300025302 Bacteria 218290
484 Ga0207426_1000667 3300025302 Bacteria 41796
485 Ga0209051_1000014 3300025303 Bacteria 552732
486 Ga0209051_1000274 3300025303 Bacteria 84662
487 Ga0209051_1000332 3300025303 Bacteria 71041
488 Ga0209051_1028633 3300025303 Bacteria 2196
489 Ga0209257_1000024 3300025304 Bacteria 726068
490 Ga0209257_1000870 3300025304 Bacteria 42856
491 Ga0207697_10062258 3300025315 Bacteria 1553
492 Ga0207656_10039808 3300025321 Bacteria 1990
493 Ga0207656_10084524 3300025321 Bacteria 1432
494 Ga0207655_1024763 3300025728 Bacteria 2932
495 Ga0207713_1000414 3300025735 Bacteria 45438
496 Ga0207682_10014073 3300025893 Bacteria 3117
497 Ga0207692_10124132 3300025898 Bacteria 1450
498 Ga0207642_10035838 3300025899 Bacteria 2124
499 Ga0207642_10062072 3300025899 Bacteria 1741
500 Ga0207642_10142431 3300025899 Bacteria 1266
501 Ga0207688_10001480 3300025901 Bacteria 12308
502 Ga0207688_10052048 3300025901 Bacteria 2294
503 Ga0207680_10000006 3300025903 Bacteria 635950
504 Ga0207680_10000940 3300025903 Bacteria 13755
505 Ga0207645_10019412 3300025907 Bacteria 4456
506 Ga0207645_10030686 3300025907 Bacteria 3463
507 Ga0207643_10023185 3300025908 Bacteria 3422
508 Ga0207705_10005090 3300025909 Bacteria 9855
509 Ga0207654_10017320 3300025911 Bacteria 3763
510 Ga0207695_10004730 3300025913 Bacteria 18442
511 Ga0207671_10001229 3300025914 Bacteria 30320
512 Ga0207671_10023099 3300025914 Bacteria 4692
513 Ga0207693_10105165 3300025915 Bacteria 2213
514 Ga0207660_10316423 3300025917 Bacteria 1246
515 Ga0207662_10001753 3300025918 Bacteria 10651
516 Ga0207662_10294677 3300025918 Bacteria 1077
517 Ga0207662_10323955 3300025918 Bacteria 1029
518 Ga0207646_10105576 3300025922 Bacteria 2526
519 Ga0207646_10111946 3300025922 Bacteria 2450
520 Ga0207681_10178190 3300025923 Bacteria 1617
521 Ga0207694_10012749 3300025924 Bacteria 6333
522 Ga0207694_10062210 3300025924 Bacteria 2906
523 Ga0207650_10000774 3300025925 Bacteria 24596
524 Ga0207659_10000001 3300025926 Bacteria 660958
525 Ga0207659_10000484 3300025926 Bacteria 23967
526 Ga0207659_10078784 3300025926 Bacteria 2429
527 Ga0207659_10316134 3300025926 Bacteria 1287
528 Ga0207687_10083816 3300025927 Bacteria 2309
529 Ga0207644_10000525 3300025931 Bacteria 24823
530 Ga0207644_10025031 3300025931 Bacteria 4101
531 Ga0207706_10019452 3300025933 Bacteria 6110
532 Ga0207706_10026056 3300025933 Bacteria 5235
533 Ga0207706_10037925 3300025933 Bacteria 4276
534 Ga0207709_10000205 3300025935 Bacteria 77131
535 Ga0207709_10006435 3300025935 Bacteria 6592
536 Ga0207709_10246459 3300025935 Bacteria 1302
537 Ga0207709_10354054 3300025935 Bacteria 1109
538 Ga0207670_10102749 3300025936 Bacteria 2044
539 Ga0207670_10559311 3300025936 Bacteria 935
540 Ga0207669_10000481 3300025937 Bacteria 17388
541 Ga0207669_10026630 3300025937 Bacteria 3150
542 Ga0207704_10031772 3300025938 Bacteria 2979
543 Ga0207704_10043324 3300025938 Bacteria 2656
544 Ga0207704_10188741 3300025938 Bacteria 1497
545 Ga0207691_10008486 3300025940 Bacteria 9867
546 Ga0207691_10065159 3300025940 Bacteria 3299
547 Ga0207691_10072913 3300025940 Bacteria 3096
548 Ga0207691_10341088 3300025940 Bacteria 1283
549 Ga0207711_10001399 3300025941 Bacteria 22639
550 Ga0207711_10055573 3300025941 Bacteria 3399
551 Ga0207711_10152055 3300025941 Bacteria 2089
552 Ga0207711_10184022 3300025941 Bacteria 1901
553 Ga0207711_10187262 3300025941 Bacteria 1885
554 Ga0207711_10237041 3300025941 Bacteria 1672
555 Ga0207711_10446342 3300025941 Bacteria 1204
556 Ga0207689_10008615 3300025942 Bacteria 8883
557 Ga0207689_10056732 3300025942 Bacteria 3223
558 Ga0207689_10147906 3300025942 Bacteria 1935
559 Ga0207689_10364680 3300025942 Unclassified 1201
560 Ga0207689_10615924 3300025942 Bacteria 914
561 Ga0207661_10027227 3300025944 Bacteria 4365
562 Ga0207679_10002749 3300025945 Bacteria 10882
563 Ga0207679_10140007 3300025945 Bacteria 1954
564 Ga0207679_10275512 3300025945 Bacteria 1441
565 Ga0207667_10000871 3300025949 Bacteria 38739
566 Ga0207651_10061786 3300025960 Bacteria 2608
567 Ga0207651_10067093 3300025960 Bacteria 2523
568 Ga0207651_10743204 3300025960 Bacteria 867
569 Ga0207712_10038611 3300025961 Bacteria 3266
570 Ga0207712_10068631 3300025961 Bacteria 2541
571 Ga0207712_10120403 3300025961 Bacteria 1985
572 Ga0207712_10651808 3300025961 Bacteria 915
573 Ga0207668_10028014 3300025972 Bacteria 3678
574 Ga0207668_10065380 3300025972 Bacteria 2574
575 Ga0207668_10165732 3300025972 Bacteria 1727
576 Ga0207658_10000866 3300025986 Bacteria 25261
577 Ga0207658_10017943 3300025986 Bacteria 4879
578 Ga0207658_10163312 3300025986 Bacteria 1827
579 Ga0207677_10000623 3300026023 Bacteria 21544
580 Ga0207677_10014438 3300026023 Bacteria 4613
581 Ga0207677_10065961 3300026023 Bacteria 2528
582 Ga0207703_10000773 3300026035 Bacteria 31458
583 Ga0207703_10040351 3300026035 Bacteria 3735
584 Ga0207703_10073142 3300026035 Unclassified 2835
585 Ga0207703_10132165 3300026035 Bacteria 2157
586 Ga0207703_10311298 3300026035 Bacteria 1439
587 Ga0207639_10014980 3300026041 Bacteria 5463
588 Ga0207639_10050721 3300026041 Bacteria 3152
589 Ga0207639_10696358 3300026041 Bacteria 942
590 Ga0207678_10042060 3300026067 Bacteria 3960
591 Ga0207678_10199914 3300026067 Bacteria 1709
592 Ga0207708_10000257 3300026075 Bacteria 41841
593 Ga0207708_10011569 3300026075 Bacteria 6576
594 Ga0207702_10424928 3300026078 Bacteria 1286
595 Ga0207702_10705722 3300026078 Bacteria 994
596 Ga0207641_10001102 3300026088 Bacteria 27131
597 Ga0207641_10011271 3300026088 Bacteria 7334
598 Ga0207641_10122929 3300026088 Bacteria 2319
599 Ga0207648_10004593 3300026089 Bacteria 14152
600 Ga0207648_10035543 3300026089 Bacteria 4389
601 Ga0207648_10143112 3300026089 Bacteria 2108
602 Ga0207648_10157783 3300026089 Bacteria 2003
603 Ga0207648_10224643 3300026089 Bacteria 1670
604 Ga0207648_10253089 3300026089 Bacteria 1570
605 Ga0207676_10000742 3300026095 Bacteria 25556
606 Ga0207676_10007617 3300026095 Bacteria 7687
607 Ga0207676_10027450 3300026095 Bacteria 4240
608 Ga0207676_10061574 3300026095 Bacteria 2972
609 Ga0207674_10008075 3300026116 Bacteria 12202
610 Ga0207674_10447436 3300026116 Bacteria 1249
611 Ga0207675_100010522 3300026118 Bacteria 8667
612 Ga0207675_100041465 3300026118 Bacteria 4299
613 Ga0207675_100049827 3300026118 Bacteria 3907
614 Ga0207675_100133977 3300026118 Bacteria 2350
615 Ga0207683_10003309 3300026121 Bacteria 14048
616 Ga0207683_10071626 3300026121 Bacteria 3065
617 Ga0207683_10076756 3300026121 Bacteria 2958
618 Ga0207683_10095109 3300026121 Bacteria 2656
619 Ga0207698_10038010 3300026142 Bacteria 3552
620 Ga0207698_10043657 3300026142 Bacteria 3361
621 Ga0207698_10616483 3300026142 Bacteria 1071
622 Ga0207698_10769230 3300026142 Bacteria 963
623 Ga0209371_1000152 3300027312 Bacteria 108927
624 Ga0209999_1016561 3300027543 Bacteria 1341
625 Ga0210002_1000309 3300027617 Bacteria 6737
626 Ga0209983_1002360 3300027665 Bacteria 4143
627 Ga0209282_1000001 3300027666 Bacteria 2450367
628 Ga0209966_1011401 3300027695 Bacteria 1621
629 Ga0209998_10001138 3300027717 Bacteria 6576
630 Ga0209813_10001998 3300027866 Bacteria 4616
631 Ga0209813_10069062 3300027866 Bacteria 1145
632 Ga0209974_10002289 3300027876 Bacteria 6958
633 Ga0207428_10011904 3300027907 Bacteria 7658
634 Ga0207428_10079589 3300027907 Bacteria 2562
635 Ga0207428_10085915 3300027907 Bacteria 2449
636 Ga0268266_10000043 3300028379 Bacteria 316604
637 Ga0268266_10008417 3300028379 Bacteria 9173
638 Ga0268266_10037322 3300028379 Bacteria 4140
639 Ga0268266_10070061 3300028379 Bacteria 3039
640 Ga0268266_10077439 3300028379 Bacteria 2891
641 Ga0268266_10092777 3300028379 Bacteria 2649
642 Ga0268266_10142466 3300028379 Bacteria 2152
643 Ga0268266_10597719 3300028379 Bacteria 1060
644 Ga0268266_10735283 3300028379 Bacteria 952
645 Ga0268265_10029292 3300028380 Bacteria 3950
646 Ga0268265_10169750 3300028380 Bacteria 1863
647 Ga0268265_10236136 3300028380 Bacteria 1610
648 Ga0268265_10537119 3300028380 Unclassified 1108
649 Ga0268264_10083320 3300028381 Bacteria 2739
650 Ga0268264_10236018 3300028381 Bacteria 1691
651 Ga0268264_10359755 3300028381 Bacteria 1388
652 Ga0307517_10134965 3300028786 Bacteria 1759
653 Ga0307515_10000053 3300028794 Bacteria 266512
654 Ga0307515_10000618 3300028794 Bacteria 83065
655 Ga0307515_10023904 3300028794 Bacteria 10679
656 Ga0307515_10312553 3300028794 Bacteria 1245
657 Ga0268256_1000127 3300030500 Bacteria 108927
658 Ga0316176_1193569 3300030732 Bacteria 3040
659 Ga0316181_1065387 3300030744 Bacteria 16314
660 Ga0265332_10021978 3300031238 Bacteria 2816
661 Ga0265339_10001128 3300031249 Bacteria 20202
662 Ga0265339_10059387 3300031249 Bacteria 2062
663 Ga0265327_10000995 3300031251 Bacteria 40212
664 Ga0265316_10001895 3300031344 Bacteria 21972
665 Ga0307513_10022490 3300031456 Bacteria 7405
666 Ga0307513_10054978 3300031456 Bacteria 4263
667 Ga0307513_10162864 3300031456 Bacteria 2120
668 Ga0307509_10192440 3300031507 Bacteria 1889
669 Ga0307408_100208092 3300031548 Bacteria 1588
670 Ga0307408_100566509 3300031548 Bacteria 1004
671 Ga0307508_10069676 3300031616 Bacteria 3089
672 Ga0265314_10000001 3300031711 Bacteria 3792860
673 Ga0307516_10005459 3300031730 Bacteria 15196
674 Ga0307405_10023327 3300031731 Bacteria 3515
