F492173

General Info

Members Datasets Scaffolds Average Seq Length
1249 571 2498 89

Family's Representative Sequence

Representative Sequence 3300004800|Ga0058861_12019322|Ga0058861_120193222
Length 79
Sequence MAHKKAGGSSRNGRDSAGRRLGVKKFIVRQRGTRVYPGTNVGLGKDHTLFALADGRVRFHDGKQGRKYVSVDIMAVAAE

Samples

Sample ID Description Type Environment
1 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
142 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
143 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
144 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
145 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
146 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
167 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
174 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
179 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
180 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
181 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
183 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
184 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
185 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
193 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
196 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
262 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
263 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
264 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
268 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
269 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
270 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
271 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
272 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
273 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
274 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
275 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
277 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
278 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
279 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
280 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
281 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
282 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
283 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
284 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
285 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
286 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
287 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
288 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
289 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
290 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
291 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
292 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
293 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
294 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
295 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
296 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
297 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
299 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
300 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
302 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
303 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
304 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
305 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
306 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
307 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
308 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
309 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
312 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
313 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
317 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
318 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
319 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
320 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
321 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
322 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
323 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
324 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
325 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
326 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
327 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
328 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
329 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
330 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
331 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
332 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
333 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
334 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
335 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
336 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
337 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
338 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
339 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
340 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
341 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
342 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
343 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
344 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
345 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
346 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
347 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
348 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
349 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
350 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
351 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
352 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
353 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
354 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
355 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
356 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
357 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
358 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
359 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
360 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
361 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
362 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
363 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
364 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
365 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
366 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
367 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
368 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
369 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
370 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
371 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
372 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
373 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
374 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
375 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
376 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
377 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
378 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
379 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
380 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
381 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
382 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
383 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
384 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
385 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
386 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
387 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
388 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
389 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
390 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
391 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
392 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
393 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
394 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
395 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
396 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
397 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
398 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
399 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
400 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
401 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
402 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
403 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
404 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
405 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
406 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
407 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
408 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
409 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
410 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
411 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
412 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
413 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
414 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
415 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
416 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
417 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
418 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
419 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
420 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
421 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
422 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
423 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
424 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
425 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
426 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
427 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
428 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
429 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
430 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
431 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
432 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
433 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
434 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
435 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
436 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
437 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
438 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
439 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
440 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
441 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
446 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
472 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
473 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
474 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
475 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
476 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
477 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
478 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
479 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
480 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
481 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
482 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
483 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
484 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
485 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
486 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
487 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
488 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
489 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
490 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
492 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
493 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
494 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
495 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
496 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
497 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
498 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
499 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
500 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
501 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
502 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
503 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
504 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
505 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
506 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
507 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
508 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
509 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
510 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
511 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
512 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
