F492228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1254 | 399 | 1254 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_11220825|Ga0070681_112208252 |
| Length | 90 |
| Sequence | MATTCTHLGEIKVSQTQTRVCNECVQLGDTWVHLGHVGCCDSSKNKHATRHFHRTRHPLIRSIEPGERWVWCYVDEMAPGELPSEGIVAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 144 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 151 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 152 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 153 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 236 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 237 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 238 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 239 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 240 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 260 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 261 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 262 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 263 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 264 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 266 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 267 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 268 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 269 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 270 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 274 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 275 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 276 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 279 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 280 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 281 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 329 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 330 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 356 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 357 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 358 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 359 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 360 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 361 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 362 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.19 |
| Metatranscriptomes | 7.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.2 |
| Nodule | 0 |
| Rhizoplane | 1.28 |
| Rhizosphere | 96.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1012948 | 3300001978 | Unclassified | 856 |
| 2 | JGI24743J22301_10006256 | 3300001991 | Bacteria | 2021 |
| 3 | JGI24745J21846_1039197 | 3300002073 | Unclassified | 584 |
| 4 | JGI24033J26618_1047475 | 3300002155 | Unclassified | 610 |
| 5 | JGI24034J26672_10006364 | 3300002239 | Bacteria | 1703 |
| 6 | rootH1_10074194 | 3300003316 | Bacteria | 1578 |
| 7 | rootH1_10118688 | 3300003323 | Bacteria | 2762 |
| 8 | Ga0058863_10169016 | 3300004799 | Bacteria | 1115 |
| 9 | Ga0058863_11328245 | 3300004799 | Bacteria | 1361 |
| 10 | Ga0058863_11972463 | 3300004799 | Bacteria | 875 |
| 11 | Ga0058861_10035870 | 3300004800 | Bacteria | 668 |
| 12 | Ga0058862_12838737 | 3300004803 | Bacteria | 945 |
| 13 | Ga0065165_1001397 | 3300005262 | Bacteria | 26353 |
| 14 | Ga0065712_10127583 | 3300005290 | Bacteria | 1589 |
| 15 | Ga0065712_10533850 | 3300005290 | Unclassified | 628 |
| 16 | Ga0065715_10447627 | 3300005293 | Unclassified | 827 |
| 17 | Ga0065707_10161803 | 3300005295 | Bacteria | 1541 |
| 18 | Ga0065707_10612311 | 3300005295 | Bacteria | 669 |
| 19 | Ga0070658_10067908 | 3300005327 | Bacteria | 2914 |
| 20 | Ga0070658_10169186 | 3300005327 | Bacteria | 1836 |
| 21 | Ga0070658_10208422 | 3300005327 | Bacteria | 1651 |
| 22 | Ga0070658_10348612 | 3300005327 | Unclassified | 1267 |
| 23 | Ga0070676_10028309 | 3300005328 | Bacteria | 3182 |
| 24 | Ga0070683_100038660 | 3300005329 | Bacteria | 4375 |
| 25 | Ga0070683_100043720 | 3300005329 | Unclassified | 4129 |
| 26 | Ga0070683_100052914 | 3300005329 | Bacteria | 3762 |
| 27 | Ga0070683_100068057 | 3300005329 | Bacteria | 3317 |
| 28 | Ga0070683_100307367 | 3300005329 | Bacteria | 1508 |
| 29 | Ga0070690_100055358 | 3300005330 | Bacteria | 2541 |
| 30 | Ga0070690_101283815 | 3300005330 | Bacteria | 586 |
| 31 | Ga0070670_100003945 | 3300005331 | Bacteria | 12379 |
| 32 | Ga0070670_100038379 | 3300005331 | Bacteria | 4119 |
| 33 | Ga0070677_10008635 | 3300005333 | Bacteria | 3435 |
| 34 | Ga0070677_10666361 | 3300005333 | Bacteria | 583 |
| 35 | Ga0068869_100001726 | 3300005334 | Bacteria | 13057 |
| 36 | Ga0068869_100043396 | 3300005334 | Bacteria | 3229 |
| 37 | Ga0068869_101269207 | 3300005334 | Bacteria | 649 |
| 38 | Ga0068869_101385045 | 3300005334 | Bacteria | 622 |
| 39 | Ga0070666_10018142 | 3300005335 | Bacteria | 4520 |
| 40 | Ga0070666_10054209 | 3300005335 | Bacteria | 2705 |
| 41 | Ga0070666_10076867 | 3300005335 | Bacteria | 2278 |
| 42 | Ga0070666_10113694 | 3300005335 | Bacteria | 1873 |
| 43 | Ga0070666_10947841 | 3300005335 | Bacteria | 637 |
| 44 | Ga0070680_100075561 | 3300005336 | Bacteria | 2773 |
| 45 | Ga0070680_100107381 | 3300005336 | Bacteria | 2322 |
| 46 | Ga0070680_100152520 | 3300005336 | Bacteria | 1940 |
| 47 | Ga0070680_100153174 | 3300005336 | Unclassified | 1936 |