675 Ga0307405_10089733 3300031731 Bacteria 2031
676 Ga0307412_10069628 3300031911 Bacteria 2395
677 Ga0307412_10108167 3300031911 Bacteria 1980
678 Ga0307416_100531707 3300032002 Bacteria 1246
679 Ga0307416_100956763 3300032002 Bacteria 958
680 Ga0307415_100372982 3300032126 Bacteria 1209
681 Ga0307510_10078578 3300033180 Bacteria 3226
682 Ga0373934_0009692 3300035086 Bacteria 3611
683 Ga0373934_0037368 3300035086 Bacteria 1912
684 Ga0373923_0212062 3300035111 Bacteria 898
685 Ga0373954_0040501 3300035118 Bacteria 2170
686 Ga0373954_0124203 3300035118 Bacteria 1254
687 Ga0373956_0134282 3300035119 Bacteria 1160
688 Ga0373957_0037546 3300035120 Bacteria 1810
689 Ga0373957_0073210 3300035120 Bacteria 1343
690 Ga0373943_0030022 3300035170 Bacteria 2571
691 Ga0373943_0181049 3300035170 Bacteria 1158
692 Ga0373946_0029505 3300035171 Bacteria 2184
693 Ga0373955_0019870 3300035172 Bacteria 3367
694 Ga0373955_0032246 3300035172 Bacteria 2749
695 Ga0373935_0454437 3300035692 Bacteria 926
696 Ga0373933_0010244 3300035724 Bacteria 5136
697 Ga0373933_0049648 3300035724 Bacteria 2502
698 Ga0373933_0091077 3300035724 Bacteria 1882
699 Ga0373947_0020442 3300035725 Bacteria 3822
700 Ga0373947_0268367 3300035725 Bacteria 1132
701 Ga0373937_0010435 3300036401 Bacteria 8113
702 Ga0373937_0020842 3300036401 Bacteria 5879
703 Ga0373937_0070945 3300036401 Bacteria 3213
704 Ga0373937_0326011 3300036401 Bacteria 1453
705 Ga0373925_0002798 3300037068 Bacteria 13769
706 Ga0395901_0239865 3300038443 Bacteria 1891
707 Ga0436365_1891255 3300039437 Bacteria 2933
708 Ga0439466_0098106 3300041411 Bacteria 915
709 Ga0451789_0018855 3300041443 Bacteria 1127
710 Ga0451807_1553985 3300041486 Bacteria 4922
711 Ga0451843_1444807 3300041509 Bacteria 4878
712 Ga0451853_1440263 3300041512 Bacteria 4294
713 Ga0439448_0055057 3300042005 Bacteria 1308
714 Ga0439432_051182 3300042006 Bacteria 1288
715 Ga0450911_000056 3300042115 Bacteria 46087
716 Ga0450909_022396 3300042185 Bacteria 946
717 Ga0439435_0045136 3300042436 Bacteria 1245
718 Ga0439460_0005446 3300042461 Bacteria 3123
719 Ga0450918_002996 3300042531 Bacteria 3164
720 Ga0451577_0001050 3300042876 Bacteria 39884
721 Ga0466972_0065842 3300044658 Bacteria 1733
722 Ga0466972_0144060 3300044658 Bacteria 1121
723 Ga0453683_0033193 3300044673 Bacteria 3255
724 Ga0453683_0065514 3300044673 Bacteria 2271
725 Ga0466963_0045039 3300044694 Bacteria 2905
726 Ga0466963_0095607 3300044694 Bacteria 2028
727 Ga0453684_0434664 3300044712 Bacteria 1463
728 Ga0466960_0016167 3300044901 Bacteria 3232
729 Ga0466960_0087380 3300044901 Bacteria 1583
730 Ga0451576_0102156 3300045051 Bacteria 2982
731 Ga0451576_0133003 3300045051 Bacteria 2593
732 Ga0451576_0453743 3300045051 Bacteria 1346
733 Ga0466967_0009914 3300045976 Bacteria 7108
734 Ga0466967_0201316 3300045976 Bacteria 1886
735 Ga0495617_000808 3300046452 Bacteria 15140
736 Ga0495617_005124 3300046452 Bacteria 4681
737 Ga0495617_013829 3300046452 Bacteria 2745
738 Ga0495627_002867 3300046453 Bacteria 7959
739 Ga0495638_0000023 3300046460 Bacteria 363063
740 Ga0495638_0011342 3300046460 Bacteria 6141
741 Ga0495638_0014393 3300046460 Bacteria 5348
742 Ga0495638_0038370 3300046460 Bacteria 3044
743 Ga0495638_0082742 3300046460 Bacteria 1946
744 Ga0495638_0090457 3300046460 Bacteria 1845
745 Ga0495651_0069881 3300046462 Bacteria 2673
746 Ga0495651_0114370 3300046462 Bacteria 1991
747 Ga0495653_0257704 3300046463 Bacteria 1155
748 Ga0495650_0011900 3300046471 Bacteria 4717
749 Ga0495580_0010226 3300046472 Bacteria 7319
750 Ga0495605_0097709 3300046474 Bacteria 1353
751 Ga0495662_0244857 3300046476 Bacteria 883
752 Ga0495664_0026848 3300046477 Bacteria 3355
753 Ga0495584_0000071 3300046491 Bacteria 72115
754 Ga0495585_0010363 3300046492 Bacteria 5552
755 Ga0495594_0013599 3300046499 Bacteria 4251
756 Ga0495607_0004789 3300046501 Bacteria 9881
757 Ga0495607_0012651 3300046501 Bacteria 5560
758 Ga0495607_0085985 3300046501 Bacteria 1716
759 Ga0495583_0001091 3300046506 Bacteria 30075
760 Ga0495606_0000188 3300046507 Bacteria 108100
761 Ga0495606_0000841 3300046507 Bacteria 46218
762 Ga0495606_0044161 3300046507 Bacteria 2966
763 Ga0495606_0132487 3300046507 Bacteria 1480
764 Ga0495608_0109431 3300046511 Bacteria 1777
765 Ga0495610_0001611 3300046512 Bacteria 19853
766 Ga0495610_0007064 3300046512 Bacteria 7584
767 Ga0495616_0000122 3300046513 Bacteria 67299
768 Ga0495616_0000355 3300046513 Bacteria 35882
769 Ga0495616_0003191 3300046513 Bacteria 10572
770 Ga0495616_0008748 3300046513 Bacteria 5967
771 Ga0495618_0382714 3300046514 Bacteria 863
772 Ga0495620_0023981 3300046515 Bacteria 2908
773 Ga0495628_0014510 3300046516 Bacteria 6602
774 Ga0495628_0396450 3300046516 Bacteria 1009
775 Ga0495630_0485212 3300046517 Bacteria 948
776 Ga0495630_0528524 3300046517 Bacteria 904
777 Ga0495631_0001414 3300046518 Bacteria 14580
778 Ga0495632_0007990 3300046519 Bacteria 6567
779 Ga0495632_0018117 3300046519 Bacteria 3871
780 Ga0495637_0005182 3300046520 Bacteria 6677
781 Ga0495637_0025030 3300046520 Bacteria 2695
782 Ga0495643_0000323 3300046522 Bacteria 65626
783 Ga0495648_0000025 3300046524 Bacteria 233415
784 Ga0495648_0060217 3300046524 Bacteria 2260
785 Ga0495648_0061348 3300046524 Bacteria 2234
786 Ga0495663_0019037 3300046525 Bacteria 1960
787 Ga0495663_0031885 3300046525 Bacteria 1567
788 Ga0495642_0001873 3300046528 Bacteria 8985
789 Ga0495642_0196445 3300046528 Bacteria 879
790 Ga0495652_0041051 3300046529 Bacteria 3996
791 Ga0495654_0003361 3300046530 Bacteria 9856
792 Ga0495654_0010645 3300046530 Bacteria 4996
793 Ga0495654_0033307 3300046530 Bacteria 2608
794 Ga0495654_0137451 3300046530 Bacteria 1092
795 Ga0495640_0093538 3300046533 Bacteria 1981
796 Ga0495640_0395328 3300046533 Bacteria 849
797 Ga0495586_0138151 3300046535 Bacteria 1367
798 Ga0495587_0033122 3300046536 Bacteria 3121
799 Ga0495609_0008707 3300046538 Bacteria 4950
800 Ga0495621_0021203 3300046539 Bacteria 2140
801 Ga0495621_0087106 3300046539 Bacteria 1172
802 Ga0495597_0011980 3300046542 Bacteria 4191
803 Ga0495645_0009205 3300046543 Bacteria 6901
804 Ga0495645_0080669 3300046543 Bacteria 2335
805 Ga0495622_0000432 3300046557 Bacteria 27458
806 Ga0495633_0000045 3300046558 Bacteria 169729
807 Ga0495633_0001317 3300046558 Bacteria 19570
808 Ga0495633_0024492 3300046558 Bacteria 2982
809 Ga0495667_0040394 3300046559 Bacteria 3098
810 Ga0495656_0094854 3300046615 Bacteria 1371
811 Ga0495656_0099536 3300046615 Bacteria 1342
812 Ga0495668_0000066 3300046616 Bacteria 178533
813 Ga0495668_0010566 3300046616 Bacteria 5579
814 Ga0495668_0051064 3300046616 Bacteria 2290
815 Ga0495634_0059369 3300046642 Bacteria 2548
816 Ga0495611_0016389 3300046648 Bacteria 3168
817 Ga0495625_0004405 3300046660 Bacteria 13347
818 Ga0495625_0007334 3300046660 Bacteria 9628
819 Ga0495625_0008709 3300046660 Bacteria 8604
820 Ga0495625_0009193 3300046660 Bacteria 8301
821 Ga0495625_0013422 3300046660 Bacteria 6584
822 Ga0495625_0023189 3300046660 Bacteria 4743
823 Ga0495625_0058782 3300046660 Bacteria 2730
824 Ga0495625_0066935 3300046660 Bacteria 2529
825 Ga0495625_0067628 3300046660 Bacteria 2514
826 Ga0495659_0025165 3300046664 Bacteria 2036
827 Ga0495659_0069819 3300046664 Bacteria 1314
828 Ga0495661_0010607 3300046665 Bacteria 6283
829 Ga0495661_0234189 3300046665 Bacteria 945
830 Ga0495658_0116019 3300046683 Bacteria 1614
831 Ga0495613_0128818 3300046689 Bacteria 1813
832 Ga0495624_0064775 3300046690 Bacteria 2284
833 Ga0495670_0001619 3300046691 Bacteria 11025
834 Ga0495670_0119634 3300046691 Bacteria 1367
835 Ga0495671_0095646 3300046692 Bacteria 1453
836 Ga0495649_0000637 3300046694 Bacteria 28551
837 Ga0495649_0031363 3300046694 Bacteria 2931
838 Ga0495660_0000576 3300046810 Bacteria 29432
839 Ga0495581_0058319 3300047315 Bacteria 2229
840 Ga0495604_0018356 3300047317 Bacteria 5602
841 Ga0495604_0260433 3300047317 Bacteria 1179
842 Ga0495674_0008854 3300047319 Bacteria 9576
843 Ga0495674_0113433 3300047319 Bacteria 2295
844 Ga0495674_0121526 3300047319 Bacteria 2206
845 Ga0495674_0479465 3300047319 Bacteria 997
846 Ga0495674_0526280 3300047319 Bacteria 943
847 Ga0495672_0002578 3300047320 Bacteria 16477
848 Ga0495672_0003539 3300047320 Bacteria 13300
849 Ga0495672_0003844 3300047320 Bacteria 12631
850 Ga0495672_0158464 3300047320 Bacteria 1166
851 Ga0495672_0228087 3300047320 Unclassified 916
852 Ga0495680_0048507 3300047322 Bacteria 3334
853 Ga0495680_0068636 3300047322 Bacteria 2707
854 Ga0495680_0073501 3300047322 Bacteria 2598
855 Ga0495675_0214790 3300047444 Bacteria 1166
856 Ga0495673_0000028 3300047469 Bacteria 473418
857 Ga0495673_0020923 3300047469 Bacteria 3245
858 Ga0495681_0000009 3300047470 Bacteria 205224
859 Ga0495681_0002453 3300047470 Bacteria 13248
860 Ga0495684_0035825 3300047471 Bacteria 3805
861 Ga0495684_0085401 3300047471 Bacteria 2393
862 Ga0495684_0231627 3300047471 Bacteria 1351
863 Ga0495684_0278708 3300047471 Bacteria 1207
864 Ga0495686_0001324 3300047472 Bacteria 27731
865 Ga0495686_0002384 3300047472 Bacteria 17849
866 Ga0495686_0025117 3300047472 Bacteria 3907
867 Ga0495686_0058761 3300047472 Bacteria 2396
868 Ga0495602_0414142 3300048088 Bacteria 958
869 Ga0495626_0041044 3300048091 Bacteria 2183
870 Ga0496100_0000062 3300048903 Bacteria 61872
871 Ga0496100_0046751 3300048903 Bacteria 2785
