F492173
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1249 | 571 | 2498 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300004800|Ga0058861_12019322|Ga0058861_120193222 |
| Length | 79 |
| Sequence | MAHKKAGGSSRNGRDSAGRRLGVKKFIVRQRGTRVYPGTNVGLGKDHTLFALADGRVRFHDGKQGRKYVSVDIMAVAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 142 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 143 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 144 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 145 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 146 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 147 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 167 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 180 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 181 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 263 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 264 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 268 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 269 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 270 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 272 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 273 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 274 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 275 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 277 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 278 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 279 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 280 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 281 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 282 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 283 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 284 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 285 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 286 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 287 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 288 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 289 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 290 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 291 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 292 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 293 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 294 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 295 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 296 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 297 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 299 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 300 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 302 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 303 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 305 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 306 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 307 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 309 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 310 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 311 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 312 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 313 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 314 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 315 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 316 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 317 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 318 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 319 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 320 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 321 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 322 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 323 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 324 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 325 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 326 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 329 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 330 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 331 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 332 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 333 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 334 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 335 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 336 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 337 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 338 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 339 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 340 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 341 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 342 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 343 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 344 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 345 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 346 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 347 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 348 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 349 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 350 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 351 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 352 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 353 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 354 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 355 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 356 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 357 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 358 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 359 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 360 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 361 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 417 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 418 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 419 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 420 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 421 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 422 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 425 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 426 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 427 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 428 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 429 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 430 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 431 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 432 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 433 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 434 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 435 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 436 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 437 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 438 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 439 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 440 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 441 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 480 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 481 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 482 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 483 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 484 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 488 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 489 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 490 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 493 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 494 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 495 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 496 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 497 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 498 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 499 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 500 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 507 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 508 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 509 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 510 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 512 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 513 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 514 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 515 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 516 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 517 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 518 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 519 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 521 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 522 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 523 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 524 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 525 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 526 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 527 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 529 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 530 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 531 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 532 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 533 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 534 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 543 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 544 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 545 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 546 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 547 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 548 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 549 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 550 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 551 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 552 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 553 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 554 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 555 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 556 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 557 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 558 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 559 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 560 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 561 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 562 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 563 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 564 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 565 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 566 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 567 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 568 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 569 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 570 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 571 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.87 |
| Metatranscriptomes | 4.88 |
| Isolates | 2.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.41 |
| Nodule | 0.24 |
| Rhizoplane | 5.76 |
| Rhizosphere | 73.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058861_12019322 | 3300004800 | Bacteria | 707 |
| 2 | SwRhRL2b_contig_3919511 | 2162886007 | Bacteria | 2293 |
| 3 | SwRhRL2b_contig_520222 | 2162886007 | Bacteria | 3263 |
| 4 | ARcpr5yngRDRAFT_c002624 | 3300000043 | Bacteria | 1851 |
| 5 | ARCol0yngRDRAFT_1001217 | 3300000652 | Bacteria | 2174 |
| 6 | ARCol0yngRDRAFT_1017172 | 3300000652 | Bacteria | 552 |
| 7 | JGI24746J21847_1001905 | 3300001977 | Bacteria | 3327 |
| 8 | JGI24740J21852_10025198 | 3300001979 | Bacteria | 2008 |
| 9 | JGI24740J21852_10042732 | 3300001979 | Bacteria | 1356 |
| 10 | JGI24739J22299_10006425 | 3300001989 | Bacteria | 4438 |
| 11 | JGI24739J22299_10200045 | 3300001989 | Bacteria | 586 |
| 12 | JGI24737J22298_10026070 | 3300001990 | Bacteria | 1846 |
| 13 | JGI24735J21928_10042720 | 3300002067 | Bacteria | 1319 |
| 14 | JGI24735J21928_10133842 | 3300002067 | Bacteria | 715 |
| 15 | JGI24748J21848_1008124 | 3300002074 | Bacteria | 1232 |
| 16 | JGI24749J21850_1001036 | 3300002076 | Bacteria | 3952 |
| 17 | JGI24744J21845_10012571 | 3300002077 | Bacteria | 1716 |
| 18 | JGI24744J21845_10021627 | 3300002077 | Bacteria | 1265 |
| 19 | JGI24033J26618_1017319 | 3300002155 | Bacteria | 901 |
| 20 | JGI24034J26672_10013892 | 3300002239 | Bacteria | 1225 |
| 21 | JGI24034J26672_10027937 | 3300002239 | Bacteria | 909 |
| 22 | JGI24034J26672_10092567 | 3300002239 | Bacteria | 562 |
| 23 | JGI24742J22300_10013146 | 3300002244 | Bacteria | 1385 |
| 24 | JGI24742J22300_10071167 | 3300002244 | Bacteria | 648 |
| 25 | JGI24751J29686_10038094 | 3300002459 | Bacteria | 996 |
| 26 | JGI25150J39212_1000233 | 3300002774 | Bacteria | 30182 |
| 27 | JGI25150J39212_1025895 | 3300002774 | Bacteria | 852 |
| 28 | JGI25151J46595_10016142 | 3300003187 | Bacteria | 3272 |
| 29 | JGI25165J46597_1000100 | 3300003214 | Bacteria | 157712 |
| 30 | JGI25153J46596_10000005 | 3300003215 | Bacteria | 492839 |
| 31 | JGI25153J46596_10000460 | 3300003215 | Bacteria | 26041 |
| 32 | JGI25153J46596_10003205 | 3300003215 | Bacteria | 9195 |
| 33 | Ga0006777J48905_1037455 | 3300003308 | Bacteria | 1118 |
| 34 | Ga0007417J51691_1030187 | 3300003544 | Bacteria | 858 |
| 35 | Ga0007410J51695_1032737 | 3300003574 | Bacteria | 924 |
| 36 | Ga0007409J51694_1068937 | 3300003575 | Bacteria | 727 |
| 37 | Ga0007429J51699_1023319 | 3300003579 | Bacteria | 928 |
| 38 | Ga0007429J51699_1031546 | 3300003579 | Bacteria | 923 |
| 39 | Ga0006780_1025085 | 3300003735 | Bacteria | 554 |
| 40 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 41 | Ga0055542_1000355 | 3300003762 | Bacteria | 48043 |
| 42 | Ga0055542_1028374 | 3300003762 | Bacteria | 737 |
| 43 | Ga0055529_1000045 | 3300003763 | Bacteria | 209617 |
| 44 | Ga0055529_1001200 | 3300003763 | Bacteria | 10283 |
| 45 | Ga0055526_1051195 | 3300003771 | Bacteria | 941 |
| 46 | Ga0055537_1003015 | 3300003773 | Bacteria | 5320 |
| 47 | Ga0055537_1003625 | 3300003773 | Bacteria | 4688 |
| 48 | Ga0055524_1000030 | 3300003775 | Bacteria | 187756 |
| 49 | Ga0055528_1027333 | 3300003790 | Bacteria | 1610 |
| 50 | Ga0055530_10000554 | 3300003791 | Bacteria | 32407 |
| 51 | Ga0055530_10022028 | 3300003791 | Bacteria | 1863 |
| 52 | Ga0055540_1001254 | 3300003792 | Bacteria | 15524 |
| 53 | Ga0055531_10000019 | 3300003794 | Bacteria | 170825 |
| 54 | Ga0055531_10006010 | 3300003794 | Bacteria | 6968 |
| 55 | Ga0055531_10071482 | 3300003794 | Bacteria | 799 |
| 56 | Ga0055543_1014987 | 3300004625 | Bacteria | 1500 |
| 57 | Ga0065165_1019566 | 3300005262 | Bacteria | 2410 |
| 58 | Ga0065165_1032206 | 3300005262 | Bacteria | 1646 |
| 59 | Ga0065165_1090877 | 3300005262 | Bacteria | 777 |
| 60 | Ga0065714_10346504 | 3300005288 | Bacteria | 640 |
| 61 | Ga0065704_10070490 | 3300005289 | Bacteria | 22609 |
| 62 | Ga0065704_10074996 | 3300005289 | Bacteria | 5861 |
| 63 | Ga0065712_10319854 | 3300005290 | Bacteria | 830 |
| 64 | Ga0065715_10038607 | 3300005293 | Bacteria | 1350 |
| 65 | Ga0065715_10091935 | 3300005293 | Bacteria | 5447 |
| 66 | Ga0065715_10970762 | 3300005293 | Bacteria | 540 |
| 67 | Ga0065715_11099189 | 3300005293 | Bacteria | 520 |
| 68 | Ga0065707_10584051 | 3300005295 | Bacteria | 700 |
| 69 | Ga0070658_10000808 | 3300005327 | Bacteria | 26765 |
| 70 | Ga0070658_10000957 | 3300005327 | Bacteria | 24684 |
| 71 | Ga0070658_10011514 | 3300005327 | Bacteria | 7094 |
| 72 | Ga0070658_10103001 | 3300005327 | Bacteria | 2361 |
| 73 | Ga0070676_10016131 | 3300005328 | Bacteria | 4127 |
| 74 | Ga0070676_10227190 | 3300005328 | Bacteria | 1235 |
| 75 | Ga0070676_10806097 | 3300005328 | Bacteria | 693 |
| 76 | Ga0070676_11261761 | 3300005328 | Bacteria | 563 |
| 77 | Ga0070683_100336697 | 3300005329 | Bacteria | 1437 |
