F492089

General Info

Members Datasets Scaffolds Average Seq Length
1241 263 1241 218

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10013302|JGI24735J21928_100133023
Length 218
Sequence LAVIVILALVALFIGLRLYSVLGERTGHEQQPILKPADSDAARATPQVTQPAAPQAAPADNGDLAFVPTAGPGVRAILAADSTFDVARFLEGAKAAYRMILEAYWKGDLDAIRGHVEPHIYDAFAAATEQRAKDGLKLDNRLVTIDQVVISEATLERGVAVITVRFEADIAAVTRNVEGQVVAGSLSDAVQTRDLWTFRRDTNSRDPNWLLIETDEEE

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
179 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
253 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
254 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
255 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
256 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
261 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 1.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 4.67
Rhizosphere 94.68
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1013291 3300001976 Bacteria 1075
2 JGI24746J21847_1002084 3300001977 Bacteria 3196
3 JGI24747J21853_1001581 3300001978 Bacteria 1734
4 JGI24740J21852_10020678 3300001979 Bacteria 2291
5 JGI24740J21852_10037044 3300001979 Bacteria 1509
6 JGI24739J22299_10001857 3300001989 Bacteria 8059
7 JGI24739J22299_10003420 3300001989 Bacteria 6056
8 JGI24737J22298_10000229 3300001990 Bacteria 18537
9 JGI24737J22298_10000380 3300001990 Bacteria 15123
10 JGI24737J22298_10048451 3300001990 Bacteria 1293
11 JGI24737J22298_10078046 3300001990 Unclassified 987
12 JGI24743J22301_10017544 3300001991 Bacteria 1345
13 JGI24735J21928_10013302 3300002067 Bacteria 2589
14 JGI24735J21928_10013884 3300002067 Bacteria 2527
15 JGI24735J21928_10054753 3300002067 Bacteria 1149
16 JGI24738J21930_10000035 3300002075 Bacteria 25714
17 JGI24738J21930_10000111 3300002075 Bacteria 19088
18 JGI24738J21930_10011415 3300002075 Bacteria 1954
19 JGI24738J21930_10025120 3300002075 Bacteria 1225
20 JGI24744J21845_10001913 3300002077 Bacteria 4200
21 JGI24034J26672_10016227 3300002239 Unclassified 1146
22 Ga0065712_10093551 3300005290 Bacteria 2272
23 Ga0065715_10000359 3300005293 Bacteria 22373
24 Ga0070658_10000950 3300005327 Bacteria 24773
25 Ga0070658_10004834 3300005327 Bacteria 10977
26 Ga0070658_10007017 3300005327 Bacteria 9097
27 Ga0070658_10007328 3300005327 Bacteria 8909
28 Ga0070658_10008348 3300005327 Bacteria 8330
29 Ga0070658_10035822 3300005327 Bacteria 3998
30 Ga0070658_10048392 3300005327 Bacteria 3442
31 Ga0070658_10058707 3300005327 Bacteria 3132
32 Ga0070658_10066902 3300005327 Bacteria 2935
33 Ga0070658_10086254 3300005327 Bacteria 2582
34 Ga0070658_10086428 3300005327 Bacteria 2580
35 Ga0070658_10098619 3300005327 Bacteria 2413
36 Ga0070658_10178274 3300005327 Bacteria 1788
37 Ga0070658_10190659 3300005327 Bacteria 1728
38 Ga0070658_10255462 3300005327 Bacteria 1487
39 Ga0070658_10287436 3300005327 Bacteria 1401
40 Ga0070658_10313747 3300005327 Bacteria 1338
41 Ga0070658_10389358 3300005327 Bacteria 1196
42 Ga0070676_10110847 3300005328 Bacteria 1708
43 Ga0070676_10145152 3300005328 Bacteria 1514
44 Ga0070676_10180150 3300005328 Bacteria 1373
45 Ga0070676_10191868 3300005328 Bacteria 1334
46 Ga0070683_100001317 3300005329 Bacteria 18886
47 Ga0070683_100002246 3300005329 Bacteria 15318
48 Ga0070683_100064707 3300005329 Bacteria 3404
49 Ga0070683_100106903 3300005329 Bacteria 2638
50 Ga0070683_100138672 3300005329 Bacteria 2304
51 Ga0070683_100271938 3300005329 Bacteria 1612
52 Ga0070683_100312688 3300005329 Bacteria 1495
53 Ga0070690_100087890 3300005330 Bacteria 2042
54 Ga0070690_100117033 3300005330 Bacteria 1785
55 Ga0070690_100781533 3300005330 Bacteria 739
56 Ga0070670_100004283 3300005331 Bacteria 11941
57 Ga0070670_100021668 3300005331 Bacteria 5525
58 Ga0070670_100023463 3300005331 Bacteria 5310
59 Ga0070670_100038464 3300005331 Bacteria 4114
60 Ga0070670_100046469 3300005331 Bacteria 3733
61 Ga0070670_100147878 3300005331 Bacteria 2033
62 Ga0070670_100208352 3300005331 Bacteria 1699
63 Ga0070670_100217097 3300005331 Bacteria 1664
64 Ga0070677_10000999 3300005333 Bacteria 9157
65 Ga0070677_10008037 3300005333 Bacteria 3538
66 Ga0070677_10053961 3300005333 Bacteria 1636
67 Ga0070677_10097638 3300005333 Bacteria 1289
68 Ga0070677_10187580 3300005333 Bacteria 989
69 Ga0068869_100051248 3300005334 Bacteria 2994
70 Ga0070666_10000451 3300005335 Bacteria 24994
71 Ga0070666_10005045 3300005335 Bacteria 8075
72 Ga0070666_10007600 3300005335 Bacteria 6686
73 Ga0070666_10029477 3300005335 Bacteria 3608
74 Ga0070666_10033898 3300005335 Bacteria 3382
75 Ga0070666_10037685 3300005335 Bacteria 3216
76 Ga0070666_10050541 3300005335 Bacteria 2796
77 Ga0070666_10469947 3300005335 Unclassified 910
78 Ga0070680_100004263 3300005336 Bacteria 10737
79 Ga0070680_100004436 3300005336 Bacteria 10567
80 Ga0070680_100022841 3300005336 Bacteria 4983
81 Ga0070680_100026691 3300005336 Bacteria 4619
82 Ga0070680_100031574 3300005336 Bacteria 4260
83 Ga0070680_100074636 3300005336 Bacteria 2791
84 Ga0070680_100095267 3300005336 Bacteria 2467
85 Ga0070680_100157613 3300005336 Unclassified 1907
86 Ga0070680_100403036 3300005336 Bacteria 1166
87 Ga0070682_100004206 3300005337 Bacteria 7987
88 Ga0070682_100016231 3300005337 Bacteria 4327
89 Ga0070682_100324793 3300005337 Bacteria 1138
90 Ga0068868_100000881 3300005338 Bacteria 20375
91 Ga0068868_100029630 3300005338 Bacteria 4192
92 Ga0068868_100147032 3300005338 Unclassified 1938
93 Ga0068868_100202639 3300005338 Bacteria 1655
94 Ga0070660_100000260 3300005339 Bacteria 34947
95 Ga0070660_100004031 3300005339 Bacteria 10144
96 Ga0070660_100006497 3300005339 Bacteria 8110
97 Ga0070660_100014877 3300005339 Bacteria 5616
98 Ga0070660_100017486 3300005339 Bacteria 5228
99 Ga0070660_100017750 3300005339 Bacteria 5190
100 Ga0070660_100039431 3300005339 Bacteria 3590
101 Ga0070660_100069590 3300005339 Bacteria 2745
102 Ga0070660_100075269 3300005339 Bacteria 2643
103 Ga0070660_100080308 3300005339 Bacteria 2559
104 Ga0070660_100094011 3300005339 Bacteria 2368
105 Ga0070660_100209399 3300005339 Bacteria 1582
106 Ga0070660_100371106 3300005339 Bacteria 1180
107 Ga0070660_100408146 3300005339 Bacteria 1124
108 Ga0070689_100168237 3300005340 Unclassified 1775
109 Ga0070689_100237840 3300005340 Bacteria 1499
110 Ga0070691_10005847 3300005341 Bacteria 5611
111 Ga0070661_100000246 3300005344 Bacteria 44536
112 Ga0070661_100007780 3300005344 Bacteria 7396
113 Ga0070661_100020617 3300005344 Bacteria 4702
114 Ga0070661_100026287 3300005344 Bacteria 4185
115 Ga0070661_100027296 3300005344 Bacteria 4109
116 Ga0070661_100034441 3300005344 Bacteria 3672
117 Ga0070661_100036669 3300005344 Bacteria 3564
118 Ga0070661_100079500 3300005344 Bacteria 2420
119 Ga0070661_100233959 3300005344 Bacteria 1413
120 Ga0070692_10012710 3300005345 Bacteria 3907
121 Ga0070692_10327286 3300005345 Bacteria 944
122 Ga0070668_100010358 3300005347 Bacteria 6924
123 Ga0070668_100032292 3300005347 Bacteria 3984
124 Ga0070668_100090692 3300005347 Bacteria 2408
125 Ga0070668_100100911 3300005347 Bacteria 2286
126 Ga0070668_100161674 3300005347 Bacteria 1817
127 Ga0070668_100241551 3300005347 Bacteria 1496
128 Ga0070668_100389382 3300005347 Bacteria 1188
129 Ga0070669_100002615 3300005353 Bacteria 13015
130 Ga0070669_100016871 3300005353 Bacteria 5213
131 Ga0070669_100030619 3300005353 Bacteria 3884
132 Ga0070669_100081765 3300005353 Bacteria 2407
133 Ga0070669_100406814 3300005353 Bacteria 1114
134 Ga0070675_100004653 3300005354 Bacteria 10479
135 Ga0070675_100026701 3300005354 Bacteria 4634
136 Ga0070675_100049464 3300005354 Bacteria 3450
137 Ga0070675_100163451 3300005354 Bacteria 1916
138 Ga0070675_100365390 3300005354 Bacteria 1282
139 Ga0070675_100729036 3300005354 Bacteria 904
140 Ga0070675_100807622 3300005354 Bacteria 857
141 Ga0070671_100000825 3300005355 Bacteria 22465
142 Ga0070671_100004514 3300005355 Bacteria 11016
143 Ga0070671_100011712 3300005355 Bacteria 7053
144 Ga0070671_100013680 3300005355 Bacteria 6544
145 Ga0070671_100014729 3300005355 Bacteria 6321
146 Ga0070671_100021078 3300005355 Bacteria 5320
147 Ga0070671_100030749 3300005355 Bacteria 4431
148 Ga0070671_100035593 3300005355 Bacteria 4125
149 Ga0070671_100039305 3300005355 Bacteria 3928
150 Ga0070671_100040586 3300005355 Bacteria 3866
151 Ga0070671_100065621 3300005355 Bacteria 3024
152 Ga0070671_100069570 3300005355 Bacteria 2936
153 Ga0070671_100085909 3300005355 Bacteria 2632
154 Ga0070671_100213153 3300005355 Bacteria 1638
155 Ga0070671_100241468 3300005355 Bacteria 1533
156 Ga0070671_100504565 3300005355 Bacteria 1041
157 Ga0070671_100567289 3300005355 Bacteria 979
158 Ga0070674_100002641 3300005356 Bacteria 9913
159 Ga0070674_100060210 3300005356 Bacteria 2646
160 Ga0070674_100073398 3300005356 Bacteria 2425
161 Ga0070674_100259388 3300005356 Bacteria 1369
162 Ga0070674_100930155 3300005356 Bacteria 759
163 Ga0070673_100003488 3300005364 Bacteria 9795
164 Ga0070673_100007637 3300005364 Bacteria 7155
165 Ga0070673_100065813 3300005364 Bacteria 2893
166 Ga0070673_100078210 3300005364 Bacteria 2676
167 Ga0070673_100106382 3300005364 Bacteria 2319
168 Ga0070673_100130371 3300005364 Bacteria 2108
169 Ga0070673_100281945 3300005364 Bacteria 1458
170 Ga0070673_100500198 3300005364 Bacteria 1099
171 Ga0070659_100000195 3300005366 Bacteria 46642
172 Ga0070659_100001672 3300005366 Bacteria 15938
173 Ga0070659_100003180 3300005366 Bacteria 11690
174 Ga0070659_100009755 3300005366 Bacteria 7057
175 Ga0070659_100067067 3300005366 Bacteria 2845
176 Ga0070659_100081684 3300005366 Bacteria 2581
177 Ga0070659_100081876 3300005366 Bacteria 2578
178 Ga0070659_100094138 3300005366 Bacteria 2405
179 Ga0070659_100187443 3300005366 Bacteria 1699
180 Ga0070659_100192135 3300005366 Bacteria 1678
181 Ga0070659_100293399 3300005366 Bacteria 1354
182 Ga0070659_100421809 3300005366 Bacteria 1128
183 Ga0070659_100630365 3300005366 Bacteria 923
184 Ga0070667_100003302 3300005367 Bacteria 13792
185 Ga0070667_100003455 3300005367 Bacteria 13460
186 Ga0070667_100004244 3300005367 Bacteria 12102
187 Ga0070667_100015921 3300005367 Bacteria 6222
188 Ga0070667_100040579 3300005367 Bacteria 3903
189 Ga0070667_100056316 3300005367 Bacteria 3321
190 Ga0070667_100063443 3300005367 Bacteria 3131
191 Ga0070667_100063842 3300005367 Bacteria 3122
192 Ga0070667_100067142 3300005367 Bacteria 3048
193 Ga0070667_100067184 3300005367 Bacteria 3047
194 Ga0070667_100068000 3300005367 Bacteria 3030
195 Ga0070667_100087799 3300005367 Bacteria 2669
196 Ga0070667_100386748 3300005367 Unclassified 1271
197 Ga0070667_100722323 3300005367 Bacteria 922
198 Ga0070714_100047389 3300005435 Bacteria 3651
199 Ga0070714_100055969 3300005435 Bacteria 3372
200 Ga0070713_100017293 3300005436 Bacteria 5449
201 Ga0070713_100972681 3300005436 Bacteria 818
202 Ga0070701_10307681 3300005438 Bacteria 976
203 Ga0070700_100034056 3300005441 Bacteria 3073
204 Ga0070694_100035892 3300005444 Bacteria 3280
205 Ga0070663_100006460 3300005455 Bacteria 7055
206 Ga0070663_100006925 3300005455 Bacteria 6865
207 Ga0070663_100012865 3300005455 Bacteria 5311
208 Ga0070663_100028627 3300005455 Bacteria 3796
209 Ga0070663_100029256 3300005455 Bacteria 3762
210 Ga0070663_100113996 3300005455 Bacteria 2035
211 Ga0070663_100114282 3300005455 Bacteria 2033
212 Ga0070663_100138025 3300005455 Bacteria 1858
213 Ga0070663_100284981 3300005455 Bacteria 1318
214 Ga0070663_100422422 3300005455 Bacteria 1094
215 Ga0070663_100616654 3300005455 Bacteria 914
216 Ga0070678_100040641 3300005456 Bacteria 3291
217 Ga0070678_100134820 3300005456 Bacteria 1968
218 Ga0070678_100167291 3300005456 Bacteria 1787
219 Ga0070678_100172662 3300005456 Bacteria 1762
220 Ga0070678_100176831 3300005456 Bacteria 1743
221 Ga0070678_100615988 3300005456 Bacteria 970
222 Ga0070662_100000047 3300005457 Bacteria 66967
223 Ga0070662_100002537 3300005457 Bacteria 11260
224 Ga0070662_100002895 3300005457 Bacteria 10656
225 Ga0070662_100006664 3300005457 Bacteria 7460
226 Ga0070662_100008156 3300005457 Bacteria 6823
227 Ga0070662_100008482 3300005457 Bacteria 6706
228 Ga0070662_100011273 3300005457 Bacteria 5893
229 Ga0070662_100067097 3300005457 Bacteria 2634
230 Ga0070662_100070347 3300005457 Bacteria 2578
231 Ga0070662_100098827 3300005457 Bacteria 2205
232 Ga0070662_100162259 3300005457 Unclassified 1749
233 Ga0070662_100236230 3300005457 Bacteria 1464
234 Ga0070662_100367223 3300005457 Bacteria 1182
235 Ga0070662_100736314 3300005457 Bacteria 835
236 Ga0070681_10149323 3300005458 Bacteria 2264
237 Ga0070681_10357601 3300005458 Bacteria 1370
238 Ga0070681_10522897 3300005458 Bacteria 1100
239 Ga0068867_100005296 3300005459 Bacteria 9108
240 Ga0068867_100006073 3300005459 Bacteria 8562
241 Ga0068867_100031841 3300005459 Bacteria 3810
242 Ga0070685_10131747 3300005466 Bacteria 1564
243 Ga0070679_100015785 3300005530 Bacteria 7266
244 Ga0070679_100082597 3300005530 Bacteria 3202
245 Ga0070679_100183454 3300005530 Bacteria 2064
246 Ga0070679_100200502 3300005530 Bacteria 1962
247 Ga0070679_100286339 3300005530 Bacteria 1599
248 Ga0070679_100298936 3300005530 Unclassified 1560
249 Ga0070679_100303524 3300005530 Bacteria 1547
250 Ga0070679_100314470 3300005530 Bacteria 1516
251 Ga0070679_100332236 3300005530 Bacteria 1468
252 Ga0070679_100480359 3300005530 Bacteria 1187
253 Ga0070684_100009105 3300005535 Bacteria 7807
254 Ga0070684_100015986 3300005535 Bacteria 6129
255 Ga0068853_100000033 3300005539 Bacteria 113700
256 Ga0068853_100007792 3300005539 Bacteria 8589
257 Ga0068853_100021431 3300005539 Bacteria 5388
258 Ga0068853_100033639 3300005539 Bacteria 4350
259 Ga0068853_100129098 3300005539 Bacteria 2261
260 Ga0068853_100172070 3300005539 Bacteria 1960
261 Ga0068853_100184003 3300005539 Bacteria 1896
262 Ga0068853_100317020 3300005539 Bacteria 1445
263 Ga0068853_100362769 3300005539 Bacteria 1350
264 Ga0068853_100450181 3300005539 Bacteria 1211
265 Ga0070672_100002154 3300005543 Bacteria 12429
266 Ga0070672_100003490 3300005543 Bacteria 10188
267 Ga0070672_100008903 3300005543 Bacteria 6895
268 Ga0070672_100041357 3300005543 Bacteria 3543
269 Ga0070672_100057378 3300005543 Bacteria 3056
270 Ga0070672_100089334 3300005543 Bacteria 2482
271 Ga0070672_100109649 3300005543 Bacteria 2248
272 Ga0070672_100131378 3300005543 Bacteria 2058
273 Ga0070672_100240890 3300005543 Bacteria 1521
274 Ga0070672_100331505 3300005543 Bacteria 1295
275 Ga0070686_100217175 3300005544 Bacteria 1380
276 Ga0070693_100011462 3300005547 Bacteria 4466
277 Ga0070693_100031786 3300005547 Bacteria 2897
278 Ga0070665_100011256 3300005548 Bacteria 9048
279 Ga0070665_100012043 3300005548 Bacteria 8724
280 Ga0070665_100012854 3300005548 Bacteria 8428
281 Ga0070665_100017956 3300005548 Bacteria 7102
282 Ga0070665_100039523 3300005548 Bacteria 4743
283 Ga0070665_100272088 3300005548 Bacteria 1696
284 Ga0070665_100744094 3300005548 Bacteria 993
285 Ga0070665_100764025 3300005548 Bacteria 979
286 Ga0068855_100000531 3300005563 Bacteria 46681
287 Ga0068855_100031999 3300005563 Bacteria 6280
288 Ga0068855_100044201 3300005563 Bacteria 5273
289 Ga0068855_100053522 3300005563 Bacteria 4748
290 Ga0068855_100096784 3300005563 Bacteria 3400
291 Ga0068855_100160182 3300005563 Bacteria 2555
292 Ga0068855_100172091 3300005563 Bacteria 2452
293 Ga0068855_100239473 3300005563 Bacteria 2028
294 Ga0068855_100299728 3300005563 Bacteria 1780
295 Ga0068855_100388376 3300005563 Bacteria 1531
296 Ga0068855_100658001 3300005563 Bacteria 1124
297 Ga0068855_101071399 3300005563 Bacteria 844
298 Ga0070664_100000242 3300005564 Bacteria 39241
299 Ga0070664_100012535 3300005564 Bacteria 6896
300 Ga0070664_100014968 3300005564 Bacteria 6330
301 Ga0070664_100029545 3300005564 Bacteria 4570
302 Ga0070664_100035533 3300005564 Bacteria 4183
303 Ga0070664_100046375 3300005564 Bacteria 3671
304 Ga0070664_100093492 3300005564 Bacteria 2605
305 Ga0070664_100095020 3300005564 Bacteria 2585
306 Ga0070664_100098731 3300005564 Bacteria 2537
307 Ga0070664_100115285 3300005564 Bacteria 2348
308 Ga0070664_100146592 3300005564 Bacteria 2082
309 Ga0070664_100320190 3300005564 Bacteria 1405
310 Ga0070664_100570707 3300005564 Bacteria 1047
311 Ga0068857_100003503 3300005577 Bacteria 13106
312 Ga0068857_100008864 3300005577 Bacteria 8714
313 Ga0068857_100069483 3300005577 Bacteria 3136
314 Ga0068857_100074791 3300005577 Bacteria 3019
315 Ga0068857_100077789 3300005577 Bacteria 2960
316 Ga0068857_100097814 3300005577 Bacteria 2632
317 Ga0068857_100109367 3300005577 Bacteria 2483
318 Ga0068857_100112507 3300005577 Bacteria 2447
319 Ga0068854_100001998 3300005578 Bacteria 12488
320 Ga0068854_100004302 3300005578 Bacteria 8970
321 Ga0068854_100005905 3300005578 Bacteria 7752
322 Ga0068854_100012918 3300005578 Bacteria 5469
323 Ga0068854_100017038 3300005578 Bacteria 4856
324 Ga0068854_100031056 3300005578 Bacteria 3710
325 Ga0068854_100037092 3300005578 Bacteria 3419
326 Ga0068854_100062870 3300005578 Bacteria 2693
327 Ga0068854_100100729 3300005578 Bacteria 2166
328 Ga0068854_100326132 3300005578 Unclassified 1250
329 Ga0068856_100000162 3300005614 Bacteria 69640
330 Ga0068856_100016343 3300005614 Bacteria 7180
331 Ga0068856_100119211 3300005614 Bacteria 2640