513 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
514 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
515 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
516 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
517 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
518 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
519 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
520 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
521 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
522 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
523 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
524 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
525 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
526 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
527 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
528 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
529 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
530 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
531 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
532 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
533 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
534 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
543 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
544 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
545 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
546 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
547 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
548 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
549 2643221736 Bosea sp. Root483D1 Isolate Unclassified
550 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
551 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
552 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
553 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
554 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
555 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
556 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
557 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
558 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
559 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
560 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
561 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
562 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
563 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
564 2909042592 Labrys sp. LIt4 Isolate Nodule
565 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
566 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
567 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
568 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
569 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
570 641522639 Methylobacterium sp. 4-46 Isolate Nodule
571 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.87
Metatranscriptomes 4.88
Isolates 2.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.41
Nodule 0.24
Rhizoplane 5.76
Rhizosphere 73.82
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_12019322 3300004800 Bacteria 707
2 SwRhRL2b_contig_3919511 2162886007 Bacteria 2293
3 SwRhRL2b_contig_520222 2162886007 Bacteria 3263
4 ARcpr5yngRDRAFT_c002624 3300000043 Bacteria 1851
5 ARCol0yngRDRAFT_1001217 3300000652 Bacteria 2174
6 ARCol0yngRDRAFT_1017172 3300000652 Bacteria 552
7 JGI24746J21847_1001905 3300001977 Bacteria 3327
8 JGI24740J21852_10025198 3300001979 Bacteria 2008
9 JGI24740J21852_10042732 3300001979 Bacteria 1356
10 JGI24739J22299_10006425 3300001989 Bacteria 4438
11 JGI24739J22299_10200045 3300001989 Bacteria 586
12 JGI24737J22298_10026070 3300001990 Bacteria 1846
13 JGI24735J21928_10042720 3300002067 Bacteria 1319
14 JGI24735J21928_10133842 3300002067 Bacteria 715
15 JGI24748J21848_1008124 3300002074 Bacteria 1232
16 JGI24749J21850_1001036 3300002076 Bacteria 3952
17 JGI24744J21845_10012571 3300002077 Bacteria 1716
18 JGI24744J21845_10021627 3300002077 Bacteria 1265
19 JGI24033J26618_1017319 3300002155 Bacteria 901
20 JGI24034J26672_10013892 3300002239 Bacteria 1225
21 JGI24034J26672_10027937 3300002239 Bacteria 909
22 JGI24034J26672_10092567 3300002239 Bacteria 562
23 JGI24742J22300_10013146 3300002244 Bacteria 1385
24 JGI24742J22300_10071167 3300002244 Bacteria 648
25 JGI24751J29686_10038094 3300002459 Bacteria 996
26 JGI25150J39212_1000233 3300002774 Bacteria 30182
27 JGI25150J39212_1025895 3300002774 Bacteria 852
28 JGI25151J46595_10016142 3300003187 Bacteria 3272
29 JGI25165J46597_1000100 3300003214 Bacteria 157712
30 JGI25153J46596_10000005 3300003215 Bacteria 492839
31 JGI25153J46596_10000460 3300003215 Bacteria 26041
32 JGI25153J46596_10003205 3300003215 Bacteria 9195
33 Ga0006777J48905_1037455 3300003308 Bacteria 1118
34 Ga0007417J51691_1030187 3300003544 Bacteria 858
35 Ga0007410J51695_1032737 3300003574 Bacteria 924
36 Ga0007409J51694_1068937 3300003575 Bacteria 727
37 Ga0007429J51699_1023319 3300003579 Bacteria 928
38 Ga0007429J51699_1031546 3300003579 Bacteria 923
39 Ga0006780_1025085 3300003735 Bacteria 554
40 Ga0055525_1000012 3300003759 Bacteria 486564
41 Ga0055542_1000355 3300003762 Bacteria 48043
42 Ga0055542_1028374 3300003762 Bacteria 737
43 Ga0055529_1000045 3300003763 Bacteria 209617
44 Ga0055529_1001200 3300003763 Bacteria 10283
45 Ga0055526_1051195 3300003771 Bacteria 941
46 Ga0055537_1003015 3300003773 Bacteria 5320
47 Ga0055537_1003625 3300003773 Bacteria 4688
48 Ga0055524_1000030 3300003775 Bacteria 187756
49 Ga0055528_1027333 3300003790 Bacteria 1610
50 Ga0055530_10000554 3300003791 Bacteria 32407
51 Ga0055530_10022028 3300003791 Bacteria 1863
52 Ga0055540_1001254 3300003792 Bacteria 15524
53 Ga0055531_10000019 3300003794 Bacteria 170825
54 Ga0055531_10006010 3300003794 Bacteria 6968
55 Ga0055531_10071482 3300003794 Bacteria 799
56 Ga0055543_1014987 3300004625 Bacteria 1500
57 Ga0065165_1019566 3300005262 Bacteria 2410
58 Ga0065165_1032206 3300005262 Bacteria 1646
59 Ga0065165_1090877 3300005262 Bacteria 777
60 Ga0065714_10346504 3300005288 Bacteria 640
61 Ga0065704_10070490 3300005289 Bacteria 22609
62 Ga0065704_10074996 3300005289 Bacteria 5861
63 Ga0065712_10319854 3300005290 Bacteria 830
64 Ga0065715_10038607 3300005293 Bacteria 1350
65 Ga0065715_10091935 3300005293 Bacteria 5447
66 Ga0065715_10970762 3300005293 Bacteria 540
67 Ga0065715_11099189 3300005293 Bacteria 520
68 Ga0065707_10584051 3300005295 Bacteria 700
69 Ga0070658_10000808 3300005327 Bacteria 26765
70 Ga0070658_10000957 3300005327 Bacteria 24684
71 Ga0070658_10011514 3300005327 Bacteria 7094
72 Ga0070658_10103001 3300005327 Bacteria 2361
73 Ga0070676_10016131 3300005328 Bacteria 4127
74 Ga0070676_10227190 3300005328 Bacteria 1235
75 Ga0070676_10806097 3300005328 Bacteria 693
76 Ga0070676_11261761 3300005328 Bacteria 563
77 Ga0070683_100336697 3300005329 Bacteria 1437
78 Ga0070690_100124496 3300005330 Bacteria 1734
79 Ga0070690_100910205 3300005330 Bacteria 688
80 Ga0070670_100001686 3300005331 Bacteria 17947
81 Ga0070670_100003085 3300005331 Bacteria 13778
82 Ga0070670_100100851 3300005331 Bacteria 2486
83 Ga0070670_100165798 3300005331 Bacteria 1915
84 Ga0070670_100526485 3300005331 Bacteria 1053
85 Ga0070670_100555347 3300005331 Bacteria 1025
86 Ga0070670_100878350 3300005331 Bacteria 812
87 Ga0068869_100340064 3300005334 Bacteria 1221
88 Ga0068869_100695339 3300005334 Bacteria 867
89 Ga0068869_101881082 3300005334 Bacteria 536
90 Ga0070666_10016672 3300005335 Bacteria 4701
91 Ga0070666_10240971 3300005335 Bacteria 1279
92 Ga0070666_10424016 3300005335 Bacteria 958
93 Ga0070682_101700513 3300005337 Bacteria 548
94 Ga0068868_100214997 3300005338 Bacteria 1608
95 Ga0068868_100872315 3300005338 Unclassified 816
96 Ga0070660_100078152 3300005339 Bacteria 2594
97 Ga0070660_100913350 3300005339 Bacteria 740
98 Ga0070661_100000776 3300005344 Bacteria 23062
99 Ga0070668_100001172 3300005347 Bacteria 18548
100 Ga0070668_100002440 3300005347 Bacteria 13678
101 Ga0070668_100035024 3300005347 Bacteria 3827
102 Ga0070668_100109981 3300005347 Bacteria 2193
103 Ga0070668_100306206 3300005347 Bacteria 1334
104 Ga0070668_100555723 3300005347 Bacteria 999
105 Ga0070668_100811840 3300005347 Bacteria 832
106 Ga0070669_100000408 3300005353 Bacteria 32921
107 Ga0070669_100001266 3300005353 Bacteria 18324
108 Ga0070669_100001698 3300005353 Bacteria 15939
109 Ga0070669_100002206 3300005353 Bacteria 14110
110 Ga0070669_100434755 3300005353 Bacteria 1079
111 Ga0070675_100022565 3300005354 Bacteria 5030
112 Ga0070675_100062900 3300005354 Bacteria 3067
113 Ga0070675_100076947 3300005354 Bacteria 2776
114 Ga0070671_100000122 3300005355 Bacteria 50131
115 Ga0070671_100008715 3300005355 Bacteria 8138
116 Ga0070671_100014083 3300005355 Bacteria 6456
117 Ga0070671_100028597 3300005355 Bacteria 4591
118 Ga0070671_100077907 3300005355 Bacteria 2770
119 Ga0070671_100125573 3300005355 Bacteria 2160
120 Ga0070671_100375733 3300005355 Bacteria 1214
121 Ga0070671_101096901 3300005355 Bacteria 699
122 Ga0070671_101315543 3300005355 Bacteria 638
123 Ga0070671_101842966 3300005355 Bacteria 538
124 Ga0070674_100011530 3300005356 Bacteria 5387
125 Ga0070674_100012103 3300005356 Bacteria 5286
126 Ga0070674_100013334 3300005356 Bacteria 5078
127 Ga0070674_101181868 3300005356 Bacteria 678
128 Ga0070674_102101092 3300005356 Bacteria 515
129 Ga0070673_100020913 3300005364 Bacteria 4730
130 Ga0070673_100036022 3300005364 Bacteria 3757
131 Ga0070673_100436502 3300005364 Bacteria 1176
132 Ga0070673_101548119 3300005364 Bacteria 626
133 Ga0070659_100163395 3300005366 Bacteria 1821
134 Ga0070659_100590275 3300005366 Bacteria 954
135 Ga0070659_101338306 3300005366 Bacteria 636
136 Ga0070659_101617757 3300005366 Bacteria 578
137 Ga0070667_100000596 3300005367 Bacteria 35305
138 Ga0070667_100022920 3300005367 Bacteria 5177
139 Ga0070667_100026836 3300005367 Bacteria 4793
140 Ga0070667_100137491 3300005367 Bacteria 2137
141 Ga0070667_100284970 3300005367 Bacteria 1484
142 Ga0070667_101051623 3300005367 Bacteria 760
143 Ga0070667_101698346 3300005367 Bacteria 594
144 Ga0070667_101924869 3300005367 Bacteria 557
145 Ga0070713_101092702 3300005436 Bacteria 771
146 Ga0070701_10424070 3300005438 Bacteria 848
147 Ga0070711_101266781 3300005439 Bacteria 639
148 Ga0070705_100322643 3300005440 Bacteria 1115
149 Ga0070700_100269421 3300005441 Bacteria 1230
150 Ga0070694_100267543 3300005444 Bacteria 1299
151 Ga0070663_100009319 3300005455 Bacteria 6076
152 Ga0070678_100148533 3300005456 Bacteria 1885
153 Ga0070678_100203100 3300005456 Bacteria 1637
154 Ga0070678_100271202 3300005456 Bacteria 1431
155 Ga0070678_100328378 3300005456 Bacteria 1308
156 Ga0070678_100626345 3300005456 Bacteria 963
157 Ga0070678_102051506 3300005456 Bacteria 541
158 Ga0070662_100000872 3300005457 Bacteria 18447
159 Ga0070662_100064759 3300005457 Bacteria 2677
160 Ga0070662_101122802 3300005457 Bacteria 675
161 Ga0070681_11787276 3300005458 Bacteria 542
162 Ga0068867_100007513 3300005459 Bacteria 7706
163 Ga0068867_100049553 3300005459 Bacteria 3092
164 Ga0068867_100691070 3300005459 Bacteria 899
165 Ga0068867_101006825 3300005459 Bacteria 756
166 Ga0070685_10689205 3300005466 Bacteria 744
167 Ga0070706_100545880 3300005467 Bacteria 1078
168 Ga0070698_100365019 3300005471 Bacteria 1376
169 Ga0070699_101144278 3300005518 Bacteria 714
170 Ga0070679_101922014 3300005530 Bacteria 540
171 Ga0070684_100387437 3300005535 Bacteria 1288
172 Ga0068853_100358710 3300005539 Bacteria 1357
173 Ga0068853_100637653 3300005539 Bacteria 1013
174 Ga0068853_101245312 3300005539 Bacteria 719
175 Ga0068853_101363779 3300005539 Bacteria 686
176 Ga0068853_101914658 3300005539 Bacteria 575
177 Ga0070672_100103722 3300005543 Bacteria 2310
178 Ga0070672_100528844 3300005543 Bacteria 1022
179 Ga0070686_100155091 3300005544 Bacteria 1607
180 Ga0070686_100783497 3300005544 Bacteria 767
181 Ga0070695_100099178 3300005545 Bacteria 1959
182 Ga0070696_100641985 3300005546 Bacteria 860
183 Ga0070693_100892271 3300005547 Bacteria 666
184 Ga0070665_100001012 3300005548 Bacteria 35432
185 Ga0070665_100004063 3300005548 Bacteria 15396
186 Ga0070665_100211836 3300005548 Bacteria 1938
187 Ga0070665_100253198 3300005548 Bacteria 1762
188 Ga0070665_100805224 3300005548 Bacteria 953
189 Ga0070704_102225398 3300005549 Bacteria 510
190 Ga0068855_100003997 3300005563 Bacteria 18007
191 Ga0068855_100092560 3300005563 Bacteria 3486
192 Ga0068855_101217122 3300005563 Bacteria 782
193 Ga0070664_100027918 3300005564 Bacteria 4694
194 Ga0070664_100074095 3300005564 Bacteria 2922
195 Ga0070664_100615275 3300005564 Bacteria 1008
196 Ga0070664_101368539 3300005564 Bacteria 669
197 Ga0068857_100183846 3300005577 Bacteria 1902
198 Ga0068857_100799312 3300005577 Bacteria 901
199 Ga0068857_101180691 3300005577 Bacteria 741
200 Ga0068857_101216258 3300005577 Bacteria 730
201 Ga0068857_101664418 3300005577 Bacteria 623
202 Ga0068857_101868326 3300005577 Bacteria 588
203 Ga0068854_100005493 3300005578 Bacteria 8007
204 Ga0068854_100015015 3300005578 Bacteria 5119
205 Ga0068856_100008316 3300005614 Bacteria 10111
206 Ga0068856_100030211 3300005614 Bacteria 5297
207 Ga0068856_100038838 3300005614 Bacteria 4673
208 Ga0068856_100066194 3300005614 Bacteria 3570
209 Ga0068856_101158058 3300005614 Bacteria 790
210 Ga0070702_100056481 3300005615 Bacteria 2267
211 Ga0070702_100630366 3300005615 Bacteria 808
212 Ga0068852_100021267 3300005616 Bacteria 5176