872 Ga0496100_0069902 3300048903 Bacteria 2339
873 Ga0496100_0268614 3300048903 Bacteria 1267
874 Ga0496101_0000059 3300048904 Bacteria 130521
875 Ga0496101_0015631 3300048904 Bacteria 5120
876 Ga0496101_0026116 3300048904 Bacteria 4059
877 Ga0496101_0064626 3300048904 Bacteria 2666
878 Ga0496102_0027487 3300048905 Bacteria 5080
879 Ga0496102_0148844 3300048905 Bacteria 2198
880 Ga0496102_0370913 3300048905 Bacteria 1347
881 Ga0496102_0486700 3300048905 Bacteria 1155
882 Ga0496102_0491126 3300048905 Bacteria 1149
883 Ga0496102_0840210 3300048905 Bacteria 840
884 Ga0496103_0001093 3300048906 Bacteria 18888
885 Ga0496103_0041260 3300048906 Bacteria 2837
886 Ga0496103_0149883 3300048906 Bacteria 1494
887 Ga0496103_0161079 3300048906 Bacteria 1439
888 Ga0496104_0045641 3300048907 Bacteria 4123
889 Ga0496104_0425700 3300048907 Bacteria 1239
890 Ga0496104_0494333 3300048907 Bacteria 1134
891 Ga0496104_0716022 3300048907 Bacteria 908
892 Ga0496105_0014960 3300048908 Bacteria 6176
893 Ga0496106_0001081 3300048909 Bacteria 20116
894 Ga0496106_0024324 3300048909 Bacteria 4502
895 Ga0496106_0026645 3300048909 Bacteria 4305
896 Ga0496106_0030905 3300048909 Bacteria 3992
897 Ga0496106_0124524 3300048909 Bacteria 2017
898 Ga0496106_0355128 3300048909 Bacteria 1177
899 Ga0496107_0063389 3300048910 Bacteria 2678
900 Ga0496107_0092040 3300048910 Bacteria 2216
901 Ga0496107_0099908 3300048910 Bacteria 2127
902 Ga0496107_0102687 3300048910 Bacteria 2097
903 Ga0496108_0055531 3300048911 Bacteria 3325
904 Ga0496108_0123365 3300048911 Bacteria 2223
905 Ga0496109_0000079 3300048912 Bacteria 102182
906 Ga0496109_0000204 3300048912 Bacteria 58449
907 Ga0496109_0106520 3300048912 Bacteria 2604
908 Ga0496110_0001223 3300048913 Bacteria 18282
909 Ga0496110_0034922 3300048913 Bacteria 4358
910 Ga0496110_0045766 3300048913 Bacteria 3825
911 Ga0496110_0115770 3300048913 Bacteria 2413
912 Ga0496110_0220418 3300048913 Bacteria 1725
913 Ga0496111_0049362 3300048914 Bacteria 3034
914 Ga0496111_0066257 3300048914 Bacteria 2622
915 Ga0496111_0103993 3300048914 Bacteria 2089
916 Ga0496111_0242783 3300048914 Bacteria 1337
917 Ga0496112_0069686 3300048915 Bacteria 3474
918 Ga0496112_0150615 3300048915 Bacteria 2293
919 Ga0496112_0209832 3300048915 Bacteria 1905
920 Ga0496112_0229278 3300048915 Bacteria 1812
921 Ga0496113_0058632 3300048916 Bacteria 2897
922 Ga0496113_0101561 3300048916 Bacteria 2229
923 Ga0496114_0016279 3300048917 Bacteria 5989
924 Ga0496114_0021382 3300048917 Bacteria 5264
925 Ga0496114_0089862 3300048917 Bacteria 2607
926 Ga0496114_0108634 3300048917 Bacteria 2375
927 Ga0496115_0010941 3300048918 Bacteria 6792
928 Ga0496115_0035459 3300048918 Bacteria 3946
929 Ga0496115_0070843 3300048918 Bacteria 2827
930 Ga0496116_0011972 3300048919 Bacteria 7125
931 Ga0496117_0077954 3300048920 Bacteria 2190
932 Ga0496118_0008393 3300048921 Bacteria 10685
933 Ga0496118_0020887 3300048921 Bacteria 5790
934 Ga0496118_0032720 3300048921 Bacteria 4276
935 Ga0496118_0054669 3300048921 Bacteria 3021
936 Ga0496118_0104514 3300048921 Bacteria 1901
937 Ga0496118_0141869 3300048921 Bacteria 1521
938 Ga0496119_0004207 3300048922 Bacteria 14450
939 Ga0496119_0065277 3300048922 Bacteria 2156
940 Ga0496119_0073957 3300048922 Bacteria 1986
941 Ga0496120_0002492 3300048923 Bacteria 18506
942 Ga0496120_0057907 3300048923 Bacteria 2179
943 Ga0496121_0000048 3300048924 Bacteria 330242
944 Ga0496121_0015855 3300048924 Bacteria 7835
945 Ga0496121_0165632 3300048924 Bacteria 1611
946 Ga0496122_0001215 3300048925 Bacteria 43690
947 Ga0496122_0001414 3300048925 Bacteria 38901
948 Ga0496122_0003061 3300048925 Bacteria 22565
949 Ga0496122_0009630 3300048925 Bacteria 10119
950 Ga0496122_0029699 3300048925 Bacteria 4602
951 Ga0496122_0095480 3300048925 Bacteria 2009
952 Ga0496122_0144466 3300048925 Bacteria 1481
953 Ga0496123_0000600 3300048926 Bacteria 61187
954 Ga0496123_0001087 3300048926 Bacteria 40948
955 Ga0496123_0017048 3300048926 Bacteria 5865
956 Ga0496123_0047344 3300048926 Bacteria 2907
957 Ga0496123_0106065 3300048926 Bacteria 1620
958 Ga0496123_0277899 3300048926 Bacteria 811
959 Ga0496124_0000044 3300048927 Bacteria 289064
960 Ga0496124_0037007 3300048927 Bacteria 4248
961 Ga0496124_0060665 3300048927 Bacteria 3172
962 Ga0496124_0236543 3300048927 Bacteria 1361
963 Ga0496124_0370378 3300048927 Bacteria 1006
964 Ga0496125_0000037 3300048928 Bacteria 330242
965 Ga0496125_0005176 3300048928 Bacteria 14659
966 Ga0496125_0025768 3300048928 Bacteria 5377
967 Ga0496125_0088480 3300048928 Bacteria 2334
968 Ga0496125_0094436 3300048928 Bacteria 2228
969 Ga0496125_0122915 3300048928 Bacteria 1846
970 Ga0496126_0000046 3300048929 Bacteria 330242
971 Ga0496126_0005537 3300048929 Bacteria 14376
972 Ga0496126_0045393 3300048929 Bacteria 4039
973 Ga0496126_0051817 3300048929 Bacteria 3734
974 Ga0495678_001005 3300049459 Bacteria 24201
975 Ga0495678_004149 3300049459 Bacteria 8556
976 Ga0495678_020705 3300049459 Bacteria 2906
977 Ga0495682_0042487 3300049460 Bacteria 1666
978 Ga0495682_0077732 3300049460 Bacteria 1194
979 Ga0501034_0007925 3300049571 Bacteria 11285
980 Ga0501034_0085522 3300049571 Bacteria 3155
981 Ga0501034_0464445 3300049571 Bacteria 1182
982 Ga0501037_0037458 3300049573 Bacteria 3576
983 Ga0501038_0322478 3300049574 Bacteria 1208
984 Ga0501043_0042890 3300049579 Bacteria 3556
985 Ga0501047_0074553 3300049581 Bacteria 3267
986 Ga0501067_0118286 3300049583 Bacteria 1474
987 Ga0501068_0274588 3300049584 Bacteria 1076
988 Ga0501069_0068150 3300049585 Bacteria 1991
989 Ga0501070_0000322 3300049586 Bacteria 43590
990 Ga0501073_0145934 3300049589 Bacteria 1640
991 Ga0501073_0190390 3300049589 Bacteria 1419
992 Ga0501073_0195570 3300049589 Bacteria 1399
993 Ga0501073_0286141 3300049589 Bacteria 1137
994 Ga0501076_0353744 3300049592 Bacteria 1206
995 Ga0501249_005128 3300049679 Bacteria 2675
996 Ga0501225_0012830 3300049705 Bacteria 2349
997 Ga0501080_0002806 3300049742 Bacteria 15312
998 Ga0501080_0154597 3300049742 Bacteria 2119
999 Ga0501080_0171681 3300049742 Bacteria 2000
1000 Ga0501080_0296328 3300049742 Bacteria 1468
1001 Ga0501081_0071088 3300049743 Bacteria 2426
1002 Ga0501083_0028666 3300049744 Bacteria 3836
1003 Ga0501083_0067692 3300049744 Bacteria 2377
1004 Ga0501083_0084355 3300049744 Bacteria 2103
1005 Ga0501083_0173251 3300049744 Bacteria 1410
1006 Ga0501083_0279791 3300049744 Bacteria 1085
1007 Ga0501083_0305640 3300049744 Bacteria 1034
1008 Ga0501083_0386047 3300049744 Bacteria 911
1009 Ga0501083_0389782 3300049744 Bacteria 906
1010 Ga0501044_0004459 3300049823 Bacteria 15661
1011 Ga0501044_0176435 3300049823 Bacteria 2106
1012 nmdc:mga03683_3330_c1 3300050489 Bacteria 5164
1013 nmdc:mga03683_8398_c1 3300050489 Bacteria 3631
1014 nmdc:mga00v17_191134_c1 3300050491 Bacteria 1322
1015 nmdc:mga00v17_23923_c1 3300050491 Bacteria 3538
1016 nmdc:mga00v17_27184_c1 3300050491 Bacteria 3338
1017 nmdc:mga00v17_36736_c1 3300050491 Bacteria 2921
1018 nmdc:mga0yw44_126398_c1 3300050492 Bacteria 1651
1019 nmdc:mga0yw44_164559_c1 3300050492 Bacteria 1453
1020 nmdc:mga0yw44_240112_c1 3300050492 Bacteria 1204
1021 nmdc:mga0yw44_293919_c1 3300050492 Bacteria 1088
1022 nmdc:mga0k408_104274_c1 3300050493 Bacteria 1673
1023 nmdc:mga0k408_13804_c1 3300050493 Bacteria 4437
1024 nmdc:mga0k408_153255_c1 3300050493 Bacteria 1373
1025 nmdc:mga0k408_223191_c1 3300050493 Bacteria 1125
1026 nmdc:mga0k408_30763_c1 3300050493 Bacteria 3062
1027 nmdc:mga0k408_347319_c1 3300050493 Bacteria 885
1028 nmdc:mga0k408_74386_c1 3300050493 Bacteria 1985
1029 nmdc:mga0k408_801_c1 3300050493 Bacteria 17308
1030 nmdc:mga06z11_11495_c1 3300050494 Bacteria 3820
1031 nmdc:mga06z11_13524_c2 3300050494 Bacteria 3212
1032 nmdc:mga06z11_30557_c1 3300050494 Bacteria 2608
1033 nmdc:mga06z11_411886_c1 3300050494 Bacteria 814
1034 nmdc:mga06z11_70469_c1 3300050494 Bacteria 1848
1035 nmdc:mga06z11_7853_c1 3300050494 Bacteria 4415
1036 nmdc:mga04h51_100096_c1 3300050495 Bacteria 1055
1037 nmdc:mga07m45_24328_c1 3300050496 Bacteria 3316
1038 nmdc:mga07m45_281284_c1 3300050496 Bacteria 968
1039 nmdc:mga07m45_3811_c1 3300050496 Bacteria 7296
1040 nmdc:mga05p37_111710_c1 3300050507 Bacteria 3361
1041 nmdc:mga05p37_13336_c1 3300050507 Bacteria 9846
1042 nmdc:mga05p37_239388_c1 3300050507 Bacteria 2183
1043 nmdc:mga05p37_393282_c1 3300050507 Bacteria 1621
1044 nmdc:mga05p37_715391_c1 3300050507 Bacteria 1110
1045 nmdc:mga05p37_75173_c1 3300050507 Bacteria 4158
1046 nmdc:mga09592_122768_c1 3300050508 Bacteria 2232
1047 nmdc:mga09592_131472_c1 3300050508 Bacteria 2154
1048 nmdc:mga09592_34550_c1 3300050508 Bacteria 4226
1049 nmdc:mga09592_624477_c1 3300050508 Bacteria 922
1050 nmdc:mga0qj67_109080_c1 3300050509 Bacteria 2234
1051 nmdc:mga0qj67_128016_c1 3300050509 Bacteria 2055
1052 nmdc:mga0qj67_144377_c1 3300050509 Bacteria 1930
1053 nmdc:mga0qj67_331379_c1 3300050509 Bacteria 1232
1054 nmdc:mga0qj67_467_c1 3300050509 Bacteria 27643
1055 nmdc:mga0qj67_534993_c1 3300050509 Bacteria 940
1056 nmdc:mga06r32_11207_c1 3300050510 Bacteria 8077
1057 nmdc:mga06r32_117229_c1 3300050510 Bacteria 2624
1058 nmdc:mga06r32_184911_c1 3300050510 Bacteria 2070
1059 nmdc:mga06r32_192363_c1 3300050510 Bacteria 2028
1060 nmdc:mga06r32_316461_c1 3300050510 Bacteria 1546