| 48 | Ga0070680_100286226 | 3300005336 | Bacteria | 1397 |
| 49 | Ga0070680_100560506 | 3300005336 | Bacteria | 979 |
| 50 | Ga0070680_100612333 | 3300005336 | Bacteria | 935 |
| 51 | Ga0070680_100994740 | 3300005336 | Bacteria | 724 |
| 52 | Ga0070680_101115834 | 3300005336 | Bacteria | 682 |
| 53 | Ga0070680_101321102 | 3300005336 | Bacteria | 624 |
| 54 | Ga0070682_100008051 | 3300005337 | Bacteria | 5936 |
| 55 | Ga0070682_100126134 | 3300005337 | Bacteria | 1725 |
| 56 | Ga0070682_100158085 | 3300005337 | Bacteria | 1562 |
| 57 | Ga0070682_100289385 | 3300005337 | Bacteria | 1197 |
| 58 | Ga0070682_100774831 | 3300005337 | Bacteria | 777 |
| 59 | Ga0068868_100002997 | 3300005338 | Bacteria | 11735 |
| 60 | Ga0068868_100020426 | 3300005338 | Bacteria | 4976 |
| 61 | Ga0068868_100290804 | 3300005338 | Bacteria | 1385 |
| 62 | Ga0068868_101152182 | 3300005338 | Bacteria | 715 |
| 63 | Ga0070660_100014330 | 3300005339 | Bacteria | 5709 |
| 64 | Ga0070660_100084372 | 3300005339 | Bacteria | 2496 |
| 65 | Ga0070660_100087160 | 3300005339 | Unclassified | 2457 |
| 66 | Ga0070660_100100200 | 3300005339 | Bacteria | 2294 |
| 67 | Ga0070660_100165686 | 3300005339 | Bacteria | 1783 |
| 68 | Ga0070660_100178381 | 3300005339 | Bacteria | 1718 |
| 69 | Ga0070660_100618630 | 3300005339 | Bacteria | 906 |
| 70 | Ga0070660_100836793 | 3300005339 | Bacteria | 775 |
| 71 | Ga0070660_101126500 | 3300005339 | Bacteria | 664 |
| 72 | Ga0070689_100067085 | 3300005340 | Bacteria | 2796 |
| 73 | Ga0070689_100110645 | 3300005340 | Bacteria | 2184 |
| 74 | Ga0070689_100327815 | 3300005340 | Unclassified | 1280 |
| 75 | Ga0070689_100399077 | 3300005340 | Bacteria | 1162 |
| 76 | Ga0070689_100842324 | 3300005340 | Bacteria | 809 |
| 77 | Ga0070691_10522192 | 3300005341 | Unclassified | 689 |
| 78 | Ga0070687_100001840 | 3300005343 | Bacteria | 7678 |
| 79 | Ga0070687_100140135 | 3300005343 | Unclassified | 1407 |
| 80 | Ga0070687_100464332 | 3300005343 | Bacteria | 845 |
| 81 | Ga0070661_100073479 | 3300005344 | Bacteria | 2517 |
| 82 | Ga0070661_100168682 | 3300005344 | Bacteria | 1661 |
| 83 | Ga0070661_100190755 | 3300005344 | Unclassified | 1563 |
| 84 | Ga0070661_100957281 | 3300005344 | Unclassified | 709 |
| 85 | Ga0070661_101680762 | 3300005344 | Unclassified | 538 |
| 86 | Ga0070692_10172236 | 3300005345 | Bacteria | 1248 |
| 87 | Ga0070692_10291007 | 3300005345 | Bacteria | 994 |
| 88 | Ga0070668_100003692 | 3300005347 | Bacteria | 11309 |
| 89 | Ga0070668_100081837 | 3300005347 | Bacteria | 2532 |
| 90 | Ga0070669_100003850 | 3300005353 | Bacteria | 10843 |
| 91 | Ga0070669_100005119 | 3300005353 | Bacteria | 9479 |
| 92 | Ga0070669_100015754 | 3300005353 | Bacteria | 5390 |
| 93 | Ga0070675_100009409 | 3300005354 | Bacteria | 7603 |
| 94 | Ga0070675_100271021 | 3300005354 | Bacteria | 1490 |
| 95 | Ga0070675_100314509 | 3300005354 | Unclassified | 1382 |
| 96 | Ga0070675_100333965 | 3300005354 | Bacteria | 1341 |
| 97 | Ga0070675_100632150 | 3300005354 | Bacteria | 972 |
| 98 | Ga0070675_101087962 | 3300005354 | Bacteria | 735 |
| 99 | Ga0070675_101983338 | 3300005354 | Bacteria | 537 |
| 100 | Ga0070671_100171947 | 3300005355 | Bacteria | 1833 |
| 101 | Ga0070671_100227365 | 3300005355 | Bacteria | 1583 |
| 102 | Ga0070671_100365827 | 3300005355 | Unclassified | 1231 |
| 103 | Ga0070674_100189458 | 3300005356 | Bacteria | 1581 |
| 104 | Ga0070674_100211449 | 3300005356 | Unclassified | 1503 |
| 105 | Ga0070674_100421931 | 3300005356 | Bacteria | 1095 |
| 106 | Ga0070674_100517064 | 3300005356 | Bacteria | 997 |
| 107 | Ga0070674_100733963 | 3300005356 | Bacteria | 847 |
| 108 | Ga0070673_100029628 | 3300005364 | Unclassified | 4084 |
| 109 | Ga0070673_100588816 | 3300005364 | Bacteria | 1014 |
| 110 | Ga0070673_101218483 | 3300005364 | Bacteria | 705 |
| 111 | Ga0070688_100091372 | 3300005365 | Bacteria | 1989 |
| 112 | Ga0070688_100317300 | 3300005365 | Unclassified | 1131 |
| 113 | Ga0070688_100820135 | 3300005365 | Bacteria | 729 |
| 114 | Ga0070688_101812804 | 3300005365 | Bacteria | 501 |
| 115 | Ga0070659_100002666 | 3300005366 | Bacteria | 12691 |
| 116 | Ga0070659_100005672 | 3300005366 | Bacteria | 8976 |
| 117 | Ga0070659_100020948 | 3300005366 | Bacteria | 4972 |
| 118 | Ga0070659_100146655 | 3300005366 | Bacteria | 1923 |
| 119 | Ga0070659_100344500 | 3300005366 | Bacteria | 1249 |
| 120 | Ga0070659_100590702 | 3300005366 | Bacteria | 953 |
| 121 | Ga0070667_100012858 | 3300005367 | Bacteria | 6916 |
| 122 | Ga0070667_100039392 | 3300005367 | Bacteria | 3961 |
| 123 | Ga0070667_100138543 | 3300005367 | Bacteria | 2129 |
| 124 | Ga0070667_100299692 | 3300005367 | Bacteria | 1447 |
| 125 | Ga0070667_100335736 | 3300005367 | Unclassified | 1366 |
| 126 | Ga0070709_10013822 | 3300005434 | Bacteria | 4550 |
| 127 | Ga0070709_10022458 | 3300005434 | Bacteria | 3691 |
| 128 | Ga0070709_10028444 | 3300005434 | Bacteria | 3333 |
| 129 | Ga0070709_10101067 | 3300005434 | Bacteria | 1921 |
| 130 | Ga0070709_10157872 | 3300005434 | Bacteria | 1574 |
| 131 | Ga0070709_10173118 | 3300005434 | Bacteria | 1510 |
| 132 | Ga0070709_10198254 | 3300005434 | Bacteria | 1420 |
| 133 | Ga0070709_10218868 | 3300005434 | Bacteria | 1357 |