213 Ga0068852_100309918 3300005616 Bacteria 1530
214 Ga0068852_101180069 3300005616 Bacteria 786
215 Ga0068859_100001413 3300005617 Bacteria 24348
216 Ga0068859_100026464 3300005617 Bacteria 5817
217 Ga0068859_101474601 3300005617 Bacteria 751
218 Ga0068859_102137103 3300005617 Bacteria 618
219 Ga0068864_100034325 3300005618 Bacteria 4315
220 Ga0068864_100058936 3300005618 Bacteria 3320
221 Ga0068864_101385121 3300005618 Bacteria 705
222 Ga0068864_101543468 3300005618 Bacteria 667
223 Ga0068864_102110461 3300005618 Bacteria 570
224 Ga0068866_10508127 3300005718 Bacteria 799
225 Ga0068861_100033598 3300005719 Bacteria 3786
226 Ga0068861_101384248 3300005719 Bacteria 687
227 Ga0068861_101579578 3300005719 Bacteria 646
228 Ga0068851_10003977 3300005834 Bacteria 6623
229 Ga0068851_10269454 3300005834 Bacteria 970
230 Ga0068870_10051536 3300005840 Bacteria 2179
231 Ga0068870_10265617 3300005840 Bacteria 1070
232 Ga0068870_10433095 3300005840 Bacteria 863
233 Ga0068863_100018487 3300005841 Bacteria 6670
234 Ga0068863_100041528 3300005841 Bacteria 4374
235 Ga0068863_100217996 3300005841 Bacteria 1838
236 Ga0068863_100318872 3300005841 Bacteria 1509
237 Ga0068863_100446522 3300005841 Bacteria 1269
238 Ga0068858_100071679 3300005842 Bacteria 3214
239 Ga0068858_100492618 3300005842 Bacteria 1183
240 Ga0068860_100018416 3300005843 Bacteria 6793
241 Ga0068860_100029808 3300005843 Bacteria 5248
242 Ga0068860_100030603 3300005843 Bacteria 5176
243 Ga0068860_101158176 3300005843 Bacteria 793
244 Ga0068862_100003883 3300005844 Bacteria 12712
245 Ga0068862_100022859 3300005844 Bacteria 5234
246 Ga0068862_100030220 3300005844 Bacteria 4565
247 Ga0068862_100107007 3300005844 Bacteria 2452
248 Ga0068862_100900706 3300005844 Bacteria 869
249 Ga0081538_10002854 3300005981 Bacteria 16521
250 Ga0081538_10170439 3300005981 Bacteria 951
251 Ga0075365_10072164 3300006038 Bacteria 2325
252 Ga0075365_10109948 3300006038 Bacteria 1893
253 Ga0075365_10477367 3300006038 Bacteria 881
254 Ga0075365_10583278 3300006038 Bacteria 791
255 Ga0075365_10729918 3300006038 Bacteria 700
256 Ga0075368_10036569 3300006042 Bacteria 1918
257 Ga0075368_10299808 3300006042 Bacteria 693
258 Ga0075363_100025154 3300006048 Bacteria 3033
259 Ga0075363_100299638 3300006048 Bacteria 933
260 Ga0075364_10118963 3300006051 Bacteria 1767
261 Ga0075364_10273535 3300006051 Bacteria 1149
262 Ga0075364_10373624 3300006051 Bacteria 972
263 Ga0075364_10377646 3300006051 Bacteria 967
264 Ga0075364_10387144 3300006051 Bacteria 954
265 Ga0070712_100146886 3300006175 Bacteria 1806
266 Ga0075362_10001290 3300006177 Bacteria 7936
267 Ga0075362_10216974 3300006177 Bacteria 934
268 Ga0075367_10032202 3300006178 Bacteria 3015
269 Ga0075369_10009867 3300006186 Bacteria 3724
270 Ga0075369_10016088 3300006186 Bacteria 3012
271 Ga0075369_10026637 3300006186 Bacteria 2411
272 Ga0075369_10494592 3300006186 Bacteria 581
273 Ga0075366_10051050 3300006195 Bacteria 2457
274 Ga0075366_10063141 3300006195 Bacteria 2201
275 Ga0075366_10115554 3300006195 Bacteria 1616
276 Ga0075366_10176550 3300006195 Bacteria 1297
277 Ga0075366_10581919 3300006195 Bacteria 694
278 Ga0075366_10686094 3300006195 Bacteria 636
279 Ga0097621_100274921 3300006237 Bacteria 1481
280 Ga0075370_10149342 3300006353 Bacteria 1369
281 Ga0075370_10565927 3300006353 Bacteria 688
282 Ga0068871_100104146 3300006358 Bacteria 2380
283 Ga0068871_100880614 3300006358 Bacteria 829
284 Ga0068871_101237325 3300006358 Bacteria 701
285 Ga0075428_100142813 3300006844 Bacteria 2602
286 Ga0075428_100152242 3300006844 Bacteria 2512
287 Ga0075428_100632564 3300006844 Bacteria 1142
288 Ga0075428_101913738 3300006844 Bacteria 616
289 Ga0075430_100390506 3300006846 Bacteria 1148
290 Ga0075430_100542113 3300006846 Bacteria 959
291 Ga0075430_100717988 3300006846 Bacteria 824
292 Ga0075431_100189366 3300006847 Bacteria 2109
293 Ga0075431_100620632 3300006847 Bacteria 1063
294 Ga0075433_11192357 3300006852 Bacteria 661
295 Ga0068865_100594066 3300006881 Bacteria 935
296 Ga0097620_100001413 3300006931 Bacteria 24348
297 Ga0097620_100026465 3300006931 Bacteria 5817
298 Ga0097620_101474443 3300006931 Bacteria 751
299 Ga0097620_102137818 3300006931 Bacteria 618
300 Ga0105251_10005302 3300009011 Bacteria 8478
301 Ga0105251_10042882 3300009011 Bacteria 2193
302 Ga0105251_10141671 3300009011 Bacteria 1087
303 Ga0105250_10008207 3300009092 Bacteria 4445
304 Ga0105250_10243315 3300009092 Bacteria 767
305 Ga0105240_10046210 3300009093 Bacteria 5519
306 Ga0105240_10150959 3300009093 Bacteria 2767
307 Ga0105240_10425723 3300009093 Bacteria 1490
308 Ga0105240_11580611 3300009093 Bacteria 686
309 Ga0105240_11744685 3300009093 Bacteria 649
310 Ga0111539_10013275 3300009094 Bacteria 10294
311 Ga0111539_10269322 3300009094 Bacteria 1983
312 Ga0111539_10730597 3300009094 Bacteria 1153
313 Ga0105245_10209462 3300009098 Bacteria 1876
314 Ga0105245_10547932 3300009098 Bacteria 1178
315 Ga0105247_10024046 3300009101 Bacteria 3669
316 Ga0105247_10225356 3300009101 Bacteria 1271
317 Ga0114129_10427831 3300009147 Bacteria 1740
318 Ga0114129_10502771 3300009147 Bacteria 1583
319 Ga0114129_10533868 3300009147 Bacteria 1528
320 Ga0114129_11514071 3300009147 Bacteria 824
321 Ga0105243_10000423 3300009148 Bacteria 44393
322 Ga0105243_10555936 3300009148 Bacteria 1097
323 Ga0105243_12010938 3300009148 Bacteria 612
324 Ga0105241_10009278 3300009174 Bacteria 7234
325 Ga0105241_10423776 3300009174 Bacteria 1172
326 Ga0105242_10297423 3300009176 Bacteria 1472
327 Ga0105248_10026827 3300009177 Bacteria 6408
328 Ga0105248_10060330 3300009177 Bacteria 4258
329 Ga0105248_10080865 3300009177 Bacteria 3653
330 Ga0105248_10409273 3300009177 Bacteria 1527
331 Ga0105248_11008578 3300009177 Bacteria 940
332 Ga0105248_11039322 3300009177 Bacteria 925
333 Ga0105237_10210213 3300009545 Bacteria 1946
334 Ga0105237_10294972 3300009545 Bacteria 1624
335 Ga0105237_10709252 3300009545 Bacteria 1013
336 Ga0105237_11595555 3300009545 Bacteria 659
337 Ga0105237_12388585 3300009545 Bacteria 539
338 Ga0105238_10059481 3300009551 Bacteria 3828
339 Ga0105238_10127097 3300009551 Bacteria 2528
340 Ga0105238_10179574 3300009551 Bacteria 2094
341 Ga0105238_12679203 3300009551 Bacteria 535
342 Ga0105249_10009816 3300009553 Bacteria 8388
343 Ga0105249_10204570 3300009553 Bacteria 1934
344 Ga0105249_11013216 3300009553 Bacteria 899
345 Ga0105148_104016 3300009978 Bacteria 1048
346 Ga0105239_10473760 3300010375 Bacteria 1422
347 Ga0105239_10475938 3300010375 Bacteria 1419
348 Ga0105239_10988601 3300010375 Bacteria 967
349 Ga0105239_11028442 3300010375 Bacteria 947
350 Ga0105239_11227514 3300010375 Bacteria 864
351 Ga0105239_11475217 3300010375 Bacteria 786
352 Ga0105246_10034849 3300011119 Bacteria 3358
353 Ga0157317_1006346 3300012475 Bacteria 823
354 Ga0157322_1027459 3300012490 Bacteria 588
355 Ga0157315_1014526 3300012508 Bacteria 755
356 Ga0157315_1063024 3300012508 Bacteria 527
357 Ga0157316_1023420 3300012510 Bacteria 694
358 Ga0157316_1058686 3300012510 Bacteria 551
359 Ga0157327_1002804 3300012512 Bacteria 1234
360 Ga0157327_1015497 3300012512 Bacteria 794
361 Ga0157326_1036161 3300012513 Bacteria 675
362 Ga0157373_10180139 3300013100 Bacteria 1488
363 Ga0157373_10592669 3300013100 Bacteria 806
364 Ga0157373_10887051 3300013100 Bacteria 661
365 Ga0157371_10000032 3300013102 Bacteria 230252
366 Ga0157371_10004757 3300013102 Bacteria 11711
367 Ga0157371_10434302 3300013102 Bacteria 964
368 Ga0157370_10000152 3300013104 Bacteria 85001
369 Ga0157370_10406630 3300013104 Bacteria 1253
370 Ga0157369_10046420 3300013105 Bacteria 4720
371 Ga0157369_10369745 3300013105 Bacteria 1488
372 Ga0157369_11159648 3300013105 Bacteria 789
373 Ga0157374_10035173 3300013296 Bacteria 4582
374 Ga0157374_10117361 3300013296 Bacteria 2565
375 Ga0157378_10509205 3300013297 Bacteria 1204
376 Ga0157378_11417713 3300013297 Bacteria 738
377 Ga0157378_11446489 3300013297 Bacteria 731
378 Ga0157378_11635651 3300013297 Bacteria 690
379 Ga0163162_10047653 3300013306 Bacteria 4294
380 Ga0163162_10075148 3300013306 Bacteria 3439
381 Ga0163162_10766795 3300013306 Bacteria 1083
382 Ga0163162_11063306 3300013306 Bacteria 916
383 Ga0163162_11154471 3300013306 Bacteria 878
384 Ga0163162_11254396 3300013306 Bacteria 842
385 Ga0163162_11755874 3300013306 Bacteria 709
386 Ga0157372_11467339 3300013307 Bacteria 786
387 Ga0157375_10287973 3300013308 Bacteria 1806
388 Ga0157375_10389465 3300013308 Bacteria 1560
389 Ga0157375_10413178 3300013308 Bacteria 1516
390 Ga0157375_13680076 3300013308 Bacteria 510
391 Ga0163163_10028972 3300014325 Bacteria 5323
392 Ga0163163_11361346 3300014325 Bacteria 771
393 Ga0157380_10001109 3300014326 Bacteria 17364
394 Ga0157380_10018421 3300014326 Bacteria 5182
395 Ga0157380_10078258 3300014326 Bacteria 2697
396 Ga0157380_11204077 3300014326 Bacteria 801
397 Ga0182008_10238008 3300014497 Bacteria 936
398 Ga0182008_10330442 3300014497 Bacteria 804
399 Ga0157377_10519930 3300014745 Bacteria 835
400 Ga0157379_10237668 3300014968 Bacteria 1652
401 Ga0157376_10240807 3300014969 Bacteria 1685
402 Ga0157376_10355567 3300014969 Bacteria 1403
403 Ga0157376_10536248 3300014969 Bacteria 1156
404 Ga0163161_10001748 3300017792 Bacteria 15903
405 Ga0163161_10042717 3300017792 Bacteria 3262
406 Ga0163161_10143980 3300017792 Bacteria 1806
407 Ga0163161_10638310 3300017792 Bacteria 881
408 Ga0163161_11362757 3300017792 Bacteria 618
409 Ga0197907_10342361 3300020069 Bacteria 840
410 Ga0197907_10443662 3300020069 Bacteria 708
411 Ga0206356_11436017 3300020070 Bacteria 782
412 Ga0206356_11439898 3300020070 Bacteria 1235
413 Ga0206349_1394373 3300020075 Bacteria 927
414 Ga0206355_1251537 3300020076 Bacteria 596
415 Ga0206355_1354397 3300020076 Bacteria 992
416 Ga0206355_1436319 3300020076 Bacteria 688
417 Ga0206351_10725755 3300020077 Bacteria 601
418 Ga0206352_10349969 3300020078 Bacteria 902
419 Ga0206350_10307900 3300020080 Bacteria 799
420 Ga0206354_11299294 3300020081 Bacteria 794
421 Ga0206353_11891397 3300020082 Bacteria 741
422 Ga0224712_10277510 3300022467 Bacteria 779
423 Ga0224712_10291230 3300022467 Bacteria 762
424 Ga0224712_10488812 3300022467 Bacteria 594
425 Ga0209436_109965 3300025208 Bacteria 1768
426 Ga0207672_1003100 3300025223 Bacteria 957
427 Ga0209672_103601 3300025228 Bacteria 3137
428 Ga0209563_100030 3300025230 Bacteria 489259
429 Ga0207427_101365 3300025231 Bacteria 8998
430 Ga0207425_1000027 3300025245 Bacteria 299995
431 Ga0209646_1015744 3300025246 Bacteria 1126
432 Ga0209026_1001157 3300025250 Bacteria 12346
433 Ga0209148_1000011 3300025254 Bacteria 1196503
434 Ga0209148_1004002 3300025254 Bacteria 3772
435 Ga0209759_1025063 3300025256 Bacteria 1277
436 Ga0209129_1000416 3300025258 Bacteria 32921
437 Ga0209233_1000143 3300025261 Bacteria 191568
438 Ga0209233_1092086 3300025261 Bacteria 518
439 Ga0209565_1000012 3300025263 Bacteria 606500
440 Ga0209565_1000142 3300025263 Bacteria 99561
441 Ga0209455_1000006 3300025272 Bacteria 1196503
442 Ga0209455_1000908 3300025272 Bacteria 15432
443 Ga0209455_1002724 3300025272 Bacteria 6635
444 Ga0209673_1002755 3300025273 Bacteria 11498
445 Ga0209675_1012044 3300025291 Bacteria 2815
446 Ga0209675_1014237 3300025291 Bacteria 2432
447 Ga0209675_1092580 3300025291 Bacteria 544
448 Ga0209676_1022757 3300025292 Bacteria 2068
449 Ga0209025_1000197 3300025294 Bacteria 147029
450 Ga0209564_1002693 3300025295 Bacteria 13429
451 Ga0209564_1080555 3300025295 Bacteria 637
452 Ga0209758_1000001 3300025297 Bacteria 1981790
453 Ga0209758_1000009 3300025297 Bacteria 1123483
454 Ga0209758_1002365 3300025297 Bacteria 19421
455 Ga0209050_1000005 3300025298 Bacteria 1557793
456 Ga0209050_1000010 3300025298 Bacteria 980454
457 Ga0209050_1000254 3300025298 Bacteria 114395
458 Ga0209050_1005181 3300025298 Bacteria 8346
459 Ga0209256_1000012 3300025299 Bacteria 790371
460 Ga0207426_1007652 3300025302 Bacteria 4491
461 Ga0207426_1113075 3300025302 Bacteria 681
462 Ga0209051_1000152 3300025303 Bacteria 131355
463 Ga0209051_1146724 3300025303 Bacteria 559
464 Ga0209257_1000009 3300025304 Bacteria 1205047
465 Ga0209257_1002315 3300025304 Bacteria 19253
466 Ga0209257_1013636 3300025304 Bacteria 3587
467 Ga0207697_10000595 3300025315 Bacteria 20569
468 Ga0207697_10073672 3300025315 Bacteria 1434
469 Ga0207697_10109135 3300025315 Bacteria 1184
470 Ga0207697_10182914 3300025315 Bacteria 919
471 Ga0207656_10002662 3300025321 Bacteria 6051
472 Ga0207696_1005004 3300025711 Bacteria 5585
473 Ga0207713_1012386 3300025735 Bacteria 4566
474 Ga0207682_10003889 3300025893 Bacteria 6376
475 Ga0207682_10161102 3300025893 Bacteria 1017
476 Ga0207642_10443574 3300025899 Bacteria 785
477 Ga0207642_10495086 3300025899 Unclassified 747
478 Ga0207710_10714828 3300025900 Bacteria 526
479 Ga0207688_10063112 3300025901 Bacteria 2089
480 Ga0207688_10135214 3300025901 Bacteria 1447
481 Ga0207688_10179146 3300025901 Bacteria 1263
482 Ga0207680_10361310 3300025903 Bacteria 1021
483 Ga0207680_10431350 3300025903 Bacteria 934
484 Ga0207680_10646300 3300025903 Bacteria 757
485 Ga0207680_11008421 3300025903 Bacteria 596
486 Ga0207647_10022843 3300025904 Bacteria 4149
487 Ga0207647_10033402 3300025904 Bacteria 3294
488 Ga0207647_10057828 3300025904 Bacteria 2377
489 Ga0207647_10406208 3300025904 Bacteria 767
490 Ga0207645_10008043 3300025907 Bacteria 7397
491 Ga0207645_10055530 3300025907 Bacteria 2528
492 Ga0207645_10484273 3300025907 Bacteria 837
493 Ga0207645_11236134 3300025907 Bacteria 501