1061 nmdc:mga06r32_324479_c1 3300050510 Bacteria 1525
1062 nmdc:mga06r32_557077_c1 3300050510 Bacteria 1120
1063 nmdc:mga06r32_589656_c1 3300050510 Bacteria 1083
1064 nmdc:mga06r32_66257_c1 3300050510 Bacteria 3485
1065 nmdc:mga08y16_1396_c1 3300050511 Bacteria 24202
1066 nmdc:mga08y16_1766_c1 3300050511 Bacteria 21907
1067 nmdc:mga08y16_538928_c1 3300050511 Bacteria 1182
1068 nmdc:mga08y16_557786_c1 3300050511 Bacteria 1159
1069 nmdc:mga08y16_651695_c1 3300050511 Bacteria 1057
1070 nmdc:mga08y16_663872_c1 3300050511 Bacteria 1045
1071 nmdc:mga08y16_713195_c1 3300050511 Bacteria 1002
1072 nmdc:mga08y16_8635_c1 3300050511 Bacteria 10686
1073 nmdc:mga08y16_966723_c1 3300050511 Bacteria 834
1074 nmdc:mga0n895_507971_c1 3300050512 Bacteria 1214
1075 nmdc:mga0n895_776399_c1 3300050512 Bacteria 950
1076 nmdc:mga0rr50_33954_c1 3300050513 Bacteria 3649
1077 nmdc:mga0rr50_398202_c1 3300050513 Bacteria 1163
1078 nmdc:mga0sz30_142729_c1 3300050516 Bacteria 1058
1079 nmdc:mga0sz30_31284_c1 3300050516 Bacteria 2202
1080 nmdc:mga0sz30_44838_c1 3300050516 Bacteria 1864
1081 nmdc:mga0sz30_9385_c1 3300050516 Bacteria 3721
1082 Ga0495601_0322572 3300053077 Unclassified 1006
1083 Ga0500610_0119235 3300053079 Bacteria 1350
1084 Ga0500635_0004478 3300053080 Bacteria 3604
1085 Ga0500635_0063295 3300053080 Bacteria 1297
1086 Ga0495619_0086989 3300053085 Bacteria 2113
1087 Ga0500578_0000311 3300053086 Bacteria 59919
1088 Ga0500644_0031824 3300053088 Bacteria 1681
1089 Ga0500646_0022698 3300053090 Bacteria 1679
1090 Ga0500646_0027703 3300053090 Bacteria 1543
1091 Ga0500583_0001441 3300053092 Bacteria 6819
1092 Ga0500583_0014380 3300053092 Bacteria 3096
1093 Ga0500583_0158396 3300053092 Bacteria 1128
1094 Ga0500566_0046914 3300053094 Bacteria 2480
1095 Ga0500566_0138923 3300053094 Bacteria 1291
1096 Ga0500641_0017930 3300053096 Bacteria 2656
1097 Ga0500641_0023065 3300053096 Bacteria 2389
1098 Ga0500641_0049669 3300053096 Bacteria 1721
1099 Ga0500555_001233 3300053103 Bacteria 8230
1100 Ga0500555_025672 3300053103 Bacteria 1686
1101 Ga0500556_0000166 3300053104 Bacteria 53987
1102 Ga0500562_005069 3300053108 Bacteria 3311
1103 Ga0500592_000085 3300053116 Bacteria 21429
1104 Ga0500594_0001974 3300053118 Bacteria 4437
1105 Ga0500594_0041839 3300053118 Bacteria 1257
1106 Ga0500597_089246 3300053120 Bacteria 1339
1107 Ga0500614_060165 3300053123 Bacteria 1020
1108 Ga0500618_059317 3300053125 Bacteria 861
1109 Ga0500642_0084227 3300053130 Bacteria 1464
1110 Ga0500658_0000033 3300053134 Bacteria 89738
1111 Ga0500658_0003654 3300053134 Bacteria 5801
1112 Ga0500658_0020892 3300053134 Bacteria 2476
1113 Ga0500559_0024493 3300053136 Bacteria 2568
1114 Ga0500568_0000999 3300053139 Bacteria 19361
1115 Ga0500568_0001676 3300053139 Bacteria 13847
1116 Ga0500568_0007197 3300053139 Bacteria 5484
1117 Ga0500568_0013997 3300053139 Plasmid 3636
1118 Ga0500568_0184899 3300053139 Bacteria 765
1119 Ga0500574_001896 3300053141 Bacteria 3280
1120 Ga0500586_001470 3300053145 Bacteria 4976
1121 Ga0500603_001149 3300053150 Bacteria 6201
1122 Ga0500604_0003357 3300053151 Bacteria 4306
1123 Ga0500604_0026340 3300053151 Bacteria 1676
1124 Ga0500604_0037326 3300053151 Bacteria 1452
1125 Ga0500616_0001627 3300053153 Bacteria 20862
1126 Ga0500616_0026530 3300053153 Bacteria 3205
1127 Ga0500620_006751 3300053155 Bacteria 2781
1128 Ga0500622_0003332 3300053156 Bacteria 10837
1129 Ga0500622_0005681 3300053156 Bacteria 7415
1130 Ga0500622_0030030 3300053156 Bacteria 2855
1131 Ga0500622_0058855 3300053156 Bacteria 1963
1132 Ga0500622_0130305 3300053156 Bacteria 1209
1133 Ga0500627_0000218 3300053158 Bacteria 16566
1134 Ga0500627_0001029 3300053158 Bacteria 7604
1135 Ga0500627_0005618 3300053158 Bacteria 4181
1136 Ga0500627_0120606 3300053158 Bacteria 1183
1137 Ga0500627_0160083 3300053158 Bacteria 1016
1138 Ga0500636_0000055 3300053177 Bacteria 54438
1139 Ga0500637_0022401 3300053178 Bacteria 3442
1140 Ga0500637_0197134 3300053178 Bacteria 1148
1141 Ga0500645_001347 3300053730 Bacteria 12702
1142 Ga0501084_0247380 3300054114 Bacteria 1505
1143 Ga0501082_0192679 3300060353 Bacteria 1773
1144 Ga0501082_0398963 3300060353 Bacteria 1200
1145 Ga0501082_0410887 3300060353 Bacteria 1181
1146 Ga0501082_0560575 3300060353 Bacteria 999
1147 2509080082 2508501114 Bacteria 7082538
1148 2514418312 2513237305 Bacteria 7293571
1149 2572255889 2571042365 Bacteria 3289345
1150 2595446164 2593339238 Bacteria 4182970
1151 2599612089 2599185212 Bacteria 6765997
1152 2599625988 2599185214 Bacteria 8209958
1153 2599674930 2599185226 Bacteria 8233575
1154 2599683824 2599185227 Bacteria 8246414
1155 2599695573 2599185229 Bacteria 8216126
1156 2600025997 2599185316 Bacteria 6320029
1157 2600058101 2599185322 Bacteria 6763055
1158 2600080141 2599185325 Bacteria 6324919
1159 2644105413 2643221618 Bacteria 7717186
1160 2644145747 2643221626 Bacteria 8069654
1161 2644210452 2643221637 Bacteria 5345260
1162 2644311360 2643221655 Bacteria 7722067
1163 2644331241 2643221659 Bacteria 7890716
1164 2644337573 2643221660 Bacteria 4208257
1165 2644544664 2643221698 Bacteria 7756764
1166 2644617034 2643221712 Bacteria 7729434
1167 2644654004 2643221718 Bacteria 5345506
1168 2671129848 2667528176 Bacteria 6724917
1169 2723577161 2721755686 Bacteria 7343952
1170 2738845428 2738541300 Bacteria 6675882
1171 2738881039 2738541307 Bacteria 8606193
1172 2739058357 2738541337 Bacteria 6183410
1173 2739243771 2738543012 Bacteria 7115078
1174 2739276481 2738543018 Bacteria 6718814
1175 2739308495 2738543024 Bacteria 5603683
1176 2739345525 2738543030 Bacteria 6719714
1177 2739731833 2739367700 Bacteria 4747630
1178 2776913519 2775507049 Bacteria 6284736
1179 2793976712 2791355406 Bacteria 11364898
1180 2816472611 2816332133 Bacteria 7249298
1181 2819602225 2818991446 Bacteria 7757362
1182 2819662262 2818991457 Bacteria 5323295
1183 2821132192 2821131069 Bacteria 6108407
1184 2831272090 2831265667 Bacteria 7184833
1185 2838061763 2838054893 Bacteria 7451788
1186 2844163931 2844163670 Bacteria 7266046
1187 2852688036 2852684882 Bacteria 5463342
1188 2857356070 2857349434 Bacteria 7926032
1189 2857562566 2857558681 Bacteria 6617694
1190 2857568343 2857564685 Bacteria 6290584
1191 2857576913 2857576091 Bacteria 5465855
1192 2885199663 2885198086 Bacteria 7212419
1193 2885213314 2885211737 Bacteria 7212420
1194 2888350427 2888350351 Bacteria 7372807
1195 2889022361 2889016732 Bacteria 6700763
1196 2899928697 2899924645 Bacteria 7487985
1197 2903769901 2903768456 Bacteria 9749579
1198 2904549347 2904541872 Bacteria 8915136
1199 2906361921 2906354277 Bacteria 6991324
1200 2917705003 2917699015 Bacteria 7043791
1201 2919132902 2919130084 Bacteria 5301837
1202 2919467717 2919462493 Bacteria 5817112
1203 2922136803 2922130491 Bacteria 7173936
1204 2922192687 2922185730 Bacteria 7113964
1205 2928043358 2928037797 Bacteria 7273642
1206 2928050800 2928044640 Bacteria 7271509
1207 2928056300 2928051484 Bacteria 7773759
1208 2928066218 2928064002 Bacteria 7419480
1209 2928076241 2928070936 Bacteria 8062541
1210 2928085190 2928084124 Bacteria 7159212
1211 2929164802 2929160207 Bacteria 9075316
1212 2929199460 2929195423 Bacteria 5325372
1213 2937824069 2937822353 Bacteria 7290551
1214 2941487202 2941485952 Bacteria 3591484
1215 2941504646 2941499720 Bacteria 7599444
1216 2958103339 2958100919 Bacteria 6800575
1217 2958173715 2958172287 Bacteria 6716688
1218 2965125572 2965119406 Bacteria 6956431
1219 2968118073 2968117919 Bacteria 6536078
1220 2977948560 2977942078 Bacteria 7570577
1221 2977976277 2977971508 Bacteria 7472917
1222 2977992004 2977986579 Bacteria 6581278
1223 2979713443 2979710463 Bacteria 6785254
1224 2987639883 2987636660 Bacteria 8088555
1225 2989350151 2989349275 Bacteria 6349068
1226 3004207456 3004203850 Bacteria 7307914
1227 8004642641 8004640170 Bacteria 6723001
1228 8045867730 8045864390 Bacteria 5043873
1229 8047900800 8047893842 Bacteria 11723082
1230 8048358102 8048356638 Bacteria 11044339
1231 8048377741 8048369669 Bacteria 11666822
1232 8048386838 8048379754 Bacteria 11877923
1233 Ga0450893_0013104
1234 SwRhRL2b_contig_2860078
1235 JGI24744J21845_10039697
1236 JGI25162J39368_1000325
1237 JGI25152J39213_1004868
1238 JGI25152J39213_1005264
1239 JGI25150J39212_1001022
1240 JGI25159J45721_1005249
1241 JGI25159J45721_1009606
1242 JGI25151J46595_10000769
1243 JGI25151J46595_10001831
1244 JGI25151J46595_10011357
1245 JGI25151J46595_10035102
1246 JGI25165J46597_1000025
1247 JGI25165J46597_1000093
1248 JGI25153J46596_10007130
1249 JGI25153J46596_10010807
1250 rootH1_10059477
1251 rootH2_10080573
1252 rootL2_10019734
1253 rootL2_10173320
1254 rootL2_10287941
1255 rootL2_10304017
1256 rootH1_10089564
1257 rootH1_10181815
1258 rootH1_10294441
1259 JGI25160J50197_1007920
1260 JGI25160J50197_1021648
1261 JGI25161J50226_1002500
1262 JGI25161J50226_1002906
1263 Ga0006562J51391_1022014
1264 Ga0006562J51391_1022018
1265 Ga0055532_1002928
1266 Ga0055535_1000075
1267 Ga0055535_1012050
1268 Ga0055542_1000010
1269 Ga0055542_1000059
1270 Ga0055526_1000049
1271 Ga0055526_1002029
1272 Ga0055526_1002541
1273 Ga0055526_1011134
1274 Ga0055537_1004302
1275 Ga0055524_1000010
1276 Ga0055524_1000945
1277 Ga0055524_1009016
1278 Ga0055536_1001372
1279 Ga0055534_1004396
1280 Ga0055528_1009372
1281 Ga0055530_10000110