332 Ga0068856_100170663 3300005614 Bacteria 2187
333 Ga0068856_100498669 3300005614 Bacteria 1238
334 Ga0068856_100775027 3300005614 Bacteria 979
335 Ga0068856_100810951 3300005614 Bacteria 955
336 Ga0068852_100001990 3300005616 Bacteria 13925
337 Ga0068852_100002549 3300005616 Bacteria 12555
338 Ga0068852_100006456 3300005616 Bacteria 8472
339 Ga0068852_100020466 3300005616 Bacteria 5263
340 Ga0068852_100049931 3300005616 Bacteria 3581
341 Ga0068852_100205461 3300005616 Bacteria 1866
342 Ga0068852_100258566 3300005616 Bacteria 1671
343 Ga0068852_100321164 3300005616 Bacteria 1504
344 Ga0068852_100543385 3300005616 Bacteria 1161
345 Ga0068859_100008163 3300005617 Bacteria 10621
346 Ga0068859_100026939 3300005617 Bacteria 5766
347 Ga0068859_100036370 3300005617 Bacteria 4943
348 Ga0068859_100088327 3300005617 Bacteria 3149
349 Ga0068859_100247432 3300005617 Bacteria 1873
350 Ga0068864_100001290 3300005618 Bacteria 20864
351 Ga0068864_100003128 3300005618 Bacteria 13675
352 Ga0068864_100004851 3300005618 Bacteria 11014
353 Ga0068864_100013936 3300005618 Bacteria 6663
354 Ga0068864_100041042 3300005618 Bacteria 3958
355 Ga0068864_100290357 3300005618 Bacteria 1529
356 Ga0068866_10037141 3300005718 Bacteria 2391
357 Ga0068866_10221270 3300005718 Unclassified 1142
358 Ga0068861_100004768 3300005719 Bacteria 9116
359 Ga0068861_100062365 3300005719 Bacteria 2863
360 Ga0068851_10024620 3300005834 Bacteria 2948
361 Ga0068851_10039595 3300005834 Bacteria 2367
362 Ga0068851_10041771 3300005834 Bacteria 2307
363 Ga0068851_10063820 3300005834 Bacteria 1892
364 Ga0068851_10071363 3300005834 Bacteria 1797
365 Ga0068851_10074977 3300005834 Unclassified 1757
366 Ga0068870_10073710 3300005840 Bacteria 1868
367 Ga0068863_100006129 3300005841 Bacteria 11792
368 Ga0068863_100037056 3300005841 Bacteria 4644
369 Ga0068863_100094035 3300005841 Bacteria 2845
370 Ga0068863_100436727 3300005841 Bacteria 1283
371 Ga0068863_100476379 3300005841 Bacteria 1227
372 Ga0068863_100769799 3300005841 Bacteria 959
373 Ga0068858_100014242 3300005842 Bacteria 7498
374 Ga0068858_100022221 3300005842 Bacteria 5923
375 Ga0068858_100051595 3300005842 Bacteria 3805
376 Ga0068858_100330386 3300005842 Bacteria 1458
377 Ga0068858_101090519 3300005842 Unclassified 784
378 Ga0068860_100012703 3300005843 Bacteria 8285
379 Ga0068860_100019113 3300005843 Bacteria 6653
380 Ga0068860_100028539 3300005843 Bacteria 5372
381 Ga0068860_100059624 3300005843 Bacteria 3628
382 Ga0068860_100277259 3300005843 Bacteria 1638
383 Ga0068860_100850230 3300005843 Bacteria 927
384 Ga0068862_100005443 3300005844 Bacteria 10639
385 Ga0068862_100009248 3300005844 Bacteria 8159
386 Ga0068862_100009717 3300005844 Bacteria 7951
387 Ga0068862_100014049 3300005844 Bacteria 6642
388 Ga0068862_100021213 3300005844 Bacteria 5430
389 Ga0068862_100063009 3300005844 Bacteria 3190
390 Ga0068862_100132927 3300005844 Bacteria 2203
391 Ga0068862_100510352 3300005844 Bacteria 1142
392 Ga0070717_10024236 3300006028 Bacteria 4816
393 Ga0097621_100014323 3300006237 Bacteria 5932
394 Ga0097621_100052535 3300006237 Bacteria 3320
395 Ga0097621_100156800 3300006237 Bacteria 1954
396 Ga0075370_10150478 3300006353 Unclassified 1364
397 Ga0068871_100006417 3300006358 Bacteria 8321
398 Ga0068871_100020356 3300006358 Bacteria 5081
399 Ga0068871_100105553 3300006358 Bacteria 2364
400 Ga0068871_100252451 3300006358 Bacteria 1536
401 Ga0068865_100033541 3300006881 Bacteria 3438
402 Ga0068865_100200837 3300006881 Bacteria 1547
403 Ga0097620_100008163 3300006931 Bacteria 10621
404 Ga0097620_100026941 3300006931 Bacteria 5766
405 Ga0097620_100036370 3300006931 Bacteria 4943
406 Ga0097620_100088321 3300006931 Bacteria 3149
407 Ga0097620_100247425 3300006931 Bacteria 1873
408 Ga0105240_10014520 3300009093 Bacteria 10752
409 Ga0105240_10047741 3300009093 Bacteria 5416
410 Ga0105240_10109964 3300009093 Bacteria 3336
411 Ga0105245_10000285 3300009098 Bacteria 48237
412 Ga0105245_10047095 3300009098 Bacteria 3854
413 Ga0105247_10248127 3300009101 Bacteria 1216
414 Ga0105243_10138425 3300009148 Bacteria 2074
415 Ga0105241_10018764 3300009174 Bacteria 5095
416 Ga0105241_10042296 3300009174 Bacteria 3446
417 Ga0105241_10092993 3300009174 Bacteria 2382
418 Ga0105241_10321132 3300009174 Bacteria 1335
419 Ga0105241_10332997 3300009174 Bacteria 1313
420 Ga0105248_10000059 3300009177 Bacteria 137176
421 Ga0105248_10004029 3300009177 Bacteria 16252
422 Ga0105248_10004871 3300009177 Bacteria 14855
423 Ga0105248_10013832 3300009177 Bacteria 8878
424 Ga0105248_10013976 3300009177 Bacteria 8832
425 Ga0105248_10020125 3300009177 Bacteria 7394
426 Ga0105248_10081096 3300009177 Bacteria 3647
427 Ga0105248_10098492 3300009177 Bacteria 3294
428 Ga0105248_10112409 3300009177 Bacteria 3072
429 Ga0105248_10155358 3300009177 Bacteria 2582
430 Ga0105248_10197743 3300009177 Bacteria 2265
431 Ga0105248_11383059 3300009177 Bacteria 796
432 Ga0105237_10221355 3300009545 Bacteria 1893
433 Ga0105237_10808009 3300009545 Bacteria 945
434 Ga0105238_10007506 3300009551 Bacteria 10924
435 Ga0105238_10027467 3300009551 Bacteria 5801
436 Ga0105238_10110443 3300009551 Bacteria 2730
437 Ga0105238_10804650 3300009551 Bacteria 955
438 Ga0105249_10010129 3300009553 Bacteria 8276
439 Ga0105249_10057420 3300009553 Bacteria 3565
440 Ga0105249_10113737 3300009553 Bacteria 2562
441 Ga0105249_10125011 3300009553 Bacteria 2448
442 Ga0105249_10620646 3300009553 Bacteria 1137
443 Ga0105249_10688631 3300009553 Bacteria 1082
444 Ga0105249_11213566 3300009553 Unclassified 825
445 Ga0105239_10064925 3300010375 Bacteria 4008
446 Ga0105239_10065771 3300010375 Bacteria 3983
447 Ga0105246_10012160 3300011119 Bacteria 5365
448 Ga0105246_10018923 3300011119 Bacteria 4393
449 Ga0105246_10331883 3300011119 Bacteria 1240
450 Ga0105246_10872507 3300011119 Bacteria 805
451 Ga0157327_1007033 3300012512 Bacteria 968
452 Ga0157373_10005880 3300013100 Bacteria 9182
453 Ga0157373_10030292 3300013100 Bacteria 3893
454 Ga0157373_10045050 3300013100 Bacteria 3149
455 Ga0157373_10056222 3300013100 Bacteria 2795
456 Ga0157373_10087944 3300013100 Bacteria 2189
457 Ga0157373_10105914 3300013100 Bacteria 1977
458 Ga0157373_10150374 3300013100 Bacteria 1638
459 Ga0157373_10180066 3300013100 Bacteria 1488
460 Ga0157371_10002316 3300013102 Bacteria 18311
461 Ga0157371_10004954 3300013102 Bacteria 11440
462 Ga0157371_10012470 3300013102 Bacteria 6495
463 Ga0157371_10044544 3300013102 Bacteria 3159
464 Ga0157371_10055698 3300013102 Bacteria 2806
465 Ga0157371_10060794 3300013102 Bacteria 2678
466 Ga0157371_10108981 3300013102 Bacteria 1965
467 Ga0157371_10109966 3300013102 Bacteria 1956
468 Ga0157371_10133011 3300013102 Bacteria 1770
469 Ga0157371_10168325 3300013102 Bacteria 1565
470 Ga0157371_10235563 3300013102 Bacteria 1316
471 Ga0157371_10303940 3300013102 Bacteria 1155
472 Ga0157371_10377062 3300013102 Unclassified 1035
473 Ga0157371_10492618 3300013102 Unclassified 904
474 Ga0157371_10654476 3300013102 Bacteria 784
475 Ga0157370_10018643 3300013104 Bacteria 6977
476 Ga0157370_10029028 3300013104 Bacteria 5434
477 Ga0157370_10073474 3300013104 Bacteria 3226
478 Ga0157370_10178977 3300013104 Bacteria 1971
479 Ga0157370_10179402 3300013104 Bacteria 1968
480 Ga0157370_10225175 3300013104 Unclassified 1736
481 Ga0157370_10326321 3300013104 Bacteria 1415
482 Ga0157369_10000106 3300013105 Bacteria 117964
483 Ga0157369_10029017 3300013105 Bacteria 6118
484 Ga0157369_10038318 3300013105 Bacteria 5242
485 Ga0157369_10069955 3300013105 Bacteria 3770
486 Ga0157369_10099750 3300013105 Bacteria 3096
487 Ga0157369_10270884 3300013105 Bacteria 1769
488 Ga0157369_10874871 3300013105 Bacteria 922
489 Ga0157374_10028067 3300013296 Bacteria 5083
490 Ga0157374_10056936 3300013296 Bacteria 3651
491 Ga0157374_10165850 3300013296 Bacteria 2153
492 Ga0157374_10214224 3300013296 Bacteria 1889
493 Ga0157374_10454211 3300013296 Bacteria 1283
494 Ga0157374_10758737 3300013296 Bacteria 985
495 Ga0157378_10001258 3300013297 Bacteria 22842
496 Ga0157378_10018275 3300013297 Bacteria 6154
497 Ga0157378_10155837 3300013297 Unclassified 2132
498 Ga0157378_10712478 3300013297 Bacteria 1024
499 Ga0163162_10010468 3300013306 Bacteria 9017
500 Ga0163162_10037174 3300013306 Bacteria 4857
501 Ga0163162_10040346 3300013306 Bacteria 4668
502 Ga0163162_10091527 3300013306 Bacteria 3125
503 Ga0163162_10137034 3300013306 Bacteria 2559
504 Ga0163162_10217821 3300013306 Bacteria 2039
505 Ga0163162_10252327 3300013306 Bacteria 1896
506 Ga0163162_11473232 3300013306 Bacteria 775
507 Ga0157372_10031246 3300013307 Bacteria 5830
508 Ga0157372_10034037 3300013307 Bacteria 5598
509 Ga0157372_10076052 3300013307 Bacteria 3790
510 Ga0157372_10281734 3300013307 Bacteria 1932
511 Ga0157372_10376012 3300013307 Bacteria 1655
512 Ga0157372_10432473 3300013307 Bacteria 1534
513 Ga0157372_11426523 3300013307 Bacteria 798
514 Ga0157375_10004348 3300013308 Bacteria 12300
515 Ga0157375_10008191 3300013308 Bacteria 9153
516 Ga0157375_10024631 3300013308 Bacteria 5574
517 Ga0157375_10058033 3300013308 Bacteria 3828
518 Ga0157375_10157579 3300013308 Bacteria 2410
519 Ga0157375_10992026 3300013308 Unclassified 980
520 Ga0157375_11248494 3300013308 Bacteria 872
521 Ga0163163_10000273 3300014325 Bacteria 51622
522 Ga0163163_10014997 3300014325 Bacteria 7143
523 Ga0163163_10021539 3300014325 Bacteria 6086
524 Ga0163163_10091516 3300014325 Bacteria 3056
525 Ga0163163_10189906 3300014325 Bacteria 2103
526 Ga0163163_10291852 3300014325 Bacteria 1683
527 Ga0157380_10005051 3300014326 Bacteria 9205
528 Ga0157380_10032967 3300014326 Bacteria 3986
529 Ga0157380_10227157 3300014326 Bacteria 1674
530 Ga0157380_10588922 3300014326 Bacteria 1098
531 Ga0157377_10075394 3300014745 Bacteria 1959
532 Ga0157377_10393525 3300014745 Bacteria 942
533 Ga0157379_10004542 3300014968 Bacteria 11908
534 Ga0157379_10023074 3300014968 Bacteria 5517
535 Ga0157379_10600278 3300014968 Unclassified 1028
536 Ga0157376_10136551 3300014969 Bacteria 2195
537 Ga0163161_10000753 3300017792 Bacteria 25411
538 Ga0163161_10034360 3300017792 Bacteria 3627
539 Ga0197907_10065295 3300020069 Bacteria 875
540 Ga0197907_10556007 3300020069 Bacteria 2478
541 Ga0197907_10807907 3300020069 Bacteria 718
542 Ga0206356_11135239 3300020070 Bacteria 2059
543 Ga0206356_11744870 3300020070 Bacteria 2125
544 Ga0206349_1139987 3300020075 Bacteria 816
545 Ga0206352_10165450 3300020078 Bacteria 941
546 Ga0206350_11349959 3300020080 Bacteria 785
547 Ga0206354_10393434 3300020081 Bacteria 1345
548 Ga0206354_11575063 3300020081 Bacteria 1617
549 Ga0206354_11593635 3300020081 Bacteria 1641
550 Ga0206353_10370532 3300020082 Bacteria 2503
551 Ga0206353_11564124 3300020082 Bacteria 2042
552 Ga0224712_10029299 3300022467 Bacteria 1976
553 Ga0224712_10214034 3300022467 Unclassified 880
554 Ga0224712_10252045 3300022467 Bacteria 816
555 Ga0207666_1004870 3300025271 Bacteria 1697
556 Ga0207697_10000158 3300025315 Bacteria 33821
557 Ga0207697_10035271 3300025315 Bacteria 2047
558 Ga0207656_10034107 3300025321 Bacteria 2123
559 Ga0207656_10043245 3300025321 Bacteria 1920
560 Ga0207656_10050124 3300025321 Bacteria 1802
561 Ga0207656_10103505 3300025321 Unclassified 1308
562 Ga0207682_10001693 3300025893 Bacteria 10102
563 Ga0207682_10115601 3300025893 Bacteria 1185
564 Ga0207682_10196231 3300025893 Unclassified 927
565 Ga0207642_10032955 3300025899 Bacteria 2187
566 Ga0207642_10161518 3300025899 Bacteria 1203
567 Ga0207642_10165599 3300025899 Unclassified 1191
568 Ga0207688_10000317 3300025901 Bacteria 22230
569 Ga0207688_10003267 3300025901 Bacteria 8855
570 Ga0207688_10024903 3300025901 Bacteria 3283
571 Ga0207688_10101166 3300025901 Bacteria 1664
572 Ga0207688_10175805 3300025901 Bacteria 1275
573 Ga0207680_10000681 3300025903 Bacteria 16056
574 Ga0207680_10013048 3300025903 Bacteria 4253
575 Ga0207680_10023816 3300025903 Bacteria 3350
576 Ga0207680_10053319 3300025903 Bacteria 2427
577 Ga0207680_10079421 3300025903 Bacteria 2057
578 Ga0207680_10086033 3300025903 Bacteria 1987
579 Ga0207647_10000114 3300025904 Bacteria 62368
580 Ga0207647_10000253 3300025904 Bacteria 43758
581 Ga0207647_10004069 3300025904 Bacteria 10873
582 Ga0207647_10004979 3300025904 Bacteria 9793
583 Ga0207647_10043619 3300025904 Bacteria 2806
584 Ga0207647_10059394 3300025904 Bacteria 2340
585 Ga0207647_10121357 3300025904 Bacteria 1541
586 Ga0207647_10136214 3300025904 Bacteria 1441
587 Ga0207647_10158968 3300025904 Bacteria 1319
588 Ga0207647_10195915 3300025904 Bacteria 1170
589 Ga0207699_10220519 3300025906 Bacteria 1294
590 Ga0207645_10013547 3300025907 Bacteria 5491
591 Ga0207645_10026481 3300025907 Bacteria 3746
592 Ga0207645_10044423 3300025907 Bacteria 2843
593 Ga0207645_10087607 3300025907 Bacteria 2001
594 Ga0207645_10103225 3300025907 Bacteria 1840
595 Ga0207643_10036524 3300025908 Bacteria 2756
596 Ga0207643_10052521 3300025908 Bacteria 2315
597 Ga0207705_10000062 3300025909 Bacteria 149432
598 Ga0207705_10000581 3300025909 Bacteria 30651
599 Ga0207705_10000929 3300025909 Bacteria 23915
600 Ga0207705_10002326 3300025909 Bacteria 14701
601 Ga0207705_10006023 3300025909 Bacteria 9020
602 Ga0207705_10007756 3300025909 Bacteria 7886
603 Ga0207705_10011342 3300025909 Bacteria 6454
604 Ga0207705_10025698 3300025909 Bacteria 4201
605 Ga0207705_10028342 3300025909 Bacteria 3992
606 Ga0207705_10032292 3300025909 Bacteria 3740
607 Ga0207705_10035958 3300025909 Bacteria 3545
608 Ga0207705_10043066 3300025909 Bacteria 3242
609 Ga0207705_10047976 3300025909 Bacteria 3072
610 Ga0207705_10080321 3300025909 Bacteria 2376
611 Ga0207705_10092416 3300025909 Bacteria 2217
612 Ga0207705_10294006 3300025909 Bacteria 1245
613 Ga0207705_10294084 3300025909 Bacteria 1245
614 Ga0207654_10083371 3300025911 Bacteria 1930
615 Ga0207654_10510213 3300025911 Bacteria 850
616 Ga0207707_10025005 3300025912 Bacteria 5225
617 Ga0207707_10125330 3300025912 Bacteria 2246
618 Ga0207707_10169859 3300025912 Bacteria 1906
619 Ga0207707_10200505 3300025912 Bacteria 1740
620 Ga0207707_10295590 3300025912 Bacteria 1401
621 Ga0207707_10411432 3300025912 Bacteria 1160
622 Ga0207707_10476970 3300025912 Bacteria 1066
623 Ga0207707_10560269 3300025912 Bacteria 970
624 Ga0207695_10019571 3300025913 Bacteria 7789
625 Ga0207695_10033529 3300025913 Bacteria 5598
626 Ga0207695_10175732 3300025913 Bacteria 2064
627 Ga0207660_10000049 3300025917 Bacteria 59933
628 Ga0207660_10007093 3300025917 Bacteria 7258
629 Ga0207660_10012629 3300025917 Bacteria 5531
630 Ga0207660_10039636 3300025917 Bacteria 3294
631 Ga0207660_10044181 3300025917 Bacteria 3134
632 Ga0207660_10065299 3300025917 Bacteria 2629
633 Ga0207660_10071751 3300025917 Bacteria 2520
634 Ga0207660_10219912 3300025917 Bacteria 1490
635 Ga0207662_10207559 3300025918 Bacteria 1270
636 Ga0207657_10000403 3300025919 Bacteria 45863
637 Ga0207657_10000498 3300025919 Bacteria 41427
638 Ga0207657_10000806 3300025919 Bacteria 33100
639 Ga0207657_10002900 3300025919 Bacteria 18411
640 Ga0207657_10006708 3300025919 Bacteria 11895
641 Ga0207657_10010167 3300025919 Bacteria 9400
642 Ga0207657_10011406 3300025919 Bacteria 8823
643 Ga0207657_10011918 3300025919 Bacteria 8603
644 Ga0207657_10014704 3300025919 Bacteria 7622
645 Ga0207657_10015026 3300025919 Bacteria 7518
646 Ga0207657_10015606 3300025919 Bacteria 7349
647 Ga0207657_10023118 3300025919 Bacteria 5796
648 Ga0207657_10027580 3300025919 Bacteria 5200
649 Ga0207657_10045766 3300025919 Bacteria 3837
650 Ga0207657_10066225 3300025919 Bacteria 3076
651 Ga0207657_10068358 3300025919 Bacteria 3018
652 Ga0207657_10096580 3300025919 Bacteria 2458
653 Ga0207657_10133112 3300025919 Bacteria 2036
654 Ga0207657_10301125 3300025919 Bacteria 1270
655 Ga0207649_10000230 3300025920 Bacteria 45560
656 Ga0207649_10001080 3300025920 Bacteria 16599
657 Ga0207649_10007546 3300025920 Bacteria 5913
658 Ga0207649_10012784 3300025920 Bacteria 4669
659 Ga0207649_10018682 3300025920 Bacteria 3948
660 Ga0207649_10026507 3300025920 Bacteria 3391
661 Ga0207649_10041731 3300025920 Bacteria 2794
662 Ga0207649_10052647 3300025920 Bacteria 2526
663 Ga0207649_10088128 3300025920 Bacteria 2026
664 Ga0207649_10201938 3300025920 Bacteria 1405
665 Ga0207649_10226244 3300025920 Bacteria 1335
666 Ga0207649_10380604 3300025920 Bacteria 1052
667 Ga0207652_10030232 3300025921 Bacteria 4534
668 Ga0207652_10109275 3300025921 Bacteria 2451
669 Ga0207652_10127562 3300025921 Bacteria 2267
670 Ga0207652_10142814 3300025921 Bacteria 2141
671 Ga0207652_10153211 3300025921 Bacteria 2064
672 Ga0207652_10207673 3300025921 Bacteria 1763
673 Ga0207652_10483998 3300025921 Bacteria 1114
674 Ga0207652_10737061 3300025921 Bacteria 878
675 Ga0207681_10023027 3300025923 Bacteria 3978
676 Ga0207681_10042387 3300025923 Bacteria 3040
677 Ga0207681_10045552 3300025923 Bacteria 2946
678 Ga0207681_10179255 3300025923 Bacteria 1612
679 Ga0207681_10253601 3300025923 Bacteria 1375
680 Ga0207681_10306865 3300025923 Unclassified 1257
681 Ga0207681_10348384 3300025923 Bacteria 1185
682 Ga0207694_10028971 3300025924 Bacteria 4223
683 Ga0207694_10123584 3300025924 Bacteria 2068
684 Ga0207694_10347910 3300025924 Unclassified 1227
685 Ga0207694_10392577 3300025924 Bacteria 1153
686 Ga0207650_10003054 3300025925 Bacteria 11531