494 Ga0207643_10041321 3300025908 Bacteria 2598
495 Ga0207643_10166029 3300025908 Bacteria 1330
496 Ga0207705_10000009 3300025909 Bacteria 576128
497 Ga0207705_10000122 3300025909 Bacteria 86442
498 Ga0207705_10028066 3300025909 Bacteria 4013
499 Ga0207705_10377512 3300025909 Bacteria 1095
500 Ga0207654_10001772 3300025911 Bacteria 11212
501 Ga0207654_10664454 3300025911 Bacteria 747
502 Ga0207695_10034521 3300025913 Bacteria 5499
503 Ga0207695_10093798 3300025913 Bacteria 3011
504 Ga0207695_10300486 3300025913 Bacteria 1496
505 Ga0207695_10489051 3300025913 Bacteria 1113
506 Ga0207671_10009515 3300025914 Bacteria 8115
507 Ga0207671_10469294 3300025914 Bacteria 1003
508 Ga0207671_10696985 3300025914 Bacteria 808
509 Ga0207671_10810682 3300025914 Bacteria 742
510 Ga0207693_10264377 3300025915 Unclassified 1349
511 Ga0207662_10267515 3300025918 Bacteria 1127
512 Ga0207657_10039979 3300025919 Bacteria 4160
513 Ga0207649_10000482 3300025920 Bacteria 28301
514 Ga0207649_10028573 3300025920 Bacteria 3284
515 Ga0207649_11380204 3300025920 Bacteria 557
516 Ga0207652_10226194 3300025921 Bacteria 1686
517 Ga0207681_10000387 3300025923 Bacteria 30892
518 Ga0207681_10001010 3300025923 Bacteria 18360
519 Ga0207681_10001632 3300025923 Bacteria 14465
520 Ga0207681_10026231 3300025923 Bacteria 3756
521 Ga0207681_10368141 3300025923 Bacteria 1154
522 Ga0207681_10518112 3300025923 Bacteria 978
523 Ga0207681_10839171 3300025923 Bacteria 768
524 Ga0207694_10005283 3300025924 Bacteria 9953
525 Ga0207694_10059351 3300025924 Bacteria 2975
526 Ga0207694_10298255 3300025924 Bacteria 1327
527 Ga0207694_10444900 3300025924 Bacteria 1081
528 Ga0207650_10002289 3300025925 Bacteria 13345
529 Ga0207650_10070938 3300025925 Bacteria 2620
530 Ga0207650_10080672 3300025925 Bacteria 2467
531 Ga0207650_10144869 3300025925 Bacteria 1870
532 Ga0207650_10223930 3300025925 Bacteria 1515
533 Ga0207650_10684350 3300025925 Bacteria 866
534 Ga0207659_10001032 3300025926 Bacteria 16497
535 Ga0207659_10163319 3300025926 Bacteria 1751
536 Ga0207659_10178036 3300025926 Bacteria 1682
537 Ga0207659_10776419 3300025926 Bacteria 823
538 Ga0207687_10320987 3300025927 Bacteria 1254
539 Ga0207644_10000048 3300025931 Bacteria 102494
540 Ga0207644_10000293 3300025931 Bacteria 32998
541 Ga0207644_10006574 3300025931 Bacteria 7573
542 Ga0207644_10014696 3300025931 Bacteria 5246
543 Ga0207644_10161897 3300025931 Bacteria 1740
544 Ga0207644_10252123 3300025931 Bacteria 1408
545 Ga0207644_10619547 3300025931 Bacteria 899
546 Ga0207644_10753935 3300025931 Bacteria 813
547 Ga0207690_10000052 3300025932 Bacteria 106112
548 Ga0207690_10361496 3300025932 Bacteria 1150
549 Ga0207706_10002470 3300025933 Bacteria 18018
550 Ga0207706_10019428 3300025933 Bacteria 6114
551 Ga0207706_11075288 3300025933 Bacteria 673
552 Ga0207686_10231924 3300025934 Bacteria 1339
553 Ga0207686_10351866 3300025934 Bacteria 1109
554 Ga0207709_10000574 3300025935 Bacteria 30979
555 Ga0207709_10387182 3300025935 Bacteria 1065
556 Ga0207709_10920234 3300025935 Bacteria 711
557 Ga0207709_11469804 3300025935 Bacteria 565
558 Ga0207670_11350781 3300025936 Bacteria 605
559 Ga0207669_10000044 3300025937 Bacteria 63993
560 Ga0207669_10007750 3300025937 Bacteria 4995
561 Ga0207669_10024307 3300025937 Bacteria 3254
562 Ga0207704_10391686 3300025938 Bacteria 1094
563 Ga0207704_11878280 3300025938 Bacteria 515
564 Ga0207691_10002177 3300025940 Bacteria 19162
565 Ga0207691_10142133 3300025940 Bacteria 2115
566 Ga0207691_11627805 3300025940 Bacteria 524
567 Ga0207711_10202869 3300025941 Bacteria 1810
568 Ga0207711_10241428 3300025941 Bacteria 1656
569 Ga0207711_10335169 3300025941 Bacteria 1399
570 Ga0207711_11724276 3300025941 Bacteria 570
571 Ga0207689_11469562 3300025942 Bacteria 570
572 Ga0207661_11369783 3300025944 Bacteria 649
573 Ga0207679_10027267 3300025945 Bacteria 3949
574 Ga0207679_11814755 3300025945 Bacteria 557
575 Ga0207667_10000002 3300025949 Bacteria 895662
576 Ga0207667_10053707 3300025949 Bacteria 4239
577 Ga0207667_10772239 3300025949 Bacteria 959
578 Ga0207667_11023535 3300025949 Bacteria 812
579 Ga0207651_10024451 3300025960 Bacteria 3737
580 Ga0207712_10013270 3300025961 Bacteria 5281
581 Ga0207712_10280829 3300025961 Bacteria 1359
582 Ga0207712_10446143 3300025961 Bacteria 1096
583 Ga0207712_11880967 3300025961 Bacteria 536
584 Ga0207668_10000720 3300025972 Bacteria 20252
585 Ga0207668_10005075 3300025972 Bacteria 7748
586 Ga0207668_10077705 3300025972 Bacteria 2394
587 Ga0207668_10232671 3300025972 Bacteria 1487
588 Ga0207668_10275915 3300025972 Bacteria 1376
589 Ga0207668_11902423 3300025972 Bacteria 536
590 Ga0207668_11925484 3300025972 Bacteria 533
591 Ga0207640_10002340 3300025981 Bacteria 10184
592 Ga0207640_10017460 3300025981 Bacteria 4199
593 Ga0207658_10001159 3300025986 Bacteria 21112
594 Ga0207658_10025817 3300025986 Bacteria 4114
595 Ga0207658_10099468 3300025986 Bacteria 2275
596 Ga0207658_10207340 3300025986 Bacteria 1640
597 Ga0207658_10285591 3300025986 Bacteria 1416
598 Ga0207658_10906088 3300025986 Bacteria 803
599 Ga0207677_10162266 3300026023 Bacteria 1738
600 Ga0207677_10164483 3300026023 Bacteria 1728
601 Ga0207703_10011232 3300026035 Bacteria 6968
602 Ga0207703_10064656 3300026035 Bacteria 3004
603 Ga0207703_10785799 3300026035 Bacteria 908
604 Ga0207639_10000777 3300026041 Bacteria 21710
605 Ga0207639_11108890 3300026041 Bacteria 742
606 Ga0207639_11476767 3300026041 Bacteria 638
607 Ga0207678_10005545 3300026067 Bacteria 11277
608 Ga0207678_10068106 3300026067 Bacteria 3055
609 Ga0207708_10206377 3300026075 Bacteria 1569
610 Ga0207702_10003669 3300026078 Bacteria 13897
611 Ga0207702_10006661 3300026078 Bacteria 9934
612 Ga0207702_11156063 3300026078 Bacteria 768
613 Ga0207641_10006329 3300026088 Bacteria 10006
614 Ga0207641_10168806 3300026088 Bacteria 1995
615 Ga0207641_10405047 3300026088 Bacteria 1310
616 Ga0207641_10558432 3300026088 Bacteria 1117
617 Ga0207641_10802312 3300026088 Bacteria 931
618 Ga0207641_11612360 3300026088 Bacteria 651
619 Ga0207641_12023876 3300026088 Bacteria 577
620 Ga0207648_10029482 3300026089 Bacteria 4866
621 Ga0207648_10085699 3300026089 Bacteria 2748
622 Ga0207676_10030447 3300026095 Bacteria 4052
623 Ga0207676_10046151 3300026095 Bacteria 3370
624 Ga0207676_10252703 3300026095 Bacteria 1587
625 Ga0207676_11219950 3300026095 Bacteria 746
626 Ga0207674_10012390 3300026116 Bacteria 9533
627 Ga0207674_10173026 3300026116 Bacteria 2112
628 Ga0207674_10668720 3300026116 Bacteria 1003
629 Ga0207674_11207251 3300026116 Bacteria 726
630 Ga0207674_11359009 3300026116 Bacteria 680
631 Ga0207675_100016300 3300026118 Bacteria 6937
632 Ga0207683_10140414 3300026121 Bacteria 2176
633 Ga0207683_10240991 3300026121 Bacteria 1649
634 Ga0207683_10498239 3300026121 Bacteria 1125
635 Ga0207683_10552332 3300026121 Bacteria 1065
636 Ga0207683_11344496 3300026121 Bacteria 661
637 Ga0207698_10000537 3300026142 Bacteria 22020
638 Ga0207698_10008071 3300026142 Bacteria 6639
639 Ga0207698_10151214 3300026142 Bacteria 2015
640 Ga0209973_1038452 3300027252 Bacteria 695
641 Ga0209970_1024934 3300027614 Bacteria 1023
642 Ga0210002_1034486 3300027617 Bacteria 848
643 Ga0210002_1078664 3300027617 Bacteria 586
644 Ga0209971_1049962 3300027682 Bacteria 1010
645 Ga0209998_10056268 3300027717 Bacteria 919
646 Ga0209813_10000081 3300027866 Bacteria 35059
647 Ga0207428_10243522 3300027907 Bacteria 1343
648 Ga0207428_10462692 3300027907 Bacteria 924
649 Ga0265356_1039492 3300028017 Bacteria 519
650 Ga0268266_10000471 3300028379 Bacteria 58314
651 Ga0268266_10014912 3300028379 Bacteria 6674
652 Ga0268266_10181481 3300028379 Bacteria 1917
653 Ga0268266_10915904 3300028379 Bacteria 848
654 Ga0268266_11959938 3300028379 Bacteria 559
655 Ga0268266_12167543 3300028379 Bacteria 528
656 Ga0268265_10010196 3300028380 Bacteria 6342
657 Ga0268265_10011459 3300028380 Bacteria 5995
658 Ga0268265_10037933 3300028380 Bacteria 3540
659 Ga0268265_10043598 3300028380 Bacteria 3336
660 Ga0268265_10110885 3300028380 Bacteria 2239
661 Ga0268265_11170391 3300028380 Unclassified 766
662 Ga0268265_12217624 3300028380 Bacteria 556
663 Ga0268264_10001249 3300028381 Bacteria 24255
664 Ga0268264_10005153 3300028381 Bacteria 11076
665 Ga0268264_10006783 3300028381 Bacteria 9618
666 Ga0268264_10263600 3300028381 Bacteria 1606
667 Ga0268264_10501721 3300028381 Bacteria 1184
668 Ga0268264_11115163 3300028381 Bacteria 798
669 Ga0265318_10281431 3300028577 Bacteria 607
670 Ga0307517_10032795 3300028786 Bacteria 5989
671 Ga0307515_10002885 3300028794 Bacteria 36551
672 Ga0307515_10544729 3300028794 Bacteria 770
673 Ga0265338_10041348 3300028800 Bacteria 4312
674 Ga0316176_1100255 3300030732 Bacteria 697
675 Ga0314311_1148511 3300030733 Bacteria 919
676 Ga0314311_1234607 3300030733 Bacteria 1075
677 Ga0316181_1135234 3300030744 Bacteria 747
678 Ga0316182_1060881 3300030745 Bacteria 580
679 Ga0316182_1148393 3300030745 Bacteria 860
680 Ga0265760_10112912 3300031090 Bacteria 867
681 Ga0265330_10031999 3300031235 Bacteria 2358
682 Ga0265325_10114964 3300031241 Bacteria 1303
683 Ga0265331_10073322 3300031250 Bacteria 1599
684 Ga0265316_10151330 3300031344 Bacteria 1738
685 Ga0307513_10010088 3300031456 Bacteria 11892
686 Ga0307408_100478820 3300031548 Bacteria 1085
687 Ga0307408_101285422 3300031548 Bacteria 685
688 Ga0307408_101799182 3300031548 Bacteria 585
689 Ga0307408_102182809 3300031548 Bacteria 535
690 Ga0316575_10257840 3300031665 Bacteria 732
691 Ga0316579_10004122 3300031691 Bacteria 5743
692 Ga0316576_10023190 3300031727 Bacteria 4319
693 Ga0316576_10724450 3300031727 Bacteria 720
694 Ga0316576_11179694 3300031727 Bacteria 541
695 Ga0307405_10079995 3300031731 Bacteria 2132
696 Ga0307405_10242229 3300031731 Bacteria 1336
697 Ga0307405_10402989 3300031731 Bacteria 1071
698 Ga0307405_10662999 3300031731 Bacteria 859
699 Ga0307405_10674720 3300031731 Bacteria 853
700 Ga0307405_10789461 3300031731 Bacteria 794
701 Ga0307405_10874348 3300031731 Bacteria 758
702 Ga0307413_10229429 3300031824 Bacteria 1362
703 Ga0307413_10281774 3300031824 Bacteria 1250
704 Ga0307413_10630335 3300031824 Bacteria 881
705 Ga0307413_10640145 3300031824 Bacteria 875
706 Ga0307413_10774038 3300031824 Bacteria 804
707 Ga0307413_11651359 3300031824 Bacteria 570
708 Ga0307410_10637498 3300031852 Bacteria 892
709 Ga0307410_10948085 3300031852 Bacteria 739
710 Ga0307410_11301693 3300031852 Bacteria 636
711 Ga0307406_10276975 3300031901 Bacteria 1277
712 Ga0307406_10647690 3300031901 Bacteria 876
713 Ga0307406_10725491 3300031901 Bacteria 832
714 Ga0307406_10746523 3300031901 Bacteria 821
715 Ga0307406_10943146 3300031901 Bacteria 737
716 Ga0307406_11232056 3300031901 Bacteria 651
717 Ga0307406_11365044 3300031901 Bacteria 620
718 Ga0307407_10040629 3300031903 Bacteria 2595
719 Ga0307407_10159039 3300031903 Bacteria 1476
720 Ga0307407_11082644 3300031903 Bacteria 622
721 Ga0307407_11194044 3300031903 Bacteria 594
722 Ga0307412_10010127 3300031911 Bacteria 5422
723 Ga0307412_10020188 3300031911 Bacteria 4051
724 Ga0307412_10088761 3300031911 Bacteria 2158
725 Ga0307412_10168075 3300031911 Bacteria 1637
726 Ga0307412_10225103 3300031911 Bacteria 1440
727 Ga0307412_10264932 3300031911 Bacteria 1342
728 Ga0307412_10655875 3300031911 Bacteria 895
729 Ga0307412_10797808 3300031911 Bacteria 819
730 Ga0307412_10872636 3300031911 Bacteria 786
731 Ga0307412_11036908 3300031911 Bacteria 727
732 Ga0307412_11072137 3300031911 Bacteria 715
733 Ga0307412_12078026 3300031911 Bacteria 527
734 Ga0307409_100122294 3300031995 Bacteria 2207
735 Ga0307409_100405053 3300031995 Bacteria 1304
736 Ga0307409_100580029 3300031995 Bacteria 1105
737 Ga0307409_100713214 3300031995 Bacteria 1003
738 Ga0307409_100778273 3300031995 Bacteria 963
739 Ga0307409_100830586 3300031995 Bacteria 933
740 Ga0307409_102652186 3300031995 Bacteria 529
741 Ga0307409_102713475 3300031995 Bacteria 523
742 Ga0307416_100066176 3300032002 Bacteria 2974
743 Ga0307416_100213452 3300032002 Bacteria 1843
744 Ga0307416_100399071 3300032002 Bacteria 1412
745 Ga0307416_100469867 3300032002 Bacteria 1315
746 Ga0307416_100981045 3300032002 Bacteria 947
747 Ga0307416_101196369 3300032002 Bacteria 865
748 Ga0307416_102475077 3300032002 Bacteria 618
749 Ga0307416_102860286 3300032002 Bacteria 577
750 Ga0307414_10065371 3300032004 Bacteria 2594
751 Ga0307414_10070136 3300032004 Bacteria 2522
752 Ga0307414_10082088 3300032004 Bacteria 2362
753 Ga0307414_10121242 3300032004 Bacteria 2010
754 Ga0307414_10150384 3300032004 Bacteria 1836
755 Ga0307414_10293449 3300032004 Bacteria 1372
756 Ga0307414_10484627 3300032004 Bacteria 1091
757 Ga0307414_10492531 3300032004 Bacteria 1083
758 Ga0307414_10572278 3300032004 Bacteria 1009
759 Ga0307414_10785350 3300032004 Bacteria 867
760 Ga0307414_10972663 3300032004 Bacteria 780
761 Ga0307414_11456459 3300032004 Bacteria 637
762 Ga0307414_11458569 3300032004 Bacteria 636
763 Ga0307411_10048142 3300032005 Bacteria 2761
764 Ga0307411_10322920 3300032005 Bacteria 1247
765 Ga0307411_10856289 3300032005 Bacteria 804
766 Ga0307411_12046010 3300032005 Bacteria 535
767 Ga0307411_12108890 3300032005 Bacteria 527
768 Ga0307415_100188175 3300032126 Bacteria 1626
769 Ga0307415_100241924 3300032126 Bacteria 1460
770 Ga0307415_100576145 3300032126 Bacteria 997
771 Ga0307510_10041740 3300033180 Bacteria 5010
772 Ga0307510_10246300 3300033180 Bacteria 1278
773 Ga0316588_1101767 3300033528 Unclassified 720
774 Ga0373934_0011200 3300035086 Bacteria 3376