1282 Ga0055540_1000041
1283 Ga0055540_1001203
1284 Ga0055540_1010275
1285 Ga0055540_1013272
1286 Ga0055531_10001413
1287 Ga0055531_10015183
1288 Ga0058692_1000049
1289 Ga0055543_1000644
1290 Ga0055543_1001425
1291 Ga0055543_1004012
1292 Ga0065165_1000270
1293 Ga0065165_1009374
1294 Ga0065165_1010028
1295 Ga0065714_10072403
1296 Ga0065714_10112334
1297 Ga0065704_10071092
1298 Ga0065712_10069451
1299 Ga0065715_10098321
1300 Ga0065715_10119915
1301 Ga0065707_10092842
1302 Ga0065707_10121741
1303 Ga0065707_10145648
1304 Ga0065707_10208077
1305 Ga0070658_10003035
1306 Ga0070676_10025716
1307 Ga0070676_10117849
1308 Ga0070683_100133310
1309 Ga0070690_100000538
1310 Ga0070690_100422631
1311 Ga0070670_100004373
1312 Ga0070670_100169575
1313 Ga0070677_10028182
1314 Ga0070677_10034722
1315 Ga0068869_100003866
1316 Ga0068869_100033771
1317 Ga0068869_100129209
1318 Ga0068869_100459705
1319 Ga0070666_10001802
1320 Ga0070666_10025039
1321 Ga0070680_100161241
1322 Ga0070682_100002484
1323 Ga0070682_100129428
1324 Ga0068868_100000766
1325 Ga0068868_100001742
1326 Ga0070660_100145029
1327 Ga0070689_100005140
1328 Ga0070689_100013198
1329 Ga0070689_100051022
1330 Ga0070689_100350364
1331 Ga0070691_10002694
1332 Ga0070691_10039606
1333 Ga0070687_100008149
1334 Ga0070661_100009036
1335 Ga0070668_100102560
1336 Ga0070668_100224697
1337 Ga0070668_100229761
1338 Ga0070668_100502268
1339 Ga0070669_100044658
1340 Ga0070669_100095142
1341 Ga0070669_100149107
1342 Ga0070669_100244735
1343 Ga0070669_100534876
1344 Ga0070675_100000010
1345 Ga0070675_100000445
1346 Ga0070675_100005604
1347 Ga0070675_100013366
1348 Ga0070671_100009551
1349 Ga0070671_100118845
1350 Ga0070671_100159471
1351 Ga0070674_100001117
1352 Ga0070674_100267646
1353 Ga0070674_100311939
1354 Ga0070674_100466206
1355 Ga0070673_100003356
1356 Ga0070688_100029427
1357 Ga0070688_100236372
1358 Ga0070667_100000477
1359 Ga0070667_100024156
1360 Ga0070667_100030777
1361 Ga0070667_100047983
1362 Ga0070667_100092158
1363 Ga0070710_10097224
1364 Ga0070701_10009549
1365 Ga0070700_100002314
1366 Ga0070694_100002558
1367 Ga0070694_100026473
1368 Ga0070694_100043861
1369 Ga0070694_100424505
1370 Ga0070663_100031606
1371 Ga0070663_100257649
1372 Ga0070678_100000859
1373 Ga0070678_100011676
1374 Ga0070678_100098686
1375 Ga0070678_100207796
1376 Ga0070678_100646979
1377 Ga0070662_100032332
1378 Ga0070662_100197030
1379 Ga0070662_100323700
1380 Ga0070662_100400524
1381 Ga0068867_100015597
1382 Ga0068867_100113402
1383 Ga0068867_100151957
1384 Ga0068867_100265589
1385 Ga0070685_10059909
1386 Ga0070685_10414690
1387 Ga0070707_100026233
1388 Ga0070699_100000005
1389 Ga0070699_100444215
1390 Ga0070684_100000954
1391 Ga0070684_100019611
1392 Ga0070697_100042621
1393 Ga0070697_100285845
1394 Ga0070697_100347549
1395 Ga0068853_100016895
1396 Ga0068853_100491929
1397 Ga0070672_100003091
1398 Ga0070672_100020071
1399 Ga0070672_100384514
1400 Ga0070686_100000293
1401 Ga0070686_100077926
1402 Ga0070686_100084831
1403 Ga0070695_100010663
1404 Ga0070695_100195142
1405 Ga0070696_100006584
1406 Ga0070696_100045880
1407 Ga0070696_100067455
1408 Ga0070696_100242352
1409 Ga0070665_100007771
1410 Ga0070665_100008646
1411 Ga0070665_100016371
1412 Ga0070665_100047277
1413 Ga0070665_100052014
1414 Ga0070665_100076080
1415 Ga0070665_100134571
1416 Ga0070665_100204752
1417 Ga0070665_100351479
1418 Ga0070665_100901571
1419 Ga0070704_100016389
1420 Ga0070704_100308255
1421 Ga0068855_100000077
1422 Ga0070664_100000870
1423 Ga0070664_100089956
1424 Ga0070664_100379291
1425 Ga0068857_100009521
1426 Ga0068857_100571779
1427 Ga0070702_100000359
1428 Ga0068852_100005804
1429 Ga0068852_100040908
1430 Ga0068852_100065512
1431 Ga0068852_100127346
1432 Ga0068852_100859147
1433 Ga0068859_100001990
1434 Ga0068859_100003719
1435 Ga0068859_100095148
1436 Ga0068859_101147594
1437 Ga0068864_100000330
1438 Ga0068864_100000771
1439 Ga0068864_100012546
1440 Ga0068864_100013570
1441 Ga0068864_100042425
1442 Ga0068864_100227085
1443 Ga0068866_10115752
1444 Ga0068861_100023885
1445 Ga0068861_100051231
1446 Ga0068861_100117001
1447 Ga0068861_100284524
1448 Ga0068851_10011636
1449 Ga0068851_10014003
1450 Ga0068870_10007021
1451 Ga0068870_10344054
1452 Ga0068863_100000715
1453 Ga0068863_100002278
1454 Ga0068863_100109709
1455 Ga0068858_100000900
1456 Ga0068858_100061781
1457 Ga0068858_100145143
1458 Ga0068860_100028701
1459 Ga0068860_100427383
1460 Ga0068860_100506913
1461 Ga0068862_100002820
1462 Ga0068862_100009212
1463 Ga0068862_100010797
1464 Ga0068862_100071412
1465 Ga0068862_100249552
1466 Ga0068862_100480852
1467 Ga0081455_10004533
1468 Ga0081455_10094267
1469 Ga0075365_10057951
1470 Ga0075365_10137495
1471 Ga0075365_10288003
1472 Ga0075368_10001221
1473 Ga0075368_10103606
1474 Ga0075363_100026753
1475 Ga0075363_100060155
1476 Ga0075363_100064279
1477 Ga0075363_100073288
1478 Ga0075364_10003984
1479 Ga0075364_10036900
1480 Ga0075364_10053196
1481 Ga0075364_10064607
1482 Ga0075364_10315933
1483 Ga0075364_10393514
1484 Ga0070712_100020126
1485 Ga0075362_10004385
1486 Ga0075362_10016898
1487 Ga0075367_10003652
1488 Ga0075367_10028294
1489 Ga0075367_10097951
1490 Ga0075369_10002867
1491 Ga0075369_10002939
1492 Ga0075369_10005309
1493 Ga0075369_10049960
1494 Ga0075369_10053629
1495 Ga0075369_10066226
1496 Ga0075366_10002636
1497 Ga0075366_10007101
1498 Ga0075366_10007693
1499 Ga0075366_10033232
1500 Ga0075366_10070189
1501 Ga0075366_10141003
1502 Ga0075366_10196740
1503 Ga0097621_100173674
1504 Ga0075370_10028180
1505 Ga0075370_10073990
1506 Ga0075370_10100650
1507 Ga0068871_100021706
1508 Ga0075428_100037285
1509 Ga0075428_100132773
1510 Ga0075428_100135898
1511 Ga0075428_100230150
1512 Ga0075428_100445885
1513 Ga0075428_100615346
1514 Ga0075430_100001045
1515 Ga0075430_100008633
1516 Ga0075430_100014112
1517 Ga0075430_100014280
1518 Ga0075430_100117464
1519 Ga0075430_100143657
1520 Ga0075430_100223467
1521 Ga0075431_100015676
1522 Ga0075431_100048191
1523 Ga0075431_100048314
1524 Ga0075431_100079161
1525 Ga0075431_100178512
1526 Ga0075431_100183113
1527 Ga0075431_100184627
1528 Ga0075431_100231265
1529 Ga0075431_100272041
1530 Ga0075431_100580635
1531 Ga0075431_100580814
1532 Ga0075434_100698364
1533 Ga0075429_100021249
1534 Ga0075429_100023365
1535 Ga0075429_100026043
1536 Ga0075429_100034391
1537 Ga0075429_100037388
1538 Ga0075429_100144021
1539 Ga0075429_100158868
1540 Ga0068865_100013232
1541 Ga0068865_100015253
1542 Ga0068865_100034091
1543 Ga0068865_100228347
1544 Ga0068865_100692454
1545 Ga0097620_100001990
1546 Ga0097620_100003719
1547 Ga0097620_100095154
1548 Ga0097620_100424970
1549 Ga0097620_101147597
1550 Ga0099826_10000002
1551 Ga0075435_100067997
1552 Ga0075435_100091437
1553 Ga0075435_100150936
1554 Ga0075435_100492769
1555 Ga0105251_10001457
1556 Ga0105244_10024505
1557 Ga0105244_10034561
1558 Ga0105240_10000866
1559 Ga0111539_10001718
1560 Ga0111539_10007550
1561 Ga0111539_10018738
1562 Ga0111539_10042091
1563 Ga0111539_10160902
1564 Ga0111539_10182497
1565 Ga0111539_10442133
1566 Ga0111539_10498400
1567 Ga0111539_10602268
1568 Ga0111539_10911764
1569 Ga0111539_10929380
1570 Ga0105245_10003688
1571 Ga0105245_10179174
1572 Ga0105245_10275307
1573 Ga0105245_10855686
1574 Ga0105245_10937138
1575 Ga0105247_10071502
1576 Ga0105247_10095325
1577 Ga0114129_10003317
1578 Ga0114129_10029934
1579 Ga0114129_10055009
1580 Ga0114129_10066596
1581 Ga0114129_10069466
1582 Ga0114129_10076662
1583 Ga0114129_10180181
1584 Ga0105243_10000269
1585 Ga0105243_10005736
1586 Ga0105243_10163931
1587 Ga0105243_10176467
1588 Ga0105243_10877601
1589 Ga0105241_10001426
1590 Ga0105242_10053019
1591 Ga0105242_10256565
1592 Ga0105248_10002894
1593 Ga0105248_10004935
1594 Ga0105248_10123754
1595 Ga0105248_10129471
1596 Ga0105237_10001081
1597 Ga0105237_10044367
1598 Ga0105237_10816030
1599 Ga0105238_10009507
1600 Ga0105238_10020386
1601 Ga0105238_10179088
1602 Ga0105238_10462170
1603 Ga0105238_10893032
1604 Ga0105249_10002448
1605 Ga0105249_10134939
1606 Ga0105249_10309268
1607 Ga0105249_10400765
1608 Ga0105249_10860948
1609 Ga0105239_10002017
1610 Ga0105239_10031239
1611 Ga0105239_10038062
1612 Ga0105239_10279743
1613 Ga0105239_10540877
1614 Ga0105239_11073771
1615 Ga0105246_10043914
1616 Ga0105246_10149512
1617 Ga0105246_10206212
1618 Ga0105246_10270955
1619 Ga0157373_10128857
1620 Ga0157369_10095638
1621 Ga0157374_10005513
1622 Ga0157374_10006819
1623 Ga0157374_10010575
1624 Ga0157378_10000005
1625 Ga0157378_10047975
1626 Ga0157378_10207074
1627 Ga0163162_10000532
1628 Ga0163162_10030738
1629 Ga0163162_10050483
1630 Ga0163162_10075086
1631 Ga0163162_10342632
1632 Ga0163162_10505735
1633 Ga0157372_10005141
1634 Ga0157372_10382757
1635 Ga0157372_10928023
1636 Ga0157372_11122086
1637 Ga0157375_10005292
1638 Ga0163163_10000548
1639 Ga0163163_10012440
1640 Ga0163163_10017005
1641 Ga0163163_10020181
1642 Ga0163163_10141575
1643 Ga0157380_10004116
1644 Ga0157380_10039432
1645 Ga0157380_10052291
1646 Ga0157380_10111234
1647 Ga0157380_10248300
1648 Ga0157380_10405512
1649 Ga0157380_10578466
1650 Ga0157377_10018645
1651 Ga0157377_10045121
1652 Ga0157377_10066405
1653 Ga0157379_10005632
1654 Ga0157379_10047884
1655 Ga0157379_10068694
1656 Ga0157379_10106642
1657 Ga0157376_10019577
1658 Ga0157376_10035557
1659 Ga0157376_10073320