| 78 | Ga0070690_100124496 | 3300005330 | Bacteria | 1734 |
| 79 | Ga0070690_100910205 | 3300005330 | Bacteria | 688 |
| 80 | Ga0070670_100001686 | 3300005331 | Bacteria | 17947 |
| 81 | Ga0070670_100003085 | 3300005331 | Bacteria | 13778 |
| 82 | Ga0070670_100100851 | 3300005331 | Bacteria | 2486 |
| 83 | Ga0070670_100165798 | 3300005331 | Bacteria | 1915 |
| 84 | Ga0070670_100526485 | 3300005331 | Bacteria | 1053 |
| 85 | Ga0070670_100555347 | 3300005331 | Bacteria | 1025 |
| 86 | Ga0070670_100878350 | 3300005331 | Bacteria | 812 |
| 87 | Ga0068869_100340064 | 3300005334 | Bacteria | 1221 |
| 88 | Ga0068869_100695339 | 3300005334 | Bacteria | 867 |
| 89 | Ga0068869_101881082 | 3300005334 | Bacteria | 536 |
| 90 | Ga0070666_10016672 | 3300005335 | Bacteria | 4701 |
| 91 | Ga0070666_10240971 | 3300005335 | Bacteria | 1279 |
| 92 | Ga0070666_10424016 | 3300005335 | Bacteria | 958 |
| 93 | Ga0070682_101700513 | 3300005337 | Bacteria | 548 |
| 94 | Ga0068868_100214997 | 3300005338 | Bacteria | 1608 |
| 95 | Ga0068868_100872315 | 3300005338 | Unclassified | 816 |
| 96 | Ga0070660_100078152 | 3300005339 | Bacteria | 2594 |
| 97 | Ga0070660_100913350 | 3300005339 | Bacteria | 740 |
| 98 | Ga0070661_100000776 | 3300005344 | Bacteria | 23062 |
| 99 | Ga0070668_100001172 | 3300005347 | Bacteria | 18548 |
| 100 | Ga0070668_100002440 | 3300005347 | Bacteria | 13678 |
| 101 | Ga0070668_100035024 | 3300005347 | Bacteria | 3827 |
| 102 | Ga0070668_100109981 | 3300005347 | Bacteria | 2193 |
| 103 | Ga0070668_100306206 | 3300005347 | Bacteria | 1334 |
| 104 | Ga0070668_100555723 | 3300005347 | Bacteria | 999 |
| 105 | Ga0070668_100811840 | 3300005347 | Bacteria | 832 |
| 106 | Ga0070669_100000408 | 3300005353 | Bacteria | 32921 |
| 107 | Ga0070669_100001266 | 3300005353 | Bacteria | 18324 |
| 108 | Ga0070669_100001698 | 3300005353 | Bacteria | 15939 |
| 109 | Ga0070669_100002206 | 3300005353 | Bacteria | 14110 |
| 110 | Ga0070669_100434755 | 3300005353 | Bacteria | 1079 |
| 111 | Ga0070675_100022565 | 3300005354 | Bacteria | 5030 |
| 112 | Ga0070675_100062900 | 3300005354 | Bacteria | 3067 |
| 113 | Ga0070675_100076947 | 3300005354 | Bacteria | 2776 |
| 114 | Ga0070671_100000122 | 3300005355 | Bacteria | 50131 |
| 115 | Ga0070671_100008715 | 3300005355 | Bacteria | 8138 |
| 116 | Ga0070671_100014083 | 3300005355 | Bacteria | 6456 |
| 117 | Ga0070671_100028597 | 3300005355 | Bacteria | 4591 |
| 118 | Ga0070671_100077907 | 3300005355 | Bacteria | 2770 |
| 119 | Ga0070671_100125573 | 3300005355 | Bacteria | 2160 |
| 120 | Ga0070671_100375733 | 3300005355 | Bacteria | 1214 |
| 121 | Ga0070671_101096901 | 3300005355 | Bacteria | 699 |
| 122 | Ga0070671_101315543 | 3300005355 | Bacteria | 638 |
| 123 | Ga0070671_101842966 | 3300005355 | Bacteria | 538 |
| 124 | Ga0070674_100011530 | 3300005356 | Bacteria | 5387 |
| 125 | Ga0070674_100012103 | 3300005356 | Bacteria | 5286 |
| 126 | Ga0070674_100013334 | 3300005356 | Bacteria | 5078 |
| 127 | Ga0070674_101181868 | 3300005356 | Bacteria | 678 |
| 128 | Ga0070674_102101092 | 3300005356 | Bacteria | 515 |
| 129 | Ga0070673_100020913 | 3300005364 | Bacteria | 4730 |
| 130 | Ga0070673_100036022 | 3300005364 | Bacteria | 3757 |
| 131 | Ga0070673_100436502 | 3300005364 | Bacteria | 1176 |
| 132 | Ga0070673_101548119 | 3300005364 | Bacteria | 626 |
| 133 | Ga0070659_100163395 | 3300005366 | Bacteria | 1821 |
| 134 | Ga0070659_100590275 | 3300005366 | Bacteria | 954 |
| 135 | Ga0070659_101338306 | 3300005366 | Bacteria | 636 |
| 136 | Ga0070659_101617757 | 3300005366 | Bacteria | 578 |
| 137 | Ga0070667_100000596 | 3300005367 | Bacteria | 35305 |
| 138 | Ga0070667_100022920 | 3300005367 | Bacteria | 5177 |
| 139 | Ga0070667_100026836 | 3300005367 | Bacteria | 4793 |
| 140 | Ga0070667_100137491 | 3300005367 | Bacteria | 2137 |
| 141 | Ga0070667_100284970 | 3300005367 | Bacteria | 1484 |
| 142 | Ga0070667_101051623 | 3300005367 | Bacteria | 760 |
| 143 | Ga0070667_101698346 | 3300005367 | Bacteria | 594 |
| 144 | Ga0070667_101924869 | 3300005367 | Bacteria | 557 |
| 145 | Ga0070713_101092702 | 3300005436 | Bacteria | 771 |
| 146 | Ga0070701_10424070 | 3300005438 | Bacteria | 848 |
| 147 | Ga0070711_101266781 | 3300005439 | Bacteria | 639 |
| 148 | Ga0070705_100322643 | 3300005440 | Bacteria | 1115 |
| 149 | Ga0070700_100269421 | 3300005441 | Bacteria | 1230 |
| 150 | Ga0070694_100267543 | 3300005444 | Bacteria | 1299 |
| 151 | Ga0070663_100009319 | 3300005455 | Bacteria | 6076 |
| 152 | Ga0070678_100148533 | 3300005456 | Bacteria | 1885 |
| 153 | Ga0070678_100203100 | 3300005456 | Bacteria | 1637 |
| 154 | Ga0070678_100271202 | 3300005456 | Bacteria | 1431 |
| 155 | Ga0070678_100328378 | 3300005456 | Bacteria | 1308 |
| 156 | Ga0070678_100626345 | 3300005456 | Bacteria | 963 |
| 157 | Ga0070678_102051506 | 3300005456 | Bacteria | 541 |
| 158 | Ga0070662_100000872 | 3300005457 | Bacteria | 18447 |
| 159 | Ga0070662_100064759 | 3300005457 | Bacteria | 2677 |
| 160 | Ga0070662_101122802 | 3300005457 | Bacteria | 675 |
| 161 | Ga0070681_11787276 | 3300005458 | Bacteria | 542 |
| 162 | Ga0068867_100007513 | 3300005459 | Bacteria | 7706 |
| 163 | Ga0068867_100049553 | 3300005459 | Bacteria | 3092 |
| 164 | Ga0068867_100691070 | 3300005459 | Bacteria | 899 |
| 165 | Ga0068867_101006825 | 3300005459 | Bacteria | 756 |
| 166 | Ga0070685_10689205 | 3300005466 | Bacteria | 744 |
| 167 | Ga0070706_100545880 | 3300005467 | Bacteria | 1078 |
| 168 | Ga0070698_100365019 | 3300005471 | Bacteria | 1376 |
| 169 | Ga0070699_101144278 | 3300005518 | Bacteria | 714 |
| 170 | Ga0070679_101922014 | 3300005530 | Bacteria | 540 |
| 171 | Ga0070684_100387437 | 3300005535 | Bacteria | 1288 |
| 172 | Ga0068853_100358710 | 3300005539 | Bacteria | 1357 |
| 173 | Ga0068853_100637653 | 3300005539 | Bacteria | 1013 |
| 174 | Ga0068853_101245312 | 3300005539 | Bacteria | 719 |
| 175 | Ga0068853_101363779 | 3300005539 | Bacteria | 686 |
| 176 | Ga0068853_101914658 | 3300005539 | Bacteria | 575 |
| 177 | Ga0070672_100103722 | 3300005543 | Bacteria | 2310 |
| 178 | Ga0070672_100528844 | 3300005543 | Bacteria | 1022 |
| 179 | Ga0070686_100155091 | 3300005544 | Bacteria | 1607 |
| 180 | Ga0070686_100783497 | 3300005544 | Bacteria | 767 |
| 181 | Ga0070695_100099178 | 3300005545 | Bacteria | 1959 |
| 182 | Ga0070696_100641985 | 3300005546 | Bacteria | 860 |
| 183 | Ga0070693_100892271 | 3300005547 | Bacteria | 666 |
| 184 | Ga0070665_100001012 | 3300005548 | Bacteria | 35432 |
| 185 | Ga0070665_100004063 | 3300005548 | Bacteria | 15396 |
| 186 | Ga0070665_100211836 | 3300005548 | Bacteria | 1938 |
| 187 | Ga0070665_100253198 | 3300005548 | Bacteria | 1762 |
| 188 | Ga0070665_100805224 | 3300005548 | Bacteria | 953 |
| 189 | Ga0070704_102225398 | 3300005549 | Bacteria | 510 |
| 190 | Ga0068855_100003997 | 3300005563 | Bacteria | 18007 |
| 191 | Ga0068855_100092560 | 3300005563 | Bacteria | 3486 |
| 192 | Ga0068855_101217122 | 3300005563 | Bacteria | 782 |
| 193 | Ga0070664_100027918 | 3300005564 | Bacteria | 4694 |
| 194 | Ga0070664_100074095 | 3300005564 | Bacteria | 2922 |
| 195 | Ga0070664_100615275 | 3300005564 | Bacteria | 1008 |
| 196 | Ga0070664_101368539 | 3300005564 | Bacteria | 669 |
| 197 | Ga0068857_100183846 | 3300005577 | Bacteria | 1902 |
| 198 | Ga0068857_100799312 | 3300005577 | Bacteria | 901 |
| 199 | Ga0068857_101180691 | 3300005577 | Bacteria | 741 |
| 200 | Ga0068857_101216258 | 3300005577 | Bacteria | 730 |
| 201 | Ga0068857_101664418 | 3300005577 | Bacteria | 623 |
| 202 | Ga0068857_101868326 | 3300005577 | Bacteria | 588 |
| 203 | Ga0068854_100005493 | 3300005578 | Bacteria | 8007 |
| 204 | Ga0068854_100015015 | 3300005578 | Bacteria | 5119 |
| 205 | Ga0068856_100008316 | 3300005614 | Bacteria | 10111 |
| 206 | Ga0068856_100030211 | 3300005614 | Bacteria | 5297 |
| 207 | Ga0068856_100038838 | 3300005614 | Bacteria | 4673 |
| 208 | Ga0068856_100066194 | 3300005614 | Bacteria | 3570 |
| 209 | Ga0068856_101158058 | 3300005614 | Bacteria | 790 |
| 210 | Ga0070702_100056481 | 3300005615 | Bacteria | 2267 |
| 211 | Ga0070702_100630366 | 3300005615 | Bacteria | 808 |
| 212 | Ga0068852_100021267 | 3300005616 | Bacteria | 5176 |
| 213 | Ga0068852_100309918 | 3300005616 | Bacteria | 1530 |
| 214 | Ga0068852_101180069 | 3300005616 | Bacteria | 786 |
| 215 | Ga0068859_100001413 | 3300005617 | Bacteria | 24348 |
| 216 | Ga0068859_100026464 | 3300005617 | Bacteria | 5817 |
| 217 | Ga0068859_101474601 | 3300005617 | Bacteria | 751 |
| 218 | Ga0068859_102137103 | 3300005617 | Bacteria | 618 |
| 219 | Ga0068864_100034325 | 3300005618 | Bacteria | 4315 |
| 220 | Ga0068864_100058936 | 3300005618 | Bacteria | 3320 |
| 221 | Ga0068864_101385121 | 3300005618 | Bacteria | 705 |
| 222 | Ga0068864_101543468 | 3300005618 | Bacteria | 667 |
| 223 | Ga0068864_102110461 | 3300005618 | Bacteria | 570 |
| 224 | Ga0068866_10508127 | 3300005718 | Bacteria | 799 |
| 225 | Ga0068861_100033598 | 3300005719 | Bacteria | 3786 |
| 226 | Ga0068861_101384248 | 3300005719 | Bacteria | 687 |
| 227 | Ga0068861_101579578 | 3300005719 | Bacteria | 646 |
| 228 | Ga0068851_10003977 | 3300005834 | Bacteria | 6623 |
| 229 | Ga0068851_10269454 | 3300005834 | Bacteria | 970 |
| 230 | Ga0068870_10051536 | 3300005840 | Bacteria | 2179 |
| 231 | Ga0068870_10265617 | 3300005840 | Bacteria | 1070 |
| 232 | Ga0068870_10433095 | 3300005840 | Bacteria | 863 |
| 233 | Ga0068863_100018487 | 3300005841 | Bacteria | 6670 |
| 234 | Ga0068863_100041528 | 3300005841 | Bacteria | 4374 |
| 235 | Ga0068863_100217996 | 3300005841 | Bacteria | 1838 |
| 236 | Ga0068863_100318872 | 3300005841 | Bacteria | 1509 |
| 237 | Ga0068863_100446522 | 3300005841 | Bacteria | 1269 |
| 238 | Ga0068858_100071679 | 3300005842 | Bacteria | 3214 |
| 239 | Ga0068858_100492618 | 3300005842 | Bacteria | 1183 |
| 240 | Ga0068860_100018416 | 3300005843 | Bacteria | 6793 |
| 241 | Ga0068860_100029808 | 3300005843 | Bacteria | 5248 |
| 242 | Ga0068860_100030603 | 3300005843 | Bacteria | 5176 |
| 243 | Ga0068860_101158176 | 3300005843 | Bacteria | 793 |
| 244 | Ga0068862_100003883 | 3300005844 | Bacteria | 12712 |
| 245 | Ga0068862_100022859 | 3300005844 | Bacteria | 5234 |
| 246 | Ga0068862_100030220 | 3300005844 | Bacteria | 4565 |
| 247 | Ga0068862_100107007 | 3300005844 | Bacteria | 2452 |
| 248 | Ga0068862_100900706 | 3300005844 | Bacteria | 869 |
| 249 | Ga0081538_10002854 | 3300005981 | Bacteria | 16521 |
| 250 | Ga0081538_10170439 | 3300005981 | Bacteria | 951 |
| 251 | Ga0075365_10072164 | 3300006038 | Bacteria | 2325 |
| 252 | Ga0075365_10109948 | 3300006038 | Bacteria | 1893 |
| 253 | Ga0075365_10477367 | 3300006038 | Bacteria | 881 |
| 254 | Ga0075365_10583278 | 3300006038 | Bacteria | 791 |
| 255 | Ga0075365_10729918 | 3300006038 | Bacteria | 700 |
| 256 | Ga0075368_10036569 | 3300006042 | Bacteria | 1918 |
| 257 | Ga0075368_10299808 | 3300006042 | Bacteria | 693 |
| 258 | Ga0075363_100025154 | 3300006048 | Bacteria | 3033 |
| 259 | Ga0075363_100299638 | 3300006048 | Bacteria | 933 |
| 260 | Ga0075364_10118963 | 3300006051 | Bacteria | 1767 |
| 261 | Ga0075364_10273535 | 3300006051 | Bacteria | 1149 |
| 262 | Ga0075364_10373624 | 3300006051 | Bacteria | 972 |
| 263 | Ga0075364_10377646 | 3300006051 | Bacteria | 967 |
| 264 | Ga0075364_10387144 | 3300006051 | Bacteria | 954 |
| 265 | Ga0070712_100146886 | 3300006175 | Bacteria | 1806 |
| 266 | Ga0075362_10001290 | 3300006177 | Bacteria | 7936 |
| 267 | Ga0075362_10216974 | 3300006177 | Bacteria | 934 |
| 268 | Ga0075367_10032202 | 3300006178 | Bacteria | 3015 |
| 269 | Ga0075369_10009867 | 3300006186 | Bacteria | 3724 |
| 270 | Ga0075369_10016088 | 3300006186 | Bacteria | 3012 |
| 271 | Ga0075369_10026637 | 3300006186 | Bacteria | 2411 |
| 272 | Ga0075369_10494592 | 3300006186 | Bacteria | 581 |
| 273 | Ga0075366_10051050 | 3300006195 | Bacteria | 2457 |
| 274 | Ga0075366_10063141 | 3300006195 | Bacteria | 2201 |
| 275 | Ga0075366_10115554 | 3300006195 | Bacteria | 1616 |
| 276 | Ga0075366_10176550 | 3300006195 | Bacteria | 1297 |
| 277 | Ga0075366_10581919 | 3300006195 | Bacteria | 694 |
| 278 | Ga0075366_10686094 | 3300006195 | Bacteria | 636 |
| 279 | Ga0097621_100274921 | 3300006237 | Bacteria | 1481 |
| 280 | Ga0075370_10149342 | 3300006353 | Bacteria | 1369 |
| 281 | Ga0075370_10565927 | 3300006353 | Bacteria | 688 |
| 282 | Ga0068871_100104146 | 3300006358 | Bacteria | 2380 |
| 283 | Ga0068871_100880614 | 3300006358 | Bacteria | 829 |
| 284 | Ga0068871_101237325 | 3300006358 | Bacteria | 701 |
| 285 | Ga0075428_100142813 | 3300006844 | Bacteria | 2602 |
| 286 | Ga0075428_100152242 | 3300006844 | Bacteria | 2512 |
| 287 | Ga0075428_100632564 | 3300006844 | Bacteria | 1142 |
| 288 | Ga0075428_101913738 | 3300006844 | Bacteria | 616 |
| 289 | Ga0075430_100390506 | 3300006846 | Bacteria | 1148 |
| 290 | Ga0075430_100542113 | 3300006846 | Bacteria | 959 |
| 291 | Ga0075430_100717988 | 3300006846 | Bacteria | 824 |
| 292 | Ga0075431_100189366 | 3300006847 | Bacteria | 2109 |
| 293 | Ga0075431_100620632 | 3300006847 | Bacteria | 1063 |
| 294 | Ga0075433_11192357 | 3300006852 | Bacteria | 661 |
| 295 | Ga0068865_100594066 | 3300006881 | Bacteria | 935 |
| 296 | Ga0097620_100001413 | 3300006931 | Bacteria | 24348 |
| 297 | Ga0097620_100026465 | 3300006931 | Bacteria | 5817 |
| 298 | Ga0097620_101474443 | 3300006931 | Bacteria | 751 |
| 299 | Ga0097620_102137818 | 3300006931 | Bacteria | 618 |
| 300 | Ga0105251_10005302 | 3300009011 | Bacteria | 8478 |
| 301 | Ga0105251_10042882 | 3300009011 | Bacteria | 2193 |
| 302 | Ga0105251_10141671 | 3300009011 | Bacteria | 1087 |
| 303 | Ga0105250_10008207 | 3300009092 | Bacteria | 4445 |
| 304 | Ga0105250_10243315 | 3300009092 | Bacteria | 767 |
| 305 | Ga0105240_10046210 | 3300009093 | Bacteria | 5519 |
| 306 | Ga0105240_10150959 | 3300009093 | Bacteria | 2767 |
| 307 | Ga0105240_10425723 | 3300009093 | Bacteria | 1490 |
| 308 | Ga0105240_11580611 | 3300009093 | Bacteria | 686 |
| 309 | Ga0105240_11744685 | 3300009093 | Bacteria | 649 |
| 310 | Ga0111539_10013275 | 3300009094 | Bacteria | 10294 |
| 311 | Ga0111539_10269322 | 3300009094 | Bacteria | 1983 |
| 312 | Ga0111539_10730597 | 3300009094 | Bacteria | 1153 |
| 313 | Ga0105245_10209462 | 3300009098 | Bacteria | 1876 |
| 314 | Ga0105245_10547932 | 3300009098 | Bacteria | 1178 |
| 315 | Ga0105247_10024046 | 3300009101 | Bacteria | 3669 |
| 316 | Ga0105247_10225356 | 3300009101 | Bacteria | 1271 |
| 317 | Ga0114129_10427831 | 3300009147 | Bacteria | 1740 |
| 318 | Ga0114129_10502771 | 3300009147 | Bacteria | 1583 |
| 319 | Ga0114129_10533868 | 3300009147 | Bacteria | 1528 |
| 320 | Ga0114129_11514071 | 3300009147 | Bacteria | 824 |
| 321 | Ga0105243_10000423 | 3300009148 | Bacteria | 44393 |
| 322 | Ga0105243_10555936 | 3300009148 | Bacteria | 1097 |
| 323 | Ga0105243_12010938 | 3300009148 | Bacteria | 612 |
| 324 | Ga0105241_10009278 | 3300009174 | Bacteria | 7234 |
| 325 | Ga0105241_10423776 | 3300009174 | Bacteria | 1172 |
| 326 | Ga0105242_10297423 | 3300009176 | Bacteria | 1472 |
| 327 | Ga0105248_10026827 | 3300009177 | Bacteria | 6408 |
| 328 | Ga0105248_10060330 | 3300009177 | Bacteria | 4258 |
| 329 | Ga0105248_10080865 | 3300009177 | Bacteria | 3653 |
| 330 | Ga0105248_10409273 | 3300009177 | Bacteria | 1527 |
| 331 | Ga0105248_11008578 | 3300009177 | Bacteria | 940 |
| 332 | Ga0105248_11039322 | 3300009177 | Bacteria | 925 |
| 333 | Ga0105237_10210213 | 3300009545 | Bacteria | 1946 |
| 334 | Ga0105237_10294972 | 3300009545 | Bacteria | 1624 |
| 335 | Ga0105237_10709252 | 3300009545 | Bacteria | 1013 |
| 336 | Ga0105237_11595555 | 3300009545 | Bacteria | 659 |
| 337 | Ga0105237_12388585 | 3300009545 | Bacteria | 539 |
| 338 | Ga0105238_10059481 | 3300009551 | Bacteria | 3828 |
| 339 | Ga0105238_10127097 | 3300009551 | Bacteria | 2528 |
| 340 | Ga0105238_10179574 | 3300009551 | Bacteria | 2094 |
| 341 | Ga0105238_12679203 | 3300009551 | Bacteria | 535 |
| 342 | Ga0105249_10009816 | 3300009553 | Bacteria | 8388 |
| 343 | Ga0105249_10204570 | 3300009553 | Bacteria | 1934 |
| 344 | Ga0105249_11013216 | 3300009553 | Bacteria | 899 |
| 345 | Ga0105148_104016 | 3300009978 | Bacteria | 1048 |
| 346 | Ga0105239_10473760 | 3300010375 | Bacteria | 1422 |
| 347 | Ga0105239_10475938 | 3300010375 | Bacteria | 1419 |