775 Ga0373934_0020309 3300035086 Bacteria 2552
776 Ga0373952_0086873 3300035092 Bacteria 807
777 Ga0373923_0120678 3300035111 Bacteria 1171
778 Ga0373954_0000013 3300035118 Bacteria 73606
779 Ga0373955_0119305 3300035172 Bacteria 1532
780 Ga0373961_0008207 3300035241 Bacteria 2538
781 Ga0373961_0139179 3300035241 Bacteria 819
782 Ga0316574_0015732 3300035398 Bacteria 4392
783 Ga0316574_0026931 3300035398 Bacteria 3460
784 Ga0316574_0049538 3300035398 Bacteria 2612
785 Ga0316574_0365320 3300035398 Bacteria 912
786 Ga0373924_0035457 3300035410 Bacteria 2023
787 Ga0373933_0008247 3300035724 Bacteria 5685
788 Ga0373937_0000568 3300036401 Bacteria 32759
789 Ga0316582_0008050 3300036647 Bacteria 5639
790 Ga0395899_0001486 3300037312 Bacteria 19952
791 Ga0395899_0175118 3300037312 Bacteria 1509
792 Ga0395900_0079824 3300037418 Bacteria 3362
793 Ga0395905_0496689 3300037471 Bacteria 1120
794 Ga0395905_0708103 3300037471 Bacteria 909
795 Ga0316581_0266312 3300037588 Bacteria 526
796 Ga0436364_1232957 3300037853 Bacteria 3551
797 Ga0395901_0135462 3300038443 Bacteria 2589
798 Ga0436365_0875957 3300039437 Bacteria 766
799 Ga0436365_1049735 3300039437 Bacteria 987
800 Ga0436363_1338713 3300039450 Bacteria 944
801 Ga0439436_0167408 3300041404 Bacteria 623
802 Ga0439439_0030580 3300041406 Bacteria 1369
803 Ga0439447_030078 3300041407 Bacteria 1371
804 Ga0439453_0001227 3300041408 Bacteria 3238
805 Ga0439461_0000086 3300041410 Bacteria 12130
806 Ga0439461_0100584 3300041410 Bacteria 703
807 Ga0439466_0038559 3300041411 Bacteria 1605
808 Ga0439465_0001125 3300041413 Bacteria 8568
809 Ga0439465_0010998 3300041413 Bacteria 2837
810 Ga0451788_13712 3300041442 Bacteria 565
811 Ga0451791_0887440 3300041451 Bacteria 742
812 Ga0451793_0892181 3300041452 Bacteria 768
813 Ga0451797_0437635 3300041453 Bacteria 684
814 Ga0451801_37066 3300041455 Bacteria 508
815 Ga0451802_1631382 3300041460 Bacteria 803
816 Ga0451833_0536339 3300041491 Bacteria 1373
817 Ga0451833_0710986 3300041491 Unclassified 640
818 Ga0451835_0060857 3300041492 Bacteria 664
819 Ga0451841_0833099 3300041498 Bacteria 995
820 Ga0451841_1278623 3300041498 Bacteria 542
821 Ga0451845_0715186 3300041501 Bacteria 722
822 Ga0451846_03630 3300041502 Bacteria 631
823 Ga0451851_0162624 3300041507 Bacteria 524
824 Ga0451853_2850232 3300041512 Bacteria 1025
825 Ga0439431_0000491 3300041997 Bacteria 8366
826 Ga0439431_0196553 3300041997 Bacteria 586
827 Ga0439431_0211085 3300041997 Bacteria 568
828 Ga0439441_097568 3300042001 Bacteria 656
829 Ga0439442_009847 3300042002 Bacteria 1933
830 Ga0439445_0000271 3300042004 Bacteria 10008
831 Ga0439445_0000898 3300042004 Bacteria 6309
832 Ga0439445_0022188 3300042004 Bacteria 1599
833 Ga0439448_0007732 3300042005 Bacteria 3122
834 Ga0439432_001270 3300042006 Bacteria 9547
835 Ga0439452_015389 3300042010 Bacteria 2100
836 Ga0439455_0200052 3300042012 Bacteria 578
837 Ga0439457_014255 3300042014 Bacteria 1780
838 Ga0439462_0003457 3300042015 Bacteria 3790
839 Ga0450923_062085 3300042125 Bacteria 817
840 Ga0450906_016697 3300042145 Bacteria 1327
841 Ga0450910_088011 3300042147 Bacteria 548
842 Ga0439446_0015960 3300042156 Bacteria 2088
843 Ga0439446_0071753 3300042156 Bacteria 1060
844 Ga0439434_0001316 3300042435 Bacteria 7154
845 Ga0439434_0258754 3300042435 Bacteria 596
846 Ga0439434_0365909 3300042435 Bacteria 505
847 Ga0439460_0285315 3300042461 Bacteria 575
848 Ga0439460_0309249 3300042461 Bacteria 553
849 Ga0466965_0190472 3300044683 Bacteria 1085
850 Ga0466966_0642050 3300044684 Bacteria 639
851 Ga0466961_0511827 3300044693 Bacteria 724
852 Ga0466963_0202490 3300044694 Bacteria 1388
853 Ga0466971_0011267 3300044719 Bacteria 3917
854 Ga0466957_0129471 3300044842 Bacteria 1615
855 Ga0466958_0058924 3300045836 Bacteria 2335
856 Ga0466967_0088373 3300045976 Bacteria 2812
857 Ga0495627_024430 3300046453 Bacteria 1970
858 Ga0495629_0409358 3300046459 Bacteria 921
859 Ga0495638_0006816 3300046460 Bacteria 8247
860 Ga0495650_0000158 3300046471 Bacteria 154681
861 Ga0495662_0629714 3300046476 Bacteria 524
862 Ga0495584_0653790 3300046491 Bacteria 536
863 Ga0495585_0007224 3300046492 Bacteria 6825
864 Ga0495596_0001722 3300046500 Bacteria 12303
865 Ga0495596_0288891 3300046500 Bacteria 637
866 Ga0495607_0233928 3300046501 Bacteria 892
867 Ga0495583_0000139 3300046506 Bacteria 123464
868 Ga0495583_0000631 3300046506 Bacteria 46958
869 Ga0495583_0049835 3300046506 Bacteria 1915
870 Ga0495583_0138928 3300046506 Bacteria 1013
871 Ga0495606_0000672 3300046507 Bacteria 53500
872 Ga0495606_0097843 3300046507 Bacteria 1792
873 Ga0495610_0001956 3300046512 Bacteria 17724
874 Ga0495610_0102024 3300046512 Bacteria 1284
875 Ga0495610_0167798 3300046512 Bacteria 923
876 Ga0495610_0241972 3300046512 Bacteria 719
877 Ga0495616_0035449 3300046513 Bacteria 2582
878 Ga0495618_0666693 3300046514 Bacteria 614
879 Ga0495620_0074993 3300046515 Bacteria 1377
880 Ga0495620_0310170 3300046515 Bacteria 599
881 Ga0495631_0274197 3300046518 Bacteria 718
882 Ga0495637_0013506 3300046520 Bacteria 3873
883 Ga0495643_0042779 3300046522 Bacteria 2467
884 Ga0495643_0058229 3300046522 Bacteria 2056
885 Ga0495643_0419710 3300046522 Bacteria 587
886 Ga0495644_0189750 3300046523 Bacteria 791
887 Ga0495648_0000143 3300046524 Bacteria 85539
888 Ga0495663_0004724 3300046525 Bacteria 3812
889 Ga0495663_0004868 3300046525 Bacteria 3752
890 Ga0495663_0074411 3300046525 Bacteria 1086
891 Ga0495642_0008825 3300046528 Bacteria 3855
892 Ga0495642_0027044 3300046528 Bacteria 2281
893 Ga0495586_0070475 3300046535 Bacteria 1909
894 Ga0495587_0027072 3300046536 Bacteria 3492
895 Ga0495587_0275897 3300046536 Bacteria 943
896 Ga0495598_0074808 3300046537 Bacteria 1074
897 Ga0495609_0096737 3300046538 Bacteria 1281
898 Ga0495621_0027893 3300046539 Bacteria 1915
899 Ga0495622_0007935 3300046557 Bacteria 4920
900 Ga0495633_0002517 3300046558 Bacteria 12889
901 Ga0495633_0077644 3300046558 Bacteria 1546
902 Ga0495633_0126517 3300046558 Bacteria 1182
903 Ga0495656_0332712 3300046615 Bacteria 784
904 Ga0495668_0000016 3300046616 Bacteria 438197
905 Ga0495625_0000150 3300046660 Bacteria 106314
906 Ga0495625_0388205 3300046660 Bacteria 874
907 Ga0495659_0030064 3300046664 Bacteria 1888
908 Ga0495659_0493366 3300046664 Bacteria 536
909 Ga0495661_0094901 3300046665 Bacteria 1690
910 Ga0495661_0261427 3300046665 Bacteria 879
911 Ga0495661_0358626 3300046665 Bacteria 716
912 Ga0495657_0161972 3300046675 Bacteria 1384
913 Ga0495658_0610658 3300046683 Bacteria 699
914 Ga0495669_0000050 3300046684 Bacteria 80688
915 Ga0495669_0015265 3300046684 Bacteria 3289
916 Ga0495670_0005678 3300046691 Bacteria 6117
917 Ga0495670_0134108 3300046691 Bacteria 1292
918 Ga0495671_0273798 3300046692 Bacteria 814
919 Ga0495649_0055299 3300046694 Bacteria 2145
920 Ga0495649_0146871 3300046694 Bacteria 1239
921 Ga0495589_0426484 3300046794 Bacteria 608
922 Ga0495600_0000690 3300046809 Bacteria 17650
923 Ga0495660_0019031 3300046810 Bacteria 3943
924 Ga0495604_0375413 3300047317 Bacteria 940
925 Ga0495672_0258162 3300047320 Bacteria 842
926 Ga0495687_000098 3300047443 Bacteria 132403
927 Ga0495687_000455 3300047443 Bacteria 50452
928 Ga0495687_026151 3300047443 Bacteria 2752
929 Ga0495687_082012 3300047443 Bacteria 1260
930 Ga0495677_0023015 3300047445 Bacteria 2261
931 Ga0495677_0174372 3300047445 Bacteria 832
932 Ga0495685_067989 3300047447 Bacteria 1196
933 Ga0495673_0175421 3300047469 Bacteria 814
934 Ga0495681_0043708 3300047470 Bacteria 2158
935 Ga0495681_0171859 3300047470 Bacteria 896
936 Ga0495686_0619169 3300047472 Bacteria 559
937 Ga0495615_0000060 3300048090 Bacteria 34266
938 Ga0495626_0000877 3300048091 Bacteria 26762
939 Ga0495626_0287230 3300048091 Bacteria 652
940 Ga0496100_0000980 3300048903 Bacteria 13723
941 Ga0496100_0011451 3300048903 Bacteria 5049
942 Ga0496100_0105517 3300048903 Bacteria 1949
943 Ga0496101_0008286 3300048904 Bacteria 6791
944 Ga0496101_0077643 3300048904 Bacteria 2447
945 Ga0496101_0381119 3300048904 Bacteria 1109
946 Ga0496101_0392392 3300048904 Bacteria 1093
947 Ga0496101_0851214 3300048904 Bacteria 718
948 Ga0496102_0000199 3300048905 Bacteria 81435
949 Ga0496102_0001054 3300048905 Bacteria 25520
950 Ga0496102_0058238 3300048905 Bacteria 3530
951 Ga0496102_0060341 3300048905 Bacteria 3468
952 Ga0496102_0790010 3300048905 Bacteria 872
953 Ga0496103_0000289 3300048906 Bacteria 47033
954 Ga0496103_0000633 3300048906 Bacteria 26944
955 Ga0496103_0004432 3300048906 Bacteria 8517
956 Ga0496103_0062475 3300048906 Bacteria 2318
957 Ga0496103_0087293 3300048906 Bacteria 1966
958 Ga0496103_0252642 3300048906 Bacteria 1134
959 Ga0496104_0000474 3300048907 Bacteria 34558
960 Ga0496104_0045338 3300048907 Bacteria 4134
961 Ga0496104_0136930 3300048907 Bacteria 2353
962 Ga0496104_0249205 3300048907 Bacteria 1689
963 Ga0496104_0284172 3300048907 Bacteria 1567
964 Ga0496104_0619960 3300048907 Bacteria 991
965 Ga0496105_0000690 3300048908 Bacteria 22731
966 Ga0496105_0124885 3300048908 Bacteria 2121
967 Ga0496105_0158470 3300048908 Bacteria 1858
968 Ga0496106_0008825 3300048909 Bacteria 7450
969 Ga0496106_0008866 3300048909 Bacteria 7435
970 Ga0496107_0014228 3300048910 Bacteria 5571
971 Ga0496107_0023026 3300048910 Bacteria 4404
972 Ga0496107_0066908 3300048910 Bacteria 2605
973 Ga0496107_0233824 3300048910 Bacteria 1367
974 Ga0496108_0277684 3300048911 Bacteria 1458
975 Ga0496109_0182656 3300048912 Bacteria 1970
976 Ga0496109_0194861 3300048912 Bacteria 1904
977 Ga0496109_0357358 3300048912 Bacteria 1380
978 Ga0496110_0025670 3300048913 Bacteria 5038
979 Ga0496110_0067902 3300048913 Bacteria 3155
980 Ga0496110_0121287 3300048913 Bacteria 2355
981 Ga0496110_0835615 3300048913 Bacteria 826
982 Ga0496111_0033303 3300048914 Bacteria 3674
983 Ga0496111_0082756 3300048914 Bacteria 2344
984 Ga0496111_0156088 3300048914 Bacteria 1693
985 Ga0496111_0373799 3300048914 Bacteria 1054
986 Ga0496112_0014681 3300048915 Bacteria 7280
987 Ga0496112_0100877 3300048915 Bacteria 2856
988 Ga0496112_0120643 3300048915 Bacteria 2592
989 Ga0496112_0368823 3300048915 Bacteria 1377
990 Ga0496112_0879669 3300048915 Bacteria 818
991 Ga0496113_0004277 3300048916 Bacteria 8751
992 Ga0496113_0015458 3300048916 Bacteria 5246
993 Ga0496113_0057153 3300048916 Bacteria 2931
994 Ga0496113_0194089 3300048916 Bacteria 1612
995 Ga0496113_0661150 3300048916 Bacteria 835
996 Ga0496113_1579017 3300048916 Bacteria 505
997 Ga0496114_0007726 3300048917 Bacteria 8507
998 Ga0496114_0287877 3300048917 Bacteria 1449
999 Ga0496114_0296042 3300048917 Bacteria 1428
1000 Ga0496114_0604954 3300048917 Bacteria 966
1001 Ga0496115_0000131 3300048918 Bacteria 68111
1002 Ga0496115_0000483 3300048918 Bacteria 31557
1003 Ga0496115_0119296 3300048918 Bacteria 2170
1004 Ga0496115_0399087 3300048918 Bacteria 1116
1005 Ga0496115_0541523 3300048918 Bacteria 931
1006 Ga0496116_0000045 3300048919 Bacteria 324307
1007 Ga0496116_0017932 3300048919 Bacteria 5474
1008 Ga0496116_0029227 3300048919 Bacteria 3977
1009 Ga0496116_0121950 3300048919 Bacteria 1506
1010 Ga0496117_0000352 3300048920 Bacteria 81089
1011 Ga0496117_0004523 3300048920 Bacteria 15262
1012 Ga0496117_0066974 3300048920 Bacteria 2433
1013 Ga0496117_0079061 3300048920 Bacteria 2168
1014 Ga0496117_0120301 3300048920 Bacteria 1615
1015 Ga0496117_0221919 3300048920 Bacteria 1051
1016 Ga0496117_0568574 3300048920 Bacteria 536
1017 Ga0496118_0000092 3300048921 Bacteria 169106
1018 Ga0496118_0004825 3300048921 Bacteria 15724
1019 Ga0496118_0020152 3300048921 Bacteria 5926
1020 Ga0496118_0021880 3300048921 Bacteria 5609
1021 Ga0496118_0051033 3300048921 Bacteria 3168
1022 Ga0496118_0196012 3300048921 Bacteria 1202
1023 Ga0496119_0004697 3300048922 Bacteria 13438
1024 Ga0496119_0009738 3300048922 Bacteria 8181
1025 Ga0496119_0038098 3300048922 Bacteria 3112
1026 Ga0496119_0169489 3300048922 Bacteria 1154
1027 Ga0496120_0007424 3300048923 Bacteria 8153
1028 Ga0496120_0024506 3300048923 Bacteria 3762
1029 Ga0496120_0119204 3300048923 Bacteria 1367
1030 Ga0496120_0257527 3300048923 Bacteria 816
1031 Ga0496120_0376859 3300048923 Bacteria 632
1032 Ga0496121_0000228 3300048924 Bacteria 120653
1033 Ga0496121_0001923 3300048924 Bacteria 33167
1034 Ga0496121_0007837 3300048924 Bacteria 12771
1035 Ga0496121_0057301 3300048924 Bacteria 3230
1036 Ga0496121_0228962 3300048924 Bacteria 1303
1037 Ga0496122_0009937 3300048925 Bacteria 9911
1038 Ga0496122_0020908 3300048925 Bacteria 5884
1039 Ga0496122_0033342 3300048925 Bacteria 4237
1040 Ga0496122_0068094 3300048925 Bacteria 2558
1041 Ga0496122_0107366 3300048925 Bacteria 1845
1042 Ga0496123_0000785 3300048926 Bacteria 51254
1043 Ga0496123_0001112 3300048926 Bacteria 40286
1044 Ga0496123_0033385 3300048926 Bacteria 3705
1045 Ga0496123_0041482 3300048926 Bacteria 3189
1046 Ga0496124_0000081 3300048927 Bacteria 208413
1047 Ga0496124_0005380 3300048927 Bacteria 14456
1048 Ga0496124_0053225 3300048927 Bacteria 3433
1049 Ga0496124_0273659 3300048927 Bacteria 1235
1050 Ga0496124_0402011 3300048927 Bacteria 950
1051 Ga0496124_0487541 3300048927 Bacteria 830
1052 Ga0496125_0000980 3300048928 Bacteria 44624
1053 Ga0496125_0003170 3300048928 Bacteria 20385
1054 Ga0496125_0062486 3300048928 Bacteria 2977
1055 Ga0496125_0087157 3300048928 Bacteria 2359
1056 Ga0496125_0205965 3300048928 Bacteria 1282
1057 Ga0496125_0242116 3300048928 Bacteria 1144
1058 Ga0496126_0000283 3300048929 Bacteria 107129
1059 Ga0496126_0000802 3300048929 Bacteria 56265
1060 Ga0496126_0001266 3300048929 Bacteria 40672