1660 Ga0157376_10092852
1661 Ga0182005_1005701
1662 Ga0182005_1028840
1663 Ga0163161_10003745
1664 Ga0163161_10035379
1665 Ga0213876_10033493
1666 Ga0209436_105446
1667 Ga0209674_100439
1668 Ga0209672_101737
1669 Ga0209147_100323
1670 Ga0207427_101019
1671 Ga0209437_100180
1672 Ga0209258_100078
1673 Ga0209258_100718
1674 Ga0207425_1000180
1675 Ga0207425_1000946
1676 Ga0207425_1002402
1677 Ga0209148_1000005
1678 Ga0209148_1000086
1679 Ga0209129_1000111
1680 Ga0209129_1000775
1681 Ga0209129_1016589
1682 Ga0209233_1000053
1683 Ga0209565_1000110
1684 Ga0209565_1010429
1685 Ga0209565_1021475
1686 Ga0209565_1022415
1687 Ga0209673_1000426
1688 Ga0209673_1000814
1689 Ga0209673_1021519
1690 Ga0209130_1000205
1691 Ga0209130_1000468
1692 Ga0209130_1001259
1693 Ga0209675_1000192
1694 Ga0209675_1001500
1695 Ga0209676_1000125
1696 Ga0209676_1000162
1697 Ga0209676_1009638
1698 Ga0209025_1000116
1699 Ga0209025_1000238
1700 Ga0209025_1000641
1701 Ga0209025_1005201
1702 Ga0209564_1000015
1703 Ga0209564_1000046
1704 Ga0209564_1000155
1705 Ga0209564_1000833
1706 Ga0209758_1000107
1707 Ga0209758_1000285
1708 Ga0209758_1003948
1709 Ga0209758_1056280
1710 Ga0209050_1000012
1711 Ga0209256_1000007
1712 Ga0209256_1000087
1713 Ga0209256_1000764
1714 Ga0209256_1054571
1715 Ga0207426_1000123
1716 Ga0207426_1000667
1717 Ga0209051_1000014
1718 Ga0209051_1000274
1719 Ga0209051_1000332
1720 Ga0209051_1028633
1721 Ga0209257_1000024
1722 Ga0209257_1000870
1723 Ga0207697_10062258
1724 Ga0207656_10039808
1725 Ga0207656_10084524
1726 Ga0207655_1024763
1727 Ga0207713_1000414
1728 Ga0207682_10014073
1729 Ga0207692_10124132
1730 Ga0207642_10035838
1731 Ga0207642_10062072
1732 Ga0207642_10142431
1733 Ga0207688_10001480
1734 Ga0207688_10052048
1735 Ga0207680_10000006
1736 Ga0207680_10000940
1737 Ga0207645_10019412
1738 Ga0207645_10030686
1739 Ga0207643_10023185
1740 Ga0207705_10005090
1741 Ga0207654_10017320
1742 Ga0207695_10004730
1743 Ga0207671_10001229
1744 Ga0207671_10023099
1745 Ga0207693_10105165
1746 Ga0207660_10316423
1747 Ga0207662_10001753
1748 Ga0207662_10294677
1749 Ga0207662_10323955
1750 Ga0207646_10105576
1751 Ga0207646_10111946
1752 Ga0207681_10178190
1753 Ga0207694_10012749
1754 Ga0207694_10062210
1755 Ga0207650_10000774
1756 Ga0207659_10000001
1757 Ga0207659_10000484
1758 Ga0207659_10078784
1759 Ga0207659_10316134
1760 Ga0207687_10083816
1761 Ga0207644_10000525
1762 Ga0207644_10025031
1763 Ga0207706_10019452
1764 Ga0207706_10026056
1765 Ga0207706_10037925
1766 Ga0207709_10000205
1767 Ga0207709_10006435
1768 Ga0207709_10246459
1769 Ga0207709_10354054
1770 Ga0207670_10102749
1771 Ga0207670_10559311
1772 Ga0207669_10000481
1773 Ga0207669_10026630
1774 Ga0207704_10031772
1775 Ga0207704_10043324
1776 Ga0207704_10188741
1777 Ga0207691_10008486
1778 Ga0207691_10065159
1779 Ga0207691_10072913
1780 Ga0207691_10341088
1781 Ga0207711_10001399
1782 Ga0207711_10055573
1783 Ga0207711_10152055
1784 Ga0207711_10184022
1785 Ga0207711_10187262
1786 Ga0207711_10237041
1787 Ga0207711_10446342
1788 Ga0207689_10008615
1789 Ga0207689_10056732
1790 Ga0207689_10147906
1791 Ga0207689_10364680
1792 Ga0207689_10615924
1793 Ga0207661_10027227
1794 Ga0207679_10002749
1795 Ga0207679_10140007
1796 Ga0207679_10275512
1797 Ga0207667_10000871
1798 Ga0207651_10061786
1799 Ga0207651_10067093
1800 Ga0207651_10743204
1801 Ga0207712_10038611
1802 Ga0207712_10068631
1803 Ga0207712_10120403
1804 Ga0207712_10651808
1805 Ga0207668_10028014
1806 Ga0207668_10065380
1807 Ga0207668_10165732
1808 Ga0207658_10000866
1809 Ga0207658_10017943
1810 Ga0207658_10163312
1811 Ga0207677_10000623
1812 Ga0207677_10014438
1813 Ga0207677_10065961
1814 Ga0207703_10000773
1815 Ga0207703_10040351
1816 Ga0207703_10073142
1817 Ga0207703_10132165
1818 Ga0207703_10311298
1819 Ga0207639_10014980
1820 Ga0207639_10050721
1821 Ga0207639_10696358
1822 Ga0207678_10042060
1823 Ga0207678_10199914
1824 Ga0207708_10000257
1825 Ga0207708_10011569
1826 Ga0207702_10424928
1827 Ga0207702_10705722
1828 Ga0207641_10001102
1829 Ga0207641_10011271
1830 Ga0207641_10122929
1831 Ga0207648_10004593
1832 Ga0207648_10035543
1833 Ga0207648_10143112
1834 Ga0207648_10157783
1835 Ga0207648_10224643
1836 Ga0207648_10253089
1837 Ga0207676_10000742
1838 Ga0207676_10007617
1839 Ga0207676_10027450
1840 Ga0207676_10061574
1841 Ga0207674_10008075
1842 Ga0207674_10447436
1843 Ga0207675_100010522
1844 Ga0207675_100041465
1845 Ga0207675_100049827
1846 Ga0207675_100133977
1847 Ga0207683_10003309
1848 Ga0207683_10071626
1849 Ga0207683_10076756
1850 Ga0207683_10095109
1851 Ga0207698_10038010
1852 Ga0207698_10043657
1853 Ga0207698_10616483
1854 Ga0207698_10769230
1855 Ga0209371_1000152
1856 Ga0209999_1016561
1857 Ga0210002_1000309
1858 Ga0209983_1002360
1859 Ga0209282_1000001
1860 Ga0209966_1011401
1861 Ga0209998_10001138
1862 Ga0209813_10001998
1863 Ga0209813_10069062
1864 Ga0209974_10002289
1865 Ga0207428_10011904
1866 Ga0207428_10079589
1867 Ga0207428_10085915
1868 Ga0268266_10000043
1869 Ga0268266_10008417
1870 Ga0268266_10037322
1871 Ga0268266_10070061
1872 Ga0268266_10077439
1873 Ga0268266_10092777
1874 Ga0268266_10142466
1875 Ga0268266_10597719
1876 Ga0268266_10735283
1877 Ga0268265_10029292
1878 Ga0268265_10169750
1879 Ga0268265_10236136
1880 Ga0268265_10537119
1881 Ga0268264_10083320
1882 Ga0268264_10236018
1883 Ga0268264_10359755
1884 Ga0307517_10134965
1885 Ga0307515_10000053
1886 Ga0307515_10000618
1887 Ga0307515_10023904
1888 Ga0307515_10312553
1889 Ga0268256_1000127
1890 Ga0316176_1193569
1891 Ga0316181_1065387
1892 Ga0265332_10021978
1893 Ga0265339_10001128
1894 Ga0265339_10059387
1895 Ga0265327_10000995
1896 Ga0265316_10001895
1897 Ga0307513_10022490
1898 Ga0307513_10054978
1899 Ga0307513_10162864
1900 Ga0307509_10192440
1901 Ga0307408_100208092
1902 Ga0307408_100566509
1903 Ga0307508_10069676
1904 Ga0265314_10000001
1905 Ga0307516_10005459
1906 Ga0307405_10023327
1907 Ga0307405_10089733
1908 Ga0307412_10069628
1909 Ga0307412_10108167
1910 Ga0307416_100531707
1911 Ga0307416_100956763
1912 Ga0307415_100372982
1913 Ga0307510_10078578
1914 Ga0373934_0009692
1915 Ga0373934_0037368
1916 Ga0373923_0212062
1917 Ga0373954_0040501
1918 Ga0373954_0124203
1919 Ga0373956_0134282
1920 Ga0373957_0037546
1921 Ga0373957_0073210
1922 Ga0373943_0030022
1923 Ga0373943_0181049
1924 Ga0373946_0029505
1925 Ga0373955_0019870
1926 Ga0373955_0032246
1927 Ga0373935_0454437
1928 Ga0373933_0010244
1929 Ga0373933_0049648
1930 Ga0373933_0091077
1931 Ga0373947_0020442
1932 Ga0373947_0268367
1933 Ga0373937_0010435
1934 Ga0373937_0020842
1935 Ga0373937_0070945
1936 Ga0373937_0326011
1937 Ga0373925_0002798
1938 Ga0395901_0239865
1939 Ga0436365_1891255
1940 Ga0439466_0098106
1941 Ga0451789_0018855
1942 Ga0451807_1553985
1943 Ga0451843_1444807
1944 Ga0451853_1440263
1945 Ga0439448_0055057
1946 Ga0439432_051182
1947 Ga0450911_000056
1948 Ga0450909_022396
1949 Ga0439435_0045136
1950 Ga0439460_0005446
1951 Ga0450918_002996
1952 Ga0451577_0001050
1953 Ga0466972_0065842
1954 Ga0466972_0144060
1955 Ga0453683_0033193
1956 Ga0453683_0065514
1957 Ga0466963_0045039
1958 Ga0466963_0095607
1959 Ga0453684_0434664
1960 Ga0466960_0016167
1961 Ga0466960_0087380
1962 Ga0451576_0102156
1963 Ga0451576_0133003
1964 Ga0451576_0453743
1965 Ga0466967_0009914
1966 Ga0466967_0201316
1967 Ga0495617_000808
1968 Ga0495617_005124
1969 Ga0495617_013829
1970 Ga0495627_002867
1971 Ga0495638_0000023
1972 Ga0495638_0011342
1973 Ga0495638_0014393
1974 Ga0495638_0038370
1975 Ga0495638_0082742
1976 Ga0495638_0090457
1977 Ga0495651_0069881
1978 Ga0495651_0114370
1979 Ga0495653_0257704
1980 Ga0495650_0011900
1981 Ga0495580_0010226
1982 Ga0495605_0097709
1983 Ga0495662_0244857
1984 Ga0495664_0026848
1985 Ga0495584_0000071
1986 Ga0495585_0010363
1987 Ga0495594_0013599
1988 Ga0495607_0004789
1989 Ga0495607_0012651
1990 Ga0495607_0085985
1991 Ga0495583_0001091
1992 Ga0495606_0000188
1993 Ga0495606_0000841
1994 Ga0495606_0044161
1995 Ga0495606_0132487
1996 Ga0495608_0109431
1997 Ga0495610_0001611
1998 Ga0495610_0007064
1999 Ga0495616_0000122
2000 Ga0495616_0000355
2001 Ga0495616_0003191
2002 Ga0495616_0008748
2003 Ga0495618_0382714
2004 Ga0495620_0023981
2005 Ga0495628_0014510
2006 Ga0495628_0396450
2007 Ga0495630_0485212
2008 Ga0495630_0528524
2009 Ga0495631_0001414
2010 Ga0495632_0007990
2011 Ga0495632_0018117
2012 Ga0495637_0005182
2013 Ga0495637_0025030
2014 Ga0495643_0000323
2015 Ga0495648_0000025
2016 Ga0495648_0060217
2017 Ga0495648_0061348
2018 Ga0495663_0019037
2019 Ga0495663_0031885
2020 Ga0495642_0001873
2021 Ga0495642_0196445
2022 Ga0495652_0041051
2023 Ga0495654_0003361
2024 Ga0495654_0010645
2025 Ga0495654_0033307
2026 Ga0495654_0137451
2027 Ga0495640_0093538
2028 Ga0495640_0395328
2029 Ga0495586_0138151
2030 Ga0495587_0033122
2031 Ga0495609_0008707
2032 Ga0495621_0021203
2033 Ga0495621_0087106
2034 Ga0495597_0011980
2035 Ga0495645_0009205
2036 Ga0495645_0080669
2037 Ga0495622_0000432
2038 Ga0495633_0000045
2039 Ga0495633_0001317
2040 Ga0495633_0024492
2041 Ga0495667_0040394
2042 Ga0495656_0094854
2043 Ga0495656_0099536
2044 Ga0495668_0000066
2045 Ga0495668_0010566
2046 Ga0495668_0051064
2047 Ga0495634_0059369
2048 Ga0495611_0016389
2049 Ga0495625_0004405
2050 Ga0495625_0007334
2051 Ga0495625_0008709
2052 Ga0495625_0009193
2053 Ga0495625_0013422
2054 Ga0495625_0023189