| 348 | Ga0105239_10988601 | 3300010375 | Bacteria | 967 |
| 349 | Ga0105239_11028442 | 3300010375 | Bacteria | 947 |
| 350 | Ga0105239_11227514 | 3300010375 | Bacteria | 864 |
| 351 | Ga0105239_11475217 | 3300010375 | Bacteria | 786 |
| 352 | Ga0105246_10034849 | 3300011119 | Bacteria | 3358 |
| 353 | Ga0157317_1006346 | 3300012475 | Bacteria | 823 |
| 354 | Ga0157322_1027459 | 3300012490 | Bacteria | 588 |
| 355 | Ga0157315_1014526 | 3300012508 | Bacteria | 755 |
| 356 | Ga0157315_1063024 | 3300012508 | Bacteria | 527 |
| 357 | Ga0157316_1023420 | 3300012510 | Bacteria | 694 |
| 358 | Ga0157316_1058686 | 3300012510 | Bacteria | 551 |
| 359 | Ga0157327_1002804 | 3300012512 | Bacteria | 1234 |
| 360 | Ga0157327_1015497 | 3300012512 | Bacteria | 794 |
| 361 | Ga0157326_1036161 | 3300012513 | Bacteria | 675 |
| 362 | Ga0157373_10180139 | 3300013100 | Bacteria | 1488 |
| 363 | Ga0157373_10592669 | 3300013100 | Bacteria | 806 |
| 364 | Ga0157373_10887051 | 3300013100 | Bacteria | 661 |
| 365 | Ga0157371_10000032 | 3300013102 | Bacteria | 230252 |
| 366 | Ga0157371_10004757 | 3300013102 | Bacteria | 11711 |
| 367 | Ga0157371_10434302 | 3300013102 | Bacteria | 964 |
| 368 | Ga0157370_10000152 | 3300013104 | Bacteria | 85001 |
| 369 | Ga0157370_10406630 | 3300013104 | Bacteria | 1253 |
| 370 | Ga0157369_10046420 | 3300013105 | Bacteria | 4720 |
| 371 | Ga0157369_10369745 | 3300013105 | Bacteria | 1488 |
| 372 | Ga0157369_11159648 | 3300013105 | Bacteria | 789 |
| 373 | Ga0157374_10035173 | 3300013296 | Bacteria | 4582 |
| 374 | Ga0157374_10117361 | 3300013296 | Bacteria | 2565 |
| 375 | Ga0157378_10509205 | 3300013297 | Bacteria | 1204 |
| 376 | Ga0157378_11417713 | 3300013297 | Bacteria | 738 |
| 377 | Ga0157378_11446489 | 3300013297 | Bacteria | 731 |
| 378 | Ga0157378_11635651 | 3300013297 | Bacteria | 690 |
| 379 | Ga0163162_10047653 | 3300013306 | Bacteria | 4294 |
| 380 | Ga0163162_10075148 | 3300013306 | Bacteria | 3439 |
| 381 | Ga0163162_10766795 | 3300013306 | Bacteria | 1083 |
| 382 | Ga0163162_11063306 | 3300013306 | Bacteria | 916 |
| 383 | Ga0163162_11154471 | 3300013306 | Bacteria | 878 |
| 384 | Ga0163162_11254396 | 3300013306 | Bacteria | 842 |
| 385 | Ga0163162_11755874 | 3300013306 | Bacteria | 709 |
| 386 | Ga0157372_11467339 | 3300013307 | Bacteria | 786 |
| 387 | Ga0157375_10287973 | 3300013308 | Bacteria | 1806 |
| 388 | Ga0157375_10389465 | 3300013308 | Bacteria | 1560 |
| 389 | Ga0157375_10413178 | 3300013308 | Bacteria | 1516 |
| 390 | Ga0157375_13680076 | 3300013308 | Bacteria | 510 |
| 391 | Ga0163163_10028972 | 3300014325 | Bacteria | 5323 |
| 392 | Ga0163163_11361346 | 3300014325 | Bacteria | 771 |
| 393 | Ga0157380_10001109 | 3300014326 | Bacteria | 17364 |
| 394 | Ga0157380_10018421 | 3300014326 | Bacteria | 5182 |
| 395 | Ga0157380_10078258 | 3300014326 | Bacteria | 2697 |
| 396 | Ga0157380_11204077 | 3300014326 | Bacteria | 801 |
| 397 | Ga0182008_10238008 | 3300014497 | Bacteria | 936 |
| 398 | Ga0182008_10330442 | 3300014497 | Bacteria | 804 |
| 399 | Ga0157377_10519930 | 3300014745 | Bacteria | 835 |
| 400 | Ga0157379_10237668 | 3300014968 | Bacteria | 1652 |
| 401 | Ga0157376_10240807 | 3300014969 | Bacteria | 1685 |
| 402 | Ga0157376_10355567 | 3300014969 | Bacteria | 1403 |
| 403 | Ga0157376_10536248 | 3300014969 | Bacteria | 1156 |
| 404 | Ga0163161_10001748 | 3300017792 | Bacteria | 15903 |
| 405 | Ga0163161_10042717 | 3300017792 | Bacteria | 3262 |
| 406 | Ga0163161_10143980 | 3300017792 | Bacteria | 1806 |
| 407 | Ga0163161_10638310 | 3300017792 | Bacteria | 881 |
| 408 | Ga0163161_11362757 | 3300017792 | Bacteria | 618 |
| 409 | Ga0197907_10342361 | 3300020069 | Bacteria | 840 |
| 410 | Ga0197907_10443662 | 3300020069 | Bacteria | 708 |
| 411 | Ga0206356_11436017 | 3300020070 | Bacteria | 782 |
| 412 | Ga0206356_11439898 | 3300020070 | Bacteria | 1235 |
| 413 | Ga0206349_1394373 | 3300020075 | Bacteria | 927 |
| 414 | Ga0206355_1251537 | 3300020076 | Bacteria | 596 |
| 415 | Ga0206355_1354397 | 3300020076 | Bacteria | 992 |
| 416 | Ga0206355_1436319 | 3300020076 | Bacteria | 688 |
| 417 | Ga0206351_10725755 | 3300020077 | Bacteria | 601 |
| 418 | Ga0206352_10349969 | 3300020078 | Bacteria | 902 |
| 419 | Ga0206350_10307900 | 3300020080 | Bacteria | 799 |
| 420 | Ga0206354_11299294 | 3300020081 | Bacteria | 794 |
| 421 | Ga0206353_11891397 | 3300020082 | Bacteria | 741 |
| 422 | Ga0224712_10277510 | 3300022467 | Bacteria | 779 |
| 423 | Ga0224712_10291230 | 3300022467 | Bacteria | 762 |
| 424 | Ga0224712_10488812 | 3300022467 | Bacteria | 594 |
| 425 | Ga0209436_109965 | 3300025208 | Bacteria | 1768 |
| 426 | Ga0207672_1003100 | 3300025223 | Bacteria | 957 |
| 427 | Ga0209672_103601 | 3300025228 | Bacteria | 3137 |
| 428 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 429 | Ga0207427_101365 | 3300025231 | Bacteria | 8998 |
| 430 | Ga0207425_1000027 | 3300025245 | Bacteria | 299995 |
| 431 | Ga0209646_1015744 | 3300025246 | Bacteria | 1126 |
| 432 | Ga0209026_1001157 | 3300025250 | Bacteria | 12346 |
| 433 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 434 | Ga0209148_1004002 | 3300025254 | Bacteria | 3772 |
| 435 | Ga0209759_1025063 | 3300025256 | Bacteria | 1277 |
| 436 | Ga0209129_1000416 | 3300025258 | Bacteria | 32921 |
| 437 | Ga0209233_1000143 | 3300025261 | Bacteria | 191568 |
| 438 | Ga0209233_1092086 | 3300025261 | Bacteria | 518 |
| 439 | Ga0209565_1000012 | 3300025263 | Bacteria | 606500 |
| 440 | Ga0209565_1000142 | 3300025263 | Bacteria | 99561 |
| 441 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 442 | Ga0209455_1000908 | 3300025272 | Bacteria | 15432 |
| 443 | Ga0209455_1002724 | 3300025272 | Bacteria | 6635 |
| 444 | Ga0209673_1002755 | 3300025273 | Bacteria | 11498 |
| 445 | Ga0209675_1012044 | 3300025291 | Bacteria | 2815 |
| 446 | Ga0209675_1014237 | 3300025291 | Bacteria | 2432 |
| 447 | Ga0209675_1092580 | 3300025291 | Bacteria | 544 |
| 448 | Ga0209676_1022757 | 3300025292 | Bacteria | 2068 |
| 449 | Ga0209025_1000197 | 3300025294 | Bacteria | 147029 |
| 450 | Ga0209564_1002693 | 3300025295 | Bacteria | 13429 |
| 451 | Ga0209564_1080555 | 3300025295 | Bacteria | 637 |
| 452 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 453 | Ga0209758_1000009 | 3300025297 | Bacteria | 1123483 |
| 454 | Ga0209758_1002365 | 3300025297 | Bacteria | 19421 |
| 455 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 456 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 457 | Ga0209050_1000254 | 3300025298 | Bacteria | 114395 |
| 458 | Ga0209050_1005181 | 3300025298 | Bacteria | 8346 |
| 459 | Ga0209256_1000012 | 3300025299 | Bacteria | 790371 |
| 460 | Ga0207426_1007652 | 3300025302 | Bacteria | 4491 |
| 461 | Ga0207426_1113075 | 3300025302 | Bacteria | 681 |
| 462 | Ga0209051_1000152 | 3300025303 | Bacteria | 131355 |
| 463 | Ga0209051_1146724 | 3300025303 | Bacteria | 559 |
| 464 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 465 | Ga0209257_1002315 | 3300025304 | Bacteria | 19253 |
| 466 | Ga0209257_1013636 | 3300025304 | Bacteria | 3587 |
| 467 | Ga0207697_10000595 | 3300025315 | Bacteria | 20569 |
| 468 | Ga0207697_10073672 | 3300025315 | Bacteria | 1434 |
| 469 | Ga0207697_10109135 | 3300025315 | Bacteria | 1184 |
| 470 | Ga0207697_10182914 | 3300025315 | Bacteria | 919 |
| 471 | Ga0207656_10002662 | 3300025321 | Bacteria | 6051 |
| 472 | Ga0207696_1005004 | 3300025711 | Bacteria | 5585 |
| 473 | Ga0207713_1012386 | 3300025735 | Bacteria | 4566 |
| 474 | Ga0207682_10003889 | 3300025893 | Bacteria | 6376 |
| 475 | Ga0207682_10161102 | 3300025893 | Bacteria | 1017 |
| 476 | Ga0207642_10443574 | 3300025899 | Bacteria | 785 |
| 477 | Ga0207642_10495086 | 3300025899 | Unclassified | 747 |
| 478 | Ga0207710_10714828 | 3300025900 | Bacteria | 526 |
| 479 | Ga0207688_10063112 | 3300025901 | Bacteria | 2089 |
| 480 | Ga0207688_10135214 | 3300025901 | Bacteria | 1447 |
| 481 | Ga0207688_10179146 | 3300025901 | Bacteria | 1263 |
| 482 | Ga0207680_10361310 | 3300025903 | Bacteria | 1021 |
| 483 | Ga0207680_10431350 | 3300025903 | Bacteria | 934 |
| 484 | Ga0207680_10646300 | 3300025903 | Bacteria | 757 |
| 485 | Ga0207680_11008421 | 3300025903 | Bacteria | 596 |
| 486 | Ga0207647_10022843 | 3300025904 | Bacteria | 4149 |
| 487 | Ga0207647_10033402 | 3300025904 | Bacteria | 3294 |
| 488 | Ga0207647_10057828 | 3300025904 | Bacteria | 2377 |
| 489 | Ga0207647_10406208 | 3300025904 | Bacteria | 767 |
| 490 | Ga0207645_10008043 | 3300025907 | Bacteria | 7397 |
| 491 | Ga0207645_10055530 | 3300025907 | Bacteria | 2528 |
| 492 | Ga0207645_10484273 | 3300025907 | Bacteria | 837 |
| 493 | Ga0207645_11236134 | 3300025907 | Bacteria | 501 |
| 494 | Ga0207643_10041321 | 3300025908 | Bacteria | 2598 |
| 495 | Ga0207643_10166029 | 3300025908 | Bacteria | 1330 |
| 496 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 497 | Ga0207705_10000122 | 3300025909 | Bacteria | 86442 |
| 498 | Ga0207705_10028066 | 3300025909 | Bacteria | 4013 |
| 499 | Ga0207705_10377512 | 3300025909 | Bacteria | 1095 |
| 500 | Ga0207654_10001772 | 3300025911 | Bacteria | 11212 |
| 501 | Ga0207654_10664454 | 3300025911 | Bacteria | 747 |
| 502 | Ga0207695_10034521 | 3300025913 | Bacteria | 5499 |
| 503 | Ga0207695_10093798 | 3300025913 | Bacteria | 3011 |
| 504 | Ga0207695_10300486 | 3300025913 | Bacteria | 1496 |
| 505 | Ga0207695_10489051 | 3300025913 | Bacteria | 1113 |
| 506 | Ga0207671_10009515 | 3300025914 | Bacteria | 8115 |
| 507 | Ga0207671_10469294 | 3300025914 | Bacteria | 1003 |
| 508 | Ga0207671_10696985 | 3300025914 | Bacteria | 808 |
| 509 | Ga0207671_10810682 | 3300025914 | Bacteria | 742 |
| 510 | Ga0207693_10264377 | 3300025915 | Unclassified | 1349 |
| 511 | Ga0207662_10267515 | 3300025918 | Bacteria | 1127 |
| 512 | Ga0207657_10039979 | 3300025919 | Bacteria | 4160 |
| 513 | Ga0207649_10000482 | 3300025920 | Bacteria | 28301 |
| 514 | Ga0207649_10028573 | 3300025920 | Bacteria | 3284 |
| 515 | Ga0207649_11380204 | 3300025920 | Bacteria | 557 |
| 516 | Ga0207652_10226194 | 3300025921 | Bacteria | 1686 |
| 517 | Ga0207681_10000387 | 3300025923 | Bacteria | 30892 |
| 518 | Ga0207681_10001010 | 3300025923 | Bacteria | 18360 |
| 519 | Ga0207681_10001632 | 3300025923 | Bacteria | 14465 |
| 520 | Ga0207681_10026231 | 3300025923 | Bacteria | 3756 |
| 521 | Ga0207681_10368141 | 3300025923 | Bacteria | 1154 |
| 522 | Ga0207681_10518112 | 3300025923 | Bacteria | 978 |
| 523 | Ga0207681_10839171 | 3300025923 | Bacteria | 768 |
| 524 | Ga0207694_10005283 | 3300025924 | Bacteria | 9953 |
| 525 | Ga0207694_10059351 | 3300025924 | Bacteria | 2975 |
| 526 | Ga0207694_10298255 | 3300025924 | Bacteria | 1327 |
| 527 | Ga0207694_10444900 | 3300025924 | Bacteria | 1081 |
| 528 | Ga0207650_10002289 | 3300025925 | Bacteria | 13345 |
| 529 | Ga0207650_10070938 | 3300025925 | Bacteria | 2620 |
| 530 | Ga0207650_10080672 | 3300025925 | Bacteria | 2467 |
| 531 | Ga0207650_10144869 | 3300025925 | Bacteria | 1870 |
| 532 | Ga0207650_10223930 | 3300025925 | Bacteria | 1515 |
| 533 | Ga0207650_10684350 | 3300025925 | Bacteria | 866 |
| 534 | Ga0207659_10001032 | 3300025926 | Bacteria | 16497 |
| 535 | Ga0207659_10163319 | 3300025926 | Bacteria | 1751 |
| 536 | Ga0207659_10178036 | 3300025926 | Bacteria | 1682 |
| 537 | Ga0207659_10776419 | 3300025926 | Bacteria | 823 |
| 538 | Ga0207687_10320987 | 3300025927 | Bacteria | 1254 |
| 539 | Ga0207644_10000048 | 3300025931 | Bacteria | 102494 |
| 540 | Ga0207644_10000293 | 3300025931 | Bacteria | 32998 |
| 541 | Ga0207644_10006574 | 3300025931 | Bacteria | 7573 |
| 542 | Ga0207644_10014696 | 3300025931 | Bacteria | 5246 |
| 543 | Ga0207644_10161897 | 3300025931 | Bacteria | 1740 |
| 544 | Ga0207644_10252123 | 3300025931 | Bacteria | 1408 |
| 545 | Ga0207644_10619547 | 3300025931 | Bacteria | 899 |
| 546 | Ga0207644_10753935 | 3300025931 | Bacteria | 813 |
| 547 | Ga0207690_10000052 | 3300025932 | Bacteria | 106112 |
| 548 | Ga0207690_10361496 | 3300025932 | Bacteria | 1150 |
| 549 | Ga0207706_10002470 | 3300025933 | Bacteria | 18018 |
| 550 | Ga0207706_10019428 | 3300025933 | Bacteria | 6114 |
| 551 | Ga0207706_11075288 | 3300025933 | Bacteria | 673 |
| 552 | Ga0207686_10231924 | 3300025934 | Bacteria | 1339 |
| 553 | Ga0207686_10351866 | 3300025934 | Bacteria | 1109 |
| 554 | Ga0207709_10000574 | 3300025935 | Bacteria | 30979 |
| 555 | Ga0207709_10387182 | 3300025935 | Bacteria | 1065 |
| 556 | Ga0207709_10920234 | 3300025935 | Bacteria | 711 |
| 557 | Ga0207709_11469804 | 3300025935 | Bacteria | 565 |
| 558 | Ga0207670_11350781 | 3300025936 | Bacteria | 605 |
| 559 | Ga0207669_10000044 | 3300025937 | Bacteria | 63993 |
| 560 | Ga0207669_10007750 | 3300025937 | Bacteria | 4995 |
| 561 | Ga0207669_10024307 | 3300025937 | Bacteria | 3254 |
| 562 | Ga0207704_10391686 | 3300025938 | Bacteria | 1094 |
| 563 | Ga0207704_11878280 | 3300025938 | Bacteria | 515 |
| 564 | Ga0207691_10002177 | 3300025940 | Bacteria | 19162 |
| 565 | Ga0207691_10142133 | 3300025940 | Bacteria | 2115 |
| 566 | Ga0207691_11627805 | 3300025940 | Bacteria | 524 |
| 567 | Ga0207711_10202869 | 3300025941 | Bacteria | 1810 |
| 568 | Ga0207711_10241428 | 3300025941 | Bacteria | 1656 |
| 569 | Ga0207711_10335169 | 3300025941 | Bacteria | 1399 |
| 570 | Ga0207711_11724276 | 3300025941 | Bacteria | 570 |
| 571 | Ga0207689_11469562 | 3300025942 | Bacteria | 570 |
| 572 | Ga0207661_11369783 | 3300025944 | Bacteria | 649 |
| 573 | Ga0207679_10027267 | 3300025945 | Bacteria | 3949 |
| 574 | Ga0207679_11814755 | 3300025945 | Bacteria | 557 |
| 575 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 576 | Ga0207667_10053707 | 3300025949 | Bacteria | 4239 |
| 577 | Ga0207667_10772239 | 3300025949 | Bacteria | 959 |
| 578 | Ga0207667_11023535 | 3300025949 | Bacteria | 812 |
| 579 | Ga0207651_10024451 | 3300025960 | Bacteria | 3737 |
| 580 | Ga0207712_10013270 | 3300025961 | Bacteria | 5281 |
| 581 | Ga0207712_10280829 | 3300025961 | Bacteria | 1359 |
| 582 | Ga0207712_10446143 | 3300025961 | Bacteria | 1096 |
| 583 | Ga0207712_11880967 | 3300025961 | Bacteria | 536 |
| 584 | Ga0207668_10000720 | 3300025972 | Bacteria | 20252 |
| 585 | Ga0207668_10005075 | 3300025972 | Bacteria | 7748 |
| 586 | Ga0207668_10077705 | 3300025972 | Bacteria | 2394 |
| 587 | Ga0207668_10232671 | 3300025972 | Bacteria | 1487 |
| 588 | Ga0207668_10275915 | 3300025972 | Bacteria | 1376 |
| 589 | Ga0207668_11902423 | 3300025972 | Bacteria | 536 |
| 590 | Ga0207668_11925484 | 3300025972 | Bacteria | 533 |
| 591 | Ga0207640_10002340 | 3300025981 | Bacteria | 10184 |
| 592 | Ga0207640_10017460 | 3300025981 | Bacteria | 4199 |
| 593 | Ga0207658_10001159 | 3300025986 | Bacteria | 21112 |
| 594 | Ga0207658_10025817 | 3300025986 | Bacteria | 4114 |
| 595 | Ga0207658_10099468 | 3300025986 | Bacteria | 2275 |
| 596 | Ga0207658_10207340 | 3300025986 | Bacteria | 1640 |
| 597 | Ga0207658_10285591 | 3300025986 | Bacteria | 1416 |
| 598 | Ga0207658_10906088 | 3300025986 | Bacteria | 803 |
| 599 | Ga0207677_10162266 | 3300026023 | Bacteria | 1738 |
| 600 | Ga0207677_10164483 | 3300026023 | Bacteria | 1728 |
| 601 | Ga0207703_10011232 | 3300026035 | Bacteria | 6968 |
| 602 | Ga0207703_10064656 | 3300026035 | Bacteria | 3004 |
| 603 | Ga0207703_10785799 | 3300026035 | Bacteria | 908 |
| 604 | Ga0207639_10000777 | 3300026041 | Bacteria | 21710 |
| 605 | Ga0207639_11108890 | 3300026041 | Bacteria | 742 |
| 606 | Ga0207639_11476767 | 3300026041 | Bacteria | 638 |
| 607 | Ga0207678_10005545 | 3300026067 | Bacteria | 11277 |
| 608 | Ga0207678_10068106 | 3300026067 | Bacteria | 3055 |
| 609 | Ga0207708_10206377 | 3300026075 | Bacteria | 1569 |
| 610 | Ga0207702_10003669 | 3300026078 | Bacteria | 13897 |
| 611 | Ga0207702_10006661 | 3300026078 | Bacteria | 9934 |
| 612 | Ga0207702_11156063 | 3300026078 | Bacteria | 768 |
| 613 | Ga0207641_10006329 | 3300026088 | Bacteria | 10006 |
| 614 | Ga0207641_10168806 | 3300026088 | Bacteria | 1995 |
| 615 | Ga0207641_10405047 | 3300026088 | Bacteria | 1310 |
| 616 | Ga0207641_10558432 | 3300026088 | Bacteria | 1117 |
| 617 | Ga0207641_10802312 | 3300026088 | Bacteria | 931 |
| 618 | Ga0207641_11612360 | 3300026088 | Bacteria | 651 |
| 619 | Ga0207641_12023876 | 3300026088 | Bacteria | 577 |