1061 Ga0496126_0041891 3300048929 Bacteria 4233
1062 Ga0496126_0625867 3300048929 Bacteria 845
1063 Ga0496126_1082057 3300048929 Bacteria 597
1064 Ga0501306_023694 3300049127 Bacteria 873
1065 Ga0501309_024779 3300049129 Bacteria 859
1066 Ga0501309_026442 3300049129 Bacteria 838
1067 Ga0501310_017093 3300049130 Bacteria 875
1068 Ga0501307_061030 3300049162 Bacteria 585
1069 Ga0495682_0061278 3300049460 Bacteria 1358
1070 Ga0495682_0098625 3300049460 Bacteria 1048
1071 Ga0501311_013777 3300049527 Bacteria 1025
1072 Ga0501313_017138 3300049529 Bacteria 874
1073 Ga0501313_018621 3300049529 Bacteria 844
1074 Ga0501314_026384 3300049530 Bacteria 629
1075 Ga0501314_042408 3300049530 Bacteria 533
1076 Ga0501315_020960 3300049531 Bacteria 881
1077 Ga0501315_105878 3300049531 Bacteria 501
1078 Ga0501316_020284 3300049532 Bacteria 833
1079 Ga0501317_079426 3300049533 Bacteria 565
1080 Ga0501320_017114 3300049536 Bacteria 808
1081 Ga0501320_022178 3300049536 Bacteria 743
1082 Ga0501321_029872 3300049537 Bacteria 723
1083 Ga0501322_005374 3300049538 Bacteria 887
1084 Ga0501323_069045 3300049539 Bacteria 563
1085 Ga0501324_042584 3300049540 Bacteria 522
1086 Ga0501325_009145 3300049541 Bacteria 874
1087 Ga0501325_028935 3300049541 Bacteria 625
1088 Ga0501335_012565 3300049551 Bacteria 838
1089 Ga0501335_034641 3300049551 Bacteria 580
1090 Ga0501031_0662317 3300049568 Bacteria 671
1091 Ga0501034_1040756 3300049571 Bacteria 701
1092 Ga0501034_1588619 3300049571 Bacteria 527
1093 Ga0501036_0103495 3300049572 Bacteria 2408
1094 Ga0501036_0297146 3300049572 Bacteria 1351
1095 Ga0501038_0398038 3300049574 Bacteria 1066
1096 Ga0501039_0224459 3300049575 Bacteria 1477
1097 Ga0501039_0758499 3300049575 Bacteria 758
1098 Ga0501040_0081187 3300049576 Bacteria 2247
1099 Ga0501040_0453851 3300049576 Bacteria 923
1100 Ga0501040_0887974 3300049576 Bacteria 646
1101 Ga0501041_0208506 3300049577 Bacteria 1226
1102 Ga0501041_0240171 3300049577 Bacteria 1138
1103 Ga0501042_0139913 3300049578 Bacteria 1745
1104 Ga0501043_0031566 3300049579 Bacteria 4164
1105 Ga0501046_0259051 3300049580 Bacteria 1278
1106 Ga0501046_0787017 3300049580 Bacteria 667
1107 Ga0501047_0003524 3300049581 Bacteria 14774
1108 Ga0501047_1428378 3300049581 Bacteria 507
1109 Ga0501048_1075243 3300049582 Bacteria 579
1110 Ga0501048_1142579 3300049582 Bacteria 560
1111 Ga0501068_0527564 3300049584 Bacteria 767
1112 Ga0501070_1405341 3300049586 Bacteria 530
1113 Ga0501071_0616366 3300049587 Bacteria 834
1114 Ga0501071_0669833 3300049587 Bacteria 799
1115 Ga0501072_0304092 3300049588 Bacteria 1268
1116 Ga0501072_0462932 3300049588 Bacteria 1004
1117 Ga0501072_1347058 3300049588 Bacteria 553
1118 Ga0501073_0614491 3300049589 Bacteria 750
1119 Ga0501075_0201896 3300049591 Bacteria 1516
1120 Ga0501076_0430969 3300049592 Bacteria 1085
1121 Ga0501076_0579764 3300049592 Bacteria 925
1122 Ga0501077_0672342 3300049593 Bacteria 665
1123 Ga0501233_127262 3300049668 Bacteria 693
1124 Ga0501242_037278 3300049674 Bacteria 677
1125 Ga0501243_103110 3300049675 Bacteria 578
1126 Ga0501250_072046 3300049680 Bacteria 573
1127 Ga0501245_099636 3300049708 Bacteria 587
1128 Ga0501079_0173420 3300049741 Bacteria 1682
1129 Ga0501081_1121903 3300049743 Bacteria 595
1130 Ga0501083_0559352 3300049744 Bacteria 744
1131 Ga0501241_082930 3300049758 Bacteria 669
1132 Ga0501268_046505 3300049765 Bacteria 830
1133 Ga0501273_051053 3300049770 Bacteria 633
1134 Ga0501035_1467660 3300049822 Bacteria 521
1135 Ga0501045_0045082 3300049824 Bacteria 3211
1136 nmdc:mga03683_284554_c1 3300050489 Bacteria 773
1137 nmdc:mga03683_9705_c1 3300050489 Bacteria 3433
1138 nmdc:mga03n38_272530_c1 3300050490 Bacteria 901
1139 nmdc:mga03n38_401807_c1 3300050490 Bacteria 754
1140 nmdc:mga03n38_52666_c1 3300050490 Bacteria 1823
1141 nmdc:mga03n38_766621_c1 3300050490 Bacteria 560
1142 nmdc:mga00v17_1556_c1 3300050491 Bacteria 11982
1143 nmdc:mga00v17_231124_c1 3300050491 Bacteria 1198
1144 nmdc:mga00v17_240296_c1 3300050491 Bacteria 1174
1145 nmdc:mga0yw44_704623_c1 3300050492 Bacteria 686
1146 nmdc:mga0yw44_95654_c1 3300050492 Bacteria 1885
1147 nmdc:mga0k408_17456_c1 3300050493 Bacteria 3999
1148 nmdc:mga0k408_484044_c1 3300050493 Bacteria 734
1149 nmdc:mga06z11_893064_c1 3300050494 Bacteria 541
1150 nmdc:mga06z11_904_c1 3300050494 Bacteria 10791
1151 nmdc:mga04h51_172_c1 3300050495 Bacteria 18653
1152 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
1153 nmdc:mga07m45_186261_c1 3300050496 Bacteria 1207
1154 nmdc:mga07m45_721857_c1 3300050496 Bacteria 573
1155 nmdc:mga05p37_344142_c1 3300050507 Bacteria 1757
1156 nmdc:mga05p37_466232_c1 3300050507 Bacteria 1458
1157 nmdc:mga05p37_538169_c1 3300050507 Bacteria 1332
1158 nmdc:mga09592_1047268_c1 3300050508 Bacteria 680
1159 nmdc:mga09592_816473_c1 3300050508 Unclassified 788
1160 nmdc:mga0qj67_541144_c1 3300050509 Bacteria 934
1161 nmdc:mga06r32_415204_c1 3300050510 Bacteria 1327
1162 nmdc:mga08y16_1119983_c1 3300050511 Bacteria 761
1163 nmdc:mga08y16_209471_c1 3300050511 Unclassified 2019
1164 nmdc:mga08y16_238311_c1 3300050511 Bacteria 1881
1165 nmdc:mga08y16_640169_c1 3300050511 Bacteria 1068
1166 nmdc:mga0n895_666212_c1 3300050512 Unclassified 1038
1167 nmdc:mga0sz30_13412_c1 3300050516 Bacteria 3209
1168 nmdc:mga0sz30_263955_c1 3300050516 Bacteria 767
1169 nmdc:mga0sz30_32949_c1 3300050516 Bacteria 2151
1170 nmdc:mga0sz30_36777_c1 3300050516 Bacteria 1111
1171 nmdc:mga0sz30_62919_c1 3300050516 Bacteria 1588
1172 nmdc:mga0sz30_90873_c2 3300050516 Bacteria 505
1173 Ga0500610_0003391 3300053079 Bacteria 6102
1174 Ga0500643_047079 3300053087 Bacteria 1244
1175 Ga0500643_126527 3300053087 Bacteria 688
1176 Ga0500647_0118147 3300053091 Bacteria 1256
1177 Ga0500566_0001151 3300053094 Bacteria 15363
1178 Ga0500641_0002644 3300053096 Bacteria 6325
1179 Ga0500648_219243 3300053097 Bacteria 934
1180 Ga0500650_0260426 3300053098 Bacteria 776
1181 Ga0500650_0263044 3300053098 Bacteria 771
1182 Ga0500555_000016 3300053103 Bacteria 203144
1183 Ga0500555_018781 3300053103 Bacteria 1992
1184 Ga0500555_087752 3300053103 Bacteria 802
1185 Ga0500562_098244 3300053108 Bacteria 797
1186 Ga0500595_001620 3300053119 Bacteria 11857
1187 Ga0500595_012595 3300053119 Bacteria 3265
1188 Ga0500607_001731 3300053121 Bacteria 18963
1189 Ga0500607_211989 3300053121 Bacteria 818
1190 Ga0500642_0000580 3300053130 Bacteria 11005
1191 Ga0500658_0000538 3300053134 Bacteria 15973
1192 Ga0500559_0284725 3300053136 Bacteria 777
1193 Ga0500568_0133288 3300053139 Bacteria 923
1194 Ga0500588_0135525 3300053146 Bacteria 880
1195 Ga0500588_0180947 3300053146 Bacteria 775
1196 Ga0500600_0428177 3300053149 Bacteria 515
1197 Ga0500604_0075893 3300053151 Bacteria 1079
1198 Ga0500624_012592 3300053157 Bacteria 1253
1199 Ga0500627_0487192 3300053158 Bacteria 515
1200 Ga0500636_0004289 3300053177 Bacteria 8076
1201 Ga0500611_106687 3300053727 Bacteria 732
1202 Ga0500611_199905 3300053727 Bacteria 566
1203 Ga0500645_000002 3300053730 Bacteria 388892
1204 Ga0500645_081482 3300053730 Bacteria 923
1205 Ga0500645_223737 3300053730 Bacteria 503
1206 Ga0500596_015335 3300053735 Bacteria 1151
1207 Ga0501084_0351017 3300054114 Bacteria 1246
1208 Ga0501084_0478375 3300054114 Bacteria 1053
1209 Ga0501084_1378503 3300054114 Bacteria 591
1210 Ga0500661_096813 3300055283 Bacteria 557
1211 Ga0590077_114602 3300059426 Bacteria 635
1212 Ga0587077_236397 3300059493 Bacteria 522
1213 Ga0587094_076285 3300059513 Bacteria 613
1214 Ga0587106_111050 3300059605 Bacteria 571
1215 Ga0587072_113682 3300059643 Bacteria 620
1216 Ga0587078_050361 3300059646 Bacteria 609
1217 Ga0587102_032719 3300059649 Bacteria 642
1218 Ga0587110_059526 3300059654 Bacteria 526
1219 Ga0587111_0106248 3300060346 Bacteria 706
1220 Ga0466962_0013182 3300061719 Bacteria 3976
1221 Ga0530510_1083781 3300061734 Bacteria 614
1222 2545672525 2545555834 Bacteria 8130841
1223 2566037845 2565956521 Bacteria 4468993
1224 2585261873 2582581305 Bacteria 4895574
1225 2643948666 2643221588 Bacteria 3692460
1226 2644127187 2643221622 Bacteria 4212502
1227 2644746027 2643221736 Bacteria 6608466
1228 2738711253 2738541275 Bacteria 4830863
1229 2738849678 2738541301 Bacteria 4834102
1230 2738865407 2738541304 Bacteria 4833665
1231 2739297925 2738543022 Bacteria 4835059
1232 2739359603 2738543033 Bacteria 4833336
1233 2739649214 2739367664 Bacteria 4114334
1234 2740027687 2739367865 Bacteria 4114482
1235 2753767322 2751185897 Bacteria 5322941
1236 2819551367 2818991438 Bacteria 5793701
1237 2842699849 2842698319 Bacteria 5190321
1238 2879166515 2879163058 Bacteria 4223965
1239 2884298765 2884298095 Bacteria 3823049
1240 2885430174 2885429604 Bacteria 3642894
1241 2896429422 2896429255 Bacteria 2557483
1242 2909044485 2909042592 Bacteria 6499737
1243 2919452573 2919450847 Bacteria 5631160
1244 2919499272 2919497567 Bacteria 4408621
1245 2919689417 2919688452 Bacteria 4595932
1246 2928961459 2928959182 Bacteria 4725774
1247 3003672560 3003665799 Bacteria 7279786
1248 641644355 641522639 Bacteria 7737025
1249 8054305365 8054302542 Bacteria 5698134
1250 Ga0058861_12019322
1251 SwRhRL2b_contig_3919511
1252 SwRhRL2b_contig_520222
1253 ARcpr5yngRDRAFT_c002624
1254 ARCol0yngRDRAFT_1001217
1255 ARCol0yngRDRAFT_1017172
1256 JGI24746J21847_1001905
1257 JGI24740J21852_10025198
1258 JGI24740J21852_10042732
1259 JGI24739J22299_10006425
1260 JGI24739J22299_10200045
1261 JGI24737J22298_10026070
1262 JGI24735J21928_10042720
1263 JGI24735J21928_10133842
1264 JGI24748J21848_1008124
1265 JGI24749J21850_1001036
1266 JGI24744J21845_10012571
1267 JGI24744J21845_10021627
1268 JGI24033J26618_1017319
1269 JGI24034J26672_10013892
1270 JGI24034J26672_10027937
1271 JGI24034J26672_10092567
1272 JGI24742J22300_10013146
1273 JGI24742J22300_10071167
1274 JGI24751J29686_10038094
1275 JGI25150J39212_1000233
1276 JGI25150J39212_1025895
1277 JGI25151J46595_10016142
1278 JGI25165J46597_1000100
1279 JGI25153J46596_10000005
1280 JGI25153J46596_10000460
1281 JGI25153J46596_10003205
1282 Ga0006777J48905_1037455
1283 Ga0007417J51691_1030187
1284 Ga0007410J51695_1032737
1285 Ga0007409J51694_1068937
1286 Ga0007429J51699_1023319
1287 Ga0007429J51699_1031546
1288 Ga0006780_1025085
1289 Ga0055525_1000012
1290 Ga0055542_1000355
1291 Ga0055542_1028374
1292 Ga0055529_1000045
1293 Ga0055529_1001200
1294 Ga0055526_1051195
1295 Ga0055537_1003015
1296 Ga0055537_1003625
1297 Ga0055524_1000030
1298 Ga0055528_1027333
1299 Ga0055530_10000554
1300 Ga0055530_10022028
1301 Ga0055540_1001254
1302 Ga0055531_10000019
1303 Ga0055531_10006010
1304 Ga0055531_10071482
1305 Ga0055543_1014987
1306 Ga0065165_1019566
1307 Ga0065165_1032206
1308 Ga0065165_1090877
1309 Ga0065714_10346504
1310 Ga0065704_10070490
1311 Ga0065704_10074996
1312 Ga0065712_10319854
1313 Ga0065715_10038607
1314 Ga0065715_10091935
1315 Ga0065715_10970762
1316 Ga0065715_11099189
1317 Ga0065707_10584051
1318 Ga0070658_10000808
1319 Ga0070658_10000957
1320 Ga0070658_10011514
1321 Ga0070658_10103001
1322 Ga0070676_10016131
1323 Ga0070676_10227190
1324 Ga0070676_10806097
1325 Ga0070676_11261761
1326 Ga0070683_100336697
1327 Ga0070690_100124496
1328 Ga0070690_100910205
1329 Ga0070670_100001686
1330 Ga0070670_100003085
1331 Ga0070670_100100851
1332 Ga0070670_100165798
1333 Ga0070670_100526485
1334 Ga0070670_100555347
1335 Ga0070670_100878350
1336 Ga0068869_100340064
1337 Ga0068869_100695339
1338 Ga0068869_101881082
1339 Ga0070666_10016672
1340 Ga0070666_10240971
1341 Ga0070666_10424016
1342 Ga0070682_101700513
1343 Ga0068868_100214997
1344 Ga0068868_100872315
1345 Ga0070660_100078152
1346 Ga0070660_100913350
1347 Ga0070661_100000776
1348 Ga0070668_100001172
1349 Ga0070668_100002440
1350 Ga0070668_100035024
1351 Ga0070668_100109981
1352 Ga0070668_100306206
1353 Ga0070668_100555723
1354 Ga0070668_100811840
1355 Ga0070669_100000408
1356 Ga0070669_100001266
1357 Ga0070669_100001698
1358 Ga0070669_100002206
1359 Ga0070669_100434755
1360 Ga0070675_100022565
1361 Ga0070675_100062900
1362 Ga0070675_100076947
1363 Ga0070671_100000122
1364 Ga0070671_100008715
1365 Ga0070671_100014083
1366 Ga0070671_100028597
1367 Ga0070671_100077907
1368 Ga0070671_100125573
1369 Ga0070671_100375733
1370 Ga0070671_101096901
1371 Ga0070671_101315543
1372 Ga0070671_101842966
1373 Ga0070674_100011530
1374 Ga0070674_100012103
1375 Ga0070674_100013334
1376 Ga0070674_101181868
1377 Ga0070674_102101092
1378 Ga0070673_100020913
1379 Ga0070673_100036022
1380 Ga0070673_100436502
1381 Ga0070673_101548119
1382 Ga0070659_100163395
1383 Ga0070659_100590275
1384 Ga0070659_101338306
1385 Ga0070659_101617757
1386 Ga0070667_100000596
1387 Ga0070667_100022920
1388 Ga0070667_100026836
1389 Ga0070667_100137491
1390 Ga0070667_100284970
1391 Ga0070667_101051623
1392 Ga0070667_101698346
1393 Ga0070667_101924869
1394 Ga0070713_101092702
1395 Ga0070701_10424070
1396 Ga0070711_101266781
1397 Ga0070705_100322643
1398 Ga0070700_100269421
1399 Ga0070694_100267543
1400 Ga0070663_100009319
1401 Ga0070678_100148533
1402 Ga0070678_100203100
1403 Ga0070678_100271202
1404 Ga0070678_100328378
1405 Ga0070678_100626345
1406 Ga0070678_102051506
1407 Ga0070662_100000872
1408 Ga0070662_100064759
1409 Ga0070662_101122802
1410 Ga0070681_11787276
1411 Ga0068867_100007513
1412 Ga0068867_100049553
1413 Ga0068867_100691070
1414 Ga0068867_101006825
1415 Ga0070685_10689205
1416 Ga0070706_100545880
1417 Ga0070698_100365019
1418 Ga0070699_101144278
1419 Ga0070679_101922014
1420 Ga0070684_100387437
1421 Ga0068853_100358710