| 134 | Ga0070709_10827624 | 3300005434 | Unclassified | 728 |
| 135 | Ga0070714_100008559 | 3300005435 | Bacteria | 8000 |
| 136 | Ga0070714_100079767 | 3300005435 | Bacteria | 2846 |
| 137 | Ga0070714_100169170 | 3300005435 | Bacteria | 1982 |
| 138 | Ga0070714_100173109 | 3300005435 | Bacteria | 1960 |
| 139 | Ga0070714_100200496 | 3300005435 | Bacteria | 1825 |
| 140 | Ga0070714_100273817 | 3300005435 | Bacteria | 1566 |
| 141 | Ga0070714_100571329 | 3300005435 | Unclassified | 1084 |
| 142 | Ga0070714_100832148 | 3300005435 | Unclassified | 895 |
| 143 | Ga0070714_101467519 | 3300005435 | Bacteria | 666 |
| 144 | Ga0070714_101860292 | 3300005435 | Unclassified | 588 |
| 145 | Ga0070713_100031891 | 3300005436 | Bacteria | 4202 |
| 146 | Ga0070713_100054101 | 3300005436 | Bacteria | 3329 |
| 147 | Ga0070713_100253781 | 3300005436 | Bacteria | 1605 |
| 148 | Ga0070713_100596834 | 3300005436 | Bacteria | 1049 |
| 149 | Ga0070713_101262329 | 3300005436 | Unclassified | 715 |
| 150 | Ga0070713_101485823 | 3300005436 | Unclassified | 657 |
| 151 | Ga0070713_101651276 | 3300005436 | Bacteria | 622 |
| 152 | Ga0070710_10032552 | 3300005437 | Bacteria | 2825 |
| 153 | Ga0070710_10049421 | 3300005437 | Bacteria | 2352 |
| 154 | Ga0070710_10297599 | 3300005437 | Unclassified | 1052 |
| 155 | Ga0070710_10650914 | 3300005437 | Unclassified | 739 |
| 156 | Ga0070711_100002998 | 3300005439 | Bacteria | 9750 |
| 157 | Ga0070711_100003181 | 3300005439 | Bacteria | 9527 |
| 158 | Ga0070711_100009164 | 3300005439 | Bacteria | 6083 |
| 159 | Ga0070711_100245733 | 3300005439 | Bacteria | 1401 |
| 160 | Ga0070711_100600650 | 3300005439 | Bacteria | 918 |
| 161 | Ga0070711_101149337 | 3300005439 | Bacteria | 670 |
| 162 | Ga0070711_101741672 | 3300005439 | Bacteria | 546 |
| 163 | Ga0070700_100220340 | 3300005441 | Bacteria | 1344 |
| 164 | Ga0070700_100353091 | 3300005441 | Bacteria | 1091 |
| 165 | Ga0070694_100036045 | 3300005444 | Bacteria | 3274 |
| 166 | Ga0070708_100101920 | 3300005445 | Unclassified | 2630 |
| 167 | Ga0070708_100112405 | 3300005445 | Bacteria | 2505 |
| 168 | Ga0070708_100173433 | 3300005445 | Bacteria | 2014 |
| 169 | Ga0070708_100430714 | 3300005445 | Bacteria | 1244 |
| 170 | Ga0070708_100704655 | 3300005445 | Bacteria | 950 |
| 171 | Ga0070663_100018203 | 3300005455 | Unclassified | 4599 |
| 172 | Ga0070663_100020969 | 3300005455 | Bacteria | 4336 |
| 173 | Ga0070663_100140869 | 3300005455 | Bacteria | 1841 |
| 174 | Ga0070663_100222803 | 3300005455 | Bacteria | 1481 |
| 175 | Ga0070663_100870956 | 3300005455 | Unclassified | 776 |
| 176 | Ga0070663_100942412 | 3300005455 | Unclassified | 748 |
| 177 | Ga0070678_100506091 | 3300005456 | Bacteria | 1066 |
| 178 | Ga0070678_100978581 | 3300005456 | Bacteria | 777 |
| 179 | Ga0070678_101463464 | 3300005456 | Bacteria | 639 |
| 180 | Ga0070662_100002683 | 3300005457 | Bacteria | 10979 |
| 181 | Ga0070662_100019519 | 3300005457 | Unclassified | 4602 |
| 182 | Ga0070662_100319859 | 3300005457 | Unclassified | 1265 |
| 183 | Ga0070662_100348908 | 3300005457 | Bacteria | 1212 |
| 184 | Ga0070681_10000034 | 3300005458 | Bacteria | 98600 |
| 185 | Ga0070681_10000866 | 3300005458 | Bacteria | 25486 |
| 186 | Ga0070681_10004801 | 3300005458 | Bacteria | 12958 |
| 187 | Ga0070681_10015551 | 3300005458 | Bacteria | 7579 |
| 188 | Ga0070681_10053214 | 3300005458 | Bacteria | 4034 |
| 189 | Ga0070681_10066651 | 3300005458 | Bacteria | 3569 |
| 190 | Ga0070681_10110791 | 3300005458 | Bacteria | 2684 |
| 191 | Ga0070681_10124433 | 3300005458 | Bacteria | 2511 |
| 192 | Ga0070681_10257813 | 3300005458 | Bacteria | 1656 |
| 193 | Ga0070681_10331415 | 3300005458 | Bacteria | 1432 |
| 194 | Ga0070681_10480312 | 3300005458 | Bacteria | 1155 |
| 195 | Ga0070681_10587272 | 3300005458 | Bacteria | 1028 |
| 196 | Ga0070681_10849360 | 3300005458 | Bacteria | 831 |
| 197 | Ga0070681_11092996 | 3300005458 | Unclassified | 718 |
| 198 | Ga0070681_11220825 | 3300005458 | Bacteria | 674 |
| 199 | Ga0068867_100002188 | 3300005459 | Bacteria | 13721 |
| 200 | Ga0068867_100003854 | 3300005459 | Bacteria | 10546 |
| 201 | Ga0068867_100013806 | 3300005459 | Bacteria | 5719 |
| 202 | Ga0068867_100038423 | 3300005459 | Bacteria | 3485 |
| 203 | Ga0068867_100046167 | 3300005459 | Bacteria | 3198 |
| 204 | Ga0068867_100312526 | 3300005459 | Bacteria | 1299 |
| 205 | Ga0068867_100929926 | 3300005459 | Bacteria | 784 |
| 206 | Ga0068867_101267561 | 3300005459 | Bacteria | 679 |
| 207 | Ga0068867_101273963 | 3300005459 | Bacteria | 678 |
| 208 | Ga0070685_10020596 | 3300005466 | Bacteria | 3569 |
| 209 | Ga0070685_10203978 | 3300005466 | Bacteria | 1287 |
| 210 | Ga0070685_10516900 | 3300005466 | Unclassified | 847 |
| 211 | Ga0070706_100004512 | 3300005467 | Bacteria | 13405 |
| 212 | Ga0070706_100031340 | 3300005467 | Bacteria | 4903 |
| 213 | Ga0070706_100233730 | 3300005467 | Unclassified | 1716 |
| 214 | Ga0070706_101018619 | 3300005467 | Unclassified | 763 |
| 215 | Ga0070706_102027529 | 3300005467 | Bacteria | 521 |
| 216 | Ga0070707_100019321 | 3300005468 | Bacteria | 6417 |
| 217 | Ga0070707_100062647 | 3300005468 | Bacteria | 3568 |
| 218 | Ga0070707_100070745 | 3300005468 | Bacteria | 3360 |
| 219 | Ga0070707_100386866 | 3300005468 | Bacteria | 1358 |