| 620 | Ga0207648_10029482 | 3300026089 | Bacteria | 4866 |
| 621 | Ga0207648_10085699 | 3300026089 | Bacteria | 2748 |
| 622 | Ga0207676_10030447 | 3300026095 | Bacteria | 4052 |
| 623 | Ga0207676_10046151 | 3300026095 | Bacteria | 3370 |
| 624 | Ga0207676_10252703 | 3300026095 | Bacteria | 1587 |
| 625 | Ga0207676_11219950 | 3300026095 | Bacteria | 746 |
| 626 | Ga0207674_10012390 | 3300026116 | Bacteria | 9533 |
| 627 | Ga0207674_10173026 | 3300026116 | Bacteria | 2112 |
| 628 | Ga0207674_10668720 | 3300026116 | Bacteria | 1003 |
| 629 | Ga0207674_11207251 | 3300026116 | Bacteria | 726 |
| 630 | Ga0207674_11359009 | 3300026116 | Bacteria | 680 |
| 631 | Ga0207675_100016300 | 3300026118 | Bacteria | 6937 |
| 632 | Ga0207683_10140414 | 3300026121 | Bacteria | 2176 |
| 633 | Ga0207683_10240991 | 3300026121 | Bacteria | 1649 |
| 634 | Ga0207683_10498239 | 3300026121 | Bacteria | 1125 |
| 635 | Ga0207683_10552332 | 3300026121 | Bacteria | 1065 |
| 636 | Ga0207683_11344496 | 3300026121 | Bacteria | 661 |
| 637 | Ga0207698_10000537 | 3300026142 | Bacteria | 22020 |
| 638 | Ga0207698_10008071 | 3300026142 | Bacteria | 6639 |
| 639 | Ga0207698_10151214 | 3300026142 | Bacteria | 2015 |
| 640 | Ga0209973_1038452 | 3300027252 | Bacteria | 695 |
| 641 | Ga0209970_1024934 | 3300027614 | Bacteria | 1023 |
| 642 | Ga0210002_1034486 | 3300027617 | Bacteria | 848 |
| 643 | Ga0210002_1078664 | 3300027617 | Bacteria | 586 |
| 644 | Ga0209971_1049962 | 3300027682 | Bacteria | 1010 |
| 645 | Ga0209998_10056268 | 3300027717 | Bacteria | 919 |
| 646 | Ga0209813_10000081 | 3300027866 | Bacteria | 35059 |
| 647 | Ga0207428_10243522 | 3300027907 | Bacteria | 1343 |
| 648 | Ga0207428_10462692 | 3300027907 | Bacteria | 924 |
| 649 | Ga0265356_1039492 | 3300028017 | Bacteria | 519 |
| 650 | Ga0268266_10000471 | 3300028379 | Bacteria | 58314 |
| 651 | Ga0268266_10014912 | 3300028379 | Bacteria | 6674 |
| 652 | Ga0268266_10181481 | 3300028379 | Bacteria | 1917 |
| 653 | Ga0268266_10915904 | 3300028379 | Bacteria | 848 |
| 654 | Ga0268266_11959938 | 3300028379 | Bacteria | 559 |
| 655 | Ga0268266_12167543 | 3300028379 | Bacteria | 528 |
| 656 | Ga0268265_10010196 | 3300028380 | Bacteria | 6342 |
| 657 | Ga0268265_10011459 | 3300028380 | Bacteria | 5995 |
| 658 | Ga0268265_10037933 | 3300028380 | Bacteria | 3540 |
| 659 | Ga0268265_10043598 | 3300028380 | Bacteria | 3336 |
| 660 | Ga0268265_10110885 | 3300028380 | Bacteria | 2239 |
| 661 | Ga0268265_11170391 | 3300028380 | Unclassified | 766 |
| 662 | Ga0268265_12217624 | 3300028380 | Bacteria | 556 |
| 663 | Ga0268264_10001249 | 3300028381 | Bacteria | 24255 |
| 664 | Ga0268264_10005153 | 3300028381 | Bacteria | 11076 |
| 665 | Ga0268264_10006783 | 3300028381 | Bacteria | 9618 |
| 666 | Ga0268264_10263600 | 3300028381 | Bacteria | 1606 |
| 667 | Ga0268264_10501721 | 3300028381 | Bacteria | 1184 |
| 668 | Ga0268264_11115163 | 3300028381 | Bacteria | 798 |
| 669 | Ga0265318_10281431 | 3300028577 | Bacteria | 607 |
| 670 | Ga0307517_10032795 | 3300028786 | Bacteria | 5989 |
| 671 | Ga0307515_10002885 | 3300028794 | Bacteria | 36551 |
| 672 | Ga0307515_10544729 | 3300028794 | Bacteria | 770 |
| 673 | Ga0265338_10041348 | 3300028800 | Bacteria | 4312 |
| 674 | Ga0316176_1100255 | 3300030732 | Bacteria | 697 |
| 675 | Ga0314311_1148511 | 3300030733 | Bacteria | 919 |
| 676 | Ga0314311_1234607 | 3300030733 | Bacteria | 1075 |
| 677 | Ga0316181_1135234 | 3300030744 | Bacteria | 747 |
| 678 | Ga0316182_1060881 | 3300030745 | Bacteria | 580 |
| 679 | Ga0316182_1148393 | 3300030745 | Bacteria | 860 |
| 680 | Ga0265760_10112912 | 3300031090 | Bacteria | 867 |
| 681 | Ga0265330_10031999 | 3300031235 | Bacteria | 2358 |
| 682 | Ga0265325_10114964 | 3300031241 | Bacteria | 1303 |
| 683 | Ga0265331_10073322 | 3300031250 | Bacteria | 1599 |
| 684 | Ga0265316_10151330 | 3300031344 | Bacteria | 1738 |
| 685 | Ga0307513_10010088 | 3300031456 | Bacteria | 11892 |
| 686 | Ga0307408_100478820 | 3300031548 | Bacteria | 1085 |
| 687 | Ga0307408_101285422 | 3300031548 | Bacteria | 685 |
| 688 | Ga0307408_101799182 | 3300031548 | Bacteria | 585 |
| 689 | Ga0307408_102182809 | 3300031548 | Bacteria | 535 |
| 690 | Ga0316575_10257840 | 3300031665 | Bacteria | 732 |
| 691 | Ga0316579_10004122 | 3300031691 | Bacteria | 5743 |
| 692 | Ga0316576_10023190 | 3300031727 | Bacteria | 4319 |
| 693 | Ga0316576_10724450 | 3300031727 | Bacteria | 720 |
| 694 | Ga0316576_11179694 | 3300031727 | Bacteria | 541 |
| 695 | Ga0307405_10079995 | 3300031731 | Bacteria | 2132 |
| 696 | Ga0307405_10242229 | 3300031731 | Bacteria | 1336 |
| 697 | Ga0307405_10402989 | 3300031731 | Bacteria | 1071 |
| 698 | Ga0307405_10662999 | 3300031731 | Bacteria | 859 |
| 699 | Ga0307405_10674720 | 3300031731 | Bacteria | 853 |
| 700 | Ga0307405_10789461 | 3300031731 | Bacteria | 794 |
| 701 | Ga0307405_10874348 | 3300031731 | Bacteria | 758 |
| 702 | Ga0307413_10229429 | 3300031824 | Bacteria | 1362 |
| 703 | Ga0307413_10281774 | 3300031824 | Bacteria | 1250 |
| 704 | Ga0307413_10630335 | 3300031824 | Bacteria | 881 |
| 705 | Ga0307413_10640145 | 3300031824 | Bacteria | 875 |
| 706 | Ga0307413_10774038 | 3300031824 | Bacteria | 804 |
| 707 | Ga0307413_11651359 | 3300031824 | Bacteria | 570 |
| 708 | Ga0307410_10637498 | 3300031852 | Bacteria | 892 |
| 709 | Ga0307410_10948085 | 3300031852 | Bacteria | 739 |
| 710 | Ga0307410_11301693 | 3300031852 | Bacteria | 636 |
| 711 | Ga0307406_10276975 | 3300031901 | Bacteria | 1277 |
| 712 | Ga0307406_10647690 | 3300031901 | Bacteria | 876 |
| 713 | Ga0307406_10725491 | 3300031901 | Bacteria | 832 |
| 714 | Ga0307406_10746523 | 3300031901 | Bacteria | 821 |
| 715 | Ga0307406_10943146 | 3300031901 | Bacteria | 737 |
| 716 | Ga0307406_11232056 | 3300031901 | Bacteria | 651 |
| 717 | Ga0307406_11365044 | 3300031901 | Bacteria | 620 |
| 718 | Ga0307407_10040629 | 3300031903 | Bacteria | 2595 |
| 719 | Ga0307407_10159039 | 3300031903 | Bacteria | 1476 |
| 720 | Ga0307407_11082644 | 3300031903 | Bacteria | 622 |
| 721 | Ga0307407_11194044 | 3300031903 | Bacteria | 594 |
| 722 | Ga0307412_10010127 | 3300031911 | Bacteria | 5422 |
| 723 | Ga0307412_10020188 | 3300031911 | Bacteria | 4051 |
| 724 | Ga0307412_10088761 | 3300031911 | Bacteria | 2158 |
| 725 | Ga0307412_10168075 | 3300031911 | Bacteria | 1637 |
| 726 | Ga0307412_10225103 | 3300031911 | Bacteria | 1440 |
| 727 | Ga0307412_10264932 | 3300031911 | Bacteria | 1342 |
| 728 | Ga0307412_10655875 | 3300031911 | Bacteria | 895 |
| 729 | Ga0307412_10797808 | 3300031911 | Bacteria | 819 |
| 730 | Ga0307412_10872636 | 3300031911 | Bacteria | 786 |
| 731 | Ga0307412_11036908 | 3300031911 | Bacteria | 727 |
| 732 | Ga0307412_11072137 | 3300031911 | Bacteria | 715 |
| 733 | Ga0307412_12078026 | 3300031911 | Bacteria | 527 |
| 734 | Ga0307409_100122294 | 3300031995 | Bacteria | 2207 |
| 735 | Ga0307409_100405053 | 3300031995 | Bacteria | 1304 |
| 736 | Ga0307409_100580029 | 3300031995 | Bacteria | 1105 |
| 737 | Ga0307409_100713214 | 3300031995 | Bacteria | 1003 |
| 738 | Ga0307409_100778273 | 3300031995 | Bacteria | 963 |
| 739 | Ga0307409_100830586 | 3300031995 | Bacteria | 933 |
| 740 | Ga0307409_102652186 | 3300031995 | Bacteria | 529 |
| 741 | Ga0307409_102713475 | 3300031995 | Bacteria | 523 |
| 742 | Ga0307416_100066176 | 3300032002 | Bacteria | 2974 |
| 743 | Ga0307416_100213452 | 3300032002 | Bacteria | 1843 |
| 744 | Ga0307416_100399071 | 3300032002 | Bacteria | 1412 |
| 745 | Ga0307416_100469867 | 3300032002 | Bacteria | 1315 |
| 746 | Ga0307416_100981045 | 3300032002 | Bacteria | 947 |
| 747 | Ga0307416_101196369 | 3300032002 | Bacteria | 865 |
| 748 | Ga0307416_102475077 | 3300032002 | Bacteria | 618 |
| 749 | Ga0307416_102860286 | 3300032002 | Bacteria | 577 |
| 750 | Ga0307414_10065371 | 3300032004 | Bacteria | 2594 |
| 751 | Ga0307414_10070136 | 3300032004 | Bacteria | 2522 |
| 752 | Ga0307414_10082088 | 3300032004 | Bacteria | 2362 |
| 753 | Ga0307414_10121242 | 3300032004 | Bacteria | 2010 |
| 754 | Ga0307414_10150384 | 3300032004 | Bacteria | 1836 |
| 755 | Ga0307414_10293449 | 3300032004 | Bacteria | 1372 |
| 756 | Ga0307414_10484627 | 3300032004 | Bacteria | 1091 |
| 757 | Ga0307414_10492531 | 3300032004 | Bacteria | 1083 |
| 758 | Ga0307414_10572278 | 3300032004 | Bacteria | 1009 |
| 759 | Ga0307414_10785350 | 3300032004 | Bacteria | 867 |
| 760 | Ga0307414_10972663 | 3300032004 | Bacteria | 780 |
| 761 | Ga0307414_11456459 | 3300032004 | Bacteria | 637 |
| 762 | Ga0307414_11458569 | 3300032004 | Bacteria | 636 |
| 763 | Ga0307411_10048142 | 3300032005 | Bacteria | 2761 |
| 764 | Ga0307411_10322920 | 3300032005 | Bacteria | 1247 |
| 765 | Ga0307411_10856289 | 3300032005 | Bacteria | 804 |
| 766 | Ga0307411_12046010 | 3300032005 | Bacteria | 535 |
| 767 | Ga0307411_12108890 | 3300032005 | Bacteria | 527 |
| 768 | Ga0307415_100188175 | 3300032126 | Bacteria | 1626 |
| 769 | Ga0307415_100241924 | 3300032126 | Bacteria | 1460 |
| 770 | Ga0307415_100576145 | 3300032126 | Bacteria | 997 |
| 771 | Ga0307510_10041740 | 3300033180 | Bacteria | 5010 |
| 772 | Ga0307510_10246300 | 3300033180 | Bacteria | 1278 |
| 773 | Ga0316588_1101767 | 3300033528 | Unclassified | 720 |
| 774 | Ga0373934_0011200 | 3300035086 | Bacteria | 3376 |
| 775 | Ga0373934_0020309 | 3300035086 | Bacteria | 2552 |
| 776 | Ga0373952_0086873 | 3300035092 | Bacteria | 807 |
| 777 | Ga0373923_0120678 | 3300035111 | Bacteria | 1171 |
| 778 | Ga0373954_0000013 | 3300035118 | Bacteria | 73606 |
| 779 | Ga0373955_0119305 | 3300035172 | Bacteria | 1532 |
| 780 | Ga0373961_0008207 | 3300035241 | Bacteria | 2538 |
| 781 | Ga0373961_0139179 | 3300035241 | Bacteria | 819 |
| 782 | Ga0316574_0015732 | 3300035398 | Bacteria | 4392 |
| 783 | Ga0316574_0026931 | 3300035398 | Bacteria | 3460 |
| 784 | Ga0316574_0049538 | 3300035398 | Bacteria | 2612 |
| 785 | Ga0316574_0365320 | 3300035398 | Bacteria | 912 |
| 786 | Ga0373924_0035457 | 3300035410 | Bacteria | 2023 |
| 787 | Ga0373933_0008247 | 3300035724 | Bacteria | 5685 |
| 788 | Ga0373937_0000568 | 3300036401 | Bacteria | 32759 |
| 789 | Ga0316582_0008050 | 3300036647 | Bacteria | 5639 |
| 790 | Ga0395899_0001486 | 3300037312 | Bacteria | 19952 |
| 791 | Ga0395899_0175118 | 3300037312 | Bacteria | 1509 |
| 792 | Ga0395900_0079824 | 3300037418 | Bacteria | 3362 |
| 793 | Ga0395905_0496689 | 3300037471 | Bacteria | 1120 |
| 794 | Ga0395905_0708103 | 3300037471 | Bacteria | 909 |
| 795 | Ga0316581_0266312 | 3300037588 | Bacteria | 526 |
| 796 | Ga0436364_1232957 | 3300037853 | Bacteria | 3551 |
| 797 | Ga0395901_0135462 | 3300038443 | Bacteria | 2589 |
| 798 | Ga0436365_0875957 | 3300039437 | Bacteria | 766 |
| 799 | Ga0436365_1049735 | 3300039437 | Bacteria | 987 |
| 800 | Ga0436363_1338713 | 3300039450 | Bacteria | 944 |
| 801 | Ga0439436_0167408 | 3300041404 | Bacteria | 623 |
| 802 | Ga0439439_0030580 | 3300041406 | Bacteria | 1369 |
| 803 | Ga0439447_030078 | 3300041407 | Bacteria | 1371 |
| 804 | Ga0439453_0001227 | 3300041408 | Bacteria | 3238 |
| 805 | Ga0439461_0000086 | 3300041410 | Bacteria | 12130 |
| 806 | Ga0439461_0100584 | 3300041410 | Bacteria | 703 |
| 807 | Ga0439466_0038559 | 3300041411 | Bacteria | 1605 |
| 808 | Ga0439465_0001125 | 3300041413 | Bacteria | 8568 |
| 809 | Ga0439465_0010998 | 3300041413 | Bacteria | 2837 |
| 810 | Ga0451788_13712 | 3300041442 | Bacteria | 565 |
| 811 | Ga0451791_0887440 | 3300041451 | Bacteria | 742 |
| 812 | Ga0451793_0892181 | 3300041452 | Bacteria | 768 |
| 813 | Ga0451797_0437635 | 3300041453 | Bacteria | 684 |
| 814 | Ga0451801_37066 | 3300041455 | Bacteria | 508 |
| 815 | Ga0451802_1631382 | 3300041460 | Bacteria | 803 |
| 816 | Ga0451833_0536339 | 3300041491 | Bacteria | 1373 |
| 817 | Ga0451833_0710986 | 3300041491 | Unclassified | 640 |
| 818 | Ga0451835_0060857 | 3300041492 | Bacteria | 664 |
| 819 | Ga0451841_0833099 | 3300041498 | Bacteria | 995 |
| 820 | Ga0451841_1278623 | 3300041498 | Bacteria | 542 |
| 821 | Ga0451845_0715186 | 3300041501 | Bacteria | 722 |
| 822 | Ga0451846_03630 | 3300041502 | Bacteria | 631 |
| 823 | Ga0451851_0162624 | 3300041507 | Bacteria | 524 |
| 824 | Ga0451853_2850232 | 3300041512 | Bacteria | 1025 |
| 825 | Ga0439431_0000491 | 3300041997 | Bacteria | 8366 |
| 826 | Ga0439431_0196553 | 3300041997 | Bacteria | 586 |
| 827 | Ga0439431_0211085 | 3300041997 | Bacteria | 568 |
| 828 | Ga0439441_097568 | 3300042001 | Bacteria | 656 |
| 829 | Ga0439442_009847 | 3300042002 | Bacteria | 1933 |
| 830 | Ga0439445_0000271 | 3300042004 | Bacteria | 10008 |
| 831 | Ga0439445_0000898 | 3300042004 | Bacteria | 6309 |
| 832 | Ga0439445_0022188 | 3300042004 | Bacteria | 1599 |
| 833 | Ga0439448_0007732 | 3300042005 | Bacteria | 3122 |
| 834 | Ga0439432_001270 | 3300042006 | Bacteria | 9547 |
| 835 | Ga0439452_015389 | 3300042010 | Bacteria | 2100 |
| 836 | Ga0439455_0200052 | 3300042012 | Bacteria | 578 |
| 837 | Ga0439457_014255 | 3300042014 | Bacteria | 1780 |
| 838 | Ga0439462_0003457 | 3300042015 | Bacteria | 3790 |
| 839 | Ga0450923_062085 | 3300042125 | Bacteria | 817 |
| 840 | Ga0450906_016697 | 3300042145 | Bacteria | 1327 |
| 841 | Ga0450910_088011 | 3300042147 | Bacteria | 548 |
| 842 | Ga0439446_0015960 | 3300042156 | Bacteria | 2088 |
| 843 | Ga0439446_0071753 | 3300042156 | Bacteria | 1060 |
| 844 | Ga0439434_0001316 | 3300042435 | Bacteria | 7154 |
| 845 | Ga0439434_0258754 | 3300042435 | Bacteria | 596 |
| 846 | Ga0439434_0365909 | 3300042435 | Bacteria | 505 |
| 847 | Ga0439460_0285315 | 3300042461 | Bacteria | 575 |
| 848 | Ga0439460_0309249 | 3300042461 | Bacteria | 553 |
| 849 | Ga0466965_0190472 | 3300044683 | Bacteria | 1085 |
| 850 | Ga0466966_0642050 | 3300044684 | Bacteria | 639 |
| 851 | Ga0466961_0511827 | 3300044693 | Bacteria | 724 |
| 852 | Ga0466963_0202490 | 3300044694 | Bacteria | 1388 |
| 853 | Ga0466971_0011267 | 3300044719 | Bacteria | 3917 |
| 854 | Ga0466957_0129471 | 3300044842 | Bacteria | 1615 |
| 855 | Ga0466958_0058924 | 3300045836 | Bacteria | 2335 |
| 856 | Ga0466967_0088373 | 3300045976 | Bacteria | 2812 |
| 857 | Ga0495627_024430 | 3300046453 | Bacteria | 1970 |
| 858 | Ga0495629_0409358 | 3300046459 | Bacteria | 921 |
| 859 | Ga0495638_0006816 | 3300046460 | Bacteria | 8247 |
| 860 | Ga0495650_0000158 | 3300046471 | Bacteria | 154681 |
| 861 | Ga0495662_0629714 | 3300046476 | Bacteria | 524 |
| 862 | Ga0495584_0653790 | 3300046491 | Bacteria | 536 |
| 863 | Ga0495585_0007224 | 3300046492 | Bacteria | 6825 |
| 864 | Ga0495596_0001722 | 3300046500 | Bacteria | 12303 |
| 865 | Ga0495596_0288891 | 3300046500 | Bacteria | 637 |
| 866 | Ga0495607_0233928 | 3300046501 | Bacteria | 892 |
| 867 | Ga0495583_0000139 | 3300046506 | Bacteria | 123464 |
| 868 | Ga0495583_0000631 | 3300046506 | Bacteria | 46958 |
| 869 | Ga0495583_0049835 | 3300046506 | Bacteria | 1915 |
| 870 | Ga0495583_0138928 | 3300046506 | Bacteria | 1013 |
| 871 | Ga0495606_0000672 | 3300046507 | Bacteria | 53500 |
| 872 | Ga0495606_0097843 | 3300046507 | Bacteria | 1792 |
| 873 | Ga0495610_0001956 | 3300046512 | Bacteria | 17724 |
| 874 | Ga0495610_0102024 | 3300046512 | Bacteria | 1284 |
| 875 | Ga0495610_0167798 | 3300046512 | Bacteria | 923 |
| 876 | Ga0495610_0241972 | 3300046512 | Bacteria | 719 |
| 877 | Ga0495616_0035449 | 3300046513 | Bacteria | 2582 |
| 878 | Ga0495618_0666693 | 3300046514 | Bacteria | 614 |
| 879 | Ga0495620_0074993 | 3300046515 | Bacteria | 1377 |
| 880 | Ga0495620_0310170 | 3300046515 | Bacteria | 599 |
| 881 | Ga0495631_0274197 | 3300046518 | Bacteria | 718 |
| 882 | Ga0495637_0013506 | 3300046520 | Bacteria | 3873 |
| 883 | Ga0495643_0042779 | 3300046522 | Bacteria | 2467 |
| 884 | Ga0495643_0058229 | 3300046522 | Bacteria | 2056 |
| 885 | Ga0495643_0419710 | 3300046522 | Bacteria | 587 |
| 886 | Ga0495644_0189750 | 3300046523 | Bacteria | 791 |
| 887 | Ga0495648_0000143 | 3300046524 | Bacteria | 85539 |
| 888 | Ga0495663_0004724 | 3300046525 | Bacteria | 3812 |
| 889 | Ga0495663_0004868 | 3300046525 | Bacteria | 3752 |
| 890 | Ga0495663_0074411 | 3300046525 | Bacteria | 1086 |
| 891 | Ga0495642_0008825 | 3300046528 | Bacteria | 3855 |
| 892 | Ga0495642_0027044 | 3300046528 | Bacteria | 2281 |
| 893 | Ga0495586_0070475 | 3300046535 | Bacteria | 1909 |
| 894 | Ga0495587_0027072 | 3300046536 | Bacteria | 3492 |