687 Ga0207650_10016419 3300025925 Bacteria 5174
688 Ga0207650_10018631 3300025925 Bacteria 4873
689 Ga0207650_10029822 3300025925 Bacteria 3924
690 Ga0207650_10128811 3300025925 Bacteria 1978
691 Ga0207650_10769213 3300025925 Bacteria 815
692 Ga0207650_10882224 3300025925 Bacteria 759
693 Ga0207659_10019935 3300025926 Bacteria 4424
694 Ga0207659_10028253 3300025926 Bacteria 3810
695 Ga0207659_10089226 3300025926 Bacteria 2299
696 Ga0207659_10127013 3300025926 Bacteria 1963
697 Ga0207687_10031400 3300025927 Bacteria 3589
698 Ga0207687_10051360 3300025927 Bacteria 2874
699 Ga0207700_10013879 3300025928 Bacteria 5261
700 Ga0207664_10024314 3300025929 Bacteria 4552
701 Ga0207664_10139618 3300025929 Bacteria 2048
702 Ga0207664_10318659 3300025929 Bacteria 1372
703 Ga0207664_10501139 3300025929 Bacteria 1087
704 Ga0207644_10000695 3300025931 Bacteria 21288
705 Ga0207644_10001502 3300025931 Bacteria 15032
706 Ga0207644_10005273 3300025931 Bacteria 8437
707 Ga0207644_10007766 3300025931 Bacteria 7003
708 Ga0207644_10018366 3300025931 Bacteria 4730
709 Ga0207644_10020310 3300025931 Bacteria 4516
710 Ga0207644_10022968 3300025931 Bacteria 4266
711 Ga0207644_10030225 3300025931 Bacteria 3765
712 Ga0207644_10032584 3300025931 Bacteria 3636
713 Ga0207644_10039516 3300025931 Bacteria 3331
714 Ga0207644_10098869 3300025931 Bacteria 2188
715 Ga0207644_10143266 3300025931 Bacteria 1842
716 Ga0207644_10207003 3300025931 Bacteria 1549
717 Ga0207644_10253225 3300025931 Bacteria 1405
718 Ga0207690_10000155 3300025932 Bacteria 53735
719 Ga0207690_10004169 3300025932 Bacteria 8537
720 Ga0207690_10012502 3300025932 Bacteria 5079
721 Ga0207690_10017213 3300025932 Bacteria 4410
722 Ga0207690_10030846 3300025932 Bacteria 3424
723 Ga0207690_10031693 3300025932 Bacteria 3385
724 Ga0207690_10049606 3300025932 Bacteria 2799
725 Ga0207690_10057356 3300025932 Bacteria 2631
726 Ga0207690_10064121 3300025932 Bacteria 2507
727 Ga0207690_10116843 3300025932 Bacteria 1930
728 Ga0207690_10249578 3300025932 Bacteria 1370
729 Ga0207690_10274004 3300025932 Bacteria 1312
730 Ga0207690_10289868 3300025932 Bacteria 1277
731 Ga0207690_10478772 3300025932 Bacteria 1004
732 Ga0207706_10000342 3300025933 Bacteria 50517
733 Ga0207706_10000431 3300025933 Bacteria 44951
734 Ga0207706_10000434 3300025933 Bacteria 44818
735 Ga0207706_10000643 3300025933 Bacteria 37034
736 Ga0207706_10001263 3300025933 Bacteria 25500
737 Ga0207706_10001330 3300025933 Bacteria 24746
738 Ga0207706_10007033 3300025933 Bacteria 10403
739 Ga0207706_10007778 3300025933 Bacteria 9895
740 Ga0207706_10032063 3300025933 Bacteria 4680
741 Ga0207706_10035989 3300025933 Bacteria 4399
742 Ga0207706_10094715 3300025933 Bacteria 2627
743 Ga0207706_10121521 3300025933 Bacteria 2297
744 Ga0207706_10187567 3300025933 Bacteria 1815
745 Ga0207706_10219339 3300025933 Bacteria 1665
746 Ga0207706_10257765 3300025933 Bacteria 1523
747 Ga0207706_10280777 3300025933 Bacteria 1452
748 Ga0207706_10405191 3300025933 Bacteria 1182
749 Ga0207709_10074709 3300025935 Bacteria 2164
750 Ga0207670_10197849 3300025936 Bacteria 1525
751 Ga0207670_10437740 3300025936 Bacteria 1052
752 Ga0207669_10004765 3300025937 Bacteria 6012
753 Ga0207669_10013845 3300025937 Bacteria 4024
754 Ga0207669_10052517 3300025937 Bacteria 2449
755 Ga0207669_10054465 3300025937 Bacteria 2416
756 Ga0207704_10098044 3300025938 Bacteria 1946
757 Ga0207704_10274938 3300025938 Bacteria 1277
758 Ga0207704_10603465 3300025938 Bacteria 899
759 Ga0207665_10158241 3300025939 Bacteria 1627
760 Ga0207691_10000848 3300025940 Bacteria 30357
761 Ga0207691_10000852 3300025940 Bacteria 30260
762 Ga0207691_10001147 3300025940 Bacteria 26294
763 Ga0207691_10052542 3300025940 Bacteria 3721
764 Ga0207691_10068766 3300025940 Bacteria 3200
765 Ga0207691_10078368 3300025940 Bacteria 2975
766 Ga0207691_10093178 3300025940 Bacteria 2698
767 Ga0207691_10107428 3300025940 Bacteria 2484
768 Ga0207691_10192049 3300025940 Bacteria 1780
769 Ga0207691_10241007 3300025940 Bacteria 1563
770 Ga0207691_10251487 3300025940 Bacteria 1526
771 Ga0207711_10003628 3300025941 Bacteria 13348
772 Ga0207711_10003910 3300025941 Bacteria 12816
773 Ga0207711_10003912 3300025941 Bacteria 12815
774 Ga0207711_10004265 3300025941 Bacteria 12216
775 Ga0207711_10017606 3300025941 Bacteria 5935
776 Ga0207711_10018660 3300025941 Bacteria 5767
777 Ga0207711_10022793 3300025941 Bacteria 5239
778 Ga0207711_10037257 3300025941 Bacteria 4130
779 Ga0207711_10071281 3300025941 Bacteria 3015
780 Ga0207711_10210499 3300025941 Bacteria 1776
781 Ga0207689_10000017 3300025942 Bacteria 117159
782 Ga0207689_10010558 3300025942 Bacteria 7951
783 Ga0207689_10044482 3300025942 Bacteria 3671
784 Ga0207689_10056409 3300025942 Bacteria 3233
785 Ga0207689_10376750 3300025942 Bacteria 1181
786 Ga0207661_10000947 3300025944 Bacteria 19105
787 Ga0207661_10050831 3300025944 Bacteria 3305
788 Ga0207661_10178503 3300025944 Bacteria 1853
789 Ga0207661_10482517 3300025944 Bacteria 1132
790 Ga0207679_10000213 3300025945 Bacteria 45916
791 Ga0207679_10010265 3300025945 Bacteria 6025
792 Ga0207679_10046450 3300025945 Bacteria 3148
793 Ga0207679_10188575 3300025945 Bacteria 1712
794 Ga0207679_10242979 3300025945 Bacteria 1526
795 Ga0207679_10280250 3300025945 Bacteria 1429
796 Ga0207679_10299416 3300025945 Bacteria 1386
797 Ga0207679_10334082 3300025945 Bacteria 1316
798 Ga0207679_10510874 3300025945 Bacteria 1073
799 Ga0207667_10001300 3300025949 Bacteria 31316
800 Ga0207667_10019052 3300025949 Bacteria 7671
801 Ga0207667_10027212 3300025949 Bacteria 6230
802 Ga0207667_10064080 3300025949 Bacteria 3838
803 Ga0207667_10100369 3300025949 Bacteria 2985
804 Ga0207667_10144280 3300025949 Bacteria 2451
805 Ga0207667_10192850 3300025949 Bacteria 2090
806 Ga0207667_10349064 3300025949 Bacteria 1509
807 Ga0207667_10758583 3300025949 Bacteria 969
808 Ga0207667_10767041 3300025949 Bacteria 963
809 Ga0207667_10776975 3300025949 Bacteria 956
810 Ga0207651_10006199 3300025960 Bacteria 6227
811 Ga0207651_10029218 3300025960 Bacteria 3490
812 Ga0207651_10029871 3300025960 Bacteria 3461
813 Ga0207651_10037678 3300025960 Bacteria 3170
814 Ga0207651_10090774 3300025960 Bacteria 2234
815 Ga0207651_10280180 3300025960 Bacteria 1377
816 Ga0207651_10439344 3300025960 Bacteria 1117
817 Ga0207651_10732149 3300025960 Bacteria 873
818 Ga0207651_11014212 3300025960 Bacteria 742
819 Ga0207712_10000513 3300025961 Bacteria 32083
820 Ga0207712_10006581 3300025961 Bacteria 7332
821 Ga0207712_10008327 3300025961 Bacteria 6555
822 Ga0207668_10000223 3300025972 Bacteria 38523
823 Ga0207668_10002049 3300025972 Bacteria 11759
824 Ga0207668_10013108 3300025972 Bacteria 5096
825 Ga0207668_10064739 3300025972 Bacteria 2585
826 Ga0207668_10122248 3300025972 Bacteria 1973
827 Ga0207668_10123024 3300025972 Bacteria 1968
828 Ga0207668_10139158 3300025972 Bacteria 1864
829 Ga0207668_10173511 3300025972 Bacteria 1693
830 Ga0207640_10002788 3300025981 Bacteria 9372
831 Ga0207640_10007575 3300025981 Bacteria 5997
832 Ga0207640_10010153 3300025981 Bacteria 5294
833 Ga0207640_10040461 3300025981 Bacteria 2957
834 Ga0207640_10089040 3300025981 Bacteria 2132
835 Ga0207640_10221250 3300025981 Unclassified 1450
836 Ga0207640_10459423 3300025981 Unclassified 1051
837 Ga0207658_10007346 3300025986 Bacteria 7510
838 Ga0207658_10008048 3300025986 Bacteria 7182
839 Ga0207658_10035614 3300025986 Bacteria 3566
840 Ga0207658_10079146 3300025986 Bacteria 2513
841 Ga0207658_10087172 3300025986 Bacteria 2410
842 Ga0207658_10114857 3300025986 Bacteria 2135
843 Ga0207658_10351519 3300025986 Unclassified 1283
844 Ga0207677_10160288 3300026023 Unclassified 1747
845 Ga0207703_10006402 3300026035 Bacteria 9411
846 Ga0207703_10007329 3300026035 Bacteria 8769
847 Ga0207703_10026010 3300026035 Bacteria 4606
848 Ga0207703_10082973 3300026035 Bacteria 2676
849 Ga0207703_10189826 3300026035 Bacteria 1819
850 Ga0207703_10298844 3300026035 Bacteria 1468
851 Ga0207703_10855857 3300026035 Unclassified 870
852 Ga0207639_10000347 3300026041 Bacteria 32007
853 Ga0207639_10040564 3300026041 Bacteria 3475
854 Ga0207639_10055955 3300026041 Bacteria 3021
855 Ga0207639_10142526 3300026041 Bacteria 1998
856 Ga0207639_10220133 3300026041 Bacteria 1639
857 Ga0207639_10260975 3300026041 Bacteria 1515
858 Ga0207639_10355032 3300026041 Unclassified 1310
859 Ga0207678_10001692 3300026067 Bacteria 20210
860 Ga0207678_10004182 3300026067 Bacteria 12952
861 Ga0207678_10005277 3300026067 Bacteria 11572
862 Ga0207678_10009190 3300026067 Bacteria 8701
863 Ga0207678_10013156 3300026067 Bacteria 7260
864 Ga0207678_10015700 3300026067 Bacteria 6655
865 Ga0207678_10017742 3300026067 Bacteria 6250
866 Ga0207678_10029181 3300026067 Bacteria 4815
867 Ga0207678_10035314 3300026067 Bacteria 4353
868 Ga0207678_10049787 3300026067 Bacteria 3620
869 Ga0207678_10051881 3300026067 Bacteria 3540
870 Ga0207678_10083355 3300026067 Bacteria 2735
871 Ga0207678_10131299 3300026067 Bacteria 2137
872 Ga0207678_10149656 3300026067 Bacteria 1993
873 Ga0207678_10355183 3300026067 Bacteria 1264
874 Ga0207678_10452723 3300026067 Bacteria 1116
875 Ga0207678_10508532 3300026067 Bacteria 1050
876 Ga0207678_10517798 3300026067 Bacteria 1041
877 Ga0207708_10287215 3300026075 Bacteria 1334
878 Ga0207702_10000496 3300026078 Bacteria 44248
879 Ga0207702_10015606 3300026078 Bacteria 6287
880 Ga0207702_10022763 3300026078 Bacteria 5198
881 Ga0207702_10034421 3300026078 Bacteria 4234
882 Ga0207702_10039218 3300026078 Bacteria 3968
883 Ga0207702_10097596 3300026078 Bacteria 2586
884 Ga0207641_10005331 3300026088 Bacteria 10984
885 Ga0207641_10016993 3300026088 Bacteria 5956
886 Ga0207641_10019912 3300026088 Bacteria 5508
887 Ga0207641_10021361 3300026088 Bacteria 5320
888 Ga0207641_10055221 3300026088 Bacteria 3372
889 Ga0207641_10205783 3300026088 Bacteria 1817
890 Ga0207641_10341796 3300026088 Bacteria 1424
891 Ga0207648_10001216 3300026089 Bacteria 28854
892 Ga0207648_10004524 3300026089 Bacteria 14251
893 Ga0207648_10006444 3300026089 Bacteria 11662
894 Ga0207648_10008416 3300026089 Bacteria 9993
895 Ga0207648_10023466 3300026089 Bacteria 5525
896 Ga0207648_10106101 3300026089 Bacteria 2465
897 Ga0207648_10214526 3300026089 Bacteria 1709
898 Ga0207676_10003642 3300026095 Bacteria 10901
899 Ga0207676_10005936 3300026095 Bacteria 8618
900 Ga0207676_10012995 3300026095 Bacteria 5978
901 Ga0207676_10047469 3300026095 Bacteria 3328
902 Ga0207676_10059590 3300026095 Bacteria 3015
903 Ga0207676_10075224 3300026095 Bacteria 2723
904 Ga0207676_10115161 3300026095 Bacteria 2257
905 Ga0207674_10000527 3300026116 Bacteria 50282
906 Ga0207674_10000580 3300026116 Bacteria 48154
907 Ga0207674_10007596 3300026116 Bacteria 12631
908 Ga0207674_10010532 3300026116 Bacteria 10467
909 Ga0207674_10016368 3300026116 Bacteria 8120
910 Ga0207674_10016922 3300026116 Bacteria 7964
911 Ga0207674_10067314 3300026116 Bacteria 3606
912 Ga0207674_10105082 3300026116 Bacteria 2802
913 Ga0207675_100063451 3300026118 Bacteria 3451
914 Ga0207675_100444648 3300026118 Bacteria 1284
915 Ga0207683_10005055 3300026121 Bacteria 11320
916 Ga0207683_10006197 3300026121 Bacteria 10251
917 Ga0207683_10012424 3300026121 Bacteria 7266
918 Ga0207683_10069188 3300026121 Bacteria 3117
919 Ga0207683_10092191 3300026121 Bacteria 2700
920 Ga0207683_10562702 3300026121 Unclassified 1054
921 Ga0207683_10646681 3300026121 Bacteria 979
922 Ga0207698_10000815 3300026142 Bacteria 18122
923 Ga0207698_10003377 3300026142 Bacteria 9614
924 Ga0207698_10016447 3300026142 Bacteria 4986
925 Ga0207698_10020485 3300026142 Bacteria 4554
926 Ga0207698_10039129 3300026142 Bacteria 3510
927 Ga0207698_10087066 3300026142 Bacteria 2543
928 Ga0207698_10112095 3300026142 Bacteria 2289
929 Ga0207698_10140213 3300026142 Bacteria 2081
930 Ga0207698_10213194 3300026142 Bacteria 1739
931 Ga0207698_10232548 3300026142 Bacteria 1674
932 Ga0207698_10279554 3300026142 Bacteria 1543
933 Ga0207698_10303254 3300026142 Bacteria 1488
934 Ga0207698_10322890 3300026142 Bacteria 1447
935 Ga0207698_10370918 3300026142 Unclassified 1358
936 Ga0207698_10446117 3300026142 Bacteria 1248
937 Ga0207698_10589565 3300026142 Bacteria 1094
938 Ga0209970_1011815 3300027614 Bacteria 1440
939 Ga0209983_1025887 3300027665 Bacteria 1239
940 Ga0209974_10001467 3300027876 Bacteria 8555
941 Ga0209974_10014750 3300027876 Bacteria 2596
942 Ga0209974_10108801 3300027876 Bacteria 974
943 Ga0268266_10005814 3300028379 Bacteria 11417
944 Ga0268266_10009325 3300028379 Bacteria 8653
945 Ga0268266_10017076 3300028379 Bacteria 6197
946 Ga0268266_10034214 3300028379 Bacteria 4321
947 Ga0268266_10035777 3300028379 Bacteria 4223
948 Ga0268266_10156875 3300028379 Bacteria 2056
949 Ga0268266_10548325 3300028379 Bacteria 1108
950 Ga0268266_10965747 3300028379 Bacteria 824
951 Ga0268265_10001836 3300028380 Bacteria 16950
952 Ga0268265_10004795 3300028380 Bacteria 9321
953 Ga0268265_10008727 3300028380 Bacteria 6853
954 Ga0268265_10015327 3300028380 Bacteria 5243
955 Ga0268265_10362541 3300028380 Unclassified 1327
956 Ga0268264_10001553 3300028381 Bacteria 21268
957 Ga0268264_10008809 3300028381 Bacteria 8368
958 Ga0268264_10024352 3300028381 Bacteria 4942
959 Ga0268264_10126648 3300028381 Bacteria 2258
960 Ga0268264_11015421 3300028381 Unclassified 836
961 Ga0268264_11330835 3300028381 Bacteria 729
962 Ga0316177_1039112 3300030731 Bacteria 2042
963 Ga0316176_1128831 3300030732 Bacteria 933
964 Ga0307408_100018322 3300031548 Bacteria 4697
965 Ga0307408_100031512 3300031548 Bacteria 3692
966 Ga0307408_100094101 3300031548 Bacteria 2268
967 Ga0307408_100847936 3300031548 Bacteria 833
968 Ga0307405_10048768 3300031731 Bacteria 2613
969 Ga0307405_10058162 3300031731 Bacteria 2432
970 Ga0307405_10649450 3300031731 Bacteria 867
971 Ga0307413_10029266 3300031824 Bacteria 3079
972 Ga0307413_10260688 3300031824 Bacteria 1292
973 Ga0307413_10282229 3300031824 Bacteria 1250
974 Ga0307413_10602566 3300031824 Bacteria 899
975 Ga0307413_10701810 3300031824 Unclassified 840
976 Ga0307410_10003596 3300031852 Bacteria 7809
977 Ga0307410_10023293 3300031852 Bacteria 3846
978 Ga0307410_10082460 3300031852 Bacteria 2262
979 Ga0307410_10154174 3300031852 Bacteria 1713
980 Ga0307410_10182954 3300031852 Bacteria 1588
981 Ga0307410_10233858 3300031852 Bacteria 1420
982 Ga0326468_10016295 3300031889 Unclassified 833
983 Ga0307406_10009726 3300031901 Bacteria 5405
984 Ga0307406_10067049 3300031901 Bacteria 2338
985 Ga0307406_10407775 3300031901 Unclassified 1079
986 Ga0307407_10017566 3300031903 Bacteria 3594
987 Ga0307407_10031384 3300031903 Bacteria 2877
988 Ga0307407_10078677 3300031903 Bacteria 1987
989 Ga0307412_10033368 3300031911 Bacteria 3271
990 Ga0307412_10117389 3300031911 Bacteria 1910
991 Ga0307412_10126569 3300031911 Bacteria 1849
992 Ga0307412_10801371 3300031911 Bacteria 818
993 Ga0307409_100012250 3300031995 Bacteria 5455
994 Ga0307409_100068300 3300031995 Bacteria 2810
995 Ga0307409_100152901 3300031995 Bacteria 2006
996 Ga0307409_101109740 3300031995 Bacteria 812
997 Ga0307416_100035408 3300032002 Bacteria 3812
998 Ga0307416_100047905 3300032002 Bacteria 3387
999 Ga0307416_100053529 3300032002 Bacteria 3238
1000 Ga0307416_100069269 3300032002 Bacteria 2919
1001 Ga0307416_100110262 3300032002 Bacteria 2423
1002 Ga0307416_100206447 3300032002 Bacteria 1869
1003 Ga0307416_101549103 3300032002 Bacteria 768
1004 Ga0307414_10055431 3300032004 Bacteria 2775
1005 Ga0307414_10112593 3300032004 Bacteria 2075
1006 Ga0307414_10829859 3300032004 Bacteria 844
1007 Ga0307411_10003538 3300032005 Bacteria 7271
1008 Ga0307411_10013644 3300032005 Bacteria 4492
1009 Ga0307411_10030485 3300032005 Bacteria 3306
1010 Ga0307411_10039289 3300032005 Bacteria 2992
1011 Ga0307411_10059642 3300032005 Bacteria 2530
1012 Ga0307411_10115067 3300032005 Bacteria 1934
1013 Ga0307415_100075489 3300032126 Bacteria 2385
1014 Ga0307415_100461100 3300032126 Bacteria 1101
1015 Ga0307415_100469231 3300032126 Bacteria 1093
1016 Ga0307415_100522340 3300032126 Bacteria 1042
1017 Ga0373930_0004606 3300034816 Bacteria 2254
1018 Ga0373940_0128637 3300035088 Bacteria 792
1019 Ga0373941_0013503 3300035115 Bacteria 2161
1020 Ga0373960_0192074 3300035121 Bacteria 718
1021 Ga0373943_0029338 3300035170 Bacteria 2599
1022 Ga0373931_0016681 3300035691 Bacteria 3619
1023 Ga0373937_0652098 3300036401 Bacteria 998
1024 Ga0395899_0000287 3300037312 Bacteria 64885
1025 Ga0395899_0008985 3300037312 Bacteria 7685
1026 Ga0395899_0035442 3300037312 Bacteria 3745
1027 Ga0395899_0035725 3300037312 Bacteria 3729
1028 Ga0395899_0040918 3300037312 Bacteria 3465
1029 Ga0395899_0043352 3300037312 Bacteria 3356
1030 Ga0395899_0147509 3300037312 Bacteria 1669
1031 Ga0395899_0192425 3300037312 Bacteria 1427
1032 Ga0395899_0226796 3300037312 Bacteria 1292
1033 Ga0395899_0293124 3300037312 Bacteria 1103
1034 Ga0395900_0000031 3300037418 Bacteria 262393
1035 Ga0395900_0018521 3300037418 Bacteria 7102
1036 Ga0395900_0026764 3300037418 Bacteria 5903
1037 Ga0395900_0028257 3300037418 Bacteria 5745
1038 Ga0395900_0062933 3300037418 Bacteria 3813
1039 Ga0395900_0072862 3300037418 Bacteria 3530
1040 Ga0395900_0073075 3300037418 Bacteria 3525
1041 Ga0395900_0077309 3300037418 Bacteria 3419