| 220 | Ga0070707_100644972 | 3300005468 | Bacteria | 1021 |
| 221 | Ga0070707_100702543 | 3300005468 | Bacteria | 974 |
| 222 | Ga0070707_101267169 | 3300005468 | Bacteria | 703 |
| 223 | Ga0070698_100003066 | 3300005471 | Bacteria | 18422 |
| 224 | Ga0070698_100048069 | 3300005471 | Unclassified | 4360 |
| 225 | Ga0070698_100082784 | 3300005471 | Bacteria | 3200 |
| 226 | Ga0070698_100251452 | 3300005471 | Bacteria | 1700 |
| 227 | Ga0070698_100422048 | 3300005471 | Bacteria | 1268 |
| 228 | Ga0070699_100010361 | 3300005518 | Bacteria | 8062 |
| 229 | Ga0070699_100095096 | 3300005518 | Bacteria | 2608 |
| 230 | Ga0070699_100273406 | 3300005518 | Bacteria | 1513 |
| 231 | Ga0070699_100562450 | 3300005518 | Bacteria | 1038 |
| 232 | Ga0070699_100781710 | 3300005518 | Bacteria | 873 |
| 233 | Ga0070699_101204775 | 3300005518 | Bacteria | 695 |
| 234 | Ga0070699_102115654 | 3300005518 | Bacteria | 514 |
| 235 | Ga0070679_100004353 | 3300005530 | Bacteria | 13079 |
| 236 | Ga0070679_100131869 | 3300005530 | Bacteria | 2480 |
| 237 | Ga0070679_100278304 | 3300005530 | Bacteria | 1626 |
| 238 | Ga0070679_100311181 | 3300005530 | Bacteria | 1525 |
| 239 | Ga0070679_100509907 | 3300005530 | Bacteria | 1147 |
| 240 | Ga0070679_100565309 | 3300005530 | Bacteria | 1081 |
| 241 | Ga0070679_100687620 | 3300005530 | Bacteria | 966 |
| 242 | Ga0070679_100749370 | 3300005530 | Unclassified | 919 |
| 243 | Ga0070679_101154407 | 3300005530 | Bacteria | 719 |
| 244 | Ga0070679_101238367 | 3300005530 | Unclassified | 692 |
| 245 | Ga0070684_100009298 | 3300005535 | Bacteria | 7736 |
| 246 | Ga0070684_100032072 | 3300005535 | Bacteria | 4476 |
| 247 | Ga0070684_100032814 | 3300005535 | Bacteria | 4430 |
| 248 | Ga0070684_100090844 | 3300005535 | Bacteria | 2716 |
| 249 | Ga0070684_100102391 | 3300005535 | Bacteria | 2560 |
| 250 | Ga0070684_100139502 | 3300005535 | Bacteria | 2192 |
| 251 | Ga0070684_100141434 | 3300005535 | Bacteria | 2176 |
| 252 | Ga0070684_100149776 | 3300005535 | Bacteria | 2113 |
| 253 | Ga0070684_100366017 | 3300005535 | Bacteria | 1327 |
| 254 | Ga0070684_100426222 | 3300005535 | Bacteria | 1225 |
| 255 | Ga0070684_100637644 | 3300005535 | Bacteria | 991 |
| 256 | Ga0070684_101002781 | 3300005535 | Unclassified | 784 |
| 257 | Ga0070684_102140132 | 3300005535 | Bacteria | 528 |
| 258 | Ga0070697_100038980 | 3300005536 | Bacteria | 3840 |
| 259 | Ga0070697_100083399 | 3300005536 | Bacteria | 2636 |
| 260 | Ga0070697_100159347 | 3300005536 | Bacteria | 1906 |
| 261 | Ga0070697_100254727 | 3300005536 | Bacteria | 1501 |
| 262 | Ga0070697_100929069 | 3300005536 | Bacteria | 772 |
| 263 | Ga0070697_101541598 | 3300005536 | Bacteria | 594 |
| 264 | Ga0068853_100006343 | 3300005539 | Bacteria | 9387 |
| 265 | Ga0068853_100023709 | 3300005539 | Bacteria | 5141 |
| 266 | Ga0068853_100023953 | 3300005539 | Bacteria | 5116 |
| 267 | Ga0068853_100054558 | 3300005539 | Bacteria | 3444 |
| 268 | Ga0068853_100136453 | 3300005539 | Unclassified | 2200 |
| 269 | Ga0068853_100208592 | 3300005539 | Unclassified | 1780 |
| 270 | Ga0068853_100474674 | 3300005539 | Bacteria | 1179 |
| 271 | Ga0068853_100560559 | 3300005539 | Bacteria | 1083 |
| 272 | Ga0068853_100788036 | 3300005539 | Bacteria | 910 |
| 273 | Ga0070672_100131384 | 3300005543 | Bacteria | 2058 |
| 274 | Ga0070672_101200556 | 3300005543 | Bacteria | 676 |
| 275 | Ga0070672_101270673 | 3300005543 | Bacteria | 657 |
| 276 | Ga0070686_100001440 | 3300005544 | Bacteria | 13445 |
| 277 | Ga0070686_100007852 | 3300005544 | Bacteria | 5965 |
| 278 | Ga0070686_100049173 | 3300005544 | Bacteria | 2674 |
| 279 | Ga0070695_100032054 | 3300005545 | Unclassified | 3284 |
| 280 | Ga0070695_100208066 | 3300005545 | Bacteria | 1402 |
| 281 | Ga0070695_100972452 | 3300005545 | Bacteria | 689 |
| 282 | Ga0070693_100010082 | 3300005547 | Bacteria | 4718 |
| 283 | Ga0070693_100036873 | 3300005547 | Bacteria | 2721 |
| 284 | Ga0070693_100198595 | 3300005547 | Bacteria | 1301 |
| 285 | Ga0070665_100008136 | 3300005548 | Bacteria | 10615 |
| 286 | Ga0070665_100066861 | 3300005548 | Bacteria | 3605 |
| 287 | Ga0070704_100142682 | 3300005549 | Unclassified | 1872 |
| 288 | Ga0070704_100214449 | 3300005549 | Unclassified | 1562 |
| 289 | Ga0068855_100001570 | 3300005563 | Bacteria | 28673 |
| 290 | Ga0068855_100002685 | 3300005563 | Bacteria | 21936 |
| 291 | Ga0068855_100004336 | 3300005563 | Bacteria | 17344 |
| 292 | Ga0068855_100008443 | 3300005563 | Bacteria | 12454 |
| 293 | Ga0068855_100008940 | 3300005563 | Bacteria | 12109 |
| 294 | Ga0068855_100064834 | 3300005563 | Bacteria | 4260 |
| 295 | Ga0068855_100184044 | 3300005563 | Bacteria | 2361 |
| 296 | Ga0068855_100304257 | 3300005563 | Bacteria | 1765 |
| 297 | Ga0068855_100308434 | 3300005563 | Bacteria | 1751 |
| 298 | Ga0068855_100452362 | 3300005563 | Bacteria | 1401 |
| 299 | Ga0068855_100456708 | 3300005563 | Unclassified | 1393 |
| 300 | Ga0068855_100488219 | 3300005563 | Bacteria | 1340 |
| 301 | Ga0068855_100514410 | 3300005563 | Bacteria | 1299 |
| 302 | Ga0068855_100553639 | 3300005563 | Bacteria | 1245 |
| 303 | Ga0068855_100922035 | 3300005563 | Bacteria | 922 |
| 304 | Ga0068855_100929057 | 3300005563 | Bacteria | 917 |
| 305 | Ga0068855_101753069 | 3300005563 | Bacteria | 632 |