| 895 | Ga0495587_0275897 | 3300046536 | Bacteria | 943 |
| 896 | Ga0495598_0074808 | 3300046537 | Bacteria | 1074 |
| 897 | Ga0495609_0096737 | 3300046538 | Bacteria | 1281 |
| 898 | Ga0495621_0027893 | 3300046539 | Bacteria | 1915 |
| 899 | Ga0495622_0007935 | 3300046557 | Bacteria | 4920 |
| 900 | Ga0495633_0002517 | 3300046558 | Bacteria | 12889 |
| 901 | Ga0495633_0077644 | 3300046558 | Bacteria | 1546 |
| 902 | Ga0495633_0126517 | 3300046558 | Bacteria | 1182 |
| 903 | Ga0495656_0332712 | 3300046615 | Bacteria | 784 |
| 904 | Ga0495668_0000016 | 3300046616 | Bacteria | 438197 |
| 905 | Ga0495625_0000150 | 3300046660 | Bacteria | 106314 |
| 906 | Ga0495625_0388205 | 3300046660 | Bacteria | 874 |
| 907 | Ga0495659_0030064 | 3300046664 | Bacteria | 1888 |
| 908 | Ga0495659_0493366 | 3300046664 | Bacteria | 536 |
| 909 | Ga0495661_0094901 | 3300046665 | Bacteria | 1690 |
| 910 | Ga0495661_0261427 | 3300046665 | Bacteria | 879 |
| 911 | Ga0495661_0358626 | 3300046665 | Bacteria | 716 |
| 912 | Ga0495657_0161972 | 3300046675 | Bacteria | 1384 |
| 913 | Ga0495658_0610658 | 3300046683 | Bacteria | 699 |
| 914 | Ga0495669_0000050 | 3300046684 | Bacteria | 80688 |
| 915 | Ga0495669_0015265 | 3300046684 | Bacteria | 3289 |
| 916 | Ga0495670_0005678 | 3300046691 | Bacteria | 6117 |
| 917 | Ga0495670_0134108 | 3300046691 | Bacteria | 1292 |
| 918 | Ga0495671_0273798 | 3300046692 | Bacteria | 814 |
| 919 | Ga0495649_0055299 | 3300046694 | Bacteria | 2145 |
| 920 | Ga0495649_0146871 | 3300046694 | Bacteria | 1239 |
| 921 | Ga0495589_0426484 | 3300046794 | Bacteria | 608 |
| 922 | Ga0495600_0000690 | 3300046809 | Bacteria | 17650 |
| 923 | Ga0495660_0019031 | 3300046810 | Bacteria | 3943 |
| 924 | Ga0495604_0375413 | 3300047317 | Bacteria | 940 |
| 925 | Ga0495672_0258162 | 3300047320 | Bacteria | 842 |
| 926 | Ga0495687_000098 | 3300047443 | Bacteria | 132403 |
| 927 | Ga0495687_000455 | 3300047443 | Bacteria | 50452 |
| 928 | Ga0495687_026151 | 3300047443 | Bacteria | 2752 |
| 929 | Ga0495687_082012 | 3300047443 | Bacteria | 1260 |
| 930 | Ga0495677_0023015 | 3300047445 | Bacteria | 2261 |
| 931 | Ga0495677_0174372 | 3300047445 | Bacteria | 832 |
| 932 | Ga0495685_067989 | 3300047447 | Bacteria | 1196 |
| 933 | Ga0495673_0175421 | 3300047469 | Bacteria | 814 |
| 934 | Ga0495681_0043708 | 3300047470 | Bacteria | 2158 |
| 935 | Ga0495681_0171859 | 3300047470 | Bacteria | 896 |
| 936 | Ga0495686_0619169 | 3300047472 | Bacteria | 559 |
| 937 | Ga0495615_0000060 | 3300048090 | Bacteria | 34266 |
| 938 | Ga0495626_0000877 | 3300048091 | Bacteria | 26762 |
| 939 | Ga0495626_0287230 | 3300048091 | Bacteria | 652 |
| 940 | Ga0496100_0000980 | 3300048903 | Bacteria | 13723 |
| 941 | Ga0496100_0011451 | 3300048903 | Bacteria | 5049 |
| 942 | Ga0496100_0105517 | 3300048903 | Bacteria | 1949 |
| 943 | Ga0496101_0008286 | 3300048904 | Bacteria | 6791 |
| 944 | Ga0496101_0077643 | 3300048904 | Bacteria | 2447 |
| 945 | Ga0496101_0381119 | 3300048904 | Bacteria | 1109 |
| 946 | Ga0496101_0392392 | 3300048904 | Bacteria | 1093 |
| 947 | Ga0496101_0851214 | 3300048904 | Bacteria | 718 |
| 948 | Ga0496102_0000199 | 3300048905 | Bacteria | 81435 |
| 949 | Ga0496102_0001054 | 3300048905 | Bacteria | 25520 |
| 950 | Ga0496102_0058238 | 3300048905 | Bacteria | 3530 |
| 951 | Ga0496102_0060341 | 3300048905 | Bacteria | 3468 |
| 952 | Ga0496102_0790010 | 3300048905 | Bacteria | 872 |
| 953 | Ga0496103_0000289 | 3300048906 | Bacteria | 47033 |
| 954 | Ga0496103_0000633 | 3300048906 | Bacteria | 26944 |
| 955 | Ga0496103_0004432 | 3300048906 | Bacteria | 8517 |
| 956 | Ga0496103_0062475 | 3300048906 | Bacteria | 2318 |
| 957 | Ga0496103_0087293 | 3300048906 | Bacteria | 1966 |
| 958 | Ga0496103_0252642 | 3300048906 | Bacteria | 1134 |
| 959 | Ga0496104_0000474 | 3300048907 | Bacteria | 34558 |
| 960 | Ga0496104_0045338 | 3300048907 | Bacteria | 4134 |
| 961 | Ga0496104_0136930 | 3300048907 | Bacteria | 2353 |
| 962 | Ga0496104_0249205 | 3300048907 | Bacteria | 1689 |
| 963 | Ga0496104_0284172 | 3300048907 | Bacteria | 1567 |
| 964 | Ga0496104_0619960 | 3300048907 | Bacteria | 991 |
| 965 | Ga0496105_0000690 | 3300048908 | Bacteria | 22731 |
| 966 | Ga0496105_0124885 | 3300048908 | Bacteria | 2121 |
| 967 | Ga0496105_0158470 | 3300048908 | Bacteria | 1858 |
| 968 | Ga0496106_0008825 | 3300048909 | Bacteria | 7450 |
| 969 | Ga0496106_0008866 | 3300048909 | Bacteria | 7435 |
| 970 | Ga0496107_0014228 | 3300048910 | Bacteria | 5571 |
| 971 | Ga0496107_0023026 | 3300048910 | Bacteria | 4404 |
| 972 | Ga0496107_0066908 | 3300048910 | Bacteria | 2605 |
| 973 | Ga0496107_0233824 | 3300048910 | Bacteria | 1367 |
| 974 | Ga0496108_0277684 | 3300048911 | Bacteria | 1458 |
| 975 | Ga0496109_0182656 | 3300048912 | Bacteria | 1970 |
| 976 | Ga0496109_0194861 | 3300048912 | Bacteria | 1904 |
| 977 | Ga0496109_0357358 | 3300048912 | Bacteria | 1380 |
| 978 | Ga0496110_0025670 | 3300048913 | Bacteria | 5038 |
| 979 | Ga0496110_0067902 | 3300048913 | Bacteria | 3155 |
| 980 | Ga0496110_0121287 | 3300048913 | Bacteria | 2355 |
| 981 | Ga0496110_0835615 | 3300048913 | Bacteria | 826 |
| 982 | Ga0496111_0033303 | 3300048914 | Bacteria | 3674 |
| 983 | Ga0496111_0082756 | 3300048914 | Bacteria | 2344 |
| 984 | Ga0496111_0156088 | 3300048914 | Bacteria | 1693 |
| 985 | Ga0496111_0373799 | 3300048914 | Bacteria | 1054 |
| 986 | Ga0496112_0014681 | 3300048915 | Bacteria | 7280 |
| 987 | Ga0496112_0100877 | 3300048915 | Bacteria | 2856 |
| 988 | Ga0496112_0120643 | 3300048915 | Bacteria | 2592 |
| 989 | Ga0496112_0368823 | 3300048915 | Bacteria | 1377 |
| 990 | Ga0496112_0879669 | 3300048915 | Bacteria | 818 |
| 991 | Ga0496113_0004277 | 3300048916 | Bacteria | 8751 |
| 992 | Ga0496113_0015458 | 3300048916 | Bacteria | 5246 |
| 993 | Ga0496113_0057153 | 3300048916 | Bacteria | 2931 |
| 994 | Ga0496113_0194089 | 3300048916 | Bacteria | 1612 |
| 995 | Ga0496113_0661150 | 3300048916 | Bacteria | 835 |
| 996 | Ga0496113_1579017 | 3300048916 | Bacteria | 505 |
| 997 | Ga0496114_0007726 | 3300048917 | Bacteria | 8507 |
| 998 | Ga0496114_0287877 | 3300048917 | Bacteria | 1449 |
| 999 | Ga0496114_0296042 | 3300048917 | Bacteria | 1428 |
| 1000 | Ga0496114_0604954 | 3300048917 | Bacteria | 966 |
| 1001 | Ga0496115_0000131 | 3300048918 | Bacteria | 68111 |
| 1002 | Ga0496115_0000483 | 3300048918 | Bacteria | 31557 |
| 1003 | Ga0496115_0119296 | 3300048918 | Bacteria | 2170 |
| 1004 | Ga0496115_0399087 | 3300048918 | Bacteria | 1116 |
| 1005 | Ga0496115_0541523 | 3300048918 | Bacteria | 931 |
| 1006 | Ga0496116_0000045 | 3300048919 | Bacteria | 324307 |
| 1007 | Ga0496116_0017932 | 3300048919 | Bacteria | 5474 |
| 1008 | Ga0496116_0029227 | 3300048919 | Bacteria | 3977 |
| 1009 | Ga0496116_0121950 | 3300048919 | Bacteria | 1506 |
| 1010 | Ga0496117_0000352 | 3300048920 | Bacteria | 81089 |
| 1011 | Ga0496117_0004523 | 3300048920 | Bacteria | 15262 |
| 1012 | Ga0496117_0066974 | 3300048920 | Bacteria | 2433 |
| 1013 | Ga0496117_0079061 | 3300048920 | Bacteria | 2168 |
| 1014 | Ga0496117_0120301 | 3300048920 | Bacteria | 1615 |
| 1015 | Ga0496117_0221919 | 3300048920 | Bacteria | 1051 |
| 1016 | Ga0496117_0568574 | 3300048920 | Bacteria | 536 |
| 1017 | Ga0496118_0000092 | 3300048921 | Bacteria | 169106 |
| 1018 | Ga0496118_0004825 | 3300048921 | Bacteria | 15724 |
| 1019 | Ga0496118_0020152 | 3300048921 | Bacteria | 5926 |
| 1020 | Ga0496118_0021880 | 3300048921 | Bacteria | 5609 |
| 1021 | Ga0496118_0051033 | 3300048921 | Bacteria | 3168 |
| 1022 | Ga0496118_0196012 | 3300048921 | Bacteria | 1202 |
| 1023 | Ga0496119_0004697 | 3300048922 | Bacteria | 13438 |
| 1024 | Ga0496119_0009738 | 3300048922 | Bacteria | 8181 |
| 1025 | Ga0496119_0038098 | 3300048922 | Bacteria | 3112 |
| 1026 | Ga0496119_0169489 | 3300048922 | Bacteria | 1154 |
| 1027 | Ga0496120_0007424 | 3300048923 | Bacteria | 8153 |
| 1028 | Ga0496120_0024506 | 3300048923 | Bacteria | 3762 |
| 1029 | Ga0496120_0119204 | 3300048923 | Bacteria | 1367 |
| 1030 | Ga0496120_0257527 | 3300048923 | Bacteria | 816 |
| 1031 | Ga0496120_0376859 | 3300048923 | Bacteria | 632 |
| 1032 | Ga0496121_0000228 | 3300048924 | Bacteria | 120653 |
| 1033 | Ga0496121_0001923 | 3300048924 | Bacteria | 33167 |
| 1034 | Ga0496121_0007837 | 3300048924 | Bacteria | 12771 |
| 1035 | Ga0496121_0057301 | 3300048924 | Bacteria | 3230 |
| 1036 | Ga0496121_0228962 | 3300048924 | Bacteria | 1303 |
| 1037 | Ga0496122_0009937 | 3300048925 | Bacteria | 9911 |
| 1038 | Ga0496122_0020908 | 3300048925 | Bacteria | 5884 |
| 1039 | Ga0496122_0033342 | 3300048925 | Bacteria | 4237 |
| 1040 | Ga0496122_0068094 | 3300048925 | Bacteria | 2558 |
| 1041 | Ga0496122_0107366 | 3300048925 | Bacteria | 1845 |
| 1042 | Ga0496123_0000785 | 3300048926 | Bacteria | 51254 |
| 1043 | Ga0496123_0001112 | 3300048926 | Bacteria | 40286 |
| 1044 | Ga0496123_0033385 | 3300048926 | Bacteria | 3705 |
| 1045 | Ga0496123_0041482 | 3300048926 | Bacteria | 3189 |
| 1046 | Ga0496124_0000081 | 3300048927 | Bacteria | 208413 |
| 1047 | Ga0496124_0005380 | 3300048927 | Bacteria | 14456 |
| 1048 | Ga0496124_0053225 | 3300048927 | Bacteria | 3433 |
| 1049 | Ga0496124_0273659 | 3300048927 | Bacteria | 1235 |
| 1050 | Ga0496124_0402011 | 3300048927 | Bacteria | 950 |
| 1051 | Ga0496124_0487541 | 3300048927 | Bacteria | 830 |
| 1052 | Ga0496125_0000980 | 3300048928 | Bacteria | 44624 |
| 1053 | Ga0496125_0003170 | 3300048928 | Bacteria | 20385 |
| 1054 | Ga0496125_0062486 | 3300048928 | Bacteria | 2977 |
| 1055 | Ga0496125_0087157 | 3300048928 | Bacteria | 2359 |
| 1056 | Ga0496125_0205965 | 3300048928 | Bacteria | 1282 |
| 1057 | Ga0496125_0242116 | 3300048928 | Bacteria | 1144 |
| 1058 | Ga0496126_0000283 | 3300048929 | Bacteria | 107129 |
| 1059 | Ga0496126_0000802 | 3300048929 | Bacteria | 56265 |
| 1060 | Ga0496126_0001266 | 3300048929 | Bacteria | 40672 |
| 1061 | Ga0496126_0041891 | 3300048929 | Bacteria | 4233 |
| 1062 | Ga0496126_0625867 | 3300048929 | Bacteria | 845 |
| 1063 | Ga0496126_1082057 | 3300048929 | Bacteria | 597 |
| 1064 | Ga0501306_023694 | 3300049127 | Bacteria | 873 |
| 1065 | Ga0501309_024779 | 3300049129 | Bacteria | 859 |
| 1066 | Ga0501309_026442 | 3300049129 | Bacteria | 838 |
| 1067 | Ga0501310_017093 | 3300049130 | Bacteria | 875 |
| 1068 | Ga0501307_061030 | 3300049162 | Bacteria | 585 |
| 1069 | Ga0495682_0061278 | 3300049460 | Bacteria | 1358 |
| 1070 | Ga0495682_0098625 | 3300049460 | Bacteria | 1048 |
| 1071 | Ga0501311_013777 | 3300049527 | Bacteria | 1025 |
| 1072 | Ga0501313_017138 | 3300049529 | Bacteria | 874 |
| 1073 | Ga0501313_018621 | 3300049529 | Bacteria | 844 |
| 1074 | Ga0501314_026384 | 3300049530 | Bacteria | 629 |
| 1075 | Ga0501314_042408 | 3300049530 | Bacteria | 533 |
| 1076 | Ga0501315_020960 | 3300049531 | Bacteria | 881 |
| 1077 | Ga0501315_105878 | 3300049531 | Bacteria | 501 |
| 1078 | Ga0501316_020284 | 3300049532 | Bacteria | 833 |
| 1079 | Ga0501317_079426 | 3300049533 | Bacteria | 565 |
| 1080 | Ga0501320_017114 | 3300049536 | Bacteria | 808 |
| 1081 | Ga0501320_022178 | 3300049536 | Bacteria | 743 |
| 1082 | Ga0501321_029872 | 3300049537 | Bacteria | 723 |
| 1083 | Ga0501322_005374 | 3300049538 | Bacteria | 887 |
| 1084 | Ga0501323_069045 | 3300049539 | Bacteria | 563 |
| 1085 | Ga0501324_042584 | 3300049540 | Bacteria | 522 |
| 1086 | Ga0501325_009145 | 3300049541 | Bacteria | 874 |
| 1087 | Ga0501325_028935 | 3300049541 | Bacteria | 625 |
| 1088 | Ga0501335_012565 | 3300049551 | Bacteria | 838 |
| 1089 | Ga0501335_034641 | 3300049551 | Bacteria | 580 |
| 1090 | Ga0501031_0662317 | 3300049568 | Bacteria | 671 |
| 1091 | Ga0501034_1040756 | 3300049571 | Bacteria | 701 |
| 1092 | Ga0501034_1588619 | 3300049571 | Bacteria | 527 |
| 1093 | Ga0501036_0103495 | 3300049572 | Bacteria | 2408 |
| 1094 | Ga0501036_0297146 | 3300049572 | Bacteria | 1351 |
| 1095 | Ga0501038_0398038 | 3300049574 | Bacteria | 1066 |
| 1096 | Ga0501039_0224459 | 3300049575 | Bacteria | 1477 |
| 1097 | Ga0501039_0758499 | 3300049575 | Bacteria | 758 |
| 1098 | Ga0501040_0081187 | 3300049576 | Bacteria | 2247 |
| 1099 | Ga0501040_0453851 | 3300049576 | Bacteria | 923 |
| 1100 | Ga0501040_0887974 | 3300049576 | Bacteria | 646 |
| 1101 | Ga0501041_0208506 | 3300049577 | Bacteria | 1226 |
| 1102 | Ga0501041_0240171 | 3300049577 | Bacteria | 1138 |
| 1103 | Ga0501042_0139913 | 3300049578 | Bacteria | 1745 |
| 1104 | Ga0501043_0031566 | 3300049579 | Bacteria | 4164 |
| 1105 | Ga0501046_0259051 | 3300049580 | Bacteria | 1278 |
| 1106 | Ga0501046_0787017 | 3300049580 | Bacteria | 667 |
| 1107 | Ga0501047_0003524 | 3300049581 | Bacteria | 14774 |
| 1108 | Ga0501047_1428378 | 3300049581 | Bacteria | 507 |
| 1109 | Ga0501048_1075243 | 3300049582 | Bacteria | 579 |
| 1110 | Ga0501048_1142579 | 3300049582 | Bacteria | 560 |
| 1111 | Ga0501068_0527564 | 3300049584 | Bacteria | 767 |
| 1112 | Ga0501070_1405341 | 3300049586 | Bacteria | 530 |
| 1113 | Ga0501071_0616366 | 3300049587 | Bacteria | 834 |
| 1114 | Ga0501071_0669833 | 3300049587 | Bacteria | 799 |
| 1115 | Ga0501072_0304092 | 3300049588 | Bacteria | 1268 |
| 1116 | Ga0501072_0462932 | 3300049588 | Bacteria | 1004 |
| 1117 | Ga0501072_1347058 | 3300049588 | Bacteria | 553 |
| 1118 | Ga0501073_0614491 | 3300049589 | Bacteria | 750 |
| 1119 | Ga0501075_0201896 | 3300049591 | Bacteria | 1516 |
| 1120 | Ga0501076_0430969 | 3300049592 | Bacteria | 1085 |
| 1121 | Ga0501076_0579764 | 3300049592 | Bacteria | 925 |
| 1122 | Ga0501077_0672342 | 3300049593 | Bacteria | 665 |
| 1123 | Ga0501233_127262 | 3300049668 | Bacteria | 693 |
| 1124 | Ga0501242_037278 | 3300049674 | Bacteria | 677 |
| 1125 | Ga0501243_103110 | 3300049675 | Bacteria | 578 |
| 1126 | Ga0501250_072046 | 3300049680 | Bacteria | 573 |
| 1127 | Ga0501245_099636 | 3300049708 | Bacteria | 587 |
| 1128 | Ga0501079_0173420 | 3300049741 | Bacteria | 1682 |
| 1129 | Ga0501081_1121903 | 3300049743 | Bacteria | 595 |
| 1130 | Ga0501083_0559352 | 3300049744 | Bacteria | 744 |
| 1131 | Ga0501241_082930 | 3300049758 | Bacteria | 669 |
| 1132 | Ga0501268_046505 | 3300049765 | Bacteria | 830 |
| 1133 | Ga0501273_051053 | 3300049770 | Bacteria | 633 |
| 1134 | Ga0501035_1467660 | 3300049822 | Bacteria | 521 |
| 1135 | Ga0501045_0045082 | 3300049824 | Bacteria | 3211 |
| 1136 | nmdc:mga03683_284554_c1 | 3300050489 | Bacteria | 773 |
| 1137 | nmdc:mga03683_9705_c1 | 3300050489 | Bacteria | 3433 |
| 1138 | nmdc:mga03n38_272530_c1 | 3300050490 | Bacteria | 901 |
| 1139 | nmdc:mga03n38_401807_c1 | 3300050490 | Bacteria | 754 |
| 1140 | nmdc:mga03n38_52666_c1 | 3300050490 | Bacteria | 1823 |
| 1141 | nmdc:mga03n38_766621_c1 | 3300050490 | Bacteria | 560 |
| 1142 | nmdc:mga00v17_1556_c1 | 3300050491 | Bacteria | 11982 |
| 1143 | nmdc:mga00v17_231124_c1 | 3300050491 | Bacteria | 1198 |
| 1144 | nmdc:mga00v17_240296_c1 | 3300050491 | Bacteria | 1174 |
| 1145 | nmdc:mga0yw44_704623_c1 | 3300050492 | Bacteria | 686 |
| 1146 | nmdc:mga0yw44_95654_c1 | 3300050492 | Bacteria | 1885 |
| 1147 | nmdc:mga0k408_17456_c1 | 3300050493 | Bacteria | 3999 |
| 1148 | nmdc:mga0k408_484044_c1 | 3300050493 | Bacteria | 734 |
| 1149 | nmdc:mga06z11_893064_c1 | 3300050494 | Bacteria | 541 |
| 1150 | nmdc:mga06z11_904_c1 | 3300050494 | Bacteria | 10791 |
| 1151 | nmdc:mga04h51_172_c1 | 3300050495 | Bacteria | 18653 |
| 1152 | nmdc:mga07m45_15_c1 | 3300050496 | Bacteria | 152740 |
| 1153 | nmdc:mga07m45_186261_c1 | 3300050496 | Bacteria | 1207 |
| 1154 | nmdc:mga07m45_721857_c1 | 3300050496 | Bacteria | 573 |
| 1155 | nmdc:mga05p37_344142_c1 | 3300050507 | Bacteria | 1757 |
| 1156 | nmdc:mga05p37_466232_c1 | 3300050507 | Bacteria | 1458 |
| 1157 | nmdc:mga05p37_538169_c1 | 3300050507 | Bacteria | 1332 |
| 1158 | nmdc:mga09592_1047268_c1 | 3300050508 | Bacteria | 680 |
| 1159 | nmdc:mga09592_816473_c1 | 3300050508 | Unclassified | 788 |
| 1160 | nmdc:mga0qj67_541144_c1 | 3300050509 | Bacteria | 934 |
| 1161 | nmdc:mga06r32_415204_c1 | 3300050510 | Bacteria | 1327 |
| 1162 | nmdc:mga08y16_1119983_c1 | 3300050511 | Bacteria | 761 |
| 1163 | nmdc:mga08y16_209471_c1 | 3300050511 | Unclassified | 2019 |
| 1164 | nmdc:mga08y16_238311_c1 | 3300050511 | Bacteria | 1881 |
| 1165 | nmdc:mga08y16_640169_c1 | 3300050511 | Bacteria | 1068 |