1042 Ga0395900_0124775 3300037418 Bacteria 2640
1043 Ga0395900_0141515 3300037418 Bacteria 2463
1044 Ga0395900_0173206 3300037418 Bacteria 2196
1045 Ga0395900_0223154 3300037418 Bacteria 1898
1046 Ga0395900_0241658 3300037418 Bacteria 1811
1047 Ga0395900_0294452 3300037418 Bacteria 1611
1048 Ga0395900_0477759 3300037418 Bacteria 1199
1049 Ga0395900_0548919 3300037418 Bacteria 1100
1050 Ga0395900_0666020 3300037418 Bacteria 976
1051 Ga0395898_0012486 3300037466 Bacteria 8782
1052 Ga0395898_0038179 3300037466 Bacteria 4762
1053 Ga0395898_0053101 3300037466 Bacteria 3958
1054 Ga0395898_0091613 3300037466 Bacteria 2924
1055 Ga0395898_0092766 3300037466 Bacteria 2903
1056 Ga0395898_0106466 3300037466 Bacteria 2689
1057 Ga0395898_0159585 3300037466 Bacteria 2157
1058 Ga0395898_0170197 3300037466 Bacteria 2082
1059 Ga0395898_0371377 3300037466 Bacteria 1364
1060 Ga0395898_0384024 3300037466 Bacteria 1339
1061 Ga0395898_0414156 3300037466 Unclassified 1284
1062 Ga0395905_0015453 3300037471 Bacteria 7258
1063 Ga0395905_0031688 3300037471 Bacteria 4974
1064 Ga0395905_0070915 3300037471 Bacteria 3266
1065 Ga0395905_0093597 3300037471 Bacteria 2818
1066 Ga0395905_0102081 3300037471 Bacteria 2692
1067 Ga0395905_0106153 3300037471 Bacteria 2637
1068 Ga0395905_0143060 3300037471 Bacteria 2250
1069 Ga0395905_0184509 3300037471 Bacteria 1958
1070 Ga0395905_0241052 3300037471 Bacteria 1689
1071 Ga0395905_0279803 3300037471 Bacteria 1554
1072 Ga0395905_0336580 3300037471 Bacteria 1400
1073 Ga0395905_0397333 3300037471 Bacteria 1273
1074 Ga0395905_0413885 3300037471 Bacteria 1243
1075 Ga0395905_0447872 3300037471 Bacteria 1189
1076 Ga0395905_0855323 3300037471 Bacteria 812
1077 Ga0436364_0996148 3300037853 Bacteria 15568
1078 Ga0395901_0000035 3300038443 Bacteria 223888
1079 Ga0395901_0000329 3300038443 Bacteria 58460
1080 Ga0395901_0016246 3300038443 Bacteria 7582
1081 Ga0395901_0029354 3300038443 Bacteria 5662
1082 Ga0395901_0031929 3300038443 Bacteria 5431
1083 Ga0395901_0075005 3300038443 Bacteria 3528
1084 Ga0395901_0082710 3300038443 Bacteria 3354
1085 Ga0395901_0206673 3300038443 Bacteria 2056
1086 Ga0395901_0218346 3300038443 Bacteria 1993
1087 Ga0395901_0294139 3300038443 Bacteria 1684
1088 Ga0395901_0312899 3300038443 Bacteria 1626
1089 Ga0395901_0327327 3300038443 Bacteria 1585
1090 Ga0395901_0502782 3300038443 Bacteria 1234
1091 Ga0395901_0530103 3300038443 Bacteria 1195
1092 Ga0395901_1100180 3300038443 Bacteria 765
1093 Ga0436365_0802722 3300039437 Bacteria 9190
1094 Ga0436363_0623631 3300039450 Bacteria 1511
1095 Ga0439465_0025016 3300041413 Bacteria 1883
1096 Ga0451853_2006474 3300041512 Bacteria 1660
1097 Ga0466969_0005933 3300044656 Bacteria 6498
1098 Ga0466972_0032697 3300044658 Bacteria 2554
1099 Ga0466965_0240409 3300044683 Bacteria 969
1100 Ga0466966_0154511 3300044684 Bacteria 1398
1101 Ga0466966_0311850 3300044684 Unclassified 945
1102 Ga0466961_0010870 3300044693 Bacteria 5814
1103 Ga0466961_0085448 3300044693 Bacteria 1995
1104 Ga0466961_0086810 3300044693 Bacteria 1977
1105 Ga0466963_0000335 3300044694 Bacteria 21343
1106 Ga0466963_0023968 3300044694 Bacteria 3881
1107 Ga0466963_0129481 3300044694 Bacteria 1742
1108 Ga0466963_0147729 3300044694 Bacteria 1632
1109 Ga0466963_0172047 3300044694 Bacteria 1510
1110 Ga0466964_0002041 3300044706 Bacteria 7103
1111 Ga0466964_0038247 3300044706 Bacteria 1929
1112 Ga0466971_0009145 3300044719 Bacteria 4332
1113 Ga0466971_0071698 3300044719 Bacteria 1573
1114 Ga0466971_0096227 3300044719 Bacteria 1358
1115 Ga0466971_0232631 3300044719 Bacteria 875
1116 Ga0466968_0004014 3300044735 Bacteria 5469
1117 Ga0466970_0009178 3300044765 Bacteria 4988
1118 Ga0466970_0080447 3300044765 Unclassified 1761
1119 Ga0466957_0001921 3300044842 Bacteria 11036
1120 Ga0466957_0004078 3300044842 Bacteria 8088
1121 Ga0466957_0011549 3300044842 Bacteria 5101
1122 Ga0466960_0064988 3300044901 Bacteria 1801
1123 Ga0466960_0098653 3300044901 Bacteria 1501
1124 Ga0466959_0052885 3300045049 Bacteria 2972
1125 Ga0466959_0094238 3300045049 Bacteria 2148
1126 Ga0466959_0109871 3300045049 Bacteria 1968
1127 Ga0466958_0020199 3300045836 Bacteria 3883
1128 Ga0466958_0023425 3300045836 Bacteria 3625
1129 Ga0466958_0087472 3300045836 Bacteria 1924
1130 Ga0466958_0114006 3300045836 Bacteria 1688
1131 Ga0466967_0007335 3300045976 Bacteria 7942
1132 Ga0466967_0008133 3300045976 Bacteria 7655
1133 Ga0466967_0022827 3300045976 Bacteria 5115
1134 Ga0466967_0073433 3300045976 Bacteria 3069
1135 Ga0466967_0085729 3300045976 Bacteria 2852
1136 Ga0466967_0255826 3300045976 Bacteria 1674
1137 Ga0466967_0370348 3300045976 Bacteria 1389
1138 Ga0466967_0535904 3300045976 Bacteria 1151
1139 Ga0466967_0698523 3300045976 Unclassified 1004
1140 Ga0495583_0031762 3300046506 Bacteria 2556
1141 Ga0495663_0005944 3300046525 Bacteria 3377
1142 Ga0495663_0049462 3300046525 Bacteria 1298
1143 Ga0495663_0071778 3300046525 Bacteria 1103
1144 Ga0495621_0000350 3300046539 Bacteria 11260
1145 Ga0495621_0005701 3300046539 Bacteria 3597
1146 Ga0495621_0023456 3300046539 Bacteria 2052
1147 Ga0495633_0051209 3300046558 Bacteria 1946
1148 Ga0495668_0006182 3300046616 Bacteria 7917
1149 Ga0495668_0017226 3300046616 Bacteria 4193
1150 Ga0495625_0159120 3300046660 Bacteria 1514
1151 Ga0495669_0003756 3300046684 Bacteria 6240
1152 Ga0495669_0015222 3300046684 Bacteria 3293
1153 Ga0495669_0028157 3300046684 Bacteria 2459
1154 Ga0495669_0032311 3300046684 Bacteria 2300
1155 Ga0495669_0035478 3300046684 Bacteria 2202
1156 Ga0495669_0061458 3300046684 Bacteria 1700
1157 Ga0495669_0063285 3300046684 Bacteria 1678
1158 Ga0495669_0108022 3300046684 Bacteria 1297
1159 Ga0495669_0223333 3300046684 Bacteria 903
1160 Ga0495670_0010361 3300046691 Bacteria 4580
1161 Ga0495670_0012515 3300046691 Bacteria 4175
1162 Ga0495670_0014986 3300046691 Bacteria 3815
1163 Ga0495670_0149087 3300046691 Bacteria 1226
1164 Ga0495677_0014367 3300047445 Bacteria 2884
1165 Ga0495677_0024518 3300047445 Bacteria 2188
1166 Ga0495677_0113937 3300047445 Unclassified 1029
1167 Ga0496100_0058657 3300048903 Bacteria 2527
1168 Ga0496100_0727909 3300048903 Bacteria 775
1169 Ga0496101_0032469 3300048904 Bacteria 3675
1170 Ga0496101_0152479 3300048904 Bacteria 1768
1171 Ga0496101_0195652 3300048904 Bacteria 1562
1172 Ga0496102_0006009 3300048905 Bacteria 10337
1173 Ga0496102_0138834 3300048905 Bacteria 2278
1174 Ga0496103_0034087 3300048906 Bacteria 3113
1175 Ga0496103_0173675 3300048906 Bacteria 1384
1176 Ga0496103_0311389 3300048906 Bacteria 1013
1177 Ga0496104_0535000 3300048907 Bacteria 1083
1178 Ga0496106_0005020 3300048909 Bacteria 9790
1179 Ga0496106_0021199 3300048909 Bacteria 4824
1180 Ga0496106_0046809 3300048909 Bacteria 3253
1181 Ga0496106_0272352 3300048909 Bacteria 1356
1182 Ga0496106_0815681 3300048909 Bacteria 740
1183 Ga0496107_0002436 3300048910 Bacteria 12049
1184 Ga0496107_0005092 3300048910 Bacteria 8960
1185 Ga0496107_0006978 3300048910 Bacteria 7784
1186 Ga0496107_0008596 3300048910 Bacteria 7069
1187 Ga0496107_0038529 3300048910 Bacteria 3429
1188 Ga0496107_0059320 3300048910 Bacteria 2769
1189 Ga0496107_0126842 3300048910 Bacteria 1882
1190 Ga0496108_0004564 3300048911 Bacteria 11158
1191 Ga0496108_0006742 3300048911 Bacteria 9299
1192 Ga0496108_0008862 3300048911 Bacteria 8153
1193 Ga0496108_0011381 3300048911 Bacteria 7231
1194 Ga0496108_0028075 3300048911 Bacteria 4655
1195 Ga0496108_0503053 3300048911 Bacteria 1058
1196 Ga0496109_0019963 3300048912 Bacteria 5916
1197 Ga0496109_0020941 3300048912 Bacteria 5780
1198 Ga0496109_0057642 3300048912 Bacteria 3546
1199 Ga0496109_0067752 3300048912 Bacteria 3270
1200 Ga0496109_0222384 3300048912 Bacteria 1775
1201 Ga0496110_0007127 3300048913 Bacteria 8900
1202 Ga0496110_0009337 3300048913 Bacteria 7935
1203 Ga0496110_0010516 3300048913 Bacteria 7533
1204 Ga0496110_0030024 3300048913 Bacteria 4684
1205 Ga0496110_0054535 3300048913 Bacteria 3516
1206 Ga0496110_0462841 3300048913 Bacteria 1156
1207 Ga0496111_0003961 3300048914 Bacteria 9289
1208 Ga0496111_0021015 3300048914 Bacteria 4551
1209 Ga0496111_0040567 3300048914 Bacteria 3339
1210 Ga0496111_0053188 3300048914 Bacteria 2925
1211 Ga0496111_0057825 3300048914 Bacteria 2807
1212 Ga0496111_0142280 3300048914 Bacteria 1778
1213 Ga0496111_0149025 3300048914 Bacteria 1735
1214 Ga0496112_0010358 3300048915 Bacteria 8454
1215 Ga0496112_0013820 3300048915 Bacteria 7468
1216 Ga0496112_0105724 3300048915 Bacteria 2784
1217 Ga0496112_0165145 3300048915 Bacteria 2180
1218 Ga0496113_0010547 3300048916 Bacteria 6112
1219 Ga0496113_0011833 3300048916 Bacteria 5845
1220 Ga0496113_0134697 3300048916 Bacteria 1940
1221 Ga0496113_0180938 3300048916 Bacteria 1671
1222 Ga0496114_0000131 3300048917 Bacteria 54315
1223 Ga0496114_0005747 3300048917 Bacteria 9734
1224 Ga0496115_0019427 3300048918 Bacteria 5229
1225 Ga0501310_028560 3300049130 Bacteria 732
1226 Ga0501068_0212442 3300049584 Bacteria 1229
1227 Ga0501071_0506914 3300049587 Bacteria 926
1228 Ga0501217_078702 3300049661 Bacteria 909
1229 Ga0501223_025580 3300049663 Bacteria 1149
1230 Ga0501235_018932 3300049669 Bacteria 1527
1231 Ga0501258_000814 3300049687 Bacteria 2310
1232 Ga0501263_003221 3300049760 Bacteria 1727
1233 nmdc:mga07m45_147399_c1 3300050496 Unclassified 1364
1234 nmdc:mga06r32_22563_c1 3300050510 Bacteria 5820
1235 Ga0500658_0000073 3300053134 Bacteria 46171
1236 Ga0500627_0086087 3300053158 Bacteria 1404
1237 Ga0587088_040702 3300059508 Bacteria 874
1238 Ga0587067_069223 3300059640 Bacteria 758
1239 Ga0466962_0002842 3300061719 Bacteria 8245
1240 Ga0466962_0023546 3300061719 Bacteria 2959
1241 Ga0466962_0067245 3300061719 Bacteria 1711

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10048392 Ga0070658_100483924 196
2 3300005530 Ga0070679_100183454 Ga0070679_1001834543 196
3 3300005616 Ga0068852_100205461 Ga0068852_1002054612 196
4 3300025909 Ga0207705_10032292 Ga0207705_100322922 196
5 3300025921 Ga0207652_10153211 Ga0207652_101532113 196
6 3300026142 Ga0207698_10140213 Ga0207698_101402133 196
7 3300005345 Ga0070692_10012710 Ga0070692_100127103 197
8 3300005563 Ga0068855_100044201 Ga0068855_1000442014 197
9 3300005366 Ga0070659_100003180 Ga0070659_1000031805 198
10 3300005444 Ga0070694_100035892 Ga0070694_1000358923 198
11 3300005577 Ga0068857_100074791 Ga0068857_1000747912 198
12 3300005843 Ga0068860_100028539 Ga0068860_1000285395 198
13 3300013104 Ga0157370_10179402 Ga0157370_101794022 198
14 3300025904 Ga0207647_10000114 Ga0207647_1000011462 198
15 3300025919 Ga0207657_10096580 Ga0207657_100965802 198
16 3300025932 Ga0207690_10012502 Ga0207690_100125024 198
17 3300025933 Ga0207706_10001330 Ga0207706_1000133027 198
18 3300025940 Ga0207691_10068766 Ga0207691_100687663 198
19 3300025949 Ga0207667_10064080 Ga0207667_100640802 198
20 3300025961 Ga0207712_10000513 Ga0207712_1000051314 198
21 3300026041 Ga0207639_10260975 Ga0207639_102609752 198
22 3300026116 Ga0207674_10105082 Ga0207674_101050822 198
23 3300026142 Ga0207698_10446117 Ga0207698_104461171 198
24 3300028381 Ga0268264_10001553 Ga0268264_1000155315 198
25 3300009545 Ga0105237_10808009 Ga0105237_108080091 202
26 3300009553 Ga0105249_10057420 Ga0105249_100574203 202
27 3300010375 Ga0105239_10065771 Ga0105239_100657714 202
28 3300013306 Ga0163162_10091527 Ga0163162_100915274 202
29 3300013102 Ga0157371_10060794 Ga0157371_100607943 203
30 3300013296 Ga0157374_10758737 Ga0157374_107587371 204
31 3300044694 Ga0466963_0023968 Ga0466963_0023968_1045_1698 204
32 3300044719 Ga0466971_0009145 Ga0466971_0009145_916_1569 204
33 3300044842 Ga0466957_0001921 Ga0466957_0001921_1462_2115 204
34 3300045836 Ga0466958_0020199 Ga0466958_0020199_966_1619 204
35 3300048915 Ga0496112_0105724 Ga0496112_0105724_128_781 204
36 3300048916 Ga0496113_0180938 Ga0496113_0180938_255_908 204
37 3300061719 Ga0466962_0023546 Ga0466962_0023546_1728_2381 204
38 3300036401 Ga0373937_0652098 Ga0373937_0652098_95_748 205
39 3300005327 Ga0070658_10058707 Ga0070658_100587073 206
40 3300005329 Ga0070683_100106903 Ga0070683_1001069032 206
41 3300005530 Ga0070679_100480359 Ga0070679_1004803591 206
42 3300005614 Ga0068856_100810951 Ga0068856_1008109511 206
43 3300009174 Ga0105241_10092993 Ga0105241_100929933 206
44 3300013102 Ga0157371_10044544 Ga0157371_100445444 206
45 3300013105 Ga0157369_10874871 Ga0157369_108748711 206
46 3300025919 Ga0207657_10027580 Ga0207657_100275804 206
47 3300025920 Ga0207649_10088128 Ga0207649_100881281 206
48 3300025932 Ga0207690_10249578 Ga0207690_102495781 206
49 3300025945 Ga0207679_10280250 Ga0207679_102802502 206
50 3300026067 Ga0207678_10017742 Ga0207678_100177422 206
51 3300026078 Ga0207702_10097596 Ga0207702_100975963 206
52 3300026116 Ga0207674_10067314 Ga0207674_100673142 206
53 3300037471 Ga0395905_0241052 Ga0395905_0241052_826_1479 206
54 3300001991 JGI24743J22301_10017544 JGI24743J22301_100175442 207
55 3300005335 Ga0070666_10033898 Ga0070666_100338982 207
56 3300005338 Ga0068868_100029630 Ga0068868_1000296304 207
57 3300005339 Ga0070660_100069590 Ga0070660_1000695903 207
58 3300005354 Ga0070675_100026701 Ga0070675_1000267013 207
59 3300005355 Ga0070671_100004514 Ga0070671_1000045144 207
60 3300005356 Ga0070674_100259388 Ga0070674_1002593881 207
61 3300005364 Ga0070673_100007637 Ga0070673_1000076371 207
62 3300005367 Ga0070667_100067142 Ga0070667_1000671423 207
63 3300005457 Ga0070662_100098827 Ga0070662_1000988272 207
64 3300005543 Ga0070672_100041357 Ga0070672_1000413573 207
65 3300005548 Ga0070665_100012043 Ga0070665_1000120434 207
66 3300005564 Ga0070664_100046375 Ga0070664_1000463754 207
67 3300005577 Ga0068857_100097814 Ga0068857_1000978142 207
68 3300005578 Ga0068854_100031056 Ga0068854_1000310563 207
69 3300005834 Ga0068851_10063820 Ga0068851_100638202 207
70 3300009177 Ga0105248_11383059 Ga0105248_113830591 207
71 3300011119 Ga0105246_10872507 Ga0105246_108725071 207
72 3300013296 Ga0157374_10056936 Ga0157374_100569363 207
73 3300013297 Ga0157378_10712478 Ga0157378_107124781 207
74 3300013306 Ga0163162_10217821 Ga0163162_102178212 207
75 3300013308 Ga0157375_10024631 Ga0157375_100246313 207
76 3300014969 Ga0157376_10136551 Ga0157376_101365512 207
77 3300025901 Ga0207688_10175805 Ga0207688_101758051 207
78 3300025903 Ga0207680_10053319 Ga0207680_100533192 207
79 3300025919 Ga0207657_10015026 Ga0207657_100150263 207
80 3300025925 Ga0207650_10769213 Ga0207650_107692131 207
81 3300025931 Ga0207644_10001502 Ga0207644_100015022 207
82 3300025933 Ga0207706_10094715 Ga0207706_100947152 207
83 3300025937 Ga0207669_10052517 Ga0207669_100525172 207
84 3300025940 Ga0207691_10052542 Ga0207691_100525423 207
85 3300025945 Ga0207679_10510874 Ga0207679_105108742 207
86 3300025949 Ga0207667_10776975 Ga0207667_107769751 207
87 3300025960 Ga0207651_10029871 Ga0207651_100298713 207
88 3300026067 Ga0207678_10517798 Ga0207678_105177981 207
89 3300028379 Ga0268266_10017076 Ga0268266_100170763 207
90 3300037418 Ga0395900_0666020 Ga0395900_0666020_72_725 207
91 3300037466 Ga0395898_0053101 Ga0395898_0053101_292_945 207
92 3300038443 Ga0395901_0016246 Ga0395901_0016246_5741_6394 207
93 3300005339 Ga0070660_100075269 Ga0070660_1000752692 208
94 3300025919 Ga0207657_10015606 Ga0207657_100156067 208
95 3300025926 Ga0207659_10019935 Ga0207659_100199354 208
96 3300025949 Ga0207667_10767041 Ga0207667_107670411 209
97 3300037418 Ga0395900_0241658 Ga0395900_0241658_893_1615 209
98 3300038443 Ga0395901_0000329 Ga0395901_0000329_57321_58043 209
99 3300013297 Ga0157378_10018275 Ga0157378_100182752 211
100 3300005435 Ga0070714_100055969 Ga0070714_1000559693 212
101 3300025929 Ga0207664_10318659 Ga0207664_103186592 212
102 3300045976 Ga0466967_0535904 Ga0466967_0535904_256_909 212
103 3300001979 JGI24740J21852_10037044 JGI24740J21852_100370442 213
104 3300001989 JGI24739J22299_10003420 JGI24739J22299_100034203 213
105 3300002239 JGI24034J26672_10016227 JGI24034J26672_100162271 213
106 3300005335 Ga0070666_10050541 Ga0070666_100505411 213
107 3300005339 Ga0070660_100004031 Ga0070660_1000040316 213
108 3300005339 Ga0070660_100006497 Ga0070660_1000064972 213
109 3300005347 Ga0070668_100032292 Ga0070668_1000322922 213
110 3300005354 Ga0070675_100163451 Ga0070675_1001634513 213
111 3300005355 Ga0070671_100021078 Ga0070671_1000210785 213
112 3300005356 Ga0070674_100060210 Ga0070674_1000602103 213
113 3300005366 Ga0070659_100001672 Ga0070659_1000016726 213
114 3300005457 Ga0070662_100002895 Ga0070662_1000028956 213
115 3300005466 Ga0070685_10131747 Ga0070685_101317471 213
116 3300025981 Ga0207640_10459423 Ga0207640_104594231 213
117 3300013102 Ga0157371_10055698 Ga0157371_100556983 215
118 3300013102 Ga0157371_10133011 Ga0157371_101330112 215
119 3300013104 Ga0157370_10326321 Ga0157370_103263212 215
120 3300037312 Ga0395899_0000287 Ga0395899_0000287_40146_40847 215
121 3300037418 Ga0395900_0000031 Ga0395900_0000031_204431_205132 215
122 3300037466 Ga0395898_0012486 Ga0395898_0012486_1872_2573 215
123 3300037471 Ga0395905_0336580 Ga0395905_0336580_159_860 215
124 3300038443 Ga0395901_0000035 Ga0395901_0000035_80780_81481 215
125 3300001977 JGI24746J21847_1002084 JGI24746J21847_10020843 216
126 3300005290 Ga0065712_10093551 Ga0065712_100935513 216
127 3300005293 Ga0065715_10000359 Ga0065715_1000035920 216