2055 Ga0495625_0058782
2056 Ga0495625_0066935
2057 Ga0495625_0067628
2058 Ga0495659_0025165
2059 Ga0495659_0069819
2060 Ga0495661_0010607
2061 Ga0495661_0234189
2062 Ga0495658_0116019
2063 Ga0495613_0128818
2064 Ga0495624_0064775
2065 Ga0495670_0001619
2066 Ga0495670_0119634
2067 Ga0495671_0095646
2068 Ga0495649_0000637
2069 Ga0495649_0031363
2070 Ga0495660_0000576
2071 Ga0495581_0058319
2072 Ga0495604_0018356
2073 Ga0495604_0260433
2074 Ga0495674_0008854
2075 Ga0495674_0113433
2076 Ga0495674_0121526
2077 Ga0495674_0479465
2078 Ga0495674_0526280
2079 Ga0495672_0002578
2080 Ga0495672_0003539
2081 Ga0495672_0003844
2082 Ga0495672_0158464
2083 Ga0495672_0228087
2084 Ga0495680_0048507
2085 Ga0495680_0068636
2086 Ga0495680_0073501
2087 Ga0495675_0214790
2088 Ga0495673_0000028
2089 Ga0495673_0020923
2090 Ga0495681_0000009
2091 Ga0495681_0002453
2092 Ga0495684_0035825
2093 Ga0495684_0085401
2094 Ga0495684_0231627
2095 Ga0495684_0278708
2096 Ga0495686_0001324
2097 Ga0495686_0002384
2098 Ga0495686_0025117
2099 Ga0495686_0058761
2100 Ga0495602_0414142
2101 Ga0495626_0041044
2102 Ga0496100_0000062
2103 Ga0496100_0046751
2104 Ga0496100_0069902
2105 Ga0496100_0268614
2106 Ga0496101_0000059
2107 Ga0496101_0015631
2108 Ga0496101_0026116
2109 Ga0496101_0064626
2110 Ga0496102_0027487
2111 Ga0496102_0148844
2112 Ga0496102_0370913
2113 Ga0496102_0486700
2114 Ga0496102_0491126
2115 Ga0496102_0840210
2116 Ga0496103_0001093
2117 Ga0496103_0041260
2118 Ga0496103_0149883
2119 Ga0496103_0161079
2120 Ga0496104_0045641
2121 Ga0496104_0425700
2122 Ga0496104_0494333
2123 Ga0496104_0716022
2124 Ga0496105_0014960
2125 Ga0496106_0001081
2126 Ga0496106_0024324
2127 Ga0496106_0026645
2128 Ga0496106_0030905
2129 Ga0496106_0124524
2130 Ga0496106_0355128
2131 Ga0496107_0063389
2132 Ga0496107_0092040
2133 Ga0496107_0099908
2134 Ga0496107_0102687
2135 Ga0496108_0055531
2136 Ga0496108_0123365
2137 Ga0496109_0000079
2138 Ga0496109_0000204
2139 Ga0496109_0106520
2140 Ga0496110_0001223
2141 Ga0496110_0034922
2142 Ga0496110_0045766
2143 Ga0496110_0115770
2144 Ga0496110_0220418
2145 Ga0496111_0049362
2146 Ga0496111_0066257
2147 Ga0496111_0103993
2148 Ga0496111_0242783
2149 Ga0496112_0069686
2150 Ga0496112_0150615
2151 Ga0496112_0209832
2152 Ga0496112_0229278
2153 Ga0496113_0058632
2154 Ga0496113_0101561
2155 Ga0496114_0016279
2156 Ga0496114_0021382
2157 Ga0496114_0089862
2158 Ga0496114_0108634
2159 Ga0496115_0010941
2160 Ga0496115_0035459
2161 Ga0496115_0070843
2162 Ga0496116_0011972
2163 Ga0496117_0077954
2164 Ga0496118_0008393
2165 Ga0496118_0020887
2166 Ga0496118_0032720
2167 Ga0496118_0054669
2168 Ga0496118_0104514
2169 Ga0496118_0141869
2170 Ga0496119_0004207
2171 Ga0496119_0065277
2172 Ga0496119_0073957
2173 Ga0496120_0002492
2174 Ga0496120_0057907
2175 Ga0496121_0000048
2176 Ga0496121_0015855
2177 Ga0496121_0165632
2178 Ga0496122_0001215
2179 Ga0496122_0001414
2180 Ga0496122_0003061
2181 Ga0496122_0009630
2182 Ga0496122_0029699
2183 Ga0496122_0095480
2184 Ga0496122_0144466
2185 Ga0496123_0000600
2186 Ga0496123_0001087
2187 Ga0496123_0017048
2188 Ga0496123_0047344
2189 Ga0496123_0106065
2190 Ga0496123_0277899
2191 Ga0496124_0000044
2192 Ga0496124_0037007
2193 Ga0496124_0060665
2194 Ga0496124_0236543
2195 Ga0496124_0370378
2196 Ga0496125_0000037
2197 Ga0496125_0005176
2198 Ga0496125_0025768
2199 Ga0496125_0088480
2200 Ga0496125_0094436
2201 Ga0496125_0122915
2202 Ga0496126_0000046
2203 Ga0496126_0005537
2204 Ga0496126_0045393
2205 Ga0496126_0051817
2206 Ga0495678_001005
2207 Ga0495678_004149
2208 Ga0495678_020705
2209 Ga0495682_0042487
2210 Ga0495682_0077732
2211 Ga0501034_0007925
2212 Ga0501034_0085522
2213 Ga0501034_0464445
2214 Ga0501037_0037458
2215 Ga0501038_0322478
2216 Ga0501043_0042890
2217 Ga0501047_0074553
2218 Ga0501067_0118286
2219 Ga0501068_0274588
2220 Ga0501069_0068150
2221 Ga0501070_0000322
2222 Ga0501073_0145934
2223 Ga0501073_0190390
2224 Ga0501073_0195570
2225 Ga0501073_0286141
2226 Ga0501076_0353744
2227 Ga0501249_005128
2228 Ga0501225_0012830
2229 Ga0501080_0002806
2230 Ga0501080_0154597
2231 Ga0501080_0171681
2232 Ga0501080_0296328
2233 Ga0501081_0071088
2234 Ga0501083_0028666
2235 Ga0501083_0067692
2236 Ga0501083_0084355
2237 Ga0501083_0173251
2238 Ga0501083_0279791
2239 Ga0501083_0305640
2240 Ga0501083_0386047
2241 Ga0501083_0389782
2242 Ga0501044_0004459
2243 Ga0501044_0176435
2244 nmdc:mga03683_3330_c1
2245 nmdc:mga03683_8398_c1
2246 nmdc:mga00v17_191134_c1
2247 nmdc:mga00v17_23923_c1
2248 nmdc:mga00v17_27184_c1
2249 nmdc:mga00v17_36736_c1
2250 nmdc:mga0yw44_126398_c1
2251 nmdc:mga0yw44_164559_c1
2252 nmdc:mga0yw44_240112_c1
2253 nmdc:mga0yw44_293919_c1
2254 nmdc:mga0k408_104274_c1
2255 nmdc:mga0k408_13804_c1
2256 nmdc:mga0k408_153255_c1
2257 nmdc:mga0k408_223191_c1
2258 nmdc:mga0k408_30763_c1
2259 nmdc:mga0k408_347319_c1
2260 nmdc:mga0k408_74386_c1
2261 nmdc:mga0k408_801_c1
2262 nmdc:mga06z11_11495_c1
2263 nmdc:mga06z11_13524_c2
2264 nmdc:mga06z11_30557_c1
2265 nmdc:mga06z11_411886_c1
2266 nmdc:mga06z11_70469_c1
2267 nmdc:mga06z11_7853_c1
2268 nmdc:mga04h51_100096_c1
2269 nmdc:mga07m45_24328_c1
2270 nmdc:mga07m45_281284_c1
2271 nmdc:mga07m45_3811_c1
2272 nmdc:mga05p37_111710_c1
2273 nmdc:mga05p37_13336_c1
2274 nmdc:mga05p37_239388_c1
2275 nmdc:mga05p37_393282_c1
2276 nmdc:mga05p37_715391_c1
2277 nmdc:mga05p37_75173_c1
2278 nmdc:mga09592_122768_c1
2279 nmdc:mga09592_131472_c1
2280 nmdc:mga09592_34550_c1
2281 nmdc:mga09592_624477_c1
2282 nmdc:mga0qj67_109080_c1
2283 nmdc:mga0qj67_128016_c1
2284 nmdc:mga0qj67_144377_c1
2285 nmdc:mga0qj67_331379_c1
2286 nmdc:mga0qj67_467_c1
2287 nmdc:mga0qj67_534993_c1
2288 nmdc:mga06r32_11207_c1
2289 nmdc:mga06r32_117229_c1
2290 nmdc:mga06r32_184911_c1
2291 nmdc:mga06r32_192363_c1
2292 nmdc:mga06r32_316461_c1
2293 nmdc:mga06r32_324479_c1
2294 nmdc:mga06r32_557077_c1
2295 nmdc:mga06r32_589656_c1
2296 nmdc:mga06r32_66257_c1
2297 nmdc:mga08y16_1396_c1
2298 nmdc:mga08y16_1766_c1
2299 nmdc:mga08y16_538928_c1
2300 nmdc:mga08y16_557786_c1
2301 nmdc:mga08y16_651695_c1
2302 nmdc:mga08y16_663872_c1
2303 nmdc:mga08y16_713195_c1
2304 nmdc:mga08y16_8635_c1
2305 nmdc:mga08y16_966723_c1
2306 nmdc:mga0n895_507971_c1
2307 nmdc:mga0n895_776399_c1
2308 nmdc:mga0rr50_33954_c1
2309 nmdc:mga0rr50_398202_c1
2310 nmdc:mga0sz30_142729_c1
2311 nmdc:mga0sz30_31284_c1
2312 nmdc:mga0sz30_44838_c1
2313 nmdc:mga0sz30_9385_c1
2314 Ga0495601_0322572
2315 Ga0500610_0119235
2316 Ga0500635_0004478
2317 Ga0500635_0063295
2318 Ga0495619_0086989
2319 Ga0500578_0000311
2320 Ga0500644_0031824
2321 Ga0500646_0022698
2322 Ga0500646_0027703
2323 Ga0500583_0001441
2324 Ga0500583_0014380
2325 Ga0500583_0158396
2326 Ga0500566_0046914
2327 Ga0500566_0138923
2328 Ga0500641_0017930
2329 Ga0500641_0023065
2330 Ga0500641_0049669
2331 Ga0500555_001233
2332 Ga0500555_025672
2333 Ga0500556_0000166
2334 Ga0500562_005069
2335 Ga0500592_000085
2336 Ga0500594_0001974
2337 Ga0500594_0041839
2338 Ga0500597_089246
2339 Ga0500614_060165
2340 Ga0500618_059317
2341 Ga0500642_0084227
2342 Ga0500658_0000033
2343 Ga0500658_0003654
2344 Ga0500658_0020892
2345 Ga0500559_0024493
2346 Ga0500568_0000999
2347 Ga0500568_0001676
2348 Ga0500568_0007197
2349 Ga0500568_0013997
2350 Ga0500568_0184899
2351 Ga0500574_001896
2352 Ga0500586_001470
2353 Ga0500603_001149
2354 Ga0500604_0003357
2355 Ga0500604_0026340
2356 Ga0500604_0037326
2357 Ga0500616_0001627
2358 Ga0500616_0026530
2359 Ga0500620_006751
2360 Ga0500622_0003332
2361 Ga0500622_0005681
2362 Ga0500622_0030030
2363 Ga0500622_0058855
2364 Ga0500622_0130305
2365 Ga0500627_0000218
2366 Ga0500627_0001029
2367 Ga0500627_0005618
2368 Ga0500627_0120606
2369 Ga0500627_0160083
2370 Ga0500636_0000055
2371 Ga0500637_0022401
2372 Ga0500637_0197134
2373 Ga0500645_001347
2374 Ga0501084_0247380
2375 Ga0501082_0192679
2376 Ga0501082_0398963
2377 Ga0501082_0410887
2378 Ga0501082_0560575
2379 2509080082
2380 2514418312
2381 2572255889
2382 2595446164
2383 2599612089
2384 2599625988
2385 2599674930
2386 2599683824
2387 2599695573
2388 2600025997
2389 2600058101
2390 2600080141
2391 2644105413
2392 2644145747
2393 2644210452
2394 2644311360
2395 2644331241
2396 2644337573
2397 2644544664
2398 2644617034
2399 2644654004
2400 2671129848
2401 2723577161
2402 2738845428
2403 2738881039
2404 2739058357
2405 2739243771
2406 2739276481
2407 2739308495
2408 2739345525
2409 2739731833
2410 2776913519
2411 2793976712
2412 2816472611
2413 2819602225
2414 2819662262
2415 2821132192
2416 2831272090
2417 2838061763
2418 2844163931
2419 2852688036
2420 2857356070
2421 2857562566
2422 2857568343
2423 2857576913
2424 2885199663
2425 2885213314
2426 2888350427
2427 2889022361
2428 2899928697
2429 2903769901
2430 2904549347
2431 2906361921
2432 2917705003
2433 2919132902
2434 2919467717
2435 2922136803
2436 2922192687
2437 2928043358
2438 2928050800
2439 2928056300
2440 2928066218
2441 2928076241
2442 2928085190
2443 2929164802
2444 2929199460
2445 2937824069
2446 2941487202
2447 2941504646
2448 2958103339
2449 2958173715
2450 2965125572
2451 2968118073
2452 2977948560
2453 2977976277
2454 2977992004
2455 2979713443
2456 2987639883
2457 2989350151
2458 3004207456
2459 8004642641
2460 8045867730
2461 8047900800
2462 8048358102
2463 8048377741
2464 8048386838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