| 1166 | nmdc:mga0n895_666212_c1 | 3300050512 | Unclassified | 1038 |
| 1167 | nmdc:mga0sz30_13412_c1 | 3300050516 | Bacteria | 3209 |
| 1168 | nmdc:mga0sz30_263955_c1 | 3300050516 | Bacteria | 767 |
| 1169 | nmdc:mga0sz30_32949_c1 | 3300050516 | Bacteria | 2151 |
| 1170 | nmdc:mga0sz30_36777_c1 | 3300050516 | Bacteria | 1111 |
| 1171 | nmdc:mga0sz30_62919_c1 | 3300050516 | Bacteria | 1588 |
| 1172 | nmdc:mga0sz30_90873_c2 | 3300050516 | Bacteria | 505 |
| 1173 | Ga0500610_0003391 | 3300053079 | Bacteria | 6102 |
| 1174 | Ga0500643_047079 | 3300053087 | Bacteria | 1244 |
| 1175 | Ga0500643_126527 | 3300053087 | Bacteria | 688 |
| 1176 | Ga0500647_0118147 | 3300053091 | Bacteria | 1256 |
| 1177 | Ga0500566_0001151 | 3300053094 | Bacteria | 15363 |
| 1178 | Ga0500641_0002644 | 3300053096 | Bacteria | 6325 |
| 1179 | Ga0500648_219243 | 3300053097 | Bacteria | 934 |
| 1180 | Ga0500650_0260426 | 3300053098 | Bacteria | 776 |
| 1181 | Ga0500650_0263044 | 3300053098 | Bacteria | 771 |
| 1182 | Ga0500555_000016 | 3300053103 | Bacteria | 203144 |
| 1183 | Ga0500555_018781 | 3300053103 | Bacteria | 1992 |
| 1184 | Ga0500555_087752 | 3300053103 | Bacteria | 802 |
| 1185 | Ga0500562_098244 | 3300053108 | Bacteria | 797 |
| 1186 | Ga0500595_001620 | 3300053119 | Bacteria | 11857 |
| 1187 | Ga0500595_012595 | 3300053119 | Bacteria | 3265 |
| 1188 | Ga0500607_001731 | 3300053121 | Bacteria | 18963 |
| 1189 | Ga0500607_211989 | 3300053121 | Bacteria | 818 |
| 1190 | Ga0500642_0000580 | 3300053130 | Bacteria | 11005 |
| 1191 | Ga0500658_0000538 | 3300053134 | Bacteria | 15973 |
| 1192 | Ga0500559_0284725 | 3300053136 | Bacteria | 777 |
| 1193 | Ga0500568_0133288 | 3300053139 | Bacteria | 923 |
| 1194 | Ga0500588_0135525 | 3300053146 | Bacteria | 880 |
| 1195 | Ga0500588_0180947 | 3300053146 | Bacteria | 775 |
| 1196 | Ga0500600_0428177 | 3300053149 | Bacteria | 515 |
| 1197 | Ga0500604_0075893 | 3300053151 | Bacteria | 1079 |
| 1198 | Ga0500624_012592 | 3300053157 | Bacteria | 1253 |
| 1199 | Ga0500627_0487192 | 3300053158 | Bacteria | 515 |
| 1200 | Ga0500636_0004289 | 3300053177 | Bacteria | 8076 |
| 1201 | Ga0500611_106687 | 3300053727 | Bacteria | 732 |
| 1202 | Ga0500611_199905 | 3300053727 | Bacteria | 566 |
| 1203 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 1204 | Ga0500645_081482 | 3300053730 | Bacteria | 923 |
| 1205 | Ga0500645_223737 | 3300053730 | Bacteria | 503 |
| 1206 | Ga0500596_015335 | 3300053735 | Bacteria | 1151 |
| 1207 | Ga0501084_0351017 | 3300054114 | Bacteria | 1246 |
| 1208 | Ga0501084_0478375 | 3300054114 | Bacteria | 1053 |
| 1209 | Ga0501084_1378503 | 3300054114 | Bacteria | 591 |
| 1210 | Ga0500661_096813 | 3300055283 | Bacteria | 557 |
| 1211 | Ga0590077_114602 | 3300059426 | Bacteria | 635 |
| 1212 | Ga0587077_236397 | 3300059493 | Bacteria | 522 |
| 1213 | Ga0587094_076285 | 3300059513 | Bacteria | 613 |
| 1214 | Ga0587106_111050 | 3300059605 | Bacteria | 571 |
| 1215 | Ga0587072_113682 | 3300059643 | Bacteria | 620 |
| 1216 | Ga0587078_050361 | 3300059646 | Bacteria | 609 |
| 1217 | Ga0587102_032719 | 3300059649 | Bacteria | 642 |
| 1218 | Ga0587110_059526 | 3300059654 | Bacteria | 526 |
| 1219 | Ga0587111_0106248 | 3300060346 | Bacteria | 706 |
| 1220 | Ga0466962_0013182 | 3300061719 | Bacteria | 3976 |
| 1221 | Ga0530510_1083781 | 3300061734 | Bacteria | 614 |
| 1222 | 2545672525 | 2545555834 | Bacteria | 8130841 |
| 1223 | 2566037845 | 2565956521 | Bacteria | 4468993 |
| 1224 | 2585261873 | 2582581305 | Bacteria | 4895574 |
| 1225 | 2643948666 | 2643221588 | Bacteria | 3692460 |
| 1226 | 2644127187 | 2643221622 | Bacteria | 4212502 |
| 1227 | 2644746027 | 2643221736 | Bacteria | 6608466 |
| 1228 | 2738711253 | 2738541275 | Bacteria | 4830863 |
| 1229 | 2738849678 | 2738541301 | Bacteria | 4834102 |
| 1230 | 2738865407 | 2738541304 | Bacteria | 4833665 |
| 1231 | 2739297925 | 2738543022 | Bacteria | 4835059 |
| 1232 | 2739359603 | 2738543033 | Bacteria | 4833336 |
| 1233 | 2739649214 | 2739367664 | Bacteria | 4114334 |
| 1234 | 2740027687 | 2739367865 | Bacteria | 4114482 |
| 1235 | 2753767322 | 2751185897 | Bacteria | 5322941 |
| 1236 | 2819551367 | 2818991438 | Bacteria | 5793701 |
| 1237 | 2842699849 | 2842698319 | Bacteria | 5190321 |
| 1238 | 2879166515 | 2879163058 | Bacteria | 4223965 |
| 1239 | 2884298765 | 2884298095 | Bacteria | 3823049 |
| 1240 | 2885430174 | 2885429604 | Bacteria | 3642894 |
| 1241 | 2896429422 | 2896429255 | Bacteria | 2557483 |
| 1242 | 2909044485 | 2909042592 | Bacteria | 6499737 |
| 1243 | 2919452573 | 2919450847 | Bacteria | 5631160 |
| 1244 | 2919499272 | 2919497567 | Bacteria | 4408621 |
| 1245 | 2919689417 | 2919688452 | Bacteria | 4595932 |
| 1246 | 2928961459 | 2928959182 | Bacteria | 4725774 |
| 1247 | 3003672560 | 3003665799 | Bacteria | 7279786 |
| 1248 | 641644355 | 641522639 | Bacteria | 7737025 |
| 1249 | 8054305365 | 8054302542 | Bacteria | 5698134 |
| 1250 | Ga0058861_12019322 | |||
| 1251 | SwRhRL2b_contig_3919511 | |||
| 1252 | SwRhRL2b_contig_520222 | |||
| 1253 | ARcpr5yngRDRAFT_c002624 | |||
| 1254 | ARCol0yngRDRAFT_1001217 | |||
| 1255 | ARCol0yngRDRAFT_1017172 | |||
| 1256 | JGI24746J21847_1001905 | |||
| 1257 | JGI24740J21852_10025198 | |||
| 1258 | JGI24740J21852_10042732 | |||
| 1259 | JGI24739J22299_10006425 | |||
| 1260 | JGI24739J22299_10200045 | |||
| 1261 | JGI24737J22298_10026070 | |||
| 1262 | JGI24735J21928_10042720 | |||
| 1263 | JGI24735J21928_10133842 | |||
| 1264 | JGI24748J21848_1008124 | |||
| 1265 | JGI24749J21850_1001036 | |||
| 1266 | JGI24744J21845_10012571 | |||
| 1267 | JGI24744J21845_10021627 | |||
| 1268 | JGI24033J26618_1017319 | |||
| 1269 | JGI24034J26672_10013892 | |||
| 1270 | JGI24034J26672_10027937 | |||
| 1271 | JGI24034J26672_10092567 | |||
| 1272 | JGI24742J22300_10013146 | |||
| 1273 | JGI24742J22300_10071167 | |||
| 1274 | JGI24751J29686_10038094 | |||
| 1275 | JGI25150J39212_1000233 | |||
| 1276 | JGI25150J39212_1025895 | |||
| 1277 | JGI25151J46595_10016142 | |||
| 1278 | JGI25165J46597_1000100 | |||
| 1279 | JGI25153J46596_10000005 | |||
| 1280 | JGI25153J46596_10000460 | |||
| 1281 | JGI25153J46596_10003205 | |||
| 1282 | Ga0006777J48905_1037455 | |||
| 1283 | Ga0007417J51691_1030187 | |||
| 1284 | Ga0007410J51695_1032737 | |||
| 1285 | Ga0007409J51694_1068937 | |||
| 1286 | Ga0007429J51699_1023319 | |||
| 1287 | Ga0007429J51699_1031546 | |||
| 1288 | Ga0006780_1025085 | |||
| 1289 | Ga0055525_1000012 | |||
| 1290 | Ga0055542_1000355 | |||
| 1291 | Ga0055542_1028374 | |||
| 1292 | Ga0055529_1000045 | |||
| 1293 | Ga0055529_1001200 | |||
| 1294 | Ga0055526_1051195 | |||
| 1295 | Ga0055537_1003015 | |||
| 1296 | Ga0055537_1003625 | |||
| 1297 | Ga0055524_1000030 | |||
| 1298 | Ga0055528_1027333 | |||
| 1299 | Ga0055530_10000554 | |||
| 1300 | Ga0055530_10022028 | |||
| 1301 | Ga0055540_1001254 | |||
| 1302 | Ga0055531_10000019 | |||
| 1303 | Ga0055531_10006010 | |||
| 1304 | Ga0055531_10071482 | |||
| 1305 | Ga0055543_1014987 | |||
| 1306 | Ga0065165_1019566 | |||
| 1307 | Ga0065165_1032206 | |||
| 1308 | Ga0065165_1090877 | |||
| 1309 | Ga0065714_10346504 | |||
| 1310 | Ga0065704_10070490 | |||
| 1311 | Ga0065704_10074996 | |||
| 1312 | Ga0065712_10319854 | |||
| 1313 | Ga0065715_10038607 | |||
| 1314 | Ga0065715_10091935 | |||
| 1315 | Ga0065715_10970762 | |||
| 1316 | Ga0065715_11099189 | |||
| 1317 | Ga0065707_10584051 | |||
| 1318 | Ga0070658_10000808 | |||
| 1319 | Ga0070658_10000957 | |||
| 1320 | Ga0070658_10011514 | |||
| 1321 | Ga0070658_10103001 | |||
| 1322 | Ga0070676_10016131 | |||
| 1323 | Ga0070676_10227190 | |||
| 1324 | Ga0070676_10806097 | |||
| 1325 | Ga0070676_11261761 | |||
| 1326 | Ga0070683_100336697 | |||
| 1327 | Ga0070690_100124496 | |||
| 1328 | Ga0070690_100910205 | |||
| 1329 | Ga0070670_100001686 | |||
| 1330 | Ga0070670_100003085 | |||
| 1331 | Ga0070670_100100851 | |||
| 1332 | Ga0070670_100165798 | |||
| 1333 | Ga0070670_100526485 | |||
| 1334 | Ga0070670_100555347 | |||
| 1335 | Ga0070670_100878350 | |||
| 1336 | Ga0068869_100340064 | |||
| 1337 | Ga0068869_100695339 | |||
| 1338 | Ga0068869_101881082 | |||
| 1339 | Ga0070666_10016672 | |||
| 1340 | Ga0070666_10240971 | |||
| 1341 | Ga0070666_10424016 | |||
| 1342 | Ga0070682_101700513 | |||
| 1343 | Ga0068868_100214997 | |||
| 1344 | Ga0068868_100872315 | |||
| 1345 | Ga0070660_100078152 | |||
| 1346 | Ga0070660_100913350 | |||
| 1347 | Ga0070661_100000776 | |||
| 1348 | Ga0070668_100001172 | |||
| 1349 | Ga0070668_100002440 | |||
| 1350 | Ga0070668_100035024 | |||
| 1351 | Ga0070668_100109981 | |||
| 1352 | Ga0070668_100306206 | |||
| 1353 | Ga0070668_100555723 | |||
| 1354 | Ga0070668_100811840 | |||
| 1355 | Ga0070669_100000408 | |||
| 1356 | Ga0070669_100001266 | |||
| 1357 | Ga0070669_100001698 | |||
| 1358 | Ga0070669_100002206 | |||
| 1359 | Ga0070669_100434755 | |||
| 1360 | Ga0070675_100022565 | |||
| 1361 | Ga0070675_100062900 | |||
| 1362 | Ga0070675_100076947 | |||
| 1363 | Ga0070671_100000122 | |||
| 1364 | Ga0070671_100008715 | |||
| 1365 | Ga0070671_100014083 | |||
| 1366 | Ga0070671_100028597 | |||
| 1367 | Ga0070671_100077907 | |||
| 1368 | Ga0070671_100125573 | |||
| 1369 | Ga0070671_100375733 | |||
| 1370 | Ga0070671_101096901 | |||
| 1371 | Ga0070671_101315543 | |||
| 1372 | Ga0070671_101842966 | |||
| 1373 | Ga0070674_100011530 | |||
| 1374 | Ga0070674_100012103 | |||
| 1375 | Ga0070674_100013334 | |||
| 1376 | Ga0070674_101181868 | |||
| 1377 | Ga0070674_102101092 | |||
| 1378 | Ga0070673_100020913 | |||
| 1379 | Ga0070673_100036022 | |||
| 1380 | Ga0070673_100436502 | |||
| 1381 | Ga0070673_101548119 | |||
| 1382 | Ga0070659_100163395 | |||
| 1383 | Ga0070659_100590275 | |||
| 1384 | Ga0070659_101338306 | |||
| 1385 | Ga0070659_101617757 | |||
| 1386 | Ga0070667_100000596 | |||
| 1387 | Ga0070667_100022920 | |||
| 1388 | Ga0070667_100026836 | |||
| 1389 | Ga0070667_100137491 | |||
| 1390 | Ga0070667_100284970 | |||
| 1391 | Ga0070667_101051623 | |||
| 1392 | Ga0070667_101698346 | |||
| 1393 | Ga0070667_101924869 | |||
| 1394 | Ga0070713_101092702 | |||
| 1395 | Ga0070701_10424070 | |||
| 1396 | Ga0070711_101266781 | |||
| 1397 | Ga0070705_100322643 | |||
| 1398 | Ga0070700_100269421 | |||
| 1399 | Ga0070694_100267543 | |||
| 1400 | Ga0070663_100009319 | |||
| 1401 | Ga0070678_100148533 | |||
| 1402 | Ga0070678_100203100 | |||
| 1403 | Ga0070678_100271202 | |||
| 1404 | Ga0070678_100328378 | |||
| 1405 | Ga0070678_100626345 | |||
| 1406 | Ga0070678_102051506 | |||
| 1407 | Ga0070662_100000872 | |||
| 1408 | Ga0070662_100064759 | |||
| 1409 | Ga0070662_101122802 | |||
| 1410 | Ga0070681_11787276 | |||
| 1411 | Ga0068867_100007513 | |||
| 1412 | Ga0068867_100049553 | |||
| 1413 | Ga0068867_100691070 | |||
| 1414 | Ga0068867_101006825 | |||
| 1415 | Ga0070685_10689205 | |||
| 1416 | Ga0070706_100545880 | |||
| 1417 | Ga0070698_100365019 | |||
| 1418 | Ga0070699_101144278 | |||
| 1419 | Ga0070679_101922014 | |||
| 1420 | Ga0070684_100387437 | |||
| 1421 | Ga0068853_100358710 | |||
| 1422 | Ga0068853_100637653 | |||
| 1423 | Ga0068853_101245312 | |||
| 1424 | Ga0068853_101363779 | |||
| 1425 | Ga0068853_101914658 | |||
| 1426 | Ga0070672_100103722 | |||
| 1427 | Ga0070672_100528844 | |||
| 1428 | Ga0070686_100155091 | |||
| 1429 | Ga0070686_100783497 | |||
| 1430 | Ga0070695_100099178 | |||
| 1431 | Ga0070696_100641985 | |||
| 1432 | Ga0070693_100892271 | |||
| 1433 | Ga0070665_100001012 | |||
| 1434 | Ga0070665_100004063 | |||
| 1435 | Ga0070665_100211836 | |||
| 1436 | Ga0070665_100253198 | |||
| 1437 | Ga0070665_100805224 | |||
| 1438 | Ga0070704_102225398 | |||
| 1439 | Ga0068855_100003997 | |||
| 1440 | Ga0068855_100092560 | |||
| 1441 | Ga0068855_101217122 | |||
| 1442 | Ga0070664_100027918 | |||
| 1443 | Ga0070664_100074095 | |||
| 1444 | Ga0070664_100615275 | |||
| 1445 | Ga0070664_101368539 | |||
| 1446 | Ga0068857_100183846 | |||
| 1447 | Ga0068857_100799312 | |||
| 1448 | Ga0068857_101180691 | |||
| 1449 | Ga0068857_101216258 | |||
| 1450 | Ga0068857_101664418 | |||
| 1451 | Ga0068857_101868326 | |||
| 1452 | Ga0068854_100005493 | |||
| 1453 | Ga0068854_100015015 | |||
| 1454 | Ga0068856_100008316 | |||
| 1455 | Ga0068856_100030211 | |||
| 1456 | Ga0068856_100038838 | |||
| 1457 | Ga0068856_100066194 | |||
| 1458 | Ga0068856_101158058 | |||
| 1459 | Ga0070702_100056481 | |||
| 1460 | Ga0070702_100630366 | |||
| 1461 | Ga0068852_100021267 | |||
| 1462 | Ga0068852_100309918 | |||
| 1463 | Ga0068852_101180069 | |||
| 1464 | Ga0068859_100001413 | |||
| 1465 | Ga0068859_100026464 | |||
| 1466 | Ga0068859_101474601 | |||
| 1467 | Ga0068859_102137103 | |||
| 1468 | Ga0068864_100034325 | |||
| 1469 | Ga0068864_100058936 | |||
| 1470 | Ga0068864_101385121 | |||
| 1471 | Ga0068864_101543468 | |||
| 1472 | Ga0068864_102110461 | |||
| 1473 | Ga0068866_10508127 | |||
| 1474 | Ga0068861_100033598 | |||
| 1475 | Ga0068861_101384248 | |||
| 1476 | Ga0068861_101579578 | |||
| 1477 | Ga0068851_10003977 | |||
| 1478 | Ga0068851_10269454 | |||
| 1479 | Ga0068870_10051536 | |||
| 1480 | Ga0068870_10265617 | |||
| 1481 | Ga0068870_10433095 | |||
| 1482 | Ga0068863_100018487 | |||
| 1483 | Ga0068863_100041528 | |||
| 1484 | Ga0068863_100217996 | |||
| 1485 | Ga0068863_100318872 | |||
| 1486 | Ga0068863_100446522 | |||
| 1487 | Ga0068858_100071679 | |||
| 1488 | Ga0068858_100492618 | |||
| 1489 | Ga0068860_100018416 | |||
| 1490 | Ga0068860_100029808 | |||
| 1491 | Ga0068860_100030603 | |||
| 1492 | Ga0068860_101158176 | |||
| 1493 | Ga0068862_100003883 | |||
| 1494 | Ga0068862_100022859 | |||
| 1495 | Ga0068862_100030220 | |||
| 1496 | Ga0068862_100107007 | |||
| 1497 | Ga0068862_100900706 | |||
| 1498 | Ga0081538_10002854 | |||
| 1499 | Ga0081538_10170439 | |||
| 1500 | Ga0075365_10072164 | |||
| 1501 | Ga0075365_10109948 | |||
| 1502 | Ga0075365_10477367 | |||
| 1503 | Ga0075365_10583278 | |||
| 1504 | Ga0075365_10729918 | |||
| 1505 | Ga0075368_10036569 | |||
| 1506 | Ga0075368_10299808 | |||
| 1507 | Ga0075363_100025154 | |||
| 1508 | Ga0075363_100299638 | |||
| 1509 | Ga0075364_10118963 | |||
| 1510 | Ga0075364_10273535 | |||
| 1511 | Ga0075364_10373624 | |||
| 1512 | Ga0075364_10377646 | |||
| 1513 | Ga0075364_10387144 | |||
| 1514 | Ga0070712_100146886 | |||
| 1515 | Ga0075362_10001290 | |||
| 1516 | Ga0075362_10216974 | |||
| 1517 | Ga0075367_10032202 | |||
| 1518 | Ga0075369_10009867 | |||
| 1519 | Ga0075369_10016088 | |||
| 1520 | Ga0075369_10026637 | |||
| 1521 | Ga0075369_10494592 | |||
| 1522 | Ga0075366_10051050 | |||
| 1523 | Ga0075366_10063141 | |||
| 1524 | Ga0075366_10115554 | |||
| 1525 | Ga0075366_10176550 | |||
| 1526 | Ga0075366_10581919 | |||
| 1527 | Ga0075366_10686094 | |||
| 1528 | Ga0097621_100274921 | |||
| 1529 | Ga0075370_10149342 | |||
| 1530 | Ga0075370_10565927 | |||
| 1531 | Ga0068871_100104146 | |||
| 1532 | Ga0068871_100880614 | |||
| 1533 | Ga0068871_101237325 | |||
| 1534 | Ga0075428_100142813 | |||
| 1535 | Ga0075428_100152242 | |||
| 1536 | Ga0075428_100632564 | |||
| 1537 | Ga0075428_101913738 | |||
| 1538 | Ga0075430_100390506 | |||
| 1539 | Ga0075430_100542113 | |||
| 1540 | Ga0075430_100717988 | |||
| 1541 | Ga0075431_100189366 | |||
| 1542 | Ga0075431_100620632 | |||
| 1543 | Ga0075433_11192357 | |||
| 1544 | Ga0068865_100594066 | |||
| 1545 | Ga0097620_100001413 | |||
| 1546 | Ga0097620_100026465 | |||
| 1547 | Ga0097620_101474443 | |||
| 1548 | Ga0097620_102137818 | |||
| 1549 | Ga0105251_10005302 | |||
| 1550 | Ga0105251_10042882 | |||
| 1551 | Ga0105251_10141671 | |||
| 1552 | Ga0105250_10008207 | |||
| 1553 | Ga0105250_10243315 | |||
| 1554 | Ga0105240_10046210 | |||
| 1555 | Ga0105240_10150959 | |||
| 1556 | Ga0105240_10425723 | |||
| 1557 | Ga0105240_11580611 | |||
| 1558 | Ga0105240_11744685 | |||
| 1559 | Ga0111539_10013275 | |||
| 1560 | Ga0111539_10269322 | |||
| 1561 | Ga0111539_10730597 | |||
| 1562 | Ga0105245_10209462 | |||
| 1563 | Ga0105245_10547932 | |||
| 1564 | Ga0105247_10024046 | |||
| 1565 | Ga0105247_10225356 | |||
| 1566 | Ga0114129_10427831 | |||
| 1567 | Ga0114129_10502771 | |||
| 1568 | Ga0114129_10533868 | |||
| 1569 | Ga0114129_11514071 | |||
| 1570 | Ga0105243_10000423 | |||
| 1571 | Ga0105243_10555936 | |||
| 1572 | Ga0105243_12010938 | |||
| 1573 | Ga0105241_10009278 | |||