1422 Ga0068853_100637653
1423 Ga0068853_101245312
1424 Ga0068853_101363779
1425 Ga0068853_101914658
1426 Ga0070672_100103722
1427 Ga0070672_100528844
1428 Ga0070686_100155091
1429 Ga0070686_100783497
1430 Ga0070695_100099178
1431 Ga0070696_100641985
1432 Ga0070693_100892271
1433 Ga0070665_100001012
1434 Ga0070665_100004063
1435 Ga0070665_100211836
1436 Ga0070665_100253198
1437 Ga0070665_100805224
1438 Ga0070704_102225398
1439 Ga0068855_100003997
1440 Ga0068855_100092560
1441 Ga0068855_101217122
1442 Ga0070664_100027918
1443 Ga0070664_100074095
1444 Ga0070664_100615275
1445 Ga0070664_101368539
1446 Ga0068857_100183846
1447 Ga0068857_100799312
1448 Ga0068857_101180691
1449 Ga0068857_101216258
1450 Ga0068857_101664418
1451 Ga0068857_101868326
1452 Ga0068854_100005493
1453 Ga0068854_100015015
1454 Ga0068856_100008316
1455 Ga0068856_100030211
1456 Ga0068856_100038838
1457 Ga0068856_100066194
1458 Ga0068856_101158058
1459 Ga0070702_100056481
1460 Ga0070702_100630366
1461 Ga0068852_100021267
1462 Ga0068852_100309918
1463 Ga0068852_101180069
1464 Ga0068859_100001413
1465 Ga0068859_100026464
1466 Ga0068859_101474601
1467 Ga0068859_102137103
1468 Ga0068864_100034325
1469 Ga0068864_100058936
1470 Ga0068864_101385121
1471 Ga0068864_101543468
1472 Ga0068864_102110461
1473 Ga0068866_10508127
1474 Ga0068861_100033598
1475 Ga0068861_101384248
1476 Ga0068861_101579578
1477 Ga0068851_10003977
1478 Ga0068851_10269454
1479 Ga0068870_10051536
1480 Ga0068870_10265617
1481 Ga0068870_10433095
1482 Ga0068863_100018487
1483 Ga0068863_100041528
1484 Ga0068863_100217996
1485 Ga0068863_100318872
1486 Ga0068863_100446522
1487 Ga0068858_100071679
1488 Ga0068858_100492618
1489 Ga0068860_100018416
1490 Ga0068860_100029808
1491 Ga0068860_100030603
1492 Ga0068860_101158176
1493 Ga0068862_100003883
1494 Ga0068862_100022859
1495 Ga0068862_100030220
1496 Ga0068862_100107007
1497 Ga0068862_100900706
1498 Ga0081538_10002854
1499 Ga0081538_10170439
1500 Ga0075365_10072164
1501 Ga0075365_10109948
1502 Ga0075365_10477367
1503 Ga0075365_10583278
1504 Ga0075365_10729918
1505 Ga0075368_10036569
1506 Ga0075368_10299808
1507 Ga0075363_100025154
1508 Ga0075363_100299638
1509 Ga0075364_10118963
1510 Ga0075364_10273535
1511 Ga0075364_10373624
1512 Ga0075364_10377646
1513 Ga0075364_10387144
1514 Ga0070712_100146886
1515 Ga0075362_10001290
1516 Ga0075362_10216974
1517 Ga0075367_10032202
1518 Ga0075369_10009867
1519 Ga0075369_10016088
1520 Ga0075369_10026637
1521 Ga0075369_10494592
1522 Ga0075366_10051050
1523 Ga0075366_10063141
1524 Ga0075366_10115554
1525 Ga0075366_10176550
1526 Ga0075366_10581919
1527 Ga0075366_10686094
1528 Ga0097621_100274921
1529 Ga0075370_10149342
1530 Ga0075370_10565927
1531 Ga0068871_100104146
1532 Ga0068871_100880614
1533 Ga0068871_101237325
1534 Ga0075428_100142813
1535 Ga0075428_100152242
1536 Ga0075428_100632564
1537 Ga0075428_101913738
1538 Ga0075430_100390506
1539 Ga0075430_100542113
1540 Ga0075430_100717988
1541 Ga0075431_100189366
1542 Ga0075431_100620632
1543 Ga0075433_11192357
1544 Ga0068865_100594066
1545 Ga0097620_100001413
1546 Ga0097620_100026465
1547 Ga0097620_101474443
1548 Ga0097620_102137818
1549 Ga0105251_10005302
1550 Ga0105251_10042882
1551 Ga0105251_10141671
1552 Ga0105250_10008207
1553 Ga0105250_10243315
1554 Ga0105240_10046210
1555 Ga0105240_10150959
1556 Ga0105240_10425723
1557 Ga0105240_11580611
1558 Ga0105240_11744685
1559 Ga0111539_10013275
1560 Ga0111539_10269322
1561 Ga0111539_10730597
1562 Ga0105245_10209462
1563 Ga0105245_10547932
1564 Ga0105247_10024046
1565 Ga0105247_10225356
1566 Ga0114129_10427831
1567 Ga0114129_10502771
1568 Ga0114129_10533868
1569 Ga0114129_11514071
1570 Ga0105243_10000423
1571 Ga0105243_10555936
1572 Ga0105243_12010938
1573 Ga0105241_10009278
1574 Ga0105241_10423776
1575 Ga0105242_10297423
1576 Ga0105248_10026827
1577 Ga0105248_10060330
1578 Ga0105248_10080865
1579 Ga0105248_10409273
1580 Ga0105248_11008578
1581 Ga0105248_11039322
1582 Ga0105237_10210213
1583 Ga0105237_10294972
1584 Ga0105237_10709252
1585 Ga0105237_11595555
1586 Ga0105237_12388585
1587 Ga0105238_10059481
1588 Ga0105238_10127097
1589 Ga0105238_10179574
1590 Ga0105238_12679203
1591 Ga0105249_10009816
1592 Ga0105249_10204570
1593 Ga0105249_11013216
1594 Ga0105148_104016
1595 Ga0105239_10473760
1596 Ga0105239_10475938
1597 Ga0105239_10988601
1598 Ga0105239_11028442
1599 Ga0105239_11227514
1600 Ga0105239_11475217
1601 Ga0105246_10034849
1602 Ga0157317_1006346
1603 Ga0157322_1027459
1604 Ga0157315_1014526
1605 Ga0157315_1063024
1606 Ga0157316_1023420
1607 Ga0157316_1058686
1608 Ga0157327_1002804
1609 Ga0157327_1015497
1610 Ga0157326_1036161
1611 Ga0157373_10180139
1612 Ga0157373_10592669
1613 Ga0157373_10887051
1614 Ga0157371_10000032
1615 Ga0157371_10004757
1616 Ga0157371_10434302
1617 Ga0157370_10000152
1618 Ga0157370_10406630
1619 Ga0157369_10046420
1620 Ga0157369_10369745
1621 Ga0157369_11159648
1622 Ga0157374_10035173
1623 Ga0157374_10117361
1624 Ga0157378_10509205
1625 Ga0157378_11417713
1626 Ga0157378_11446489
1627 Ga0157378_11635651
1628 Ga0163162_10047653
1629 Ga0163162_10075148
1630 Ga0163162_10766795
1631 Ga0163162_11063306
1632 Ga0163162_11154471
1633 Ga0163162_11254396
1634 Ga0163162_11755874
1635 Ga0157372_11467339
1636 Ga0157375_10287973
1637 Ga0157375_10389465
1638 Ga0157375_10413178
1639 Ga0157375_13680076
1640 Ga0163163_10028972
1641 Ga0163163_11361346
1642 Ga0157380_10001109
1643 Ga0157380_10018421
1644 Ga0157380_10078258
1645 Ga0157380_11204077
1646 Ga0182008_10238008
1647 Ga0182008_10330442
1648 Ga0157377_10519930
1649 Ga0157379_10237668
1650 Ga0157376_10240807
1651 Ga0157376_10355567
1652 Ga0157376_10536248
1653 Ga0163161_10001748
1654 Ga0163161_10042717
1655 Ga0163161_10143980
1656 Ga0163161_10638310
1657 Ga0163161_11362757
1658 Ga0197907_10342361
1659 Ga0197907_10443662
1660 Ga0206356_11436017
1661 Ga0206356_11439898
1662 Ga0206349_1394373
1663 Ga0206355_1251537
1664 Ga0206355_1354397
1665 Ga0206355_1436319
1666 Ga0206351_10725755
1667 Ga0206352_10349969
1668 Ga0206350_10307900
1669 Ga0206354_11299294
1670 Ga0206353_11891397
1671 Ga0224712_10277510
1672 Ga0224712_10291230
1673 Ga0224712_10488812
1674 Ga0209436_109965
1675 Ga0207672_1003100
1676 Ga0209672_103601
1677 Ga0209563_100030
1678 Ga0207427_101365
1679 Ga0207425_1000027
1680 Ga0209646_1015744
1681 Ga0209026_1001157
1682 Ga0209148_1000011
1683 Ga0209148_1004002
1684 Ga0209759_1025063
1685 Ga0209129_1000416
1686 Ga0209233_1000143
1687 Ga0209233_1092086
1688 Ga0209565_1000012
1689 Ga0209565_1000142
1690 Ga0209455_1000006
1691 Ga0209455_1000908
1692 Ga0209455_1002724
1693 Ga0209673_1002755
1694 Ga0209675_1012044
1695 Ga0209675_1014237
1696 Ga0209675_1092580
1697 Ga0209676_1022757
1698 Ga0209025_1000197
1699 Ga0209564_1002693
1700 Ga0209564_1080555
1701 Ga0209758_1000001
1702 Ga0209758_1000009
1703 Ga0209758_1002365
1704 Ga0209050_1000005
1705 Ga0209050_1000010
1706 Ga0209050_1000254
1707 Ga0209050_1005181
1708 Ga0209256_1000012
1709 Ga0207426_1007652
1710 Ga0207426_1113075
1711 Ga0209051_1000152
1712 Ga0209051_1146724
1713 Ga0209257_1000009
1714 Ga0209257_1002315
1715 Ga0209257_1013636
1716 Ga0207697_10000595
1717 Ga0207697_10073672
1718 Ga0207697_10109135
1719 Ga0207697_10182914
1720 Ga0207656_10002662
1721 Ga0207696_1005004
1722 Ga0207713_1012386
1723 Ga0207682_10003889
1724 Ga0207682_10161102
1725 Ga0207642_10443574
1726 Ga0207642_10495086
1727 Ga0207710_10714828
1728 Ga0207688_10063112
1729 Ga0207688_10135214
1730 Ga0207688_10179146
1731 Ga0207680_10361310
1732 Ga0207680_10431350
1733 Ga0207680_10646300
1734 Ga0207680_11008421
1735 Ga0207647_10022843
1736 Ga0207647_10033402
1737 Ga0207647_10057828
1738 Ga0207647_10406208
1739 Ga0207645_10008043
1740 Ga0207645_10055530
1741 Ga0207645_10484273
1742 Ga0207645_11236134
1743 Ga0207643_10041321
1744 Ga0207643_10166029
1745 Ga0207705_10000009
1746 Ga0207705_10000122
1747 Ga0207705_10028066
1748 Ga0207705_10377512
1749 Ga0207654_10001772
1750 Ga0207654_10664454
1751 Ga0207695_10034521
1752 Ga0207695_10093798
1753 Ga0207695_10300486
1754 Ga0207695_10489051
1755 Ga0207671_10009515
1756 Ga0207671_10469294
1757 Ga0207671_10696985
1758 Ga0207671_10810682
1759 Ga0207693_10264377
1760 Ga0207662_10267515
1761 Ga0207657_10039979
1762 Ga0207649_10000482
1763 Ga0207649_10028573
1764 Ga0207649_11380204
1765 Ga0207652_10226194
1766 Ga0207681_10000387
1767 Ga0207681_10001010
1768 Ga0207681_10001632
1769 Ga0207681_10026231
1770 Ga0207681_10368141
1771 Ga0207681_10518112
1772 Ga0207681_10839171
1773 Ga0207694_10005283
1774 Ga0207694_10059351
1775 Ga0207694_10298255
1776 Ga0207694_10444900
1777 Ga0207650_10002289
1778 Ga0207650_10070938
1779 Ga0207650_10080672
1780 Ga0207650_10144869
1781 Ga0207650_10223930
1782 Ga0207650_10684350
1783 Ga0207659_10001032
1784 Ga0207659_10163319
1785 Ga0207659_10178036
1786 Ga0207659_10776419
1787 Ga0207687_10320987
1788 Ga0207644_10000048
1789 Ga0207644_10000293
1790 Ga0207644_10006574
1791 Ga0207644_10014696
1792 Ga0207644_10161897
1793 Ga0207644_10252123
1794 Ga0207644_10619547
1795 Ga0207644_10753935
1796 Ga0207690_10000052
1797 Ga0207690_10361496
1798 Ga0207706_10002470
1799 Ga0207706_10019428
1800 Ga0207706_11075288
1801 Ga0207686_10231924
1802 Ga0207686_10351866
1803 Ga0207709_10000574
1804 Ga0207709_10387182
1805 Ga0207709_10920234
1806 Ga0207709_11469804
1807 Ga0207670_11350781
1808 Ga0207669_10000044
1809 Ga0207669_10007750
1810 Ga0207669_10024307
1811 Ga0207704_10391686
1812 Ga0207704_11878280
1813 Ga0207691_10002177
1814 Ga0207691_10142133
1815 Ga0207691_11627805
1816 Ga0207711_10202869
1817 Ga0207711_10241428
1818 Ga0207711_10335169
1819 Ga0207711_11724276
1820 Ga0207689_11469562
1821 Ga0207661_11369783
1822 Ga0207679_10027267
1823 Ga0207679_11814755
1824 Ga0207667_10000002
1825 Ga0207667_10053707
1826 Ga0207667_10772239
1827 Ga0207667_11023535
1828 Ga0207651_10024451
1829 Ga0207712_10013270
1830 Ga0207712_10280829
1831 Ga0207712_10446143
1832 Ga0207712_11880967
1833 Ga0207668_10000720
1834 Ga0207668_10005075
1835 Ga0207668_10077705
1836 Ga0207668_10232671
1837 Ga0207668_10275915
1838 Ga0207668_11902423
1839 Ga0207668_11925484
1840 Ga0207640_10002340
1841 Ga0207640_10017460
1842 Ga0207658_10001159
1843 Ga0207658_10025817
1844 Ga0207658_10099468
1845 Ga0207658_10207340
1846 Ga0207658_10285591
1847 Ga0207658_10906088
1848 Ga0207677_10162266
1849 Ga0207677_10164483
1850 Ga0207703_10011232
1851 Ga0207703_10064656
1852 Ga0207703_10785799
1853 Ga0207639_10000777
1854 Ga0207639_11108890
1855 Ga0207639_11476767
1856 Ga0207678_10005545
1857 Ga0207678_10068106
1858 Ga0207708_10206377
1859 Ga0207702_10003669
1860 Ga0207702_10006661
1861 Ga0207702_11156063
1862 Ga0207641_10006329
1863 Ga0207641_10168806
1864 Ga0207641_10405047
1865 Ga0207641_10558432
1866 Ga0207641_10802312
1867 Ga0207641_11612360
1868 Ga0207641_12023876
1869 Ga0207648_10029482
1870 Ga0207648_10085699
1871 Ga0207676_10030447
1872 Ga0207676_10046151
1873 Ga0207676_10252703
1874 Ga0207676_11219950
1875 Ga0207674_10012390
1876 Ga0207674_10173026
1877 Ga0207674_10668720
1878 Ga0207674_11207251
1879 Ga0207674_11359009
1880 Ga0207675_100016300
1881 Ga0207683_10140414
1882 Ga0207683_10240991
1883 Ga0207683_10498239
1884 Ga0207683_10552332
1885 Ga0207683_11344496
1886 Ga0207698_10000537
1887 Ga0207698_10008071
1888 Ga0207698_10151214
1889 Ga0209973_1038452
1890 Ga0209970_1024934
1891 Ga0210002_1034486
1892 Ga0210002_1078664
1893 Ga0209971_1049962
1894 Ga0209998_10056268
1895 Ga0209813_10000081
1896 Ga0207428_10243522
1897 Ga0207428_10462692
1898 Ga0265356_1039492
1899 Ga0268266_10000471
1900 Ga0268266_10014912
1901 Ga0268266_10181481
1902 Ga0268266_10915904
1903 Ga0268266_11959938
1904 Ga0268266_12167543
1905 Ga0268265_10010196
1906 Ga0268265_10011459
1907 Ga0268265_10037933
1908 Ga0268265_10043598
1909 Ga0268265_10110885
1910 Ga0268265_11170391
1911 Ga0268265_12217624
1912 Ga0268264_10001249
1913 Ga0268264_10005153
1914 Ga0268264_10006783
1915 Ga0268264_10263600
1916 Ga0268264_10501721
1917 Ga0268264_11115163
1918 Ga0265318_10281431
1919 Ga0307517_10032795
1920 Ga0307515_10002885
1921 Ga0307515_10544729
1922 Ga0265338_10041348
1923 Ga0316176_1100255
1924 Ga0314311_1148511
1925 Ga0314311_1234607
1926 Ga0316181_1135234
1927 Ga0316182_1060881
1928 Ga0316182_1148393
1929 Ga0265760_10112912
1930 Ga0265330_10031999
1931 Ga0265325_10114964
1932 Ga0265331_10073322
1933 Ga0265316_10151330
1934 Ga0307513_10010088
1935 Ga0307408_100478820
1936 Ga0307408_101285422
1937 Ga0307408_101799182
1938 Ga0307408_102182809
1939 Ga0316575_10257840
1940 Ga0316579_10004122
1941 Ga0316576_10023190
1942 Ga0316576_10724450
1943 Ga0316576_11179694
1944 Ga0307405_10079995
1945 Ga0307405_10242229
1946 Ga0307405_10402989
1947 Ga0307405_10662999
1948 Ga0307405_10674720
1949 Ga0307405_10789461
1950 Ga0307405_10874348
1951 Ga0307413_10229429
1952 Ga0307413_10281774
1953 Ga0307413_10630335
1954 Ga0307413_10640145
1955 Ga0307413_10774038
1956 Ga0307413_11651359
1957 Ga0307410_10637498
1958 Ga0307410_10948085
1959 Ga0307410_11301693
1960 Ga0307406_10276975
1961 Ga0307406_10647690
1962 Ga0307406_10725491
1963 Ga0307406_10746523
1964 Ga0307406_10943146
1965 Ga0307406_11232056
1966 Ga0307406_11365044
1967 Ga0307407_10040629
1968 Ga0307407_10159039
1969 Ga0307407_11082644
1970 Ga0307407_11194044
1971 Ga0307412_10010127
1972 Ga0307412_10020188
1973 Ga0307412_10088761
1974 Ga0307412_10168075
1975 Ga0307412_10225103
1976 Ga0307412_10264932
1977 Ga0307412_10655875
1978 Ga0307412_10797808
1979 Ga0307412_10872636
1980 Ga0307412_11036908
1981 Ga0307412_11072137