128 3300005327 Ga0070658_10066902 Ga0070658_100669021 216
129 3300005327 Ga0070658_10255462 Ga0070658_102554621 216
130 3300005329 Ga0070683_100138672 Ga0070683_1001386722 216
131 3300005331 Ga0070670_100021668 Ga0070670_1000216685 216
132 3300005331 Ga0070670_100147878 Ga0070670_1001478782 216
133 3300005333 Ga0070677_10000999 Ga0070677_100009997 216
134 3300005335 Ga0070666_10037685 Ga0070666_100376852 216
135 3300005336 Ga0070680_100157613 Ga0070680_1001576132 216
136 3300005339 Ga0070660_100014877 Ga0070660_1000148774 216
137 3300005339 Ga0070660_100371106 Ga0070660_1003711062 216
138 3300005344 Ga0070661_100007780 Ga0070661_1000077808 216
139 3300005347 Ga0070668_100161674 Ga0070668_1001616743 216
140 3300005347 Ga0070668_100241551 Ga0070668_1002415512 216
141 3300005353 Ga0070669_100016871 Ga0070669_1000168714 216
142 3300005353 Ga0070669_100030619 Ga0070669_1000306194 216
143 3300005354 Ga0070675_100004653 Ga0070675_1000046539 216
144 3300005354 Ga0070675_100365390 Ga0070675_1003653902 216
145 3300005354 Ga0070675_100807622 Ga0070675_1008076221 216
146 3300005355 Ga0070671_100013680 Ga0070671_1000136802 216
147 3300005355 Ga0070671_100014729 Ga0070671_1000147296 216
148 3300005356 Ga0070674_100002641 Ga0070674_1000026415 216
149 3300005364 Ga0070673_100065813 Ga0070673_1000658133 216
150 3300005366 Ga0070659_100081684 Ga0070659_1000816843 216
151 3300005366 Ga0070659_100187443 Ga0070659_1001874433 216
152 3300005366 Ga0070659_100192135 Ga0070659_1001921352 216
153 3300005367 Ga0070667_100003455 Ga0070667_10000345512 216
154 3300005367 Ga0070667_100040579 Ga0070667_1000405792 216
155 3300005438 Ga0070701_10307681 Ga0070701_103076811 216
156 3300005441 Ga0070700_100034056 Ga0070700_1000340563 216
157 3300005455 Ga0070663_100006460 Ga0070663_1000064603 216
158 3300005455 Ga0070663_100029256 Ga0070663_1000292563 216
159 3300005455 Ga0070663_100113996 Ga0070663_1001139962 216
160 3300005456 Ga0070678_100176831 Ga0070678_1001768313 216
161 3300005457 Ga0070662_100006664 Ga0070662_1000066647 216
162 3300005457 Ga0070662_100008482 Ga0070662_1000084825 216
163 3300005457 Ga0070662_100736314 Ga0070662_1007363141 216
164 3300005530 Ga0070679_100015785 Ga0070679_1000157853 216
165 3300005530 Ga0070679_100298936 Ga0070679_1002989362 216
166 3300005539 Ga0068853_100033639 Ga0068853_1000336393 216
167 3300005543 Ga0070672_100003490 Ga0070672_1000034908 216
168 3300005543 Ga0070672_100057378 Ga0070672_1000573783 216
169 3300005548 Ga0070665_100012854 Ga0070665_1000128549 216
170 3300005563 Ga0068855_100172091 Ga0068855_1001720913 216
171 3300005563 Ga0068855_100299728 Ga0068855_1002997282 216
172 3300005564 Ga0070664_100115285 Ga0070664_1001152853 216
173 3300005564 Ga0070664_100570707 Ga0070664_1005707072 216
174 3300005577 Ga0068857_100109367 Ga0068857_1001093673 216
175 3300005578 Ga0068854_100017038 Ga0068854_1000170385 216
176 3300005614 Ga0068856_100170663 Ga0068856_1001706632 216
177 3300005617 Ga0068859_100036370 Ga0068859_1000363703 216
178 3300005618 Ga0068864_100290357 Ga0068864_1002903572 216
179 3300005719 Ga0068861_100004768 Ga0068861_1000047687 216
180 3300005840 Ga0068870_10073710 Ga0068870_100737103 216
181 3300005842 Ga0068858_100330386 Ga0068858_1003303862 216
182 3300005844 Ga0068862_100005443 Ga0068862_1000054434 216
183 3300006237 Ga0097621_100014323 Ga0097621_1000143234 216
184 3300006358 Ga0068871_100105553 Ga0068871_1001055532 216
185 3300006931 Ga0097620_100036370 Ga0097620_1000363703 216
186 3300009174 Ga0105241_10332997 Ga0105241_103329972 216
187 3300009551 Ga0105238_10804650 Ga0105238_108046501 216
188 3300009553 Ga0105249_10113737 Ga0105249_101137372 216
189 3300013100 Ga0157373_10005880 Ga0157373_100058807 216
190 3300013100 Ga0157373_10045050 Ga0157373_100450504 216
191 3300013102 Ga0157371_10108981 Ga0157371_101089811 216
192 3300013104 Ga0157370_10178977 Ga0157370_101789771 216
193 3300013105 Ga0157369_10000106 Ga0157369_1000010627 216
194 3300013296 Ga0157374_10028067 Ga0157374_100280672 216
195 3300014325 Ga0163163_10189906 Ga0163163_101899062 216
196 3300017792 Ga0163161_10000753 Ga0163161_1000075320 216
197 3300020081 Ga0206354_11575063 Ga0206354_115750632 216
198 3300025271 Ga0207666_1004870 Ga0207666_10048701 216
199 3300025893 Ga0207682_10001693 Ga0207682_100016935 216
200 3300025901 Ga0207688_10024903 Ga0207688_100249032 216
201 3300025904 Ga0207647_10136214 Ga0207647_101362142 216
202 3300025908 Ga0207643_10052521 Ga0207643_100525212 216
203 3300025909 Ga0207705_10000581 Ga0207705_1000058129 216
204 3300025909 Ga0207705_10000929 Ga0207705_1000092914 216
205 3300025909 Ga0207705_10002326 Ga0207705_100023268 216
206 3300025909 Ga0207705_10047976 Ga0207705_100479764 216
207 3300025913 Ga0207695_10019571 Ga0207695_100195715 216
208 3300025917 Ga0207660_10219912 Ga0207660_102199122 216
209 3300025918 Ga0207662_10207559 Ga0207662_102075592 216
210 3300025919 Ga0207657_10000498 Ga0207657_1000049820 216
211 3300025919 Ga0207657_10023118 Ga0207657_100231183 216
212 3300025919 Ga0207657_10045766 Ga0207657_100457665 216
213 3300025919 Ga0207657_10066225 Ga0207657_100662253 216
214 3300025920 Ga0207649_10001080 Ga0207649_1000108010 216
215 3300025920 Ga0207649_10226244 Ga0207649_102262441 216
216 3300025921 Ga0207652_10030232 Ga0207652_100302323 216
217 3300025923 Ga0207681_10023027 Ga0207681_100230271 216
218 3300025923 Ga0207681_10348384 Ga0207681_103483842 216
219 3300025925 Ga0207650_10003054 Ga0207650_100030543 216
220 3300025925 Ga0207650_10128811 Ga0207650_101288112 216
221 3300025929 Ga0207664_10139618 Ga0207664_101396182 216
222 3300025931 Ga0207644_10007766 Ga0207644_100077662 216
223 3300025931 Ga0207644_10020310 Ga0207644_100203105 216
224 3300025932 Ga0207690_10030846 Ga0207690_100308462 216
225 3300025932 Ga0207690_10057356 Ga0207690_100573562 216
226 3300025932 Ga0207690_10274004 Ga0207690_102740041 216
227 3300025933 Ga0207706_10000431 Ga0207706_1000043142 216
228 3300025933 Ga0207706_10000434 Ga0207706_1000043433 216
229 3300025933 Ga0207706_10405191 Ga0207706_104051912 216
230 3300025937 Ga0207669_10004765 Ga0207669_100047652 216
231 3300025938 Ga0207704_10603465 Ga0207704_106034651 216
232 3300025940 Ga0207691_10000852 Ga0207691_1000085219 216
233 3300025940 Ga0207691_10241007 Ga0207691_102410072 216
234 3300025941 Ga0207711_10071281 Ga0207711_100712813 216
235 3300025944 Ga0207661_10178503 Ga0207661_101785032 216
236 3300025949 Ga0207667_10019052 Ga0207667_100190524 216
237 3300025960 Ga0207651_10280180 Ga0207651_102801802 216
238 3300025961 Ga0207712_10008327 Ga0207712_100083274 216
239 3300025972 Ga0207668_10002049 Ga0207668_1000204910 216
240 3300025972 Ga0207668_10064739 Ga0207668_100647392 216
241 3300025981 Ga0207640_10007575 Ga0207640_100075756 216
242 3300025986 Ga0207658_10035614 Ga0207658_100356142 216
243 3300026035 Ga0207703_10298844 Ga0207703_102988442 216
244 3300026041 Ga0207639_10040564 Ga0207639_100405644 216
245 3300026067 Ga0207678_10009190 Ga0207678_100091903 216
246 3300026067 Ga0207678_10131299 Ga0207678_101312991 216
247 3300026078 Ga0207702_10039218 Ga0207702_100392182 216
248 3300026089 Ga0207648_10106101 Ga0207648_101061012 216
249 3300026095 Ga0207676_10012995 Ga0207676_100129954 216
250 3300026116 Ga0207674_10016368 Ga0207674_100163688 216
251 3300026121 Ga0207683_10006197 Ga0207683_100061976 216
252 3300026142 Ga0207698_10039129 Ga0207698_100391292 216
253 3300026142 Ga0207698_10087066 Ga0207698_100870663 216
254 3300026142 Ga0207698_10213194 Ga0207698_102131944 216
255 3300027614 Ga0209970_1011815 Ga0209970_10118151 216
256 3300027665 Ga0209983_1025887 Ga0209983_10258872 216
257 3300027876 Ga0209974_10001467 Ga0209974_100014671 216
258 3300027876 Ga0209974_10014750 Ga0209974_100147502 216
259 3300028379 Ga0268266_10009325 Ga0268266_100093255 216
260 3300028380 Ga0268265_10004795 Ga0268265_1000479510 216
261 3300031548 Ga0307408_100031512 Ga0307408_1000315121 216
262 3300031731 Ga0307405_10649450 Ga0307405_106494501 216
263 3300031824 Ga0307413_10029266 Ga0307413_100292661 216
264 3300031852 Ga0307410_10182954 Ga0307410_101829542 216
265 3300031852 Ga0307410_10233858 Ga0307410_102338582 216
266 3300031901 Ga0307406_10067049 Ga0307406_100670492 216
267 3300031901 Ga0307406_10407775 Ga0307406_104077752 216
268 3300031911 Ga0307412_10033368 Ga0307412_100333684 216
269 3300031995 Ga0307409_100152901 Ga0307409_1001529012 216
270 3300032002 Ga0307416_100035408 Ga0307416_1000354082 216
271 3300032002 Ga0307416_100053529 Ga0307416_1000535291 216
272 3300032002 Ga0307416_100110262 Ga0307416_1001102621 216
273 3300032002 Ga0307416_101549103 Ga0307416_1015491032 216
274 3300032004 Ga0307414_10112593 Ga0307414_101125933 216
275 3300032004 Ga0307414_10829859 Ga0307414_108298591 216
276 3300032005 Ga0307411_10059642 Ga0307411_100596421 216
277 3300032126 Ga0307415_100522340 Ga0307415_1005223402 216
278 3300037312 Ga0395899_0043352 Ga0395899_0043352_1831_2484 216
279 3300037418 Ga0395900_0124775 Ga0395900_0124775_479_1132 216
280 3300037418 Ga0395900_0294452 Ga0395900_0294452_939_1592 216
281 3300037466 Ga0395898_0092766 Ga0395898_0092766_1539_2192 216
282 3300037466 Ga0395898_0106466 Ga0395898_0106466_1068_1721 216
283 3300037471 Ga0395905_0184509 Ga0395905_0184509_479_1132 216
284 3300038443 Ga0395901_0031929 Ga0395901_0031929_4677_5330 216
285 3300038443 Ga0395901_0218346 Ga0395901_0218346_727_1380 216
286 3300038443 Ga0395901_1100180 Ga0395901_1100180_72_725 216
287 3300044694 Ga0466963_0000335 Ga0466963_0000335_3930_4580 216
288 3300044706 Ga0466964_0038247 Ga0466964_0038247_56_709 216
289 3300044901 Ga0466960_0098653 Ga0466960_0098653_795_1445 216
290 3300045049 Ga0466959_0094238 Ga0466959_0094238_1376_2029 216
291 3300045836 Ga0466958_0114006 Ga0466958_0114006_225_878 216
292 3300045976 Ga0466967_0008133 Ga0466967_0008133_3453_4106 216
293 3300045976 Ga0466967_0085729 Ga0466967_0085729_1306_1956 216
294 3300045976 Ga0466967_0255826 Ga0466967_0255826_103_753 216
295 3300046525 Ga0495663_0049462 Ga0495663_0049462_582_1238 216
296 3300046558 Ga0495633_0051209 Ga0495633_0051209_672_1328 216
297 3300046684 Ga0495669_0061458 Ga0495669_0061458_654_1310 216
298 3300049130 Ga0501310_028560 Ga0501310_028560_23_673 216
299 3300059508 Ga0587088_040702 Ga0587088_040702_118_771 216
300 3300001978 JGI24747J21853_1001581 JGI24747J21853_10015812 217
301 3300001979 JGI24740J21852_10020678 JGI24740J21852_100206782 217
302 3300001989 JGI24739J22299_10001857 JGI24739J22299_100018572 217
303 3300001990 JGI24737J22298_10000229 JGI24737J22298_1000022922 217
304 3300001990 JGI24737J22298_10000380 JGI24737J22298_100003802 217
305 3300001990 JGI24737J22298_10048451 JGI24737J22298_100484512 217
306 3300001990 JGI24737J22298_10078046 JGI24737J22298_100780461 217
307 3300002067 JGI24735J21928_10013302 JGI24735J21928_100133023 217
308 3300002067 JGI24735J21928_10013884 JGI24735J21928_100138843 217
309 3300002067 JGI24735J21928_10054753 JGI24735J21928_100547532 217
310 3300002075 JGI24738J21930_10000035 JGI24738J21930_100000359 217
311 3300002075 JGI24738J21930_10000111 JGI24738J21930_1000011110 217
312 3300002075 JGI24738J21930_10011415 JGI24738J21930_100114152 217
313 3300002075 JGI24738J21930_10025120 JGI24738J21930_100251201 217
314 3300002077 JGI24744J21845_10001913 JGI24744J21845_100019133 217
315 3300005327 Ga0070658_10000950 Ga0070658_1000095025 217
316 3300005327 Ga0070658_10004834 Ga0070658_100048343 217
317 3300005327 Ga0070658_10007328 Ga0070658_100073288 217
318 3300005327 Ga0070658_10008348 Ga0070658_100083483 217
319 3300005327 Ga0070658_10035822 Ga0070658_100358224 217
320 3300005327 Ga0070658_10086254 Ga0070658_100862543 217
321 3300005327 Ga0070658_10086428 Ga0070658_100864282 217
322 3300005327 Ga0070658_10098619 Ga0070658_100986193 217
323 3300005327 Ga0070658_10178274 Ga0070658_101782742 217
324 3300005327 Ga0070658_10190659 Ga0070658_101906592 217
325 3300005327 Ga0070658_10287436 Ga0070658_102874361 217
326 3300005327 Ga0070658_10313747 Ga0070658_103137472 217
327 3300005327 Ga0070658_10389358 Ga0070658_103893581 217
328 3300005328 Ga0070676_10110847 Ga0070676_101108472 217
329 3300005328 Ga0070676_10145152 Ga0070676_101451522 217
330 3300005328 Ga0070676_10180150 Ga0070676_101801502 217
331 3300005328 Ga0070676_10191868 Ga0070676_101918682 217
332 3300005329 Ga0070683_100001317 Ga0070683_10000131716 217
333 3300005329 Ga0070683_100002246 Ga0070683_10000224613 217
334 3300005329 Ga0070683_100064707 Ga0070683_1000647073 217
335 3300005329 Ga0070683_100271938 Ga0070683_1002719382 217
336 3300005329 Ga0070683_100312688 Ga0070683_1003126882 217
337 3300005330 Ga0070690_100087890 Ga0070690_1000878902 217
338 3300005330 Ga0070690_100117033 Ga0070690_1001170332 217
339 3300005330 Ga0070690_100781533 Ga0070690_1007815331 217
340 3300005331 Ga0070670_100004283 Ga0070670_10000428313 217
341 3300005331 Ga0070670_100023463 Ga0070670_1000234633 217
342 3300005331 Ga0070670_100038464 Ga0070670_1000384642 217
343 3300005331 Ga0070670_100046469 Ga0070670_1000464691 217
344 3300005331 Ga0070670_100208352 Ga0070670_1002083522 217
345 3300005331 Ga0070670_100217097 Ga0070670_1002170972 217
346 3300005333 Ga0070677_10008037 Ga0070677_100080373 217
347 3300005333 Ga0070677_10053961 Ga0070677_100539612 217
348 3300005333 Ga0070677_10097638 Ga0070677_100976381 217
349 3300005333 Ga0070677_10187580 Ga0070677_101875802 217
350 3300005334 Ga0068869_100051248 Ga0068869_1000512481 217
351 3300005335 Ga0070666_10000451 Ga0070666_1000045125 217
352 3300005335 Ga0070666_10005045 Ga0070666_100050454 217
353 3300005335 Ga0070666_10007600 Ga0070666_100076002 217
354 3300005335 Ga0070666_10029477 Ga0070666_100294773 217
355 3300005335 Ga0070666_10469947 Ga0070666_104699472 217
356 3300005336 Ga0070680_100004263 Ga0070680_1000042637 217
357 3300005336 Ga0070680_100004436 Ga0070680_1000044362 217
358 3300005336 Ga0070680_100022841 Ga0070680_1000228413 217
359 3300005336 Ga0070680_100026691 Ga0070680_1000266914 217
360 3300005336 Ga0070680_100031574 Ga0070680_1000315743 217
361 3300005336 Ga0070680_100074636 Ga0070680_1000746362 217
362 3300005336 Ga0070680_100095267 Ga0070680_1000952673 217
363 3300005336 Ga0070680_100403036 Ga0070680_1004030362 217
364 3300005337 Ga0070682_100004206 Ga0070682_1000042066 217
365 3300005337 Ga0070682_100016231 Ga0070682_1000162314 217
366 3300005337 Ga0070682_100324793 Ga0070682_1003247932 217
367 3300005338 Ga0068868_100000881 Ga0068868_1000008819 217
368 3300005338 Ga0068868_100147032 Ga0068868_1001470322 217
369 3300005338 Ga0068868_100202639 Ga0068868_1002026392 217
370 3300005339 Ga0070660_100000260 Ga0070660_10000026035 217
371 3300005339 Ga0070660_100017486 Ga0070660_1000174864 217
372 3300005339 Ga0070660_100039431 Ga0070660_1000394312 217
373 3300005339 Ga0070660_100080308 Ga0070660_1000803081 217
374 3300005339 Ga0070660_100094011 Ga0070660_1000940112 217
375 3300005339 Ga0070660_100209399 Ga0070660_1002093992 217
376 3300005339 Ga0070660_100408146 Ga0070660_1004081461 217
377 3300005340 Ga0070689_100168237 Ga0070689_1001682372 217
378 3300005340 Ga0070689_100237840 Ga0070689_1002378402 217
379 3300005341 Ga0070691_10005847 Ga0070691_100058472 217
380 3300005344 Ga0070661_100000246 Ga0070661_10000024643 217
381 3300005344 Ga0070661_100020617 Ga0070661_1000206173 217
382 3300005344 Ga0070661_100026287 Ga0070661_1000262873 217
383 3300005344 Ga0070661_100027296 Ga0070661_1000272962 217
384 3300005344 Ga0070661_100034441 Ga0070661_1000344413 217
385 3300005344 Ga0070661_100036669 Ga0070661_1000366692 217
386 3300005344 Ga0070661_100079500 Ga0070661_1000795002 217
387 3300005344 Ga0070661_100233959 Ga0070661_1002339592 217
388 3300005345 Ga0070692_10327286 Ga0070692_103272862 217
389 3300005347 Ga0070668_100010358 Ga0070668_1000103589 217
390 3300005347 Ga0070668_100090692 Ga0070668_1000906922 217
391 3300005347 Ga0070668_100389382 Ga0070668_1003893821 217
392 3300005353 Ga0070669_100002615 Ga0070669_1000026159 217
393 3300005353 Ga0070669_100081765 Ga0070669_1000817652 217
394 3300005353 Ga0070669_100406814 Ga0070669_1004068142 217
395 3300005354 Ga0070675_100049464 Ga0070675_1000494643 217
396 3300005354 Ga0070675_100729036 Ga0070675_1007290362 217
397 3300005355 Ga0070671_100000825 Ga0070671_10000082530 217
398 3300005355 Ga0070671_100011712 Ga0070671_1000117127 217
399 3300005355 Ga0070671_100030749 Ga0070671_1000307494 217
400 3300005355 Ga0070671_100035593 Ga0070671_1000355933 217
401 3300005355 Ga0070671_100039305 Ga0070671_1000393054 217
402 3300005355 Ga0070671_100040586 Ga0070671_1000405863 217
403 3300005355 Ga0070671_100065621 Ga0070671_1000656213 217
404 3300005355 Ga0070671_100069570 Ga0070671_1000695703 217
405 3300005355 Ga0070671_100085909 Ga0070671_1000859093 217
406 3300005355 Ga0070671_100241468 Ga0070671_1002414682 217
407 3300005355 Ga0070671_100504565 Ga0070671_1005045651 217
408 3300005355 Ga0070671_100567289 Ga0070671_1005672891 217
409 3300005356 Ga0070674_100073398 Ga0070674_1000733983 217
410 3300005356 Ga0070674_100930155 Ga0070674_1009301551 217
411 3300005364 Ga0070673_100003488 Ga0070673_1000034882 217
412 3300005364 Ga0070673_100078210 Ga0070673_1000782103 217
413 3300005364 Ga0070673_100130371 Ga0070673_1001303711 217