| 1574 | Ga0105241_10423776 | |||
| 1575 | Ga0105242_10297423 | |||
| 1576 | Ga0105248_10026827 | |||
| 1577 | Ga0105248_10060330 | |||
| 1578 | Ga0105248_10080865 | |||
| 1579 | Ga0105248_10409273 | |||
| 1580 | Ga0105248_11008578 | |||
| 1581 | Ga0105248_11039322 | |||
| 1582 | Ga0105237_10210213 | |||
| 1583 | Ga0105237_10294972 | |||
| 1584 | Ga0105237_10709252 | |||
| 1585 | Ga0105237_11595555 | |||
| 1586 | Ga0105237_12388585 | |||
| 1587 | Ga0105238_10059481 | |||
| 1588 | Ga0105238_10127097 | |||
| 1589 | Ga0105238_10179574 | |||
| 1590 | Ga0105238_12679203 | |||
| 1591 | Ga0105249_10009816 | |||
| 1592 | Ga0105249_10204570 | |||
| 1593 | Ga0105249_11013216 | |||
| 1594 | Ga0105148_104016 | |||
| 1595 | Ga0105239_10473760 | |||
| 1596 | Ga0105239_10475938 | |||
| 1597 | Ga0105239_10988601 | |||
| 1598 | Ga0105239_11028442 | |||
| 1599 | Ga0105239_11227514 | |||
| 1600 | Ga0105239_11475217 | |||
| 1601 | Ga0105246_10034849 | |||
| 1602 | Ga0157317_1006346 | |||
| 1603 | Ga0157322_1027459 | |||
| 1604 | Ga0157315_1014526 | |||
| 1605 | Ga0157315_1063024 | |||
| 1606 | Ga0157316_1023420 | |||
| 1607 | Ga0157316_1058686 | |||
| 1608 | Ga0157327_1002804 | |||
| 1609 | Ga0157327_1015497 | |||
| 1610 | Ga0157326_1036161 | |||
| 1611 | Ga0157373_10180139 | |||
| 1612 | Ga0157373_10592669 | |||
| 1613 | Ga0157373_10887051 | |||
| 1614 | Ga0157371_10000032 | |||
| 1615 | Ga0157371_10004757 | |||
| 1616 | Ga0157371_10434302 | |||
| 1617 | Ga0157370_10000152 | |||
| 1618 | Ga0157370_10406630 | |||
| 1619 | Ga0157369_10046420 | |||
| 1620 | Ga0157369_10369745 | |||
| 1621 | Ga0157369_11159648 | |||
| 1622 | Ga0157374_10035173 | |||
| 1623 | Ga0157374_10117361 | |||
| 1624 | Ga0157378_10509205 | |||
| 1625 | Ga0157378_11417713 | |||
| 1626 | Ga0157378_11446489 | |||
| 1627 | Ga0157378_11635651 | |||
| 1628 | Ga0163162_10047653 | |||
| 1629 | Ga0163162_10075148 | |||
| 1630 | Ga0163162_10766795 | |||
| 1631 | Ga0163162_11063306 | |||
| 1632 | Ga0163162_11154471 | |||
| 1633 | Ga0163162_11254396 | |||
| 1634 | Ga0163162_11755874 | |||
| 1635 | Ga0157372_11467339 | |||
| 1636 | Ga0157375_10287973 | |||
| 1637 | Ga0157375_10389465 | |||
| 1638 | Ga0157375_10413178 | |||
| 1639 | Ga0157375_13680076 | |||
| 1640 | Ga0163163_10028972 | |||
| 1641 | Ga0163163_11361346 | |||
| 1642 | Ga0157380_10001109 | |||
| 1643 | Ga0157380_10018421 | |||
| 1644 | Ga0157380_10078258 | |||
| 1645 | Ga0157380_11204077 | |||
| 1646 | Ga0182008_10238008 | |||
| 1647 | Ga0182008_10330442 | |||
| 1648 | Ga0157377_10519930 | |||
| 1649 | Ga0157379_10237668 | |||
| 1650 | Ga0157376_10240807 | |||
| 1651 | Ga0157376_10355567 | |||
| 1652 | Ga0157376_10536248 | |||
| 1653 | Ga0163161_10001748 | |||
| 1654 | Ga0163161_10042717 | |||
| 1655 | Ga0163161_10143980 | |||
| 1656 | Ga0163161_10638310 | |||
| 1657 | Ga0163161_11362757 | |||
| 1658 | Ga0197907_10342361 | |||
| 1659 | Ga0197907_10443662 | |||
| 1660 | Ga0206356_11436017 | |||
| 1661 | Ga0206356_11439898 | |||
| 1662 | Ga0206349_1394373 | |||
| 1663 | Ga0206355_1251537 | |||
| 1664 | Ga0206355_1354397 | |||
| 1665 | Ga0206355_1436319 | |||
| 1666 | Ga0206351_10725755 | |||
| 1667 | Ga0206352_10349969 | |||
| 1668 | Ga0206350_10307900 | |||
| 1669 | Ga0206354_11299294 | |||
| 1670 | Ga0206353_11891397 | |||
| 1671 | Ga0224712_10277510 | |||
| 1672 | Ga0224712_10291230 | |||
| 1673 | Ga0224712_10488812 | |||
| 1674 | Ga0209436_109965 | |||
| 1675 | Ga0207672_1003100 | |||
| 1676 | Ga0209672_103601 | |||
| 1677 | Ga0209563_100030 | |||
| 1678 | Ga0207427_101365 | |||
| 1679 | Ga0207425_1000027 | |||
| 1680 | Ga0209646_1015744 | |||
| 1681 | Ga0209026_1001157 | |||
| 1682 | Ga0209148_1000011 | |||
| 1683 | Ga0209148_1004002 | |||
| 1684 | Ga0209759_1025063 | |||
| 1685 | Ga0209129_1000416 | |||
| 1686 | Ga0209233_1000143 | |||
| 1687 | Ga0209233_1092086 | |||
| 1688 | Ga0209565_1000012 | |||
| 1689 | Ga0209565_1000142 | |||
| 1690 | Ga0209455_1000006 | |||
| 1691 | Ga0209455_1000908 | |||
| 1692 | Ga0209455_1002724 | |||
| 1693 | Ga0209673_1002755 | |||
| 1694 | Ga0209675_1012044 | |||
| 1695 | Ga0209675_1014237 | |||
| 1696 | Ga0209675_1092580 | |||
| 1697 | Ga0209676_1022757 | |||
| 1698 | Ga0209025_1000197 | |||
| 1699 | Ga0209564_1002693 | |||
| 1700 | Ga0209564_1080555 | |||
| 1701 | Ga0209758_1000001 | |||
| 1702 | Ga0209758_1000009 | |||
| 1703 | Ga0209758_1002365 | |||
| 1704 | Ga0209050_1000005 | |||
| 1705 | Ga0209050_1000010 | |||
| 1706 | Ga0209050_1000254 | |||
| 1707 | Ga0209050_1005181 | |||
| 1708 | Ga0209256_1000012 | |||
| 1709 | Ga0207426_1007652 | |||
| 1710 | Ga0207426_1113075 | |||
| 1711 | Ga0209051_1000152 | |||
| 1712 | Ga0209051_1146724 | |||
| 1713 | Ga0209257_1000009 | |||
| 1714 | Ga0209257_1002315 | |||
| 1715 | Ga0209257_1013636 | |||
| 1716 | Ga0207697_10000595 | |||
| 1717 | Ga0207697_10073672 | |||
| 1718 | Ga0207697_10109135 | |||
| 1719 | Ga0207697_10182914 | |||
| 1720 | Ga0207656_10002662 | |||
| 1721 | Ga0207696_1005004 | |||
| 1722 | Ga0207713_1012386 | |||
| 1723 | Ga0207682_10003889 | |||
| 1724 | Ga0207682_10161102 | |||
| 1725 | Ga0207642_10443574 | |||
| 1726 | Ga0207642_10495086 | |||
| 1727 | Ga0207710_10714828 | |||
| 1728 | Ga0207688_10063112 | |||
| 1729 | Ga0207688_10135214 | |||
| 1730 | Ga0207688_10179146 | |||
| 1731 | Ga0207680_10361310 | |||
| 1732 | Ga0207680_10431350 | |||
| 1733 | Ga0207680_10646300 | |||
| 1734 | Ga0207680_11008421 | |||
| 1735 | Ga0207647_10022843 | |||
| 1736 | Ga0207647_10033402 | |||
| 1737 | Ga0207647_10057828 | |||
| 1738 | Ga0207647_10406208 | |||
| 1739 | Ga0207645_10008043 | |||
| 1740 | Ga0207645_10055530 | |||
| 1741 | Ga0207645_10484273 | |||
| 1742 | Ga0207645_11236134 | |||
| 1743 | Ga0207643_10041321 | |||
| 1744 | Ga0207643_10166029 | |||
| 1745 | Ga0207705_10000009 | |||
| 1746 | Ga0207705_10000122 | |||
| 1747 | Ga0207705_10028066 | |||
| 1748 | Ga0207705_10377512 | |||
| 1749 | Ga0207654_10001772 | |||
| 1750 | Ga0207654_10664454 | |||
| 1751 | Ga0207695_10034521 | |||
| 1752 | Ga0207695_10093798 | |||
| 1753 | Ga0207695_10300486 | |||
| 1754 | Ga0207695_10489051 | |||
| 1755 | Ga0207671_10009515 | |||
| 1756 | Ga0207671_10469294 | |||
| 1757 | Ga0207671_10696985 | |||
| 1758 | Ga0207671_10810682 | |||
| 1759 | Ga0207693_10264377 | |||
| 1760 | Ga0207662_10267515 | |||
| 1761 | Ga0207657_10039979 | |||
| 1762 | Ga0207649_10000482 | |||
| 1763 | Ga0207649_10028573 | |||
| 1764 | Ga0207649_11380204 | |||
| 1765 | Ga0207652_10226194 | |||
| 1766 | Ga0207681_10000387 | |||
| 1767 | Ga0207681_10001010 | |||
| 1768 | Ga0207681_10001632 | |||
| 1769 | Ga0207681_10026231 | |||
| 1770 | Ga0207681_10368141 | |||
| 1771 | Ga0207681_10518112 | |||
| 1772 | Ga0207681_10839171 | |||
| 1773 | Ga0207694_10005283 | |||
| 1774 | Ga0207694_10059351 | |||
| 1775 | Ga0207694_10298255 | |||
| 1776 | Ga0207694_10444900 | |||
| 1777 | Ga0207650_10002289 | |||
| 1778 | Ga0207650_10070938 | |||
| 1779 | Ga0207650_10080672 | |||
| 1780 | Ga0207650_10144869 | |||
| 1781 | Ga0207650_10223930 | |||
| 1782 | Ga0207650_10684350 | |||
| 1783 | Ga0207659_10001032 | |||
| 1784 | Ga0207659_10163319 | |||
| 1785 | Ga0207659_10178036 | |||
| 1786 | Ga0207659_10776419 | |||
| 1787 | Ga0207687_10320987 | |||
| 1788 | Ga0207644_10000048 | |||
| 1789 | Ga0207644_10000293 | |||
| 1790 | Ga0207644_10006574 | |||
| 1791 | Ga0207644_10014696 | |||
| 1792 | Ga0207644_10161897 | |||
| 1793 | Ga0207644_10252123 | |||
| 1794 | Ga0207644_10619547 | |||
| 1795 | Ga0207644_10753935 | |||
| 1796 | Ga0207690_10000052 | |||
| 1797 | Ga0207690_10361496 | |||
| 1798 | Ga0207706_10002470 | |||
| 1799 | Ga0207706_10019428 | |||
| 1800 | Ga0207706_11075288 | |||
| 1801 | Ga0207686_10231924 | |||
| 1802 | Ga0207686_10351866 | |||
| 1803 | Ga0207709_10000574 | |||
| 1804 | Ga0207709_10387182 | |||
| 1805 | Ga0207709_10920234 | |||
| 1806 | Ga0207709_11469804 | |||
| 1807 | Ga0207670_11350781 | |||
| 1808 | Ga0207669_10000044 | |||
| 1809 | Ga0207669_10007750 | |||
| 1810 | Ga0207669_10024307 | |||
| 1811 | Ga0207704_10391686 | |||
| 1812 | Ga0207704_11878280 | |||
| 1813 | Ga0207691_10002177 | |||
| 1814 | Ga0207691_10142133 | |||
| 1815 | Ga0207691_11627805 | |||
| 1816 | Ga0207711_10202869 | |||
| 1817 | Ga0207711_10241428 | |||
| 1818 | Ga0207711_10335169 | |||
| 1819 | Ga0207711_11724276 | |||
| 1820 | Ga0207689_11469562 | |||
| 1821 | Ga0207661_11369783 | |||
| 1822 | Ga0207679_10027267 | |||
| 1823 | Ga0207679_11814755 | |||
| 1824 | Ga0207667_10000002 | |||
| 1825 | Ga0207667_10053707 | |||
| 1826 | Ga0207667_10772239 | |||
| 1827 | Ga0207667_11023535 | |||
| 1828 | Ga0207651_10024451 | |||
| 1829 | Ga0207712_10013270 | |||
| 1830 | Ga0207712_10280829 | |||
| 1831 | Ga0207712_10446143 | |||
| 1832 | Ga0207712_11880967 | |||
| 1833 | Ga0207668_10000720 | |||
| 1834 | Ga0207668_10005075 | |||
| 1835 | Ga0207668_10077705 | |||
| 1836 | Ga0207668_10232671 | |||
| 1837 | Ga0207668_10275915 | |||
| 1838 | Ga0207668_11902423 | |||
| 1839 | Ga0207668_11925484 | |||
| 1840 | Ga0207640_10002340 | |||
| 1841 | Ga0207640_10017460 | |||
| 1842 | Ga0207658_10001159 | |||
| 1843 | Ga0207658_10025817 | |||
| 1844 | Ga0207658_10099468 | |||
| 1845 | Ga0207658_10207340 | |||
| 1846 | Ga0207658_10285591 | |||
| 1847 | Ga0207658_10906088 | |||
| 1848 | Ga0207677_10162266 | |||
| 1849 | Ga0207677_10164483 | |||
| 1850 | Ga0207703_10011232 | |||
| 1851 | Ga0207703_10064656 | |||
| 1852 | Ga0207703_10785799 | |||
| 1853 | Ga0207639_10000777 | |||
| 1854 | Ga0207639_11108890 | |||
| 1855 | Ga0207639_11476767 | |||
| 1856 | Ga0207678_10005545 | |||
| 1857 | Ga0207678_10068106 | |||
| 1858 | Ga0207708_10206377 | |||
| 1859 | Ga0207702_10003669 | |||
| 1860 | Ga0207702_10006661 | |||
| 1861 | Ga0207702_11156063 | |||
| 1862 | Ga0207641_10006329 | |||
| 1863 | Ga0207641_10168806 | |||
| 1864 | Ga0207641_10405047 | |||
| 1865 | Ga0207641_10558432 | |||
| 1866 | Ga0207641_10802312 | |||
| 1867 | Ga0207641_11612360 | |||
| 1868 | Ga0207641_12023876 | |||
| 1869 | Ga0207648_10029482 | |||
| 1870 | Ga0207648_10085699 | |||
| 1871 | Ga0207676_10030447 | |||
| 1872 | Ga0207676_10046151 | |||
| 1873 | Ga0207676_10252703 | |||
| 1874 | Ga0207676_11219950 | |||
| 1875 | Ga0207674_10012390 | |||
| 1876 | Ga0207674_10173026 | |||
| 1877 | Ga0207674_10668720 | |||
| 1878 | Ga0207674_11207251 | |||
| 1879 | Ga0207674_11359009 | |||
| 1880 | Ga0207675_100016300 | |||
| 1881 | Ga0207683_10140414 | |||
| 1882 | Ga0207683_10240991 | |||
| 1883 | Ga0207683_10498239 | |||
| 1884 | Ga0207683_10552332 | |||
| 1885 | Ga0207683_11344496 | |||
| 1886 | Ga0207698_10000537 | |||
| 1887 | Ga0207698_10008071 | |||
| 1888 | Ga0207698_10151214 | |||
| 1889 | Ga0209973_1038452 | |||
| 1890 | Ga0209970_1024934 | |||
| 1891 | Ga0210002_1034486 | |||
| 1892 | Ga0210002_1078664 | |||
| 1893 | Ga0209971_1049962 | |||
| 1894 | Ga0209998_10056268 | |||
| 1895 | Ga0209813_10000081 | |||
| 1896 | Ga0207428_10243522 | |||
| 1897 | Ga0207428_10462692 | |||
| 1898 | Ga0265356_1039492 | |||
| 1899 | Ga0268266_10000471 | |||
| 1900 | Ga0268266_10014912 | |||
| 1901 | Ga0268266_10181481 | |||
| 1902 | Ga0268266_10915904 | |||
| 1903 | Ga0268266_11959938 | |||
| 1904 | Ga0268266_12167543 | |||
| 1905 | Ga0268265_10010196 | |||
| 1906 | Ga0268265_10011459 | |||
| 1907 | Ga0268265_10037933 | |||
| 1908 | Ga0268265_10043598 | |||
| 1909 | Ga0268265_10110885 | |||
| 1910 | Ga0268265_11170391 | |||
| 1911 | Ga0268265_12217624 | |||
| 1912 | Ga0268264_10001249 | |||
| 1913 | Ga0268264_10005153 | |||
| 1914 | Ga0268264_10006783 | |||
| 1915 | Ga0268264_10263600 | |||
| 1916 | Ga0268264_10501721 | |||
| 1917 | Ga0268264_11115163 | |||
| 1918 | Ga0265318_10281431 | |||
| 1919 | Ga0307517_10032795 | |||
| 1920 | Ga0307515_10002885 | |||
| 1921 | Ga0307515_10544729 | |||
| 1922 | Ga0265338_10041348 | |||
| 1923 | Ga0316176_1100255 | |||
| 1924 | Ga0314311_1148511 | |||
| 1925 | Ga0314311_1234607 | |||
| 1926 | Ga0316181_1135234 | |||
| 1927 | Ga0316182_1060881 | |||
| 1928 | Ga0316182_1148393 | |||
| 1929 | Ga0265760_10112912 | |||
| 1930 | Ga0265330_10031999 | |||
| 1931 | Ga0265325_10114964 | |||
| 1932 | Ga0265331_10073322 | |||
| 1933 | Ga0265316_10151330 | |||
| 1934 | Ga0307513_10010088 | |||
| 1935 | Ga0307408_100478820 | |||
| 1936 | Ga0307408_101285422 | |||
| 1937 | Ga0307408_101799182 | |||
| 1938 | Ga0307408_102182809 | |||
| 1939 | Ga0316575_10257840 | |||
| 1940 | Ga0316579_10004122 | |||
| 1941 | Ga0316576_10023190 | |||
| 1942 | Ga0316576_10724450 | |||
| 1943 | Ga0316576_11179694 | |||
| 1944 | Ga0307405_10079995 | |||
| 1945 | Ga0307405_10242229 | |||
| 1946 | Ga0307405_10402989 | |||
| 1947 | Ga0307405_10662999 | |||
| 1948 | Ga0307405_10674720 | |||
| 1949 | Ga0307405_10789461 | |||
| 1950 | Ga0307405_10874348 | |||
| 1951 | Ga0307413_10229429 | |||
| 1952 | Ga0307413_10281774 | |||
| 1953 | Ga0307413_10630335 | |||
| 1954 | Ga0307413_10640145 | |||
| 1955 | Ga0307413_10774038 | |||
| 1956 | Ga0307413_11651359 | |||
| 1957 | Ga0307410_10637498 | |||
| 1958 | Ga0307410_10948085 | |||
| 1959 | Ga0307410_11301693 | |||
| 1960 | Ga0307406_10276975 | |||
| 1961 | Ga0307406_10647690 | |||
| 1962 | Ga0307406_10725491 | |||
| 1963 | Ga0307406_10746523 | |||
| 1964 | Ga0307406_10943146 | |||
| 1965 | Ga0307406_11232056 | |||
| 1966 | Ga0307406_11365044 | |||
| 1967 | Ga0307407_10040629 | |||
| 1968 | Ga0307407_10159039 | |||
| 1969 | Ga0307407_11082644 | |||
| 1970 | Ga0307407_11194044 | |||
| 1971 | Ga0307412_10010127 | |||
| 1972 | Ga0307412_10020188 | |||
| 1973 | Ga0307412_10088761 | |||
| 1974 | Ga0307412_10168075 | |||
| 1975 | Ga0307412_10225103 | |||
| 1976 | Ga0307412_10264932 | |||
| 1977 | Ga0307412_10655875 | |||
| 1978 | Ga0307412_10797808 | |||
| 1979 | Ga0307412_10872636 | |||
| 1980 | Ga0307412_11036908 | |||
| 1981 | Ga0307412_11072137 | |||
| 1982 | Ga0307412_12078026 | |||
| 1983 | Ga0307409_100122294 | |||
| 1984 | Ga0307409_100405053 | |||
| 1985 | Ga0307409_100580029 | |||
| 1986 | Ga0307409_100713214 | |||
| 1987 | Ga0307409_100778273 | |||
| 1988 | Ga0307409_100830586 | |||
| 1989 | Ga0307409_102652186 | |||
| 1990 | Ga0307409_102713475 | |||
| 1991 | Ga0307416_100066176 | |||
| 1992 | Ga0307416_100213452 | |||
| 1993 | Ga0307416_100399071 | |||
| 1994 | Ga0307416_100469867 | |||
| 1995 | Ga0307416_100981045 | |||
| 1996 | Ga0307416_101196369 | |||
| 1997 | Ga0307416_102475077 | |||
| 1998 | Ga0307416_102860286 | |||
| 1999 | Ga0307414_10065371 | |||
| 2000 | Ga0307414_10070136 | |||
| 2001 | Ga0307414_10082088 | |||
| 2002 | Ga0307414_10121242 | |||
| 2003 | Ga0307414_10150384 | |||
| 2004 | Ga0307414_10293449 | |||
| 2005 | Ga0307414_10484627 | |||
| 2006 | Ga0307414_10492531 | |||
| 2007 | Ga0307414_10572278 | |||
| 2008 | Ga0307414_10785350 | |||
| 2009 | Ga0307414_10972663 | |||
| 2010 | Ga0307414_11456459 | |||
| 2011 | Ga0307414_11458569 | |||
| 2012 | Ga0307411_10048142 | |||
| 2013 | Ga0307411_10322920 | |||
| 2014 | Ga0307411_10856289 | |||
| 2015 | Ga0307411_12046010 | |||
| 2016 | Ga0307411_12108890 | |||
| 2017 | Ga0307415_100188175 | |||
| 2018 | Ga0307415_100241924 | |||
| 2019 | Ga0307415_100576145 | |||
| 2020 | Ga0307510_10041740 | |||
| 2021 | Ga0307510_10246300 | |||
| 2022 | Ga0316588_1101767 | |||
| 2023 | Ga0373934_0011200 | |||
| 2024 | Ga0373934_0020309 | |||
| 2025 | Ga0373952_0086873 | |||
| 2026 | Ga0373923_0120678 | |||
| 2027 | Ga0373954_0000013 | |||
| 2028 | Ga0373955_0119305 | |||
| 2029 | Ga0373961_0008207 | |||
| 2030 | Ga0373961_0139179 | |||
| 2031 | Ga0316574_0015732 | |||
| 2032 | Ga0316574_0026931 | |||
| 2033 | Ga0316574_0049538 | |||
| 2034 | Ga0316574_0365320 | |||
| 2035 | Ga0373924_0035457 | |||
| 2036 | Ga0373933_0008247 | |||
| 2037 | Ga0373937_0000568 | |||
| 2038 | Ga0316582_0008050 | |||
| 2039 | Ga0395899_0001486 | |||
| 2040 | Ga0395899_0175118 | |||
| 2041 | Ga0395900_0079824 | |||
| 2042 | Ga0395905_0496689 | |||
| 2043 | Ga0395905_0708103 | |||
| 2044 | Ga0316581_0266312 | |||
| 2045 | Ga0436364_1232957 | |||
| 2046 | Ga0395901_0135462 | |||
| 2047 | Ga0436365_0875957 | |||
| 2048 | Ga0436365_1049735 | |||
| 2049 | Ga0436363_1338713 | |||
| 2050 | Ga0439436_0167408 | |||
| 2051 | Ga0439439_0030580 | |||
| 2052 | Ga0439447_030078 | |||
| 2053 | Ga0439453_0001227 | |||
| 2054 | Ga0439461_0000086 | |||