| 306 | Ga0068855_102033078 | 3300005563 | Unclassified | 580 |
| 307 | Ga0070664_100003262 | 3300005564 | Bacteria | 13103 |
| 308 | Ga0070664_100012731 | 3300005564 | Bacteria | 6846 |
| 309 | Ga0070664_100081223 | 3300005564 | Bacteria | 2793 |
| 310 | Ga0070664_100166698 | 3300005564 | Bacteria | 1952 |
| 311 | Ga0070664_100199625 | 3300005564 | Bacteria | 1784 |
| 312 | Ga0070664_100212178 | 3300005564 | Bacteria | 1730 |
| 313 | Ga0070664_100215277 | 3300005564 | Bacteria | 1717 |
| 314 | Ga0070664_100994725 | 3300005564 | Unclassified | 788 |
| 315 | Ga0070664_101188301 | 3300005564 | Bacteria | 719 |
| 316 | Ga0070664_102389646 | 3300005564 | Unclassified | 501 |
| 317 | Ga0068857_100001766 | 3300005577 | Bacteria | 17387 |
| 318 | Ga0068857_100008687 | 3300005577 | Bacteria | 8790 |
| 319 | Ga0068857_100136799 | 3300005577 | Bacteria | 2212 |
| 320 | Ga0068857_100193153 | 3300005577 | Bacteria | 1854 |
| 321 | Ga0068857_100262556 | 3300005577 | Bacteria | 1585 |
| 322 | Ga0068857_100634991 | 3300005577 | Bacteria | 1011 |
| 323 | Ga0068854_100010285 | 3300005578 | Bacteria | 6064 |
| 324 | Ga0068854_100014154 | 3300005578 | Bacteria | 5252 |
| 325 | Ga0068854_100014415 | 3300005578 | Bacteria | 5212 |
| 326 | Ga0068854_100267898 | 3300005578 | Bacteria | 1370 |
| 327 | Ga0068854_100409927 | 3300005578 | Bacteria | 1123 |
| 328 | Ga0068854_100433188 | 3300005578 | Bacteria | 1094 |
| 329 | Ga0068854_100492617 | 3300005578 | Unclassified | 1031 |
| 330 | Ga0068854_100579220 | 3300005578 | Unclassified | 955 |
| 331 | Ga0068854_101500153 | 3300005578 | Bacteria | 612 |
| 332 | Ga0068856_100000494 | 3300005614 | Bacteria | 43641 |
| 333 | Ga0068856_100000571 | 3300005614 | Bacteria | 40367 |
| 334 | Ga0068856_100012826 | 3300005614 | Bacteria | 8110 |
| 335 | Ga0068856_100020988 | 3300005614 | Bacteria | 6347 |
| 336 | Ga0068856_100025816 | 3300005614 | Bacteria | 5729 |
| 337 | Ga0068856_100067395 | 3300005614 | Bacteria | 3537 |
| 338 | Ga0068856_100244501 | 3300005614 | Unclassified | 1809 |
| 339 | Ga0068856_100503913 | 3300005614 | Bacteria | 1232 |
| 340 | Ga0068856_100757148 | 3300005614 | Bacteria | 991 |
| 341 | Ga0068856_100956440 | 3300005614 | Bacteria | 875 |
| 342 | Ga0070702_100010550 | 3300005615 | Bacteria | 4557 |
| 343 | Ga0070702_100151567 | 3300005615 | Bacteria | 1489 |
| 344 | Ga0070702_100585260 | 3300005615 | Unclassified | 834 |
| 345 | Ga0068852_100019955 | 3300005616 | Bacteria | 5320 |
| 346 | Ga0068852_100027091 | 3300005616 | Bacteria | 4666 |
| 347 | Ga0068852_100054256 | 3300005616 | Bacteria | 3454 |
| 348 | Ga0068852_100069129 | 3300005616 | Bacteria | 3094 |
| 349 | Ga0068852_100079200 | 3300005616 | Bacteria | 2910 |
| 350 | Ga0068852_100098365 | 3300005616 | Bacteria | 2634 |
| 351 | Ga0068852_100251898 | 3300005616 | Bacteria | 1692 |
| 352 | Ga0068852_100375349 | 3300005616 | Bacteria | 1394 |
| 353 | Ga0068852_100801204 | 3300005616 | Bacteria | 956 |
| 354 | Ga0068852_100899419 | 3300005616 | Bacteria | 902 |
| 355 | Ga0068852_100917667 | 3300005616 | Bacteria | 893 |
| 356 | Ga0068852_102272074 | 3300005616 | Bacteria | 564 |
| 357 | Ga0068852_102805074 | 3300005616 | Bacteria | 506 |
| 358 | Ga0068859_100000492 | 3300005617 | Bacteria | 38877 |
| 359 | Ga0068859_100074505 | 3300005617 | Bacteria | 3433 |
| 360 | Ga0068864_100000824 | 3300005618 | Bacteria | 26117 |
| 361 | Ga0068864_100013098 | 3300005618 | Bacteria | 6869 |
| 362 | Ga0068864_100065215 | 3300005618 | Bacteria | 3159 |
| 363 | Ga0068864_100167207 | 3300005618 | Unclassified | 2003 |
| 364 | Ga0068864_100195582 | 3300005618 | Bacteria | 1855 |
| 365 | Ga0068864_100230741 | 3300005618 | Bacteria | 1712 |
| 366 | Ga0068864_101128535 | 3300005618 | Unclassified | 781 |
| 367 | Ga0068864_101387445 | 3300005618 | Bacteria | 704 |
| 368 | Ga0068864_101890436 | 3300005618 | Bacteria | 603 |
| 369 | Ga0068866_10012445 | 3300005718 | Bacteria | 3706 |
| 370 | Ga0068866_10019171 | 3300005718 | Bacteria | 3108 |
| 371 | Ga0068866_10124922 | 3300005718 | Bacteria | 1455 |
| 372 | Ga0068866_10279063 | 3300005718 | Unclassified | 1034 |
| 373 | Ga0068866_10315632 | 3300005718 | Bacteria | 981 |
| 374 | Ga0068866_10407211 | 3300005718 | Bacteria | 879 |
| 375 | Ga0068866_10649388 | 3300005718 | Bacteria | 718 |
| 376 | Ga0068861_100011158 | 3300005719 | Bacteria | 6239 |
| 377 | Ga0068861_100063942 | 3300005719 | Bacteria | 2830 |
| 378 | Ga0068851_10005651 | 3300005834 | Bacteria | 5681 |
| 379 | Ga0068851_10014132 | 3300005834 | Bacteria | 3786 |
| 380 | Ga0068851_10045214 | 3300005834 | Bacteria | 2225 |
| 381 | Ga0068851_10064097 | 3300005834 | Bacteria | 1888 |
| 382 | Ga0068851_10076787 | 3300005834 | Bacteria | 1738 |
| 383 | Ga0068870_10013857 | 3300005840 | Bacteria | 3798 |
| 384 | Ga0068870_10047272 | 3300005840 | Bacteria | 2262 |
| 385 | Ga0068863_100002384 | 3300005841 | Bacteria | 18685 |
| 386 | Ga0068863_100088618 | 3300005841 | Bacteria | 2933 |
| 387 | Ga0068863_100131057 | 3300005841 | Bacteria | 2394 |
| 388 | Ga0068863_100340322 | 3300005841 | Bacteria | 1459 |
| 389 | Ga0068863_101859382 | 3300005841 | Bacteria | 612 |
| 390 | Ga0068858_100001288 | 3300005842 | Bacteria | 25901 |
| 391 | Ga0068858_100001544 | 3300005842 | Bacteria | 23649 |