1982 Ga0307412_12078026
1983 Ga0307409_100122294
1984 Ga0307409_100405053
1985 Ga0307409_100580029
1986 Ga0307409_100713214
1987 Ga0307409_100778273
1988 Ga0307409_100830586
1989 Ga0307409_102652186
1990 Ga0307409_102713475
1991 Ga0307416_100066176
1992 Ga0307416_100213452
1993 Ga0307416_100399071
1994 Ga0307416_100469867
1995 Ga0307416_100981045
1996 Ga0307416_101196369
1997 Ga0307416_102475077
1998 Ga0307416_102860286
1999 Ga0307414_10065371
2000 Ga0307414_10070136
2001 Ga0307414_10082088
2002 Ga0307414_10121242
2003 Ga0307414_10150384
2004 Ga0307414_10293449
2005 Ga0307414_10484627
2006 Ga0307414_10492531
2007 Ga0307414_10572278
2008 Ga0307414_10785350
2009 Ga0307414_10972663
2010 Ga0307414_11456459
2011 Ga0307414_11458569
2012 Ga0307411_10048142
2013 Ga0307411_10322920
2014 Ga0307411_10856289
2015 Ga0307411_12046010
2016 Ga0307411_12108890
2017 Ga0307415_100188175
2018 Ga0307415_100241924
2019 Ga0307415_100576145
2020 Ga0307510_10041740
2021 Ga0307510_10246300
2022 Ga0316588_1101767
2023 Ga0373934_0011200
2024 Ga0373934_0020309
2025 Ga0373952_0086873
2026 Ga0373923_0120678
2027 Ga0373954_0000013
2028 Ga0373955_0119305
2029 Ga0373961_0008207
2030 Ga0373961_0139179
2031 Ga0316574_0015732
2032 Ga0316574_0026931
2033 Ga0316574_0049538
2034 Ga0316574_0365320
2035 Ga0373924_0035457
2036 Ga0373933_0008247
2037 Ga0373937_0000568
2038 Ga0316582_0008050
2039 Ga0395899_0001486
2040 Ga0395899_0175118
2041 Ga0395900_0079824
2042 Ga0395905_0496689
2043 Ga0395905_0708103
2044 Ga0316581_0266312
2045 Ga0436364_1232957
2046 Ga0395901_0135462
2047 Ga0436365_0875957
2048 Ga0436365_1049735
2049 Ga0436363_1338713
2050 Ga0439436_0167408
2051 Ga0439439_0030580
2052 Ga0439447_030078
2053 Ga0439453_0001227
2054 Ga0439461_0000086
2055 Ga0439461_0100584
2056 Ga0439466_0038559
2057 Ga0439465_0001125
2058 Ga0439465_0010998
2059 Ga0451788_13712
2060 Ga0451791_0887440
2061 Ga0451793_0892181
2062 Ga0451797_0437635
2063 Ga0451801_37066
2064 Ga0451802_1631382
2065 Ga0451833_0536339
2066 Ga0451833_0710986
2067 Ga0451835_0060857
2068 Ga0451841_0833099
2069 Ga0451841_1278623
2070 Ga0451845_0715186
2071 Ga0451846_03630
2072 Ga0451851_0162624
2073 Ga0451853_2850232
2074 Ga0439431_0000491
2075 Ga0439431_0196553
2076 Ga0439431_0211085
2077 Ga0439441_097568
2078 Ga0439442_009847
2079 Ga0439445_0000271
2080 Ga0439445_0000898
2081 Ga0439445_0022188
2082 Ga0439448_0007732
2083 Ga0439432_001270
2084 Ga0439452_015389
2085 Ga0439455_0200052
2086 Ga0439457_014255
2087 Ga0439462_0003457
2088 Ga0450923_062085
2089 Ga0450906_016697
2090 Ga0450910_088011
2091 Ga0439446_0015960
2092 Ga0439446_0071753
2093 Ga0439434_0001316
2094 Ga0439434_0258754
2095 Ga0439434_0365909
2096 Ga0439460_0285315
2097 Ga0439460_0309249
2098 Ga0466965_0190472
2099 Ga0466966_0642050
2100 Ga0466961_0511827
2101 Ga0466963_0202490
2102 Ga0466971_0011267
2103 Ga0466957_0129471
2104 Ga0466958_0058924
2105 Ga0466967_0088373
2106 Ga0495627_024430
2107 Ga0495629_0409358
2108 Ga0495638_0006816
2109 Ga0495650_0000158
2110 Ga0495662_0629714
2111 Ga0495584_0653790
2112 Ga0495585_0007224
2113 Ga0495596_0001722
2114 Ga0495596_0288891
2115 Ga0495607_0233928
2116 Ga0495583_0000139
2117 Ga0495583_0000631
2118 Ga0495583_0049835
2119 Ga0495583_0138928
2120 Ga0495606_0000672
2121 Ga0495606_0097843
2122 Ga0495610_0001956
2123 Ga0495610_0102024
2124 Ga0495610_0167798
2125 Ga0495610_0241972
2126 Ga0495616_0035449
2127 Ga0495618_0666693
2128 Ga0495620_0074993
2129 Ga0495620_0310170
2130 Ga0495631_0274197
2131 Ga0495637_0013506
2132 Ga0495643_0042779
2133 Ga0495643_0058229
2134 Ga0495643_0419710
2135 Ga0495644_0189750
2136 Ga0495648_0000143
2137 Ga0495663_0004724
2138 Ga0495663_0004868
2139 Ga0495663_0074411
2140 Ga0495642_0008825
2141 Ga0495642_0027044
2142 Ga0495586_0070475
2143 Ga0495587_0027072
2144 Ga0495587_0275897
2145 Ga0495598_0074808
2146 Ga0495609_0096737
2147 Ga0495621_0027893
2148 Ga0495622_0007935
2149 Ga0495633_0002517
2150 Ga0495633_0077644
2151 Ga0495633_0126517
2152 Ga0495656_0332712
2153 Ga0495668_0000016
2154 Ga0495625_0000150
2155 Ga0495625_0388205
2156 Ga0495659_0030064
2157 Ga0495659_0493366
2158 Ga0495661_0094901
2159 Ga0495661_0261427
2160 Ga0495661_0358626
2161 Ga0495657_0161972
2162 Ga0495658_0610658
2163 Ga0495669_0000050
2164 Ga0495669_0015265
2165 Ga0495670_0005678
2166 Ga0495670_0134108
2167 Ga0495671_0273798
2168 Ga0495649_0055299
2169 Ga0495649_0146871
2170 Ga0495589_0426484
2171 Ga0495600_0000690
2172 Ga0495660_0019031
2173 Ga0495604_0375413
2174 Ga0495672_0258162
2175 Ga0495687_000098
2176 Ga0495687_000455
2177 Ga0495687_026151
2178 Ga0495687_082012
2179 Ga0495677_0023015
2180 Ga0495677_0174372
2181 Ga0495685_067989
2182 Ga0495673_0175421
2183 Ga0495681_0043708
2184 Ga0495681_0171859
2185 Ga0495686_0619169
2186 Ga0495615_0000060
2187 Ga0495626_0000877
2188 Ga0495626_0287230
2189 Ga0496100_0000980
2190 Ga0496100_0011451
2191 Ga0496100_0105517
2192 Ga0496101_0008286
2193 Ga0496101_0077643
2194 Ga0496101_0381119
2195 Ga0496101_0392392
2196 Ga0496101_0851214
2197 Ga0496102_0000199
2198 Ga0496102_0001054
2199 Ga0496102_0058238
2200 Ga0496102_0060341
2201 Ga0496102_0790010
2202 Ga0496103_0000289
2203 Ga0496103_0000633
2204 Ga0496103_0004432
2205 Ga0496103_0062475
2206 Ga0496103_0087293
2207 Ga0496103_0252642
2208 Ga0496104_0000474
2209 Ga0496104_0045338
2210 Ga0496104_0136930
2211 Ga0496104_0249205
2212 Ga0496104_0284172
2213 Ga0496104_0619960
2214 Ga0496105_0000690
2215 Ga0496105_0124885
2216 Ga0496105_0158470
2217 Ga0496106_0008825
2218 Ga0496106_0008866
2219 Ga0496107_0014228
2220 Ga0496107_0023026
2221 Ga0496107_0066908
2222 Ga0496107_0233824
2223 Ga0496108_0277684
2224 Ga0496109_0182656
2225 Ga0496109_0194861
2226 Ga0496109_0357358
2227 Ga0496110_0025670
2228 Ga0496110_0067902
2229 Ga0496110_0121287
2230 Ga0496110_0835615
2231 Ga0496111_0033303
2232 Ga0496111_0082756
2233 Ga0496111_0156088
2234 Ga0496111_0373799
2235 Ga0496112_0014681
2236 Ga0496112_0100877
2237 Ga0496112_0120643
2238 Ga0496112_0368823
2239 Ga0496112_0879669
2240 Ga0496113_0004277
2241 Ga0496113_0015458
2242 Ga0496113_0057153
2243 Ga0496113_0194089
2244 Ga0496113_0661150
2245 Ga0496113_1579017
2246 Ga0496114_0007726
2247 Ga0496114_0287877
2248 Ga0496114_0296042
2249 Ga0496114_0604954
2250 Ga0496115_0000131
2251 Ga0496115_0000483
2252 Ga0496115_0119296
2253 Ga0496115_0399087
2254 Ga0496115_0541523
2255 Ga0496116_0000045
2256 Ga0496116_0017932
2257 Ga0496116_0029227
2258 Ga0496116_0121950
2259 Ga0496117_0000352
2260 Ga0496117_0004523
2261 Ga0496117_0066974
2262 Ga0496117_0079061
2263 Ga0496117_0120301
2264 Ga0496117_0221919
2265 Ga0496117_0568574
2266 Ga0496118_0000092
2267 Ga0496118_0004825
2268 Ga0496118_0020152
2269 Ga0496118_0021880
2270 Ga0496118_0051033
2271 Ga0496118_0196012
2272 Ga0496119_0004697
2273 Ga0496119_0009738
2274 Ga0496119_0038098
2275 Ga0496119_0169489
2276 Ga0496120_0007424
2277 Ga0496120_0024506
2278 Ga0496120_0119204
2279 Ga0496120_0257527
2280 Ga0496120_0376859
2281 Ga0496121_0000228
2282 Ga0496121_0001923
2283 Ga0496121_0007837
2284 Ga0496121_0057301
2285 Ga0496121_0228962
2286 Ga0496122_0009937
2287 Ga0496122_0020908
2288 Ga0496122_0033342
2289 Ga0496122_0068094
2290 Ga0496122_0107366
2291 Ga0496123_0000785
2292 Ga0496123_0001112
2293 Ga0496123_0033385
2294 Ga0496123_0041482
2295 Ga0496124_0000081
2296 Ga0496124_0005380
2297 Ga0496124_0053225
2298 Ga0496124_0273659
2299 Ga0496124_0402011
2300 Ga0496124_0487541
2301 Ga0496125_0000980
2302 Ga0496125_0003170
2303 Ga0496125_0062486
2304 Ga0496125_0087157
2305 Ga0496125_0205965
2306 Ga0496125_0242116
2307 Ga0496126_0000283
2308 Ga0496126_0000802
2309 Ga0496126_0001266
2310 Ga0496126_0041891
2311 Ga0496126_0625867
2312 Ga0496126_1082057
2313 Ga0501306_023694
2314 Ga0501309_024779
2315 Ga0501309_026442
2316 Ga0501310_017093
2317 Ga0501307_061030
2318 Ga0495682_0061278
2319 Ga0495682_0098625
2320 Ga0501311_013777
2321 Ga0501313_017138
2322 Ga0501313_018621
2323 Ga0501314_026384
2324 Ga0501314_042408
2325 Ga0501315_020960
2326 Ga0501315_105878
2327 Ga0501316_020284
2328 Ga0501317_079426
2329 Ga0501320_017114
2330 Ga0501320_022178
2331 Ga0501321_029872
2332 Ga0501322_005374
2333 Ga0501323_069045
2334 Ga0501324_042584
2335 Ga0501325_009145
2336 Ga0501325_028935
2337 Ga0501335_012565
2338 Ga0501335_034641
2339 Ga0501031_0662317
2340 Ga0501034_1040756
2341 Ga0501034_1588619
2342 Ga0501036_0103495
2343 Ga0501036_0297146
2344 Ga0501038_0398038
2345 Ga0501039_0224459
2346 Ga0501039_0758499
2347 Ga0501040_0081187
2348 Ga0501040_0453851
2349 Ga0501040_0887974
2350 Ga0501041_0208506
2351 Ga0501041_0240171
2352 Ga0501042_0139913
2353 Ga0501043_0031566
2354 Ga0501046_0259051
2355 Ga0501046_0787017
2356 Ga0501047_0003524
2357 Ga0501047_1428378
2358 Ga0501048_1075243
2359 Ga0501048_1142579
2360 Ga0501068_0527564
2361 Ga0501070_1405341
2362 Ga0501071_0616366
2363 Ga0501071_0669833
2364 Ga0501072_0304092
2365 Ga0501072_0462932
2366 Ga0501072_1347058
2367 Ga0501073_0614491
2368 Ga0501075_0201896
2369 Ga0501076_0430969
2370 Ga0501076_0579764
2371 Ga0501077_0672342
2372 Ga0501233_127262
2373 Ga0501242_037278
2374 Ga0501243_103110
2375 Ga0501250_072046
2376 Ga0501245_099636
2377 Ga0501079_0173420
2378 Ga0501081_1121903
2379 Ga0501083_0559352
2380 Ga0501241_082930
2381 Ga0501268_046505
2382 Ga0501273_051053
2383 Ga0501035_1467660
2384 Ga0501045_0045082
2385 nmdc:mga03683_284554_c1
2386 nmdc:mga03683_9705_c1
2387 nmdc:mga03n38_272530_c1
2388 nmdc:mga03n38_401807_c1
2389 nmdc:mga03n38_52666_c1
2390 nmdc:mga03n38_766621_c1
2391 nmdc:mga00v17_1556_c1
2392 nmdc:mga00v17_231124_c1
2393 nmdc:mga00v17_240296_c1
2394 nmdc:mga0yw44_704623_c1
2395 nmdc:mga0yw44_95654_c1
2396 nmdc:mga0k408_17456_c1
2397 nmdc:mga0k408_484044_c1
2398 nmdc:mga06z11_893064_c1
2399 nmdc:mga06z11_904_c1
2400 nmdc:mga04h51_172_c1
2401 nmdc:mga07m45_15_c1
2402 nmdc:mga07m45_186261_c1
2403 nmdc:mga07m45_721857_c1
2404 nmdc:mga05p37_344142_c1
2405 nmdc:mga05p37_466232_c1
2406 nmdc:mga05p37_538169_c1
2407 nmdc:mga09592_1047268_c1
2408 nmdc:mga09592_816473_c1
2409 nmdc:mga0qj67_541144_c1
2410 nmdc:mga06r32_415204_c1
2411 nmdc:mga08y16_1119983_c1
2412 nmdc:mga08y16_209471_c1
2413 nmdc:mga08y16_238311_c1
2414 nmdc:mga08y16_640169_c1
2415 nmdc:mga0n895_666212_c1
2416 nmdc:mga0sz30_13412_c1
2417 nmdc:mga0sz30_263955_c1
2418 nmdc:mga0sz30_32949_c1
2419 nmdc:mga0sz30_36777_c1
2420 nmdc:mga0sz30_62919_c1
2421 nmdc:mga0sz30_90873_c2
2422 Ga0500610_0003391
2423 Ga0500643_047079
2424 Ga0500643_126527
2425 Ga0500647_0118147
2426 Ga0500566_0001151
2427 Ga0500641_0002644
2428 Ga0500648_219243
2429 Ga0500650_0260426
2430 Ga0500650_0263044
2431 Ga0500555_000016
2432 Ga0500555_018781
2433 Ga0500555_087752
2434 Ga0500562_098244
2435 Ga0500595_001620
2436 Ga0500595_012595
2437 Ga0500607_001731
2438 Ga0500607_211989
2439 Ga0500642_0000580
2440 Ga0500658_0000538
2441 Ga0500559_0284725
2442 Ga0500568_0133288
2443 Ga0500588_0135525
2444 Ga0500588_0180947
2445 Ga0500600_0428177
2446 Ga0500604_0075893
2447 Ga0500624_012592
2448 Ga0500627_0487192
2449 Ga0500636_0004289
2450 Ga0500611_106687
2451 Ga0500611_199905
2452 Ga0500645_000002
2453 Ga0500645_081482
2454 Ga0500645_223737
2455 Ga0500596_015335
2456 Ga0501084_0351017
2457 Ga0501084_0478375
2458 Ga0501084_1378503
2459 Ga0500661_096813
2460 Ga0590077_114602
2461 Ga0587077_236397
2462 Ga0587094_076285
2463 Ga0587106_111050
2464 Ga0587072_113682
2465 Ga0587078_050361
2466 Ga0587102_032719
2467 Ga0587110_059526
2468 Ga0587111_0106248
2469 Ga0466962_0013182
2470 Ga0530510_1083781
2471 2545672525
2472 2566037845
2473 2585261873
2474 2643948666
2475 2644127187
2476 2644746027
2477 2738711253
2478 2738849678
2479 2738865407
2480 2739297925
2481 2739359603
2482 2739649214
2483 2740027687
2484 2753767322
2485 2819551367
2486 2842699849
2487 2879166515
2488 2884298765
2489 2885430174
2490 2896429422
2491 2909044485
2492 2919452573
2493 2919499272
2494 2919689417
2495 2928961459
2496 3003672560
2497 641644355
2498 8054305365

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

71

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ywy-assembly1.cif.gz_R the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.937 22 83
6yws-assembly1.cif.gz_R the structure of the large subunit of the mitoribosome from neurospora crassa 0.9365 22 83
7sae-assembly1.cif.gz_V 44sr70p class1 ribosomal particle 0.93 22 83
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9288 22 83
6ywv-assembly1.cif.gz_R the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa 0.9284 22 82
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9027 22 85 2.40.50.100
2ba1A01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8937 30 85 2.40.50.100
af_Q9U0I4_44_103_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8931 28 84 2.40.50.100
6d6qH01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.889 28 84 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8829 22 89 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A328ESH9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9517 22 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A660TPI7-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9475 22 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A382C6Q8-F1-model_v4 Ribosomal protein L27 0.9467 22 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A351YBM2-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9462 21 87 GO:0003735
GO:0006412
GO:0022625
AF-A0A166VIX0-F1-model_v4 Large ribosomal subunit protein bL27m 0.9407 22 83 GO:0003735
GO:0005762
GO:0006412

Map