| 2055 | Ga0439461_0100584 | |||
| 2056 | Ga0439466_0038559 | |||
| 2057 | Ga0439465_0001125 | |||
| 2058 | Ga0439465_0010998 | |||
| 2059 | Ga0451788_13712 | |||
| 2060 | Ga0451791_0887440 | |||
| 2061 | Ga0451793_0892181 | |||
| 2062 | Ga0451797_0437635 | |||
| 2063 | Ga0451801_37066 | |||
| 2064 | Ga0451802_1631382 | |||
| 2065 | Ga0451833_0536339 | |||
| 2066 | Ga0451833_0710986 | |||
| 2067 | Ga0451835_0060857 | |||
| 2068 | Ga0451841_0833099 | |||
| 2069 | Ga0451841_1278623 | |||
| 2070 | Ga0451845_0715186 | |||
| 2071 | Ga0451846_03630 | |||
| 2072 | Ga0451851_0162624 | |||
| 2073 | Ga0451853_2850232 | |||
| 2074 | Ga0439431_0000491 | |||
| 2075 | Ga0439431_0196553 | |||
| 2076 | Ga0439431_0211085 | |||
| 2077 | Ga0439441_097568 | |||
| 2078 | Ga0439442_009847 | |||
| 2079 | Ga0439445_0000271 | |||
| 2080 | Ga0439445_0000898 | |||
| 2081 | Ga0439445_0022188 | |||
| 2082 | Ga0439448_0007732 | |||
| 2083 | Ga0439432_001270 | |||
| 2084 | Ga0439452_015389 | |||
| 2085 | Ga0439455_0200052 | |||
| 2086 | Ga0439457_014255 | |||
| 2087 | Ga0439462_0003457 | |||
| 2088 | Ga0450923_062085 | |||
| 2089 | Ga0450906_016697 | |||
| 2090 | Ga0450910_088011 | |||
| 2091 | Ga0439446_0015960 | |||
| 2092 | Ga0439446_0071753 | |||
| 2093 | Ga0439434_0001316 | |||
| 2094 | Ga0439434_0258754 | |||
| 2095 | Ga0439434_0365909 | |||
| 2096 | Ga0439460_0285315 | |||
| 2097 | Ga0439460_0309249 | |||
| 2098 | Ga0466965_0190472 | |||
| 2099 | Ga0466966_0642050 | |||
| 2100 | Ga0466961_0511827 | |||
| 2101 | Ga0466963_0202490 | |||
| 2102 | Ga0466971_0011267 | |||
| 2103 | Ga0466957_0129471 | |||
| 2104 | Ga0466958_0058924 | |||
| 2105 | Ga0466967_0088373 | |||
| 2106 | Ga0495627_024430 | |||
| 2107 | Ga0495629_0409358 | |||
| 2108 | Ga0495638_0006816 | |||
| 2109 | Ga0495650_0000158 | |||
| 2110 | Ga0495662_0629714 | |||
| 2111 | Ga0495584_0653790 | |||
| 2112 | Ga0495585_0007224 | |||
| 2113 | Ga0495596_0001722 | |||
| 2114 | Ga0495596_0288891 | |||
| 2115 | Ga0495607_0233928 | |||
| 2116 | Ga0495583_0000139 | |||
| 2117 | Ga0495583_0000631 | |||
| 2118 | Ga0495583_0049835 | |||
| 2119 | Ga0495583_0138928 | |||
| 2120 | Ga0495606_0000672 | |||
| 2121 | Ga0495606_0097843 | |||
| 2122 | Ga0495610_0001956 | |||
| 2123 | Ga0495610_0102024 | |||
| 2124 | Ga0495610_0167798 | |||
| 2125 | Ga0495610_0241972 | |||
| 2126 | Ga0495616_0035449 | |||
| 2127 | Ga0495618_0666693 | |||
| 2128 | Ga0495620_0074993 | |||
| 2129 | Ga0495620_0310170 | |||
| 2130 | Ga0495631_0274197 | |||
| 2131 | Ga0495637_0013506 | |||
| 2132 | Ga0495643_0042779 | |||
| 2133 | Ga0495643_0058229 | |||
| 2134 | Ga0495643_0419710 | |||
| 2135 | Ga0495644_0189750 | |||
| 2136 | Ga0495648_0000143 | |||
| 2137 | Ga0495663_0004724 | |||
| 2138 | Ga0495663_0004868 | |||
| 2139 | Ga0495663_0074411 | |||
| 2140 | Ga0495642_0008825 | |||
| 2141 | Ga0495642_0027044 | |||
| 2142 | Ga0495586_0070475 | |||
| 2143 | Ga0495587_0027072 | |||
| 2144 | Ga0495587_0275897 | |||
| 2145 | Ga0495598_0074808 | |||
| 2146 | Ga0495609_0096737 | |||
| 2147 | Ga0495621_0027893 | |||
| 2148 | Ga0495622_0007935 | |||
| 2149 | Ga0495633_0002517 | |||
| 2150 | Ga0495633_0077644 | |||
| 2151 | Ga0495633_0126517 | |||
| 2152 | Ga0495656_0332712 | |||
| 2153 | Ga0495668_0000016 | |||
| 2154 | Ga0495625_0000150 | |||
| 2155 | Ga0495625_0388205 | |||
| 2156 | Ga0495659_0030064 | |||
| 2157 | Ga0495659_0493366 | |||
| 2158 | Ga0495661_0094901 | |||
| 2159 | Ga0495661_0261427 | |||
| 2160 | Ga0495661_0358626 | |||
| 2161 | Ga0495657_0161972 | |||
| 2162 | Ga0495658_0610658 | |||
| 2163 | Ga0495669_0000050 | |||
| 2164 | Ga0495669_0015265 | |||
| 2165 | Ga0495670_0005678 | |||
| 2166 | Ga0495670_0134108 | |||
| 2167 | Ga0495671_0273798 | |||
| 2168 | Ga0495649_0055299 | |||
| 2169 | Ga0495649_0146871 | |||
| 2170 | Ga0495589_0426484 | |||
| 2171 | Ga0495600_0000690 | |||
| 2172 | Ga0495660_0019031 | |||
| 2173 | Ga0495604_0375413 | |||
| 2174 | Ga0495672_0258162 | |||
| 2175 | Ga0495687_000098 | |||
| 2176 | Ga0495687_000455 | |||
| 2177 | Ga0495687_026151 | |||
| 2178 | Ga0495687_082012 | |||
| 2179 | Ga0495677_0023015 | |||
| 2180 | Ga0495677_0174372 | |||
| 2181 | Ga0495685_067989 | |||
| 2182 | Ga0495673_0175421 | |||
| 2183 | Ga0495681_0043708 | |||
| 2184 | Ga0495681_0171859 | |||
| 2185 | Ga0495686_0619169 | |||
| 2186 | Ga0495615_0000060 | |||
| 2187 | Ga0495626_0000877 | |||
| 2188 | Ga0495626_0287230 | |||
| 2189 | Ga0496100_0000980 | |||
| 2190 | Ga0496100_0011451 | |||
| 2191 | Ga0496100_0105517 | |||
| 2192 | Ga0496101_0008286 | |||
| 2193 | Ga0496101_0077643 | |||
| 2194 | Ga0496101_0381119 | |||
| 2195 | Ga0496101_0392392 | |||
| 2196 | Ga0496101_0851214 | |||
| 2197 | Ga0496102_0000199 | |||
| 2198 | Ga0496102_0001054 | |||
| 2199 | Ga0496102_0058238 | |||
| 2200 | Ga0496102_0060341 | |||
| 2201 | Ga0496102_0790010 | |||
| 2202 | Ga0496103_0000289 | |||
| 2203 | Ga0496103_0000633 | |||
| 2204 | Ga0496103_0004432 | |||
| 2205 | Ga0496103_0062475 | |||
| 2206 | Ga0496103_0087293 | |||
| 2207 | Ga0496103_0252642 | |||
| 2208 | Ga0496104_0000474 | |||
| 2209 | Ga0496104_0045338 | |||
| 2210 | Ga0496104_0136930 | |||
| 2211 | Ga0496104_0249205 | |||
| 2212 | Ga0496104_0284172 | |||
| 2213 | Ga0496104_0619960 | |||
| 2214 | Ga0496105_0000690 | |||
| 2215 | Ga0496105_0124885 | |||
| 2216 | Ga0496105_0158470 | |||
| 2217 | Ga0496106_0008825 | |||
| 2218 | Ga0496106_0008866 | |||
| 2219 | Ga0496107_0014228 | |||
| 2220 | Ga0496107_0023026 | |||
| 2221 | Ga0496107_0066908 | |||
| 2222 | Ga0496107_0233824 | |||
| 2223 | Ga0496108_0277684 | |||
| 2224 | Ga0496109_0182656 | |||
| 2225 | Ga0496109_0194861 | |||
| 2226 | Ga0496109_0357358 | |||
| 2227 | Ga0496110_0025670 | |||
| 2228 | Ga0496110_0067902 | |||
| 2229 | Ga0496110_0121287 | |||
| 2230 | Ga0496110_0835615 | |||
| 2231 | Ga0496111_0033303 | |||
| 2232 | Ga0496111_0082756 | |||
| 2233 | Ga0496111_0156088 | |||
| 2234 | Ga0496111_0373799 | |||
| 2235 | Ga0496112_0014681 | |||
| 2236 | Ga0496112_0100877 | |||
| 2237 | Ga0496112_0120643 | |||
| 2238 | Ga0496112_0368823 | |||
| 2239 | Ga0496112_0879669 | |||
| 2240 | Ga0496113_0004277 | |||
| 2241 | Ga0496113_0015458 | |||
| 2242 | Ga0496113_0057153 | |||
| 2243 | Ga0496113_0194089 | |||
| 2244 | Ga0496113_0661150 | |||
| 2245 | Ga0496113_1579017 | |||
| 2246 | Ga0496114_0007726 | |||
| 2247 | Ga0496114_0287877 | |||
| 2248 | Ga0496114_0296042 | |||
| 2249 | Ga0496114_0604954 | |||
| 2250 | Ga0496115_0000131 | |||
| 2251 | Ga0496115_0000483 | |||
| 2252 | Ga0496115_0119296 | |||
| 2253 | Ga0496115_0399087 | |||
| 2254 | Ga0496115_0541523 | |||
| 2255 | Ga0496116_0000045 | |||
| 2256 | Ga0496116_0017932 | |||
| 2257 | Ga0496116_0029227 | |||
| 2258 | Ga0496116_0121950 | |||
| 2259 | Ga0496117_0000352 | |||
| 2260 | Ga0496117_0004523 | |||
| 2261 | Ga0496117_0066974 | |||
| 2262 | Ga0496117_0079061 | |||
| 2263 | Ga0496117_0120301 | |||
| 2264 | Ga0496117_0221919 | |||
| 2265 | Ga0496117_0568574 | |||
| 2266 | Ga0496118_0000092 | |||
| 2267 | Ga0496118_0004825 | |||
| 2268 | Ga0496118_0020152 | |||
| 2269 | Ga0496118_0021880 | |||
| 2270 | Ga0496118_0051033 | |||
| 2271 | Ga0496118_0196012 | |||
| 2272 | Ga0496119_0004697 | |||
| 2273 | Ga0496119_0009738 | |||
| 2274 | Ga0496119_0038098 | |||
| 2275 | Ga0496119_0169489 | |||
| 2276 | Ga0496120_0007424 | |||
| 2277 | Ga0496120_0024506 | |||
| 2278 | Ga0496120_0119204 | |||
| 2279 | Ga0496120_0257527 | |||
| 2280 | Ga0496120_0376859 | |||
| 2281 | Ga0496121_0000228 | |||
| 2282 | Ga0496121_0001923 | |||
| 2283 | Ga0496121_0007837 | |||
| 2284 | Ga0496121_0057301 | |||
| 2285 | Ga0496121_0228962 | |||
| 2286 | Ga0496122_0009937 | |||
| 2287 | Ga0496122_0020908 | |||
| 2288 | Ga0496122_0033342 | |||
| 2289 | Ga0496122_0068094 | |||
| 2290 | Ga0496122_0107366 | |||
| 2291 | Ga0496123_0000785 | |||
| 2292 | Ga0496123_0001112 | |||
| 2293 | Ga0496123_0033385 | |||
| 2294 | Ga0496123_0041482 | |||
| 2295 | Ga0496124_0000081 | |||
| 2296 | Ga0496124_0005380 | |||
| 2297 | Ga0496124_0053225 | |||
| 2298 | Ga0496124_0273659 | |||
| 2299 | Ga0496124_0402011 | |||
| 2300 | Ga0496124_0487541 | |||
| 2301 | Ga0496125_0000980 | |||
| 2302 | Ga0496125_0003170 | |||
| 2303 | Ga0496125_0062486 | |||
| 2304 | Ga0496125_0087157 | |||
| 2305 | Ga0496125_0205965 | |||
| 2306 | Ga0496125_0242116 | |||
| 2307 | Ga0496126_0000283 | |||
| 2308 | Ga0496126_0000802 | |||
| 2309 | Ga0496126_0001266 | |||
| 2310 | Ga0496126_0041891 | |||
| 2311 | Ga0496126_0625867 | |||
| 2312 | Ga0496126_1082057 | |||
| 2313 | Ga0501306_023694 | |||
| 2314 | Ga0501309_024779 | |||
| 2315 | Ga0501309_026442 | |||
| 2316 | Ga0501310_017093 | |||
| 2317 | Ga0501307_061030 | |||
| 2318 | Ga0495682_0061278 | |||
| 2319 | Ga0495682_0098625 | |||
| 2320 | Ga0501311_013777 | |||
| 2321 | Ga0501313_017138 | |||
| 2322 | Ga0501313_018621 | |||
| 2323 | Ga0501314_026384 | |||
| 2324 | Ga0501314_042408 | |||
| 2325 | Ga0501315_020960 | |||
| 2326 | Ga0501315_105878 | |||
| 2327 | Ga0501316_020284 | |||
| 2328 | Ga0501317_079426 | |||
| 2329 | Ga0501320_017114 | |||
| 2330 | Ga0501320_022178 | |||
| 2331 | Ga0501321_029872 | |||
| 2332 | Ga0501322_005374 | |||
| 2333 | Ga0501323_069045 | |||
| 2334 | Ga0501324_042584 | |||
| 2335 | Ga0501325_009145 | |||
| 2336 | Ga0501325_028935 | |||
| 2337 | Ga0501335_012565 | |||
| 2338 | Ga0501335_034641 | |||
| 2339 | Ga0501031_0662317 | |||
| 2340 | Ga0501034_1040756 | |||
| 2341 | Ga0501034_1588619 | |||
| 2342 | Ga0501036_0103495 | |||
| 2343 | Ga0501036_0297146 | |||
| 2344 | Ga0501038_0398038 | |||
| 2345 | Ga0501039_0224459 | |||
| 2346 | Ga0501039_0758499 | |||
| 2347 | Ga0501040_0081187 | |||
| 2348 | Ga0501040_0453851 | |||
| 2349 | Ga0501040_0887974 | |||
| 2350 | Ga0501041_0208506 | |||
| 2351 | Ga0501041_0240171 | |||
| 2352 | Ga0501042_0139913 | |||
| 2353 | Ga0501043_0031566 | |||
| 2354 | Ga0501046_0259051 | |||
| 2355 | Ga0501046_0787017 | |||
| 2356 | Ga0501047_0003524 | |||
| 2357 | Ga0501047_1428378 | |||
| 2358 | Ga0501048_1075243 | |||
| 2359 | Ga0501048_1142579 | |||
| 2360 | Ga0501068_0527564 | |||
| 2361 | Ga0501070_1405341 | |||
| 2362 | Ga0501071_0616366 | |||
| 2363 | Ga0501071_0669833 | |||
| 2364 | Ga0501072_0304092 | |||
| 2365 | Ga0501072_0462932 | |||
| 2366 | Ga0501072_1347058 | |||
| 2367 | Ga0501073_0614491 | |||
| 2368 | Ga0501075_0201896 | |||
| 2369 | Ga0501076_0430969 | |||
| 2370 | Ga0501076_0579764 | |||
| 2371 | Ga0501077_0672342 | |||
| 2372 | Ga0501233_127262 | |||
| 2373 | Ga0501242_037278 | |||
| 2374 | Ga0501243_103110 | |||
| 2375 | Ga0501250_072046 | |||
| 2376 | Ga0501245_099636 | |||
| 2377 | Ga0501079_0173420 | |||
| 2378 | Ga0501081_1121903 | |||
| 2379 | Ga0501083_0559352 | |||
| 2380 | Ga0501241_082930 | |||
| 2381 | Ga0501268_046505 | |||
| 2382 | Ga0501273_051053 | |||
| 2383 | Ga0501035_1467660 | |||
| 2384 | Ga0501045_0045082 | |||
| 2385 | nmdc:mga03683_284554_c1 | |||
| 2386 | nmdc:mga03683_9705_c1 | |||
| 2387 | nmdc:mga03n38_272530_c1 | |||
| 2388 | nmdc:mga03n38_401807_c1 | |||
| 2389 | nmdc:mga03n38_52666_c1 | |||
| 2390 | nmdc:mga03n38_766621_c1 | |||
| 2391 | nmdc:mga00v17_1556_c1 | |||
| 2392 | nmdc:mga00v17_231124_c1 | |||
| 2393 | nmdc:mga00v17_240296_c1 | |||
| 2394 | nmdc:mga0yw44_704623_c1 | |||
| 2395 | nmdc:mga0yw44_95654_c1 | |||
| 2396 | nmdc:mga0k408_17456_c1 | |||
| 2397 | nmdc:mga0k408_484044_c1 | |||
| 2398 | nmdc:mga06z11_893064_c1 | |||
| 2399 | nmdc:mga06z11_904_c1 | |||
| 2400 | nmdc:mga04h51_172_c1 | |||
| 2401 | nmdc:mga07m45_15_c1 | |||
| 2402 | nmdc:mga07m45_186261_c1 | |||
| 2403 | nmdc:mga07m45_721857_c1 | |||
| 2404 | nmdc:mga05p37_344142_c1 | |||
| 2405 | nmdc:mga05p37_466232_c1 | |||
| 2406 | nmdc:mga05p37_538169_c1 | |||
| 2407 | nmdc:mga09592_1047268_c1 | |||
| 2408 | nmdc:mga09592_816473_c1 | |||
| 2409 | nmdc:mga0qj67_541144_c1 | |||
| 2410 | nmdc:mga06r32_415204_c1 | |||
| 2411 | nmdc:mga08y16_1119983_c1 | |||
| 2412 | nmdc:mga08y16_209471_c1 | |||
| 2413 | nmdc:mga08y16_238311_c1 | |||
| 2414 | nmdc:mga08y16_640169_c1 | |||
| 2415 | nmdc:mga0n895_666212_c1 | |||
| 2416 | nmdc:mga0sz30_13412_c1 | |||
| 2417 | nmdc:mga0sz30_263955_c1 | |||
| 2418 | nmdc:mga0sz30_32949_c1 | |||
| 2419 | nmdc:mga0sz30_36777_c1 | |||
| 2420 | nmdc:mga0sz30_62919_c1 | |||
| 2421 | nmdc:mga0sz30_90873_c2 | |||
| 2422 | Ga0500610_0003391 | |||
| 2423 | Ga0500643_047079 | |||
| 2424 | Ga0500643_126527 | |||
| 2425 | Ga0500647_0118147 | |||
| 2426 | Ga0500566_0001151 | |||
| 2427 | Ga0500641_0002644 | |||
| 2428 | Ga0500648_219243 | |||
| 2429 | Ga0500650_0260426 | |||
| 2430 | Ga0500650_0263044 | |||
| 2431 | Ga0500555_000016 | |||
| 2432 | Ga0500555_018781 | |||
| 2433 | Ga0500555_087752 | |||
| 2434 | Ga0500562_098244 | |||
| 2435 | Ga0500595_001620 | |||
| 2436 | Ga0500595_012595 | |||
| 2437 | Ga0500607_001731 | |||
| 2438 | Ga0500607_211989 | |||
| 2439 | Ga0500642_0000580 | |||
| 2440 | Ga0500658_0000538 | |||
| 2441 | Ga0500559_0284725 | |||
| 2442 | Ga0500568_0133288 | |||
| 2443 | Ga0500588_0135525 | |||
| 2444 | Ga0500588_0180947 | |||
| 2445 | Ga0500600_0428177 | |||
| 2446 | Ga0500604_0075893 | |||
| 2447 | Ga0500624_012592 | |||
| 2448 | Ga0500627_0487192 | |||
| 2449 | Ga0500636_0004289 | |||
| 2450 | Ga0500611_106687 | |||
| 2451 | Ga0500611_199905 | |||
| 2452 | Ga0500645_000002 | |||
| 2453 | Ga0500645_081482 | |||
| 2454 | Ga0500645_223737 | |||
| 2455 | Ga0500596_015335 | |||
| 2456 | Ga0501084_0351017 | |||
| 2457 | Ga0501084_0478375 | |||
| 2458 | Ga0501084_1378503 | |||
| 2459 | Ga0500661_096813 | |||
| 2460 | Ga0590077_114602 | |||
| 2461 | Ga0587077_236397 | |||
| 2462 | Ga0587094_076285 | |||
| 2463 | Ga0587106_111050 | |||
| 2464 | Ga0587072_113682 | |||
| 2465 | Ga0587078_050361 | |||
| 2466 | Ga0587102_032719 | |||
| 2467 | Ga0587110_059526 | |||
| 2468 | Ga0587111_0106248 | |||
| 2469 | Ga0466962_0013182 | |||
| 2470 | Ga0530510_1083781 | |||
| 2471 | 2545672525 | |||
| 2472 | 2566037845 | |||
| 2473 | 2585261873 | |||
| 2474 | 2643948666 | |||
| 2475 | 2644127187 | |||
| 2476 | 2644746027 | |||
| 2477 | 2738711253 | |||
| 2478 | 2738849678 | |||
| 2479 | 2738865407 | |||
| 2480 | 2739297925 | |||
| 2481 | 2739359603 | |||
| 2482 | 2739649214 | |||
| 2483 | 2740027687 | |||
| 2484 | 2753767322 | |||
| 2485 | 2819551367 | |||
| 2486 | 2842699849 | |||
| 2487 | 2879166515 | |||
| 2488 | 2884298765 | |||
| 2489 | 2885430174 | |||
| 2490 | 2896429422 | |||
| 2491 | 2909044485 | |||
| 2492 | 2919452573 | |||
| 2493 | 2919499272 | |||
| 2494 | 2919689417 | |||
| 2495 | 2928961459 | |||
| 2496 | 3003672560 | |||
| 2497 | 641644355 | |||
| 2498 | 8054305365 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ywy-assembly1.cif.gz_R | the structure of the mitoribosome from neurospora crassa with bound trna at the p-site | 0.937 | 22 | 83 |
| 6yws-assembly1.cif.gz_R | the structure of the large subunit of the mitoribosome from neurospora crassa | 0.9365 | 22 | 83 |
| 7sae-assembly1.cif.gz_V | 44sr70p class1 ribosomal particle | 0.93 | 22 | 83 |
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9288 | 22 | 83 |
| 6ywv-assembly1.cif.gz_R | the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa | 0.9284 | 22 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9027 | 22 | 85 | 2.40.50.100 |
| 2ba1A01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8937 | 30 | 85 | 2.40.50.100 |
| af_Q9U0I4_44_103_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8931 | 28 | 84 | 2.40.50.100 |
| 6d6qH01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.889 | 28 | 84 | 2.40.50.100 |
| af_C0Z3L6_20_123_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8829 | 22 | 89 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A328ESH9-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9517 | 22 | 83 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A660TPI7-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9475 | 22 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A382C6Q8-F1-model_v4 | Ribosomal protein L27 | 0.9467 | 22 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A351YBM2-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9462 | 21 | 87 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A166VIX0-F1-model_v4 | Large ribosomal subunit protein bL27m | 0.9407 | 22 | 83 |
GO:0003735
GO:0005762 GO:0006412 |