| 392 | Ga0068858_100021746 | 3300005842 | Bacteria | 5992 |
| 393 | Ga0068858_100041995 | 3300005842 | Bacteria | 4240 |
| 394 | Ga0068858_100254555 | 3300005842 | Bacteria | 1668 |
| 395 | Ga0068858_101029876 | 3300005842 | Bacteria | 807 |
| 396 | Ga0068858_101848427 | 3300005842 | Bacteria | 597 |
| 397 | Ga0068858_102118706 | 3300005842 | Unclassified | 556 |
| 398 | Ga0068860_100005288 | 3300005843 | Bacteria | 13101 |
| 399 | Ga0068860_100048364 | 3300005843 | Bacteria | 4053 |
| 400 | Ga0068860_100079065 | 3300005843 | Bacteria | 3127 |
| 401 | Ga0068860_100389342 | 3300005843 | Bacteria | 1377 |
| 402 | Ga0068862_100009136 | 3300005844 | Bacteria | 8205 |
| 403 | Ga0068862_100028003 | 3300005844 | Unclassified | 4746 |
| 404 | Ga0068862_100234747 | 3300005844 | Bacteria | 1665 |
| 405 | Ga0070717_10022337 | 3300006028 | Bacteria | 4997 |
| 406 | Ga0070717_10024241 | 3300006028 | Bacteria | 4816 |
| 407 | Ga0070717_10067404 | 3300006028 | Bacteria | 2978 |
| 408 | Ga0070717_10067722 | 3300006028 | Bacteria | 2971 |
| 409 | Ga0070717_10071819 | 3300006028 | Bacteria | 2888 |
| 410 | Ga0070717_10082774 | 3300006028 | Bacteria | 2697 |
| 411 | Ga0070717_10118244 | 3300006028 | Bacteria | 2268 |
| 412 | Ga0070717_10132130 | 3300006028 | Bacteria | 2147 |
| 413 | Ga0070717_10180915 | 3300006028 | Bacteria | 1838 |
| 414 | Ga0070717_10233836 | 3300006028 | Bacteria | 1619 |
| 415 | Ga0070717_10339978 | 3300006028 | Bacteria | 1340 |
| 416 | Ga0070717_10484587 | 3300006028 | Bacteria | 1117 |
| 417 | Ga0070717_10538846 | 3300006028 | Bacteria | 1057 |
| 418 | Ga0070717_10551574 | 3300006028 | Bacteria | 1044 |
| 419 | Ga0070717_10725068 | 3300006028 | Bacteria | 903 |
| 420 | Ga0070717_10762431 | 3300006028 | Bacteria | 880 |
| 421 | Ga0070717_10974339 | 3300006028 | Unclassified | 772 |
| 422 | Ga0070717_11902935 | 3300006028 | Bacteria | 537 |
| 423 | Ga0070715_10072093 | 3300006163 | Unclassified | 1546 |
| 424 | Ga0070715_10287454 | 3300006163 | Bacteria | 874 |
| 425 | Ga0070715_10472278 | 3300006163 | Bacteria | 712 |
| 426 | Ga0070716_100015742 | 3300006173 | Bacteria | 3891 |
| 427 | Ga0070716_100018398 | 3300006173 | Bacteria | 3639 |
| 428 | Ga0070716_100074910 | 3300006173 | Bacteria | 2001 |
| 429 | Ga0070716_100126690 | 3300006173 | Bacteria | 1607 |
| 430 | Ga0070716_100161478 | 3300006173 | Bacteria | 1452 |
| 431 | Ga0070716_100336149 | 3300006173 | Bacteria | 1064 |
| 432 | Ga0070716_100599832 | 3300006173 | Bacteria | 828 |
| 433 | Ga0070716_100762141 | 3300006173 | Bacteria | 746 |
| 434 | Ga0070716_101284460 | 3300006173 | Bacteria | 591 |
| 435 | Ga0070712_100006231 | 3300006175 | Bacteria | 7385 |
| 436 | Ga0070712_100082778 | 3300006175 | Unclassified | 2328 |
| 437 | Ga0070712_100150532 | 3300006175 | Bacteria | 1786 |
| 438 | Ga0070712_100530535 | 3300006175 | Unclassified | 990 |
| 439 | Ga0070712_100558024 | 3300006175 | Bacteria | 966 |
| 440 | Ga0070712_100579700 | 3300006175 | Bacteria | 948 |
| 441 | Ga0070712_101044626 | 3300006175 | Bacteria | 708 |
| 442 | Ga0070712_101485410 | 3300006175 | Bacteria | 592 |
| 443 | Ga0070712_101727666 | 3300006175 | Bacteria | 548 |
| 444 | Ga0070712_101860946 | 3300006175 | Bacteria | 527 |
| 445 | Ga0070712_101931714 | 3300006175 | Bacteria | 517 |
| 446 | Ga0075367_11088914 | 3300006178 | Bacteria | 511 |
| 447 | Ga0075369_10588796 | 3300006186 | Bacteria | 532 |
| 448 | Ga0075366_10596748 | 3300006195 | Bacteria | 684 |
| 449 | Ga0097621_100000229 | 3300006237 | Bacteria | 37450 |
| 450 | Ga0097621_100000693 | 3300006237 | Bacteria | 23626 |
| 451 | Ga0097621_100137848 | 3300006237 | Bacteria | 2083 |
| 452 | Ga0097621_100141888 | 3300006237 | Bacteria | 2053 |
| 453 | Ga0097621_100148402 | 3300006237 | Bacteria | 2010 |
| 454 | Ga0097621_100200184 | 3300006237 | Bacteria | 1733 |
| 455 | Ga0097621_100386003 | 3300006237 | Unclassified | 1252 |
| 456 | Ga0075370_10553726 | 3300006353 | Bacteria | 695 |
| 457 | Ga0075370_10863884 | 3300006353 | Bacteria | 552 |
| 458 | Ga0068871_100000071 | 3300006358 | Bacteria | 57255 |
| 459 | Ga0068871_100000385 | 3300006358 | Bacteria | 31027 |
| 460 | Ga0068871_100058479 | 3300006358 | Bacteria | 3139 |
| 461 | Ga0068871_100078544 | 3300006358 | Bacteria | 2729 |
| 462 | Ga0068871_100489008 | 3300006358 | Bacteria | 1108 |
| 463 | Ga0068871_100680070 | 3300006358 | Bacteria | 941 |
| 464 | Ga0068871_100796269 | 3300006358 | Unclassified | 871 |
| 465 | Ga0068871_100969087 | 3300006358 | Bacteria | 791 |
| 466 | Ga0075428_100091508 | 3300006844 | Bacteria | 3317 |
| 467 | Ga0075431_100112124 | 3300006847 | Bacteria | 2815 |
| 468 | Ga0075431_100149163 | 3300006847 | Bacteria | 2408 |
| 469 | Ga0075431_101463496 | 3300006847 | Unclassified | 642 |
| 470 | Ga0075433_10074837 | 3300006852 | Bacteria | 2980 |
| 471 | Ga0075433_10083094 | 3300006852 | Bacteria | 2826 |
| 472 | Ga0075433_10250864 | 3300006852 | Bacteria | 1570 |
| 473 | Ga0075433_10603100 | 3300006852 | Unclassified | 964 |
| 474 | Ga0075433_10893613 | 3300006852 | Unclassified | 775 |
| 475 | Ga0075434_100092177 | 3300006871 | Bacteria | 3032 |
| 476 | Ga0075434_100235761 | 3300006871 | Bacteria | 1850 |
| 477 | Ga0075434_100339306 | 3300006871 | Archaea | 1523 |
| 478 | Ga0075434_100501817 | 3300006871 | Bacteria | 1234 |