414 3300005364 Ga0070673_100281945 Ga0070673_1002819452 217
415 3300005364 Ga0070673_100500198 Ga0070673_1005001982 217
416 3300005366 Ga0070659_100000195 Ga0070659_10000019520 217
417 3300005366 Ga0070659_100009755 Ga0070659_1000097557 217
418 3300005366 Ga0070659_100067067 Ga0070659_1000670673 217
419 3300005366 Ga0070659_100081876 Ga0070659_1000818763 217
420 3300005366 Ga0070659_100094138 Ga0070659_1000941383 217
421 3300005366 Ga0070659_100293399 Ga0070659_1002933992 217
422 3300005366 Ga0070659_100421809 Ga0070659_1004218092 217
423 3300005366 Ga0070659_100630365 Ga0070659_1006303651 217
424 3300005367 Ga0070667_100003302 Ga0070667_1000033024 217
425 3300005367 Ga0070667_100004244 Ga0070667_1000042443 217
426 3300005367 Ga0070667_100015921 Ga0070667_1000159214 217
427 3300005367 Ga0070667_100056316 Ga0070667_1000563163 217
428 3300005367 Ga0070667_100063443 Ga0070667_1000634432 217
429 3300005367 Ga0070667_100063842 Ga0070667_1000638423 217
430 3300005367 Ga0070667_100067184 Ga0070667_1000671841 217
431 3300005367 Ga0070667_100068000 Ga0070667_1000680003 217
432 3300005367 Ga0070667_100087799 Ga0070667_1000877992 217
433 3300005367 Ga0070667_100386748 Ga0070667_1003867481 217
434 3300005435 Ga0070714_100047389 Ga0070714_1000473894 217
435 3300005436 Ga0070713_100017293 Ga0070713_1000172932 217
436 3300005436 Ga0070713_100972681 Ga0070713_1009726811 217
437 3300005455 Ga0070663_100006925 Ga0070663_1000069253 217
438 3300005455 Ga0070663_100012865 Ga0070663_1000128654 217
439 3300005455 Ga0070663_100028627 Ga0070663_1000286274 217
440 3300005455 Ga0070663_100114282 Ga0070663_1001142822 217
441 3300005455 Ga0070663_100138025 Ga0070663_1001380252 217
442 3300005455 Ga0070663_100284981 Ga0070663_1002849812 217
443 3300005455 Ga0070663_100422422 Ga0070663_1004224221 217
444 3300005455 Ga0070663_100616654 Ga0070663_1006166541 217
445 3300005456 Ga0070678_100040641 Ga0070678_1000406412 217
446 3300005456 Ga0070678_100134820 Ga0070678_1001348201 217
447 3300005456 Ga0070678_100167291 Ga0070678_1001672911 217
448 3300005456 Ga0070678_100172662 Ga0070678_1001726622 217
449 3300005456 Ga0070678_100615988 Ga0070678_1006159881 217
450 3300005457 Ga0070662_100000047 Ga0070662_10000004720 217
451 3300005457 Ga0070662_100002537 Ga0070662_1000025374 217
452 3300005457 Ga0070662_100008156 Ga0070662_1000081564 217
453 3300005457 Ga0070662_100011273 Ga0070662_1000112732 217
454 3300005457 Ga0070662_100067097 Ga0070662_1000670973 217
455 3300005457 Ga0070662_100070347 Ga0070662_1000703472 217
456 3300005457 Ga0070662_100162259 Ga0070662_1001622591 217
457 3300005457 Ga0070662_100236230 Ga0070662_1002362302 217
458 3300005457 Ga0070662_100367223 Ga0070662_1003672232 217
459 3300005458 Ga0070681_10149323 Ga0070681_101493232 217
460 3300005458 Ga0070681_10357601 Ga0070681_103576012 217
461 3300005458 Ga0070681_10522897 Ga0070681_105228972 217
462 3300005459 Ga0068867_100006073 Ga0068867_1000060736 217
463 3300005459 Ga0068867_100031841 Ga0068867_1000318413 217
464 3300005530 Ga0070679_100082597 Ga0070679_1000825971 217
465 3300005530 Ga0070679_100200502 Ga0070679_1002005022 217
466 3300005530 Ga0070679_100286339 Ga0070679_1002863392 217
467 3300005530 Ga0070679_100303524 Ga0070679_1003035242 217
468 3300005530 Ga0070679_100314470 Ga0070679_1003144702 217
469 3300005530 Ga0070679_100332236 Ga0070679_1003322361 217
470 3300005535 Ga0070684_100009105 Ga0070684_1000091056 217
471 3300005535 Ga0070684_100015986 Ga0070684_1000159866 217
472 3300005539 Ga0068853_100000033 Ga0068853_10000003371 217
473 3300005539 Ga0068853_100007792 Ga0068853_1000077922 217
474 3300005539 Ga0068853_100021431 Ga0068853_1000214311 217
475 3300005539 Ga0068853_100172070 Ga0068853_1001720702 217
476 3300005539 Ga0068853_100184003 Ga0068853_1001840032 217
477 3300005539 Ga0068853_100317020 Ga0068853_1003170202 217
478 3300005543 Ga0070672_100002154 Ga0070672_1000021545 217
479 3300005543 Ga0070672_100008903 Ga0070672_1000089033 217
480 3300005543 Ga0070672_100089334 Ga0070672_1000893342 217
481 3300005543 Ga0070672_100109649 Ga0070672_1001096492 217
482 3300005543 Ga0070672_100131378 Ga0070672_1001313782 217
483 3300005543 Ga0070672_100240890 Ga0070672_1002408902 217
484 3300005544 Ga0070686_100217175 Ga0070686_1002171751 217
485 3300005547 Ga0070693_100011462 Ga0070693_1000114623 217
486 3300005548 Ga0070665_100011256 Ga0070665_1000112562 217
487 3300005548 Ga0070665_100017956 Ga0070665_1000179564 217
488 3300005548 Ga0070665_100039523 Ga0070665_1000395232 217
489 3300005548 Ga0070665_100272088 Ga0070665_1002720882 217
490 3300005548 Ga0070665_100744094 Ga0070665_1007440941 217
491 3300005548 Ga0070665_100764025 Ga0070665_1007640251 217
492 3300005563 Ga0068855_100000531 Ga0068855_10000053120 217
493 3300005563 Ga0068855_100031999 Ga0068855_1000319996 217
494 3300005563 Ga0068855_100053522 Ga0068855_1000535223 217
495 3300005563 Ga0068855_100096784 Ga0068855_1000967843 217
496 3300005563 Ga0068855_100160182 Ga0068855_1001601822 217
497 3300005563 Ga0068855_100239473 Ga0068855_1002394732 217
498 3300005563 Ga0068855_100388376 Ga0068855_1003883762 217
499 3300005563 Ga0068855_100658001 Ga0068855_1006580012 217
500 3300005564 Ga0070664_100000242 Ga0070664_10000024225 217
501 3300005564 Ga0070664_100012535 Ga0070664_1000125355 217
502 3300005564 Ga0070664_100014968 Ga0070664_1000149682 217
503 3300005564 Ga0070664_100029545 Ga0070664_1000295453 217
504 3300005564 Ga0070664_100035533 Ga0070664_1000355332 217
505 3300005564 Ga0070664_100093492 Ga0070664_1000934923 217
506 3300005564 Ga0070664_100095020 Ga0070664_1000950203 217
507 3300005564 Ga0070664_100098731 Ga0070664_1000987312 217
508 3300005564 Ga0070664_100146592 Ga0070664_1001465922 217
509 3300005564 Ga0070664_100320190 Ga0070664_1003201902 217
510 3300005577 Ga0068857_100003503 Ga0068857_1000035033 217
511 3300005577 Ga0068857_100008864 Ga0068857_1000088646 217
512 3300005577 Ga0068857_100069483 Ga0068857_1000694833 217
513 3300005577 Ga0068857_100077789 Ga0068857_1000777892 217
514 3300005577 Ga0068857_100112507 Ga0068857_1001125073 217
515 3300005578 Ga0068854_100001998 Ga0068854_1000019984 217
516 3300005578 Ga0068854_100004302 Ga0068854_1000043021 217
517 3300005578 Ga0068854_100005905 Ga0068854_1000059054 217
518 3300005578 Ga0068854_100012918 Ga0068854_1000129185 217
519 3300005578 Ga0068854_100037092 Ga0068854_1000370923 217
520 3300005578 Ga0068854_100062870 Ga0068854_1000628703 217
521 3300005578 Ga0068854_100100729 Ga0068854_1001007292 217
522 3300005578 Ga0068854_100326132 Ga0068854_1003261322 217
523 3300005614 Ga0068856_100000162 Ga0068856_10000016219 217
524 3300005614 Ga0068856_100016343 Ga0068856_1000163433 217
525 3300005614 Ga0068856_100119211 Ga0068856_1001192112 217
526 3300005614 Ga0068856_100498669 Ga0068856_1004986692 217
527 3300005614 Ga0068856_100775027 Ga0068856_1007750271 217
528 3300005616 Ga0068852_100001990 Ga0068852_1000019906 217
529 3300005616 Ga0068852_100002549 Ga0068852_1000025493 217
530 3300005616 Ga0068852_100006456 Ga0068852_1000064569 217
531 3300005616 Ga0068852_100020466 Ga0068852_1000204664 217
532 3300005616 Ga0068852_100049931 Ga0068852_1000499311 217
533 3300005616 Ga0068852_100258566 Ga0068852_1002585662 217
534 3300005616 Ga0068852_100321164 Ga0068852_1003211642 217
535 3300005616 Ga0068852_100543385 Ga0068852_1005433852 217
536 3300005617 Ga0068859_100008163 Ga0068859_1000081634 217
537 3300005617 Ga0068859_100088327 Ga0068859_1000883271 217
538 3300005617 Ga0068859_100247432 Ga0068859_1002474323 217
539 3300005618 Ga0068864_100001290 Ga0068864_1000012906 217
540 3300005618 Ga0068864_100003128 Ga0068864_10000312813 217
541 3300005618 Ga0068864_100013936 Ga0068864_1000139364 217
542 3300005618 Ga0068864_100041042 Ga0068864_1000410422 217
543 3300005718 Ga0068866_10037141 Ga0068866_100371412 217
544 3300005718 Ga0068866_10221270 Ga0068866_102212701 217
545 3300005719 Ga0068861_100062365 Ga0068861_1000623653 217
546 3300005834 Ga0068851_10024620 Ga0068851_100246203 217
547 3300005834 Ga0068851_10039595 Ga0068851_100395952 217
548 3300005834 Ga0068851_10041771 Ga0068851_100417712 217
549 3300005834 Ga0068851_10074977 Ga0068851_100749772 217
550 3300005841 Ga0068863_100006129 Ga0068863_10000612912 217
551 3300005841 Ga0068863_100037056 Ga0068863_1000370563 217
552 3300005841 Ga0068863_100094035 Ga0068863_1000940352 217
553 3300005841 Ga0068863_100476379 Ga0068863_1004763791 217
554 3300005841 Ga0068863_100769799 Ga0068863_1007697991 217
555 3300005842 Ga0068858_100014242 Ga0068858_1000142424 217
556 3300005842 Ga0068858_100022221 Ga0068858_1000222211 217
557 3300005842 Ga0068858_101090519 Ga0068858_1010905191 217
558 3300005843 Ga0068860_100012703 Ga0068860_1000127035 217
559 3300005843 Ga0068860_100059624 Ga0068860_1000596243 217
560 3300005843 Ga0068860_100277259 Ga0068860_1002772592 217
561 3300005843 Ga0068860_100850230 Ga0068860_1008502301 217
562 3300005844 Ga0068862_100009248 Ga0068862_1000092483 217
563 3300005844 Ga0068862_100009717 Ga0068862_1000097179 217
564 3300005844 Ga0068862_100021213 Ga0068862_1000212136 217
565 3300005844 Ga0068862_100063009 Ga0068862_1000630092 217
566 3300005844 Ga0068862_100132927 Ga0068862_1001329273 217
567 3300005844 Ga0068862_100510352 Ga0068862_1005103521 217
568 3300006028 Ga0070717_10024236 Ga0070717_100242363 217
569 3300006237 Ga0097621_100052535 Ga0097621_1000525352 217
570 3300006237 Ga0097621_100156800 Ga0097621_1001568002 217
571 3300006353 Ga0075370_10150478 Ga0075370_101504781 217
572 3300006358 Ga0068871_100006417 Ga0068871_1000064172 217
573 3300006358 Ga0068871_100020356 Ga0068871_1000203561 217
574 3300006358 Ga0068871_100252451 Ga0068871_1002524512 217
575 3300006881 Ga0068865_100033541 Ga0068865_1000335411 217
576 3300006881 Ga0068865_100200837 Ga0068865_1002008372 217
577 3300006931 Ga0097620_100008163 Ga0097620_1000081634 217
578 3300006931 Ga0097620_100088321 Ga0097620_1000883214 217
579 3300006931 Ga0097620_100247425 Ga0097620_1002474253 217
580 3300009093 Ga0105240_10014520 Ga0105240_100145207 217
581 3300009093 Ga0105240_10047741 Ga0105240_100477414 217
582 3300009093 Ga0105240_10109964 Ga0105240_101099642 217
583 3300009098 Ga0105245_10000285 Ga0105245_1000028531 217
584 3300009098 Ga0105245_10047095 Ga0105245_100470953 217
585 3300009101 Ga0105247_10248127 Ga0105247_102481272 217
586 3300009148 Ga0105243_10138425 Ga0105243_101384252 217
587 3300009174 Ga0105241_10018764 Ga0105241_100187645 217
588 3300009174 Ga0105241_10042296 Ga0105241_100422963 217
589 3300009174 Ga0105241_10321132 Ga0105241_103211321 217
590 3300009177 Ga0105248_10000059 Ga0105248_100000597 217
591 3300009177 Ga0105248_10004029 Ga0105248_100040294 217
592 3300009177 Ga0105248_10004871 Ga0105248_1000487113 217
593 3300009177 Ga0105248_10013832 Ga0105248_100138326 217
594 3300009177 Ga0105248_10013976 Ga0105248_100139762 217
595 3300009177 Ga0105248_10020125 Ga0105248_100201254 217
596 3300009177 Ga0105248_10081096 Ga0105248_100810964 217
597 3300009177 Ga0105248_10098492 Ga0105248_100984923 217
598 3300009177 Ga0105248_10112409 Ga0105248_101124093 217
599 3300009177 Ga0105248_10155358 Ga0105248_101553583 217
600 3300009177 Ga0105248_10197743 Ga0105248_101977433 217
601 3300009545 Ga0105237_10221355 Ga0105237_102213553 217
602 3300009551 Ga0105238_10007506 Ga0105238_100075063 217
603 3300009551 Ga0105238_10027467 Ga0105238_100274674 217
604 3300009551 Ga0105238_10110443 Ga0105238_101104432 217
605 3300009553 Ga0105249_10125011 Ga0105249_101250111 217
606 3300009553 Ga0105249_10620646 Ga0105249_106206462 217
607 3300009553 Ga0105249_10688631 Ga0105249_106886311 217
608 3300009553 Ga0105249_11213566 Ga0105249_112135661 217
609 3300010375 Ga0105239_10064925 Ga0105239_100649252 217
610 3300011119 Ga0105246_10012160 Ga0105246_100121606 217
611 3300011119 Ga0105246_10018923 Ga0105246_100189234 217
612 3300011119 Ga0105246_10331883 Ga0105246_103318832 217
613 3300013100 Ga0157373_10030292 Ga0157373_100302921 217
614 3300013100 Ga0157373_10056222 Ga0157373_100562223 217
615 3300013100 Ga0157373_10087944 Ga0157373_100879442 217
616 3300013100 Ga0157373_10105914 Ga0157373_101059142 217
617 3300013100 Ga0157373_10150374 Ga0157373_101503741 217
618 3300013100 Ga0157373_10180066 Ga0157373_101800661 217
619 3300013102 Ga0157371_10002316 Ga0157371_1000231616 217
620 3300013102 Ga0157371_10004954 Ga0157371_100049544 217
621 3300013102 Ga0157371_10012470 Ga0157371_100124706 217
622 3300013102 Ga0157371_10109966 Ga0157371_101099662 217
623 3300013102 Ga0157371_10168325 Ga0157371_101683252 217
624 3300013102 Ga0157371_10235563 Ga0157371_102355632 217
625 3300013102 Ga0157371_10303940 Ga0157371_103039402 217
626 3300013102 Ga0157371_10377062 Ga0157371_103770621 217
627 3300013102 Ga0157371_10492618 Ga0157371_104926181 217
628 3300013102 Ga0157371_10654476 Ga0157371_106544761 217
629 3300013104 Ga0157370_10018643 Ga0157370_100186434 217
630 3300013104 Ga0157370_10029028 Ga0157370_100290284 217
631 3300013104 Ga0157370_10225175 Ga0157370_102251752 217
632 3300013105 Ga0157369_10029017 Ga0157369_100290175 217
633 3300013105 Ga0157369_10038318 Ga0157369_100383186 217
634 3300013105 Ga0157369_10069955 Ga0157369_100699553 217
635 3300013105 Ga0157369_10099750 Ga0157369_100997503 217
636 3300013105 Ga0157369_10270884 Ga0157369_102708842 217
637 3300013296 Ga0157374_10165850 Ga0157374_101658501 217
638 3300013296 Ga0157374_10214224 Ga0157374_102142243 217
639 3300013296 Ga0157374_10454211 Ga0157374_104542112 217
640 3300013297 Ga0157378_10001258 Ga0157378_1000125821 217
641 3300013297 Ga0157378_10155837 Ga0157378_101558372 217
642 3300013306 Ga0163162_10010468 Ga0163162_100104682 217
643 3300013306 Ga0163162_10037174 Ga0163162_100371743 217
644 3300013306 Ga0163162_10040346 Ga0163162_100403464 217
645 3300013306 Ga0163162_10137034 Ga0163162_101370343 217
646 3300013306 Ga0163162_11473232 Ga0163162_114732321 217
647 3300013307 Ga0157372_10031246 Ga0157372_100312461 217
648 3300013307 Ga0157372_10034037 Ga0157372_100340375 217
649 3300013307 Ga0157372_10076052 Ga0157372_100760521 217
650 3300013307 Ga0157372_10281734 Ga0157372_102817342 217
651 3300013307 Ga0157372_10376012 Ga0157372_103760121 217
652 3300013307 Ga0157372_10432473 Ga0157372_104324732 217
653 3300013307 Ga0157372_11426523 Ga0157372_114265231 217
654 3300013308 Ga0157375_10008191 Ga0157375_100081912 217
655 3300013308 Ga0157375_10058033 Ga0157375_100580332 217
656 3300013308 Ga0157375_10157579 Ga0157375_101575791 217
657 3300013308 Ga0157375_10992026 Ga0157375_109920261 217
658 3300013308 Ga0157375_11248494 Ga0157375_112484941 217
659 3300014325 Ga0163163_10000273 Ga0163163_1000027327 217
660 3300014325 Ga0163163_10014997 Ga0163163_100149976 217
661 3300014325 Ga0163163_10021539 Ga0163163_100215393 217
662 3300014325 Ga0163163_10091516 Ga0163163_100915161 217
663 3300014326 Ga0157380_10032967 Ga0157380_100329674 217
664 3300014326 Ga0157380_10227157 Ga0157380_102271572 217
665 3300014326 Ga0157380_10588922 Ga0157380_105889222 217
666 3300014745 Ga0157377_10075394 Ga0157377_100753942 217
667 3300014968 Ga0157379_10004542 Ga0157379_100045422 217
668 3300014968 Ga0157379_10023074 Ga0157379_100230742 217
669 3300014968 Ga0157379_10600278 Ga0157379_106002781 217
670 3300017792 Ga0163161_10034360 Ga0163161_100343602 217
671 3300020069 Ga0197907_10065295 Ga0197907_100652951 217
672 3300020069 Ga0197907_10556007 Ga0197907_105560073 217
673 3300020069 Ga0197907_10807907 Ga0197907_108079071 217
674 3300020070 Ga0206356_11135239 Ga0206356_111352391 217
675 3300020070 Ga0206356_11744870 Ga0206356_117448703 217
676 3300020075 Ga0206349_1139987 Ga0206349_11399871 217
677 3300020078 Ga0206352_10165450 Ga0206352_101654501 217
678 3300020080 Ga0206350_11349959 Ga0206350_113499591 217
679 3300020081 Ga0206354_10393434 Ga0206354_103934342 217
680 3300020081 Ga0206354_11593635 Ga0206354_115936351 217
681 3300020082 Ga0206353_10370532 Ga0206353_103705323 217
682 3300020082 Ga0206353_11564124 Ga0206353_115641241 217
683 3300022467 Ga0224712_10029299 Ga0224712_100292992 217
684 3300022467 Ga0224712_10214034 Ga0224712_102140342 217
685 3300022467 Ga0224712_10252045 Ga0224712_102520451 217
686 3300025315 Ga0207697_10000158 Ga0207697_100001584 217
687 3300025315 Ga0207697_10035271 Ga0207697_100352712 217
688 3300025321 Ga0207656_10034107 Ga0207656_100341072 217
689 3300025321 Ga0207656_10043245 Ga0207656_100432451 217
690 3300025321 Ga0207656_10103505 Ga0207656_101035052 217
691 3300025893 Ga0207682_10115601 Ga0207682_101156011 217
692 3300025893 Ga0207682_10196231 Ga0207682_101962311 217
693 3300025899 Ga0207642_10032955 Ga0207642_100329552 217
694 3300025899 Ga0207642_10161518 Ga0207642_101615181 217
695 3300025899 Ga0207642_10165599 Ga0207642_101655991 217
696 3300025901 Ga0207688_10000317 Ga0207688_100003173 217
697 3300025901 Ga0207688_10003267 Ga0207688_100032673 217
698 3300025901 Ga0207688_10101166 Ga0207688_101011662 217
699 3300025903 Ga0207680_10000681 Ga0207680_100006815 217
700 3300025903 Ga0207680_10013048 Ga0207680_100130482 217
701 3300025903 Ga0207680_10023816 Ga0207680_100238164 217
702 3300025903 Ga0207680_10079421 Ga0207680_100794212 217
703 3300025903 Ga0207680_10086033 Ga0207680_100860331 217
704 3300025904 Ga0207647_10000253 Ga0207647_1000025323 217