21

210

0.93

PF08659

KR

KR domain

21

193

0.88

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

27

256

0.83

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

23

237

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
7do6-assembly2.cif.gz_G crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase(nadp bound-form) 0.93 2 174
5b12-assembly2.cif.gz_E crystal structure of the b-type halohydrin hydrogen-halide-lyase mutant f71w/q125t/d199h from corynebacterium sp. n-1074 0.9188 2 173
8sy8-assembly1.cif.gz_A-2 crystal structure of tsac 0.918 2 171
5u9p-assembly1.cif.gz_C crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp and tartrate 0.9138 2 175
4z9x-assembly1.cif.gz_A crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from streptococcus pyogenes 0.9114 2 175
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9642 76 171 3.40.50.720
af_Q53LS6_31_305_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9385 2 173 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9163 3 170 3.40.50.720
af_A0A1D6Q3A1_14_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9137 2 102 3.40.50.720
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9054 2 174 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0L7TAM3-F1-model_v4 Dehydrogenase 1 1 222 GO:0016491
AF-A0A439F681-F1-model_v4 deleted 0.9992 16 245
AF-A0A436QX60-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9988 1 166 GO:0000140
GO:0004806
GO:0005811
GO:0006654
GO:0019433
AF-A0A3N5H3S3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9965 32 245 GO:0016491
AF-A0A4P8HXB9-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.995 1 245 GO:0016491

Map