| 479 | Ga0075434_100651057 | 3300006871 | Bacteria | 1072 |
| 480 | Ga0075434_101123744 | 3300006871 | Bacteria | 799 |
| 481 | Ga0075429_101554111 | 3300006880 | Bacteria | 575 |
| 482 | Ga0068865_100007241 | 3300006881 | Bacteria | 6816 |
| 483 | Ga0068865_100008484 | 3300006881 | Bacteria | 6353 |
| 484 | Ga0068865_100055079 | 3300006881 | Bacteria | 2766 |
| 485 | Ga0068865_100341961 | 3300006881 | Bacteria | 1209 |
| 486 | Ga0068865_101606070 | 3300006881 | Bacteria | 584 |
| 487 | Ga0075436_100000697 | 3300006914 | Bacteria | 22196 |
| 488 | Ga0075436_100003624 | 3300006914 | Bacteria | 10593 |
| 489 | Ga0075436_100147844 | 3300006914 | Bacteria | 1652 |
| 490 | Ga0075436_100763269 | 3300006914 | Bacteria | 719 |
| 491 | Ga0075436_100832783 | 3300006914 | Bacteria | 688 |
| 492 | Ga0075436_101050582 | 3300006914 | Bacteria | 612 |
| 493 | Ga0075436_101327608 | 3300006914 | Bacteria | 544 |
| 494 | Ga0097620_100000492 | 3300006931 | Bacteria | 38877 |
| 495 | Ga0097620_100074504 | 3300006931 | Bacteria | 3433 |
| 496 | Ga0075435_100040851 | 3300007076 | Bacteria | 3705 |
| 497 | Ga0075435_100057986 | 3300007076 | Bacteria | 3134 |
| 498 | Ga0075435_100659858 | 3300007076 | Bacteria | 908 |
| 499 | Ga0075435_100711358 | 3300007076 | Unclassified | 873 |
| 500 | Ga0075435_100879516 | 3300007076 | Bacteria | 781 |
| 501 | Ga0099794_10045534 | 3300007265 | Bacteria | 2100 |
| 502 | Ga0099794_10057241 | 3300007265 | Unclassified | 1888 |
| 503 | Ga0099795_10002569 | 3300007788 | Bacteria | 4303 |
| 504 | Ga0099795_10083995 | 3300007788 | Bacteria | 1223 |
| 505 | Ga0099795_10332724 | 3300007788 | Bacteria | 675 |
| 506 | Ga0099795_10441934 | 3300007788 | Unclassified | 597 |
| 507 | Ga0105240_10049521 | 3300009093 | Bacteria | 5302 |
| 508 | Ga0105240_10099336 | 3300009093 | Bacteria | 3543 |
| 509 | Ga0105240_10167885 | 3300009093 | Bacteria | 2601 |
| 510 | Ga0105240_10171524 | 3300009093 | Bacteria | 2569 |
| 511 | Ga0105240_10190823 | 3300009093 | Bacteria | 2410 |
| 512 | Ga0105240_10216638 | 3300009093 | Bacteria | 2233 |
| 513 | Ga0105240_10293649 | 3300009093 | Bacteria | 1862 |
| 514 | Ga0105240_10331838 | 3300009093 | Bacteria | 1730 |
| 515 | Ga0105240_10721310 | 3300009093 | Bacteria | 1086 |
| 516 | Ga0105240_10941884 | 3300009093 | Bacteria | 927 |
| 517 | Ga0105240_12560500 | 3300009093 | Unclassified | 527 |
| 518 | Ga0111539_10461367 | 3300009094 | Bacteria | 1479 |
| 519 | Ga0111539_10840582 | 3300009094 | Unclassified | 1068 |
| 520 | Ga0105245_10045147 | 3300009098 | Bacteria | 3934 |
| 521 | Ga0105245_10090667 | 3300009098 | Bacteria | 2812 |
| 522 | Ga0105245_11629084 | 3300009098 | Bacteria | 697 |
| 523 | Ga0105245_13039597 | 3300009098 | Bacteria | 520 |
| 524 | Ga0105247_10009761 | 3300009101 | Bacteria | 5821 |
| 525 | Ga0105247_10033696 | 3300009101 | Bacteria | 3117 |
| 526 | Ga0105247_10534996 | 3300009101 | Bacteria | 859 |
| 527 | Ga0105247_11488170 | 3300009101 | Bacteria | 551 |
| 528 | Ga0114129_10017580 | 3300009147 | Bacteria | 10179 |
| 529 | Ga0114129_10613916 | 3300009147 | Unclassified | 1407 |
| 530 | Ga0114129_10676335 | 3300009147 | Bacteria | 1329 |
| 531 | Ga0105243_10024167 | 3300009148 | Bacteria | 4634 |
| 532 | Ga0105243_10262795 | 3300009148 | Bacteria | 1546 |
| 533 | Ga0105243_10555437 | 3300009148 | Bacteria | 1098 |
| 534 | Ga0105243_10752150 | 3300009148 | Unclassified | 956 |
| 535 | Ga0105241_10012600 | 3300009174 | Bacteria | 6203 |
| 536 | Ga0105241_10035957 | 3300009174 | Bacteria | 3726 |
| 537 | Ga0105241_10060437 | 3300009174 | Bacteria | 2915 |
| 538 | Ga0105241_10089093 | 3300009174 | Unclassified | 2431 |
| 539 | Ga0105241_10176533 | 3300009174 | Bacteria | 1769 |
| 540 | Ga0105241_12696890 | 3300009174 | Unclassified | 500 |
| 541 | Ga0105242_10003389 | 3300009176 | Bacteria | 12406 |
| 542 | Ga0105242_10083140 | 3300009176 | Bacteria | 2680 |
| 543 | Ga0105242_10161211 | 3300009176 | Bacteria | 1963 |
| 544 | Ga0105242_10190421 | 3300009176 | Bacteria | 1816 |
| 545 | Ga0105242_11216657 | 3300009176 | Unclassified | 773 |
| 546 | Ga0105242_12984224 | 3300009176 | Bacteria | 524 |
| 547 | Ga0105248_10006560 | 3300009177 | Bacteria | 12762 |
| 548 | Ga0105248_10014540 | 3300009177 | Bacteria | 8663 |
| 549 | Ga0105248_10027109 | 3300009177 | Bacteria | 6374 |
| 550 | Ga0105248_10042946 | 3300009177 | Bacteria | 5069 |
| 551 | Ga0105248_10158876 | 3300009177 | Bacteria | 2550 |
| 552 | Ga0105248_10260273 | 3300009177 | Bacteria | 1953 |
| 553 | Ga0105248_11941565 | 3300009177 | Bacteria | 668 |
| 554 | Ga0105248_12632921 | 3300009177 | Bacteria | 573 |
| 555 | Ga0105248_13136286 | 3300009177 | Bacteria | 526 |
| 556 | Ga0105237_10000998 | 3300009545 | Bacteria | 38080 |
| 557 | Ga0105237_10076207 | 3300009545 | Unclassified | 3344 |
| 558 | Ga0105237_10120418 | 3300009545 | Bacteria | 2619 |
| 559 | Ga0105237_10146511 | 3300009545 | Bacteria | 2356 |
| 560 | Ga0105237_10163256 | 3300009545 | Bacteria | 2226 |
| 561 | Ga0105237_10373749 | 3300009545 | Bacteria | 1430 |
| 562 | Ga0105237_10475712 | 3300009545 | Bacteria | 1255 |
| 563 | Ga0105237_10537681 | 3300009545 | Bacteria | 1175 |
| 564 | Ga0105237_10761076 | 3300009545 | Bacteria | 975 |
| 565 | Ga0105237_11360921 | 3300009545 | Bacteria | 716 |
| 566 | Ga0105237_12458177 | 3300009545 | Unclassified | 531 |
| 567 | Ga0105238_10028767 | 3300009551 | Bacteria | 5660 |
| 568 | Ga0105238_10131860 | 3300009551 | Bacteria | 2477 |
| 569 | Ga0105238_10820039 | 3300009551 | Bacteria | 946 |
| 570 | Ga0105238_12119577 | 3300009551 | Unclassified | 597 |
| 571 | Ga0105238_12797190 | 3300009551 | Unclassified | 524 |
| 572 | Ga0105238_13024992 | 3300009551 | Unclassified | 505 |
| 573 | Ga0105249_10025015 | 3300009553 | Bacteria | 5372 |
| 574 | Ga0105249_10039963 | 3300009553 | Bacteria | 4260 |
| 575 | Ga0105249_10149807 | 3300009553 | Bacteria | 2245 |
| 576 | Ga0105249_10168008 | 3300009553 | Bacteria | 2125 |
| 577 | Ga0105249_11158952 | 3300009553 | Bacteria | 844 |
| 578 | Ga0105249_12589822 | 3300009553 | Bacteria | 579 |
| 579 | Ga0099796_10073709 | 3300010159 | Bacteria | 1238 |
| 580 | Ga0099796_10255621 | 3300010159 | Bacteria | 729 |
| 581 | Ga0105239_10028158 | 3300010375 | Bacteria | 6182 |
| 582 | Ga0105239_10039915 | 3300010375 | Bacteria | 5142 |
| 583 | Ga0105239_10101256 | 3300010375 | Bacteria | 3187 |
| 584 | Ga0105239_10231297 | 3300010375 | Bacteria | 2074 |
| 585 | Ga0105239_10256097 | 3300010375 | Bacteria | 1966 |
| 586 | Ga0105239_10380145 | 3300010375 | Bacteria | 1596 |
| 587 | Ga0105239_10603711 | 3300010375 | Bacteria | 1252 |
| 588 | Ga0105239_10889992 | 3300010375 | Unclassified | 1022 |
| 589 | Ga0105246_10015894 | 3300011119 | Bacteria | 4760 |
| 590 | Ga0105246_10050958 | 3300011119 | Bacteria | 2841 |
| 591 | Ga0105246_10055236 | 3300011119 | Bacteria | 2740 |
| 592 | Ga0105246_10238306 | 3300011119 | Bacteria | 1437 |
| 593 | Ga0157314_1056418 | 3300012500 | Unclassified | 516 |
| 594 | Ga0157373_10002380 | 3300013100 | Bacteria | 14283 |
| 595 | Ga0157373_10003194 | 3300013100 | Bacteria | 12392 |
| 596 | Ga0157373_10041300 | 3300013100 | Bacteria | 3299 |
| 597 | Ga0157373_10077482 | 3300013100 | Bacteria | 2345 |
| 598 | Ga0157373_10144300 | 3300013100 | Bacteria | 1674 |
| 599 | Ga0157373_10459769 | 3300013100 | Unclassified | 917 |
| 600 | Ga0157373_11499334 | 3300013100 | Bacteria | 515 |
| 601 | Ga0157371_10002907 | 3300013102 | Bacteria | 16015 |
| 602 | Ga0157371_10022249 | 3300013102 | Bacteria | 4649 |
| 603 | Ga0157371_10045463 | 3300013102 | Bacteria | 3124 |
| 604 | Ga0157371_10160659 | 3300013102 | Bacteria | 1605 |
| 605 | Ga0157371_10505176 | 3300013102 | Unclassified | 893 |
| 606 | Ga0157370_10008943 | 3300013104 | Bacteria | 10760 |
| 607 | Ga0157370_10016839 | 3300013104 | Bacteria | 7388 |
| 608 | Ga0157370_10045791 | 3300013104 | Bacteria | 4197 |
| 609 | Ga0157370_10046476 | 3300013104 | Bacteria | 4162 |
| 610 | Ga0157370_10183386 | 3300013104 | Bacteria | 1944 |
| 611 | Ga0157370_10243312 | 3300013104 | Bacteria | 1664 |
| 612 | Ga0157370_10491969 | 3300013104 | Bacteria | 1127 |
| 613 | Ga0157370_10602076 | 3300013104 | Bacteria | 1006 |
| 614 | Ga0157370_11242881 | 3300013104 | Unclassified | 672 |
| 615 | Ga0157369_10010175 | 3300013105 | Bacteria | 10734 |
| 616 | Ga0157369_10018225 | 3300013105 | Bacteria | 7874 |
| 617 | Ga0157369_10021280 | 3300013105 | Bacteria | 7253 |
| 618 | Ga0157369_10060664 | 3300013105 | Bacteria | 4078 |
| 619 | Ga0157369_10104452 | 3300013105 | Bacteria | 3017 |
| 620 | Ga0157369_10118771 | 3300013105 | Bacteria | 2806 |
| 621 | Ga0157369_10184412 | 3300013105 | Bacteria | 2195 |
| 622 | Ga0157369_10212090 | 3300013105 | Bacteria | 2029 |
| 623 | Ga0157369_10274083 | 3300013105 | Bacteria | 1758 |
| 624 | Ga0157369_10327375 | 3300013105 | Bacteria | 1592 |
| 625 | Ga0157369_11041982 | 3300013105 | Bacteria | 837 |
| 626 | Ga0157369_11132291 | 3300013105 | Bacteria | 800 |
| 627 | Ga0157369_11209324 | 3300013105 | Bacteria | 771 |
| 628 | Ga0157369_11607726 | 3300013105 | Unclassified | 661 |
| 629 | Ga0157369_11798127 | 3300013105 | Bacteria | 622 |
| 630 | Ga0157374_10001377 | 3300013296 | Bacteria | 20643 |
| 631 | Ga0157374_10001647 | 3300013296 | Bacteria | 18695 |
| 632 | Ga0157374_10026911 | 3300013296 | Bacteria | 5180 |
| 633 | Ga0157374_10069083 | 3300013296 | Bacteria | 3326 |
| 634 | Ga0157374_10140347 | 3300013296 | Bacteria | 2345 |
| 635 | Ga0157374_10178983 | 3300013296 | Bacteria | 2070 |
| 636 | Ga0157374_10239311 | 3300013296 | Bacteria | 1785 |
| 637 | Ga0157374_10525369 | 3300013296 | Unclassified | 1190 |
| 638 | Ga0157374_11405916 | 3300013296 | Bacteria | 720 |
| 639 | Ga0157378_10000733 | 3300013297 | Bacteria | 30679 |
| 640 | Ga0157378_10005107 | 3300013297 | Bacteria | 11523 |
| 641 | Ga0157378_10062863 | 3300013297 | Bacteria | 3316 |
| 642 | Ga0157378_10078132 | 3300013297 | Bacteria | 2985 |
| 643 | Ga0157378_10119801 | 3300013297 | Unclassified | 2424 |
| 644 | Ga0157378_10125230 | 3300013297 | Bacteria | 2373 |
| 645 | Ga0157378_10526648 | 3300013297 | Bacteria | 1184 |
| 646 | Ga0157378_10671165 | 3300013297 | Bacteria | 1054 |
| 647 | Ga0157378_11381374 | 3300013297 | Bacteria | 747 |
| 648 | Ga0157378_12046943 | 3300013297 | Bacteria | 623 |
| 649 | Ga0163162_10034415 | 3300013306 | Bacteria | 5042 |
| 650 | Ga0163162_10339319 | 3300013306 | Unclassified | 1635 |
| 651 | Ga0163162_10764455 | 3300013306 | Bacteria | 1085 |
| 652 | Ga0163162_11266017 | 3300013306 | Bacteria | 838 |
| 653 | Ga0157372