705 3300025904 Ga0207647_10004069 Ga0207647_1000406911 217
706 3300025904 Ga0207647_10004979 Ga0207647_100049792 217
707 3300025904 Ga0207647_10043619 Ga0207647_100436193 217
708 3300025904 Ga0207647_10059394 Ga0207647_100593942 217
709 3300025904 Ga0207647_10121357 Ga0207647_101213572 217
710 3300025904 Ga0207647_10158968 Ga0207647_101589682 217
711 3300025904 Ga0207647_10195915 Ga0207647_101959152 217
712 3300025906 Ga0207699_10220519 Ga0207699_102205191 217
713 3300025907 Ga0207645_10013547 Ga0207645_100135476 217
714 3300025907 Ga0207645_10026481 Ga0207645_100264813 217
715 3300025907 Ga0207645_10044423 Ga0207645_100444232 217
716 3300025907 Ga0207645_10087607 Ga0207645_100876071 217
717 3300025907 Ga0207645_10103225 Ga0207645_101032252 217
718 3300025908 Ga0207643_10036524 Ga0207643_100365243 217
719 3300025909 Ga0207705_10000062 Ga0207705_10000062116 217
720 3300025909 Ga0207705_10006023 Ga0207705_100060232 217
721 3300025909 Ga0207705_10007756 Ga0207705_100077566 217
722 3300025909 Ga0207705_10011342 Ga0207705_100113423 217
723 3300025909 Ga0207705_10025698 Ga0207705_100256983 217
724 3300025909 Ga0207705_10028342 Ga0207705_100283422 217
725 3300025909 Ga0207705_10035958 Ga0207705_100359583 217
726 3300025909 Ga0207705_10043066 Ga0207705_100430661 217
727 3300025909 Ga0207705_10080321 Ga0207705_100803213 217
728 3300025909 Ga0207705_10294006 Ga0207705_102940061 217
729 3300025909 Ga0207705_10294084 Ga0207705_102940842 217
730 3300025911 Ga0207654_10083371 Ga0207654_100833711 217
731 3300025911 Ga0207654_10510213 Ga0207654_105102131 217
732 3300025912 Ga0207707_10025005 Ga0207707_100250055 217
733 3300025912 Ga0207707_10125330 Ga0207707_101253302 217
734 3300025912 Ga0207707_10169859 Ga0207707_101698592 217
735 3300025912 Ga0207707_10200505 Ga0207707_102005052 217
736 3300025912 Ga0207707_10295590 Ga0207707_102955902 217
737 3300025912 Ga0207707_10411432 Ga0207707_104114321 217
738 3300025912 Ga0207707_10476970 Ga0207707_104769701 217
739 3300025913 Ga0207695_10033529 Ga0207695_100335292 217
740 3300025913 Ga0207695_10175732 Ga0207695_101757322 217
741 3300025917 Ga0207660_10000049 Ga0207660_1000004922 217
742 3300025917 Ga0207660_10007093 Ga0207660_100070937 217
743 3300025917 Ga0207660_10012629 Ga0207660_100126293 217
744 3300025917 Ga0207660_10039636 Ga0207660_100396362 217
745 3300025917 Ga0207660_10044181 Ga0207660_100441813 217
746 3300025917 Ga0207660_10065299 Ga0207660_100652992 217
747 3300025917 Ga0207660_10071751 Ga0207660_100717513 217
748 3300025919 Ga0207657_10000403 Ga0207657_1000040330 217
749 3300025919 Ga0207657_10002900 Ga0207657_1000290017 217
750 3300025919 Ga0207657_10006708 Ga0207657_100067086 217
751 3300025919 Ga0207657_10010167 Ga0207657_100101676 217
752 3300025919 Ga0207657_10011406 Ga0207657_100114064 217
753 3300025919 Ga0207657_10011918 Ga0207657_100119183 217
754 3300025919 Ga0207657_10014704 Ga0207657_100147044 217
755 3300025919 Ga0207657_10068358 Ga0207657_100683583 217
756 3300025919 Ga0207657_10133112 Ga0207657_101331122 217
757 3300025919 Ga0207657_10301125 Ga0207657_103011252 217
758 3300025920 Ga0207649_10000230 Ga0207649_1000023044 217
759 3300025920 Ga0207649_10007546 Ga0207649_100075464 217
760 3300025920 Ga0207649_10012784 Ga0207649_100127844 217
761 3300025920 Ga0207649_10018682 Ga0207649_100186823 217
762 3300025920 Ga0207649_10026507 Ga0207649_100265072 217
763 3300025920 Ga0207649_10041731 Ga0207649_100417312 217
764 3300025920 Ga0207649_10052647 Ga0207649_100526473 217
765 3300025920 Ga0207649_10201938 Ga0207649_102019381 217
766 3300025920 Ga0207649_10380604 Ga0207649_103806042 217
767 3300025921 Ga0207652_10109275 Ga0207652_101092753 217
768 3300025921 Ga0207652_10142814 Ga0207652_101428142 217
769 3300025921 Ga0207652_10207673 Ga0207652_102076732 217
770 3300025921 Ga0207652_10483998 Ga0207652_104839981 217
771 3300025921 Ga0207652_10737061 Ga0207652_107370611 217
772 3300025923 Ga0207681_10045552 Ga0207681_100455523 217
773 3300025923 Ga0207681_10179255 Ga0207681_101792551 217
774 3300025923 Ga0207681_10253601 Ga0207681_102536012 217
775 3300025923 Ga0207681_10306865 Ga0207681_103068651 217
776 3300025924 Ga0207694_10028971 Ga0207694_100289714 217
777 3300025924 Ga0207694_10123584 Ga0207694_101235841 217
778 3300025924 Ga0207694_10347910 Ga0207694_103479102 217
779 3300025924 Ga0207694_10392577 Ga0207694_103925771 217
780 3300025925 Ga0207650_10016419 Ga0207650_100164195 217
781 3300025925 Ga0207650_10018631 Ga0207650_100186313 217
782 3300025925 Ga0207650_10029822 Ga0207650_100298222 217
783 3300025925 Ga0207650_10882224 Ga0207650_108822241 217
784 3300025926 Ga0207659_10028253 Ga0207659_100282533 217
785 3300025926 Ga0207659_10089226 Ga0207659_100892263 217
786 3300025926 Ga0207659_10127013 Ga0207659_101270131 217
787 3300025927 Ga0207687_10031400 Ga0207687_100314003 217
788 3300025927 Ga0207687_10051360 Ga0207687_100513602 217
789 3300025928 Ga0207700_10013879 Ga0207700_100138794 217
790 3300025929 Ga0207664_10024314 Ga0207664_100243143 217
791 3300025929 Ga0207664_10501139 Ga0207664_105011391 217
792 3300025931 Ga0207644_10000695 Ga0207644_1000069521 217
793 3300025931 Ga0207644_10005273 Ga0207644_100052733 217
794 3300025931 Ga0207644_10018366 Ga0207644_100183664 217
795 3300025931 Ga0207644_10022968 Ga0207644_100229683 217
796 3300025931 Ga0207644_10030225 Ga0207644_100302254 217
797 3300025931 Ga0207644_10032584 Ga0207644_100325842 217
798 3300025931 Ga0207644_10039516 Ga0207644_100395161 217
799 3300025931 Ga0207644_10143266 Ga0207644_101432662 217
800 3300025931 Ga0207644_10207003 Ga0207644_102070032 217
801 3300025931 Ga0207644_10253225 Ga0207644_102532251 217
802 3300025932 Ga0207690_10000155 Ga0207690_1000015531 217
803 3300025932 Ga0207690_10004169 Ga0207690_100041692 217
804 3300025932 Ga0207690_10017213 Ga0207690_100172132 217
805 3300025932 Ga0207690_10031693 Ga0207690_100316934 217
806 3300025932 Ga0207690_10049606 Ga0207690_100496063 217
807 3300025932 Ga0207690_10064121 Ga0207690_100641213 217
808 3300025932 Ga0207690_10116843 Ga0207690_101168432 217
809 3300025932 Ga0207690_10289868 Ga0207690_102898682 217
810 3300025933 Ga0207706_10000342 Ga0207706_1000034234 217
811 3300025933 Ga0207706_10000643 Ga0207706_1000064327 217
812 3300025933 Ga0207706_10001263 Ga0207706_100012636 217
813 3300025933 Ga0207706_10007033 Ga0207706_100070336 217
814 3300025933 Ga0207706_10007778 Ga0207706_100077787 217
815 3300025933 Ga0207706_10032063 Ga0207706_100320633 217
816 3300025933 Ga0207706_10035989 Ga0207706_100359893 217
817 3300025933 Ga0207706_10121521 Ga0207706_101215212 217
818 3300025933 Ga0207706_10187567 Ga0207706_101875671 217
819 3300025933 Ga0207706_10219339 Ga0207706_102193393 217
820 3300025933 Ga0207706_10257765 Ga0207706_102577651 217
821 3300025933 Ga0207706_10280777 Ga0207706_102807771 217
822 3300025935 Ga0207709_10074709 Ga0207709_100747092 217
823 3300025936 Ga0207670_10197849 Ga0207670_101978492 217
824 3300025936 Ga0207670_10437740 Ga0207670_104377402 217
825 3300025937 Ga0207669_10013845 Ga0207669_100138453 217
826 3300025937 Ga0207669_10054465 Ga0207669_100544651 217
827 3300025938 Ga0207704_10098044 Ga0207704_100980442 217
828 3300025938 Ga0207704_10274938 Ga0207704_102749382 217
829 3300025939 Ga0207665_10158241 Ga0207665_101582412 217
830 3300025940 Ga0207691_10000848 Ga0207691_100008488 217
831 3300025940 Ga0207691_10001147 Ga0207691_1000114718 217
832 3300025940 Ga0207691_10078368 Ga0207691_100783683 217
833 3300025940 Ga0207691_10093178 Ga0207691_100931782 217
834 3300025940 Ga0207691_10107428 Ga0207691_101074281 217
835 3300025940 Ga0207691_10251487 Ga0207691_102514872 217
836 3300025941 Ga0207711_10003628 Ga0207711_100036284 217
837 3300025941 Ga0207711_10003912 Ga0207711_100039128 217
838 3300025941 Ga0207711_10004265 Ga0207711_100042658 217
839 3300025941 Ga0207711_10017606 Ga0207711_100176062 217
840 3300025941 Ga0207711_10018660 Ga0207711_100186603 217
841 3300025941 Ga0207711_10022793 Ga0207711_100227934 217
842 3300025941 Ga0207711_10037257 Ga0207711_100372574 217
843 3300025941 Ga0207711_10210499 Ga0207711_102104992 217
844 3300025942 Ga0207689_10000017 Ga0207689_1000001733 217
845 3300025942 Ga0207689_10010558 Ga0207689_100105584 217
846 3300025942 Ga0207689_10044482 Ga0207689_100444824 217
847 3300025942 Ga0207689_10376750 Ga0207689_103767502 217
848 3300025944 Ga0207661_10000947 Ga0207661_1000094720 217
849 3300025944 Ga0207661_10050831 Ga0207661_100508311 217
850 3300025944 Ga0207661_10482517 Ga0207661_104825172 217
851 3300025945 Ga0207679_10000213 Ga0207679_1000021331 217
852 3300025945 Ga0207679_10010265 Ga0207679_100102654 217
853 3300025945 Ga0207679_10046450 Ga0207679_100464502 217
854 3300025945 Ga0207679_10188575 Ga0207679_101885752 217
855 3300025945 Ga0207679_10242979 Ga0207679_102429792 217
856 3300025945 Ga0207679_10299416 Ga0207679_102994162 217
857 3300025945 Ga0207679_10334082 Ga0207679_103340822 217
858 3300025949 Ga0207667_10001300 Ga0207667_1000130030 217
859 3300025949 Ga0207667_10027212 Ga0207667_100272125 217
860 3300025949 Ga0207667_10100369 Ga0207667_101003693 217
861 3300025949 Ga0207667_10144280 Ga0207667_101442803 217
862 3300025949 Ga0207667_10192850 Ga0207667_101928502 217
863 3300025949 Ga0207667_10349064 Ga0207667_103490642 217
864 3300025949 Ga0207667_10758583 Ga0207667_107585831 217
865 3300025960 Ga0207651_10006199 Ga0207651_100061993 217
866 3300025960 Ga0207651_10029218 Ga0207651_100292182 217
867 3300025960 Ga0207651_10037678 Ga0207651_100376784 217
868 3300025960 Ga0207651_10090774 Ga0207651_100907741 217
869 3300025960 Ga0207651_10439344 Ga0207651_104393441 217
870 3300025960 Ga0207651_10732149 Ga0207651_107321491 217
871 3300025960 Ga0207651_11014212 Ga0207651_110142121 217
872 3300025972 Ga0207668_10000223 Ga0207668_1000022336 217
873 3300025972 Ga0207668_10013108 Ga0207668_100131083 217
874 3300025972 Ga0207668_10123024 Ga0207668_101230242 217
875 3300025972 Ga0207668_10139158 Ga0207668_101391582 217
876 3300025972 Ga0207668_10173511 Ga0207668_101735111 217
877 3300025981 Ga0207640_10002788 Ga0207640_100027884 217
878 3300025981 Ga0207640_10010153 Ga0207640_100101535 217
879 3300025981 Ga0207640_10040461 Ga0207640_100404612 217
880 3300025981 Ga0207640_10089040 Ga0207640_100890402 217
881 3300025981 Ga0207640_10221250 Ga0207640_102212501 217
882 3300025986 Ga0207658_10007346 Ga0207658_100073466 217
883 3300025986 Ga0207658_10008048 Ga0207658_100080483 217
884 3300025986 Ga0207658_10079146 Ga0207658_100791462 217
885 3300025986 Ga0207658_10087172 Ga0207658_100871723 217
886 3300025986 Ga0207658_10114857 Ga0207658_101148572 217
887 3300025986 Ga0207658_10351519 Ga0207658_103515191 217
888 3300026023 Ga0207677_10160288 Ga0207677_101602882 217
889 3300026035 Ga0207703_10006402 Ga0207703_1000640210 217
890 3300026035 Ga0207703_10007329 Ga0207703_100073293 217
891 3300026035 Ga0207703_10026010 Ga0207703_100260103 217
892 3300026035 Ga0207703_10082973 Ga0207703_100829733 217
893 3300026035 Ga0207703_10189826 Ga0207703_101898262 217
894 3300026035 Ga0207703_10855857 Ga0207703_108558571 217
895 3300026041 Ga0207639_10000347 Ga0207639_1000034710 217
896 3300026041 Ga0207639_10142526 Ga0207639_101425262 217
897 3300026041 Ga0207639_10220133 Ga0207639_102201333 217
898 3300026067 Ga0207678_10001692 Ga0207678_100016923 217
899 3300026067 Ga0207678_10004182 Ga0207678_100041827 217
900 3300026067 Ga0207678_10005277 Ga0207678_100052772 217
901 3300026067 Ga0207678_10013156 Ga0207678_100131567 217
902 3300026067 Ga0207678_10015700 Ga0207678_100157003 217
903 3300026067 Ga0207678_10029181 Ga0207678_100291814 217
904 3300026067 Ga0207678_10035314 Ga0207678_100353143 217
905 3300026067 Ga0207678_10049787 Ga0207678_100497873 217
906 3300026067 Ga0207678_10051881 Ga0207678_100518813 217
907 3300026067 Ga0207678_10083355 Ga0207678_100833552 217
908 3300026067 Ga0207678_10149656 Ga0207678_101496562 217
909 3300026067 Ga0207678_10355183 Ga0207678_103551832 217
910 3300026067 Ga0207678_10452723 Ga0207678_104527232 217
911 3300026067 Ga0207678_10508532 Ga0207678_105085322 217
912 3300026078 Ga0207702_10000496 Ga0207702_1000049620 217
913 3300026078 Ga0207702_10015606 Ga0207702_100156063 217
914 3300026078 Ga0207702_10022763 Ga0207702_100227633 217
915 3300026078 Ga0207702_10034421 Ga0207702_100344214 217
916 3300026088 Ga0207641_10005331 Ga0207641_100053314 217
917 3300026088 Ga0207641_10016993 Ga0207641_100169932 217
918 3300026088 Ga0207641_10019912 Ga0207641_100199126 217
919 3300026088 Ga0207641_10055221 Ga0207641_100552213 217
920 3300026088 Ga0207641_10205783 Ga0207641_102057832 217
921 3300026088 Ga0207641_10341796 Ga0207641_103417962 217
922 3300026089 Ga0207648_10001216 Ga0207648_100012164 217
923 3300026089 Ga0207648_10004524 Ga0207648_100045243 217
924 3300026089 Ga0207648_10008416 Ga0207648_1000841610 217
925 3300026089 Ga0207648_10023466 Ga0207648_100234665 217
926 3300026089 Ga0207648_10214526 Ga0207648_102145262 217
927 3300026095 Ga0207676_10003642 Ga0207676_100036422 217
928 3300026095 Ga0207676_10005936 Ga0207676_100059362 217
929 3300026095 Ga0207676_10047469 Ga0207676_100474694 217
930 3300026095 Ga0207676_10075224 Ga0207676_100752242 217
931 3300026095 Ga0207676_10115161 Ga0207676_101151613 217
932 3300026116 Ga0207674_10000527 Ga0207674_100005276 217
933 3300026116 Ga0207674_10000580 Ga0207674_1000058017 217
934 3300026116 Ga0207674_10007596 Ga0207674_100075969 217
935 3300026116 Ga0207674_10010532 Ga0207674_100105326 217
936 3300026116 Ga0207674_10016922 Ga0207674_100169222 217
937 3300026118 Ga0207675_100063451 Ga0207675_1000634514 217
938 3300026118 Ga0207675_100444648 Ga0207675_1004446482 217
939 3300026121 Ga0207683_10005055 Ga0207683_100050554 217
940 3300026121 Ga0207683_10012424 Ga0207683_100124242 217
941 3300026121 Ga0207683_10069188 Ga0207683_100691883 217
942 3300026121 Ga0207683_10092191 Ga0207683_100921912 217
943 3300026121 Ga0207683_10562702 Ga0207683_105627021 217
944 3300026121 Ga0207683_10646681 Ga0207683_106466811 217
945 3300026142 Ga0207698_10000815 Ga0207698_100008153 217
946 3300026142 Ga0207698_10003377 Ga0207698_100033776 217
947 3300026142 Ga0207698_10016447 Ga0207698_100164474 217
948 3300026142 Ga0207698_10112095 Ga0207698_101120952 217
949 3300026142 Ga0207698_10232548 Ga0207698_102325481 217
950 3300026142 Ga0207698_10279554 Ga0207698_102795541 217
951 3300026142 Ga0207698_10303254 Ga0207698_103032542 217
952 3300026142 Ga0207698_10322890 Ga0207698_103228902 217
953 3300026142 Ga0207698_10370918 Ga0207698_103709181 217
954 3300026142 Ga0207698_10589565 Ga0207698_105895652 217
955 3300028379 Ga0268266_10005814 Ga0268266_100058148 217
956 3300028379 Ga0268266_10034214 Ga0268266_100342142 217
957 3300028379 Ga0268266_10035777 Ga0268266_100357774 217
958 3300028379 Ga0268266_10156875 Ga0268266_101568752 217
959 3300028379 Ga0268266_10548325 Ga0268266_105483252 217
960 3300028379 Ga0268266_10965747 Ga0268266_109657471 217
961 3300028380 Ga0268265_10001836 Ga0268265_100018362 217
962 3300028380 Ga0268265_10015327 Ga0268265_100153275 217
963 3300028380 Ga0268265_10362541 Ga0268265_103625412 217
964 3300028381 Ga0268264_10008809 Ga0268264_100088095 217
965 3300028381 Ga0268264_10126648 Ga0268264_101266482 217
966 3300028381 Ga0268264_11015421 Ga0268264_110154211 217
967 3300028381 Ga0268264_11330835 Ga0268264_113308351 217
968 3300030731 Ga0316177_1039112 Ga0316177_10391122 217
969 3300030732 Ga0316176_1128831 Ga0316176_11288311 217
970 3300031548 Ga0307408_100018322 Ga0307408_1000183224 217
971 3300031548 Ga0307408_100094101 Ga0307408_1000941012 217
972 3300031548 Ga0307408_100847936 Ga0307408_1008479361 217
973 3300031731 Ga0307405_10048768 Ga0307405_100487683 217
974 3300031731 Ga0307405_10058162 Ga0307405_100581621 217
975 3300031824 Ga0307413_10260688 Ga0307413_102606882 217
976 3300031824 Ga0307413_10282229 Ga0307413_102822292 217
977 3300031824 Ga0307413_10602566 Ga0307413_106025661 217
978 3300031824 Ga0307413_10701810 Ga0307413_107018101 217
979 3300031852 Ga0307410_10023293 Ga0307410_100232934 217
980 3300031852 Ga0307410_10082460 Ga0307410_100824602 217
981 3300031852 Ga0307410_10154174 Ga0307410_101541742 217
982 3300031889 Ga0326468_10016295 Ga0326468_100162952 217
983 3300031901 Ga0307406_10009726 Ga0307406_100097265 217
984 3300031903 Ga0307407_10017566 Ga0307407_100175664 217
985 3300031903 Ga0307407_10078677 Ga0307407_100786772 217
986 3300031911 Ga0307412_10117389 Ga0307412_101173893 217
987 3300031911 Ga0307412_10126569 Ga0307412_101265691 217
988 3300031995 Ga0307409_100012250 Ga0307409_1000122504 217
989 3300031995 Ga0307409_100068300 Ga0307409_1000683001 217
990 3300031995 Ga0307409_101109740 Ga0307409_1011097401 217
991 3300032002 Ga0307416_100047905 Ga0307416_1000479053 217
992 3300032002 Ga0307416_100206447 Ga0307416_1002064473 217
993 3300032004 Ga0307414_10055431 Ga0307414_100554312 217
994 3300032005 Ga0307411_10003538 Ga0307411_100035386 217
995 3300032005 Ga0307411_10013644 Ga0307411_100136443 217
996 3300032005 Ga0307411_10030485 Ga0307411_100304855 217
997 3300032005 Ga0307411_10039289 Ga0307411_100392893 217
998 3300032126 Ga0307415_100075489 Ga0307415_1000754891 217
999 3300032126 Ga0307415_100461100 Ga0307415_1004611002 217
1000 3300032126 Ga0307415_100469231 Ga0307415_1004692311 217
1001 3300034816 Ga0373930_0004606 Ga0373930_0004606_342_995 217
1002 3300035088 Ga0373940_0128637 Ga0373940_0128637_59_715 217
1003 3300035115 Ga0373941_0013503 Ga0373941_0013503_314_967 217
1004 3300035121 Ga0373960_0192074 Ga0373960_0192074_41_694 217
1005 3300035170 Ga0373943_0029338 Ga0373943_0029338_498_1151 217
1006 3300035691 Ga0373931_0016681 Ga0373931_0016681_1330_1983 217
1007 3300037312 Ga0395899_0008985 Ga0395899_0008985_47_700 217
1008 3300037312 Ga0395899_0035442 Ga0395899_0035442_2963_3616 217
1009 3300037312 Ga0395899_0035725 Ga0395899_0035725_1406_2059 217
1010 3300037312 Ga0395899_0040918 Ga0395899_0040918_840_1493 217
1011 3300037312 Ga0395899_0147509 Ga0395899_0147509_77_730 217
1012 3300037312 Ga0395899_0192425 Ga0395899_0192425_295_948 217
1013 3300037312 Ga0395899_0226796 Ga0395899_0226796_207_860 217
1014 3300037312 Ga0395899_0293124 Ga0395899_0293124_13_666 217
1015 3300037418 Ga0395900_0018521 Ga0395900_0018521_755_1408 217
1016 3300037418 Ga0395900_0026764 Ga0395900_0026764_3040_3693 217
1017 3300037418 Ga0395900_0028257 Ga0395900_0028257_2973_3626 217
1018 3300037418 Ga0395900_0062933 Ga0395900_0062933_1490_2143 217
1019 3300037418 Ga0395900_0077309 Ga0395900_0077309_723_1376 217
1020 3300037418 Ga0395900_0141515 Ga0395900_0141515_765_1418 217
1021 3300037418 Ga0395900_0223154 Ga0395900_0223154_1068_1721 217
1022 3300037418 Ga0395900_0477759 Ga0395900_0477759_42_695 217
1023 3300037466 Ga0395898_0038179 Ga0395898_0038179_1423_2076 217
1024 3300037466 Ga0395898_0091613 Ga0395898_0091613_443_1096 217
1025 3300037466 Ga0395898_0159585 Ga0395898_0159585_853_1506 217
1026 3300037466 Ga0395898_0170197 Ga0395898_0170197_1368_2021 217
1027 3300037466 Ga0395898_0371377 Ga0395898_0371377_375_1028 217
1028 3300037466 Ga0395898_0384024 Ga0395898_0384024_304_957 217
1029 3300037471 Ga0395905_0015453 Ga0395905_0015453_5750_6403 217
1030 3300037471 Ga0395905_0031688 Ga0395905_0031688_3461_4114 217
1031 3300037471 Ga0395905_0070915 Ga0395905_0070915_2491_3144 217
1032 3300037471 Ga0395905_0093597 Ga0395905_0093597_1652_2305 217
1033 3300037471 Ga0395905_0102081 Ga0395905_0102081_113_766 217
1034 3300037471 Ga0395905_0106153 Ga0395905_0106153_825_1478 217
1035 3300037471 Ga0395905_0143060 Ga0395905_0143060_919_1572 217
1036 3300037471 Ga0395905_0397333 Ga0395905_0397333_334_987 217
1037 3300037471 Ga0395905_0413885 Ga0395905_0413885_311_964 217
1038 3300037471 Ga0395905_0447872 Ga0395905_0447872_181_834 217
1039 3300037471 Ga0395905_0855323 Ga0395905_0855323_17_670 217
1040 3300037853 Ga0436364_0996148 Ga0436364_0996148_3369_4028 217
1041 3300038443 Ga0395901_0029354 Ga0395901_0029354_546_1199 217
1042 3300038443 Ga0395901_0075005 Ga0395901_0075005_1487_2140 217
1043 3300038443 Ga0395901_0082710 Ga0395901_0082710_47_700 217
1044 3300038443 Ga0395901_0206673 Ga0395901_0206673_435_1088 217
1045 3300038443 Ga0395901_0294139 Ga0395901_0294139_92_745 217
1046 3300038443 Ga0395901_0312899 Ga0395901_0312899_379_1032 217
1047 3300038443 Ga0395901_0327327 Ga0395901_0327327_436_1089 217
1048 3300038443 Ga0395901_0502782 Ga0395901_0502782_325_978 217
1049 3300038443 Ga0395901_0530103 Ga0395901_0530103_435_1088 217
1050 3300039437 Ga0436365_0802722 Ga0436365_0802722_2706_3359 217
1051 3300039450 Ga0436363_0623631 Ga0436363_0623631_678_1331 217
1052 3300041413 Ga0439465_0025016 Ga0439465_0025016_778_1431 217
1053 3300041512 Ga0451853_2006474 Ga0451853_2006474_678_1331 217
1054 3300044658 Ga0466972_0032697 Ga0466972_0032697_726_1379 217
1055 3300044683 Ga0466965_0240409 Ga0466965_0240409_238_891 217
1056 3300044684 Ga0466966_0154511 Ga0466966_0154511_122_775 217
1057 3300044693 Ga0466961_0085448 Ga0466961_0085448_1085_1738 217
1058 3300044693 Ga0466961_0086810 Ga0466961_0086810_1114_1767 217
1059 3300044694 Ga0466963_0147729 Ga0466963_0147729_371_1024 217
1060 3300044694 Ga0466963_0172047 Ga0466963_0172047_707_1360 217
1061 3300044706 Ga0466964_0002041 Ga0466964_0002041_6419_7072 217
1062 3300044719 Ga0466971_0096227 Ga0466971_0096227_471_1124 217
1063 3300044719 Ga0466971_0232631 Ga0466971_0232631_185_838 217
1064 3300044735 Ga0466968_0004014 Ga0466968_0004014_1762_2415 217
1065 3300044765 Ga0466970_0009178 Ga0466970_0009178_2164_2817 217
1066 3300044842 Ga0466957_0011549 Ga0466957_0011549_1237_1890 217
1067 3300044901 Ga0466960_0064988 Ga0466960_0064988_263_916 217
1068 3300045049 Ga0466959_0052885 Ga0466959_0052885_1064_1717 217
1069 3300045049 Ga0466959_0109871 Ga0466959_0109871_1209_1862 217
1070 3300045836 Ga0466958_0087472 Ga0466958_0087472_483_1136 217
1071 3300045976 Ga0466967_0007335 Ga0466967_0007335_5802_6455 217
1072 3300045976 Ga0466967_0022827 Ga0466967_0022827_749_1402 217
1073 3300045976 Ga0466967_0370348 Ga0466967_0370348_658_1311 217
1074 3300045976 Ga0466967_0698523 Ga0466967_0698523_280_933 217
1075 3300046506 Ga0495583_0031762 Ga0495583_0031762_1255_1908 217
1076 3300046525 Ga0495663_0071778 Ga0495663_0071778_199_852 217
1077 3300046539 Ga0495621_0023456 Ga0495621_0023456_1077_1730 217
1078 3300046616 Ga0495668_0006182 Ga0495668_0006182_7155_7808 217
1079 3300046616 Ga0495668_0017226 Ga0495668_0017226_2816_3469 217
1080 3300046660 Ga0495625_0159120 Ga0495625_0159120_367_1020 217
1081 3300046684 Ga0495669_0003756 Ga0495669_0003756_3038_3691 217
1082 3300046684 Ga0495669_0015222 Ga0495669_0015222_1029_1682 217
1083 3300046684 Ga0495669_0028157 Ga0495669_0028157_500_1153 217
1084 3300046684 Ga0495669_0032311 Ga0495669_0032311_948_1601 217
1085 3300046684 Ga0495669_0035478 Ga0495669_0035478_1255_1908 217
1086 3300046684 Ga0495669_0063285 Ga0495669_0063285_378_1031 217
1087 3300046684 Ga0495669_0108022 Ga0495669_0108022_381_1037 217
1088 3300046684 Ga0495669_0223333 Ga0495669_0223333_69_722 217
1089 3300046691 Ga0495670_0149087 Ga0495670_0149087_418_1071 217
1090 3300047445 Ga0495677_0014367 Ga0495677_0014367_413_1066 217
1091 3300047445 Ga0495677_0113937 Ga0495677_0113937_167_820 217
1092 3300048903 Ga0496100_0058657 Ga0496100_0058657_214_867 217
1093 3300048903 Ga0496100_0727909 Ga0496100_0727909_91_744 217
1094 3300048904 Ga0496101_0032469 Ga0496101_0032469_2616_3269 217
1095 3300048904 Ga0496101_0152479 Ga0496101_0152479_142_795 217
1096 3300048904 Ga0496101_0195652 Ga0496101_0195652_47_700 217
1097 3300048905 Ga0496102_0006009 Ga0496102_0006009_281_934 217
1098 3300048906 Ga0496103_0034087 Ga0496103_0034087_2131_2784 217
1099 3300048906 Ga0496103_0311389 Ga0496103_0311389_254_907 217
1100 3300048907 Ga0496104_0535000 Ga0496104_0535000_165_818 217
1101 3300048909 Ga0496106_0005020 Ga0496106_0005020_218_871 217
1102 3300048909 Ga0496106_0021199 Ga0496106_0021199_1026_1679 217
1103 3300048909 Ga0496106_0046809 Ga0496106_0046809_76_729 217
1104 3300048909 Ga0496106_0272352 Ga0496106_0272352_613_1266 217
1105 3300048909 Ga0496106_0815681 Ga0496106_0815681_56_709 217
1106 3300048910 Ga0496107_0002436 Ga0496107_0002436_9888_10541 217
1107 3300048910 Ga0496107_0005092 Ga0496107_0005092_695_1348 217
1108 3300048910 Ga0496107_0008596 Ga0496107_0008596_2762_3415 217
1109 3300048910 Ga0496107_0038529 Ga0496107_0038529_1272_1925 217
1110 3300048910 Ga0496107_0059320 Ga0496107_0059320_837_1490 217
1111 3300048910 Ga0496107_0126842 Ga0496107_0126842_328_981 217
1112 3300048911 Ga0496108_0004564 Ga0496108_0004564_6501_7154 217
1113 3300048911 Ga0496108_0006742 Ga0496108_0006742_2849_3502 217
1114 3300048911 Ga0496108_0008862 Ga0496108_0008862_3659_4312 217
1115 3300048911 Ga0496108_0011381 Ga0496108_0011381_2016_2669 217
1116 3300048911 Ga0496108_0028075 Ga0496108_0028075_734_1387 217
1117 3300048911 Ga0496108_0503053 Ga0496108_0503053_141_794 217
1118 3300048912 Ga0496109_0019963 Ga0496109_0019963_229_882 217
1119 3300048912 Ga0496109_0057642 Ga0496109_0057642_1781_2434 217
1120 3300048912 Ga0496109_0067752 Ga0496109_0067752_488_1141 217
1121 3300048912 Ga0496109_0222384 Ga0496109_0222384_668_1321 217
1122 3300048913 Ga0496110_0007127 Ga0496110_0007127_2321_2974 217
1123 3300048913 Ga0496110_0009337 Ga0496110_0009337_2095_2748 217
1124 3300048913 Ga0496110_0030024 Ga0496110_0030024_789_1442 217
1125 3300048913 Ga0496110_0054535 Ga0496110_0054535_1923_2576 217
1126 3300048913 Ga0496110_0462841 Ga0496110_0462841_168_821 217
1127 3300048914 Ga0496111_0003961 Ga0496111_0003961_2175_2828 217
1128 3300048914 Ga0496111_0021015 Ga0496111_0021015_3046_3699 217
1129 3300048914 Ga0496111_0040567 Ga0496111_0040567_780_1433 217
1130 3300048914 Ga0496111_0057825 Ga0496111_0057825_830_1483 217
1131 3300048914 Ga0496111_0142280 Ga0496111_0142280_70_723 217
1132 3300048914 Ga0496111_0149025 Ga0496111_0149025_519_1172 217
1133 3300048915 Ga0496112_0010358 Ga0496112_0010358_4102_4755 217
1134 3300048915 Ga0496112_0013820 Ga0496112_0013820_2672_3325 217
1135 3300048915 Ga0496112_0165145 Ga0496112_0165145_383_1036 217
1136 3300048916 Ga0496113_0010547 Ga0496113_0010547_3165_3818 217
1137 3300048916 Ga0496113_0011833 Ga0496113_0011833_2747_3400 217
1138 3300048916 Ga0496113_0134697 Ga0496113_0134697_610_1263 217
1139 3300048917 Ga0496114_0000131 Ga0496114_0000131_24588_25241 217
1140 3300048918 Ga0496115_0019427 Ga0496115_0019427_1363_2016 217
1141 3300049584 Ga0501068_0212442 Ga0501068_0212442_383_1036 217
1142 3300049587 Ga0501071_0506914 Ga0501071_0506914_79_732 217
1143 3300049661 Ga0501217_078702 Ga0501217_078702_78_731 217
1144 3300049663 Ga0501223_025580 Ga0501223_025580_319_972 217
1145 3300049669 Ga0501235_018932 Ga0501235_018932_213_866 217
1146 3300049687 Ga0501258_000814 Ga0501258_000814_526_1179 217
1147 3300049760 Ga0501263_003221 Ga0501263_003221_53_706 217
1148 3300050496 nmdc:mga07m45_147399_c1 nmdc:mga07m45_147399_c1_428_1081 217
1149 3300053134 Ga0500658_0000073 Ga0500658_0000073_36893_37546 217
1150 3300053158 Ga0500627_0086087 Ga0500627_0086087_575_1228 217
1151 3300059640 Ga0587067_069223 Ga0587067_069223_28_681 217
1152 3300061719 Ga0466962_0067245 Ga0466962_0067245_1002_1655 217
1153 3300037418 Ga0395900_0072862 Ga0395900_0072862_2427_3164 218
1154 3300037418 Ga0395900_0073075 Ga0395900_0073075_2422_3159 218
1155 3300037466 Ga0395898_0414156 Ga0395898_0414156_512_1249 218
1156 3300044656 Ga0466969_0005933 Ga0466969_0005933_1140_1877 218
1157 3300044684 Ga0466966_0311850 Ga0466966_0311850_118_855 218
1158 3300044693 Ga0466961_0010870 Ga0466961_0010870_3291_4028 218
1159 3300044694 Ga0466963_0129481 Ga0466963_0129481_91_828 218
1160 3300044719 Ga0466971_0071698 Ga0466971_0071698_283_1020 218
1161 3300044765 Ga0466970_0080447 Ga0466970_0080447_128_865 218
1162 3300044842 Ga0466957_0004078 Ga0466957_0004078_1415_2152 218
1163 3300045836 Ga0466958_0023425 Ga0466958_0023425_679_1416 218
1164 3300061719 Ga0466962_0002842 Ga0466962_0002842_2112_2849 218
1165 3300005539 Ga0068853_100362769 Ga0068853_1003627692 219
1166 3300013104 Ga0157370_10073474 Ga0157370_100734742 219
1167 3300025912 Ga0207707_10560269 Ga0207707_105602691 219
1168 3300048905 Ga0496102_0138834 Ga0496102_0138834_1140_1808 220
1169 3300048906 Ga0496103_0173675 Ga0496103_0173675_551_1219 220
1170 3300005339 Ga0070660_100017750 Ga0070660_1000177503 226
1171 3300045976 Ga0466967_0073433 Ga0466967_0073433_550_1233 226
1172 3300031911 Ga0307412_10801371 Ga0307412_108013711 228
1173 3300005347 Ga0070668_100100911 Ga0070668_1001009112 230
1174 3300005367 Ga0070667_100722323 Ga0070667_1007223231 230
1175 3300005539 Ga0068853_100450181 Ga0068853_1004501812 230
1176 3300005844 Ga0068862_100014049 Ga0068862_1000140494 230
1177 3300025972 Ga0207668_10122248 Ga0207668_101222483 230
1178 3300026041 Ga0207639_10355032 Ga0207639_103550322 230
1179 3300028380 Ga0268265_10008727 Ga0268265_100087275 230
1180 3300046525 Ga0495663_0005944 Ga0495663_0005944_2129_2839 230
1181 3300005459 Ga0068867_100005296 Ga0068867_1000052963 233
1182 3300005539 Ga0068853_100129098 Ga0068853_1001290982 233
1183 3300005834 Ga0068851_10071363 Ga0068851_100713632 233
1184 3300025321 Ga0207656_10050124 Ga0207656_100501242 233
1185 3300025909 Ga0207705_10092416 Ga0207705_100924162 233
1186 3300026041 Ga0207639_10055955 Ga0207639_100559552 233
1187 3300026089 Ga0207648_10006444 Ga0207648_100064445 233
1188 3300026142 Ga0207698_10020485 Ga0207698_100204854 233
1189 3300005327 Ga0070658_10007017 Ga0070658_100070171 237
1190 3300005563 Ga0068855_101071399 Ga0068855_1010713991 237
1191 3300025919 Ga0207657_10000806 Ga0207657_1000080641 237
1192 3300037418 Ga0395900_0548919 Ga0395900_0548919_69_791 237
1193 3300037471 Ga0395905_0279803 Ga0395905_0279803_187_909 237
1194 3300013306 Ga0163162_10252327 Ga0163162_102523272 239
1195 3300013308 Ga0157375_10004348 Ga0157375_100043484 239
1196 3300014325 Ga0163163_10291852 Ga0163163_102918521 239
1197 3300032005 Ga0307411_10115067 Ga0307411_101150671 239
1198 3300046539 Ga0495621_0005701 Ga0495621_0005701_1852_2589 239
1199 3300046691 Ga0495670_0012515 Ga0495670_0012515_1613_2350 239
1200 3300047445 Ga0495677_0024518 Ga0495677_0024518_1429_2166 239
1201 3300048910 Ga0496107_0006978 Ga0496107_0006978_3644_4366 239
1202 3300048912 Ga0496109_0020941 Ga0496109_0020941_3783_4505 239
1203 3300048913 Ga0496110_0010516 Ga0496110_0010516_3109_3831 239
1204 3300048914 Ga0496111_0053188 Ga0496111_0053188_660_1382 239
1205 3300048917 Ga0496114_0005747 Ga0496114_0005747_2274_2996 239
1206 3300050510 nmdc:mga06r32_22563_c1 nmdc:mga06r32_22563_c1_4705_5442 239
1207 3300025921 Ga0207652_10127562 Ga0207652_101275623 240
1208 3300009553 Ga0105249_10010129 Ga0105249_100101294 242
1209 3300012512 Ga0157327_1007033 Ga0157327_10070331 242
1210 3300014326 Ga0157380_10005051 Ga0157380_100050518 242
1211 3300014745 Ga0157377_10393525 Ga0157377_103935251 242
1212 3300025932 Ga0207690_10478772 Ga0207690_104787721 242
1213 3300026075 Ga0207708_10287215 Ga0207708_102872153 242
1214 3300027876 Ga0209974_10108801 Ga0209974_101088012 242
1215 3300046539 Ga0495621_0000350 Ga0495621_0000350_10112_10858 242
1216 3300046691 Ga0495670_0010361 Ga0495670_0010361_1434_2180 242
1217 3300046691 Ga0495670_0014986 Ga0495670_0014986_2832_3578 242
1218 3300005547 Ga0070693_100031786 Ga0070693_1000317863 244
1219 3300037418 Ga0395900_0173206 Ga0395900_0173206_1396_2142 244
1220 3300001976 JGI24752J21851_1013291 JGI24752J21851_10132912 246
1221 3300005355 Ga0070671_100213153 Ga0070671_1002131532 246
1222 3300005364 Ga0070673_100106382 Ga0070673_1001063822 246
1223 3300005543 Ga0070672_100331505 Ga0070672_1003315051 246
1224 3300005617 Ga0068859_100026939 Ga0068859_1000269397 246
1225 3300005618 Ga0068864_100004851 Ga0068864_1000048514 246
1226 3300005841 Ga0068863_100436727 Ga0068863_1004367272 246
1227 3300005842 Ga0068858_100051595 Ga0068858_1000515954 246
1228 3300005843 Ga0068860_100019113 Ga0068860_1000191137 246
1229 3300006931 Ga0097620_100026941 Ga0097620_1000269417 246
1230 3300025923 Ga0207681_10042387 Ga0207681_100423873 246
1231 3300025931 Ga0207644_10098869 Ga0207644_100988692 246
1232 3300025940 Ga0207691_10192049 Ga0207691_101920492 246
1233 3300025941 Ga0207711_10003910 Ga0207711_100039109 246
1234 3300025942 Ga0207689_10056409 Ga0207689_100564093 246
1235 3300025961 Ga0207712_10006581 Ga0207712_100065814 246
1236 3300026088 Ga0207641_10021361 Ga0207641_100213614 246
1237 3300026095 Ga0207676_10059590 Ga0207676_100595902 246
1238 3300028381 Ga0268264_10024352 Ga0268264_100243522 246
1239 3300031852 Ga0307410_10003596 Ga0307410_100035962 246
1240 3300031903 Ga0307407_10031384 Ga0307407_100313842 246
1241 3300032002 Ga0307416_100069269 Ga0307416_1000692692 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04280

Tim44

Tim44-like domain

70

216

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cw9-assembly1.cif.gz_A crystal structure of human tim44 c-terminal domain 0.8324 105 243
3qk9-assembly1.cif.gz_A yeast tim44 c-terminal domain complexed with cymal-3 0.8115 103 243
7qh7-assembly1.cif.gz_d cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 4 0.8073 100 243
4ce4-assembly1.cif.gz_i 39s large subunit of the porcine mitochondrial ribosome 0.8004 102 245
8scx-assembly1.cif.gz_C cryo-em structure of the core tim23 complex from s. cerevisiae 0.7997 97 246
ID Description Score Start End Superfamily
af_O02161_236_422_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.884 100 243 3.10.450.240
af_Q1PF33_284_473_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8725 100 243 3.10.450.240
af_Q8GXP7_158_313_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8706 101 244 3.10.450.240
af_A0A1D6ILC0_91_266_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8571 103 243 3.10.450.240
af_O60084_228_426_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8184 100 243 3.10.450.240
ID Description Score Start End GO Terms
AF-A0A520HWE3-F1-model_v4 Tim44 domain-containing protein 0.9754 118 244
AF-A0A3S1EE53-F1-model_v4 Tim44 domain-containing protein 0.9739 101 245
AF-A0A356F5R0-F1-model_v4 Tim44-like domain-containing protein 0.9706 117 246 GO:0030150
GO:0051087
AF-A0A2S6TLX5-F1-model_v4 Tim44-like domain-containing protein 0.9658 100 246 GO:0030150
GO:0051087
AF-A0A434EZN2-F1-model_v4 Calcium-binding protein 0.9651 147 245

Feature Viewer

pLDDT pTM Quality
76.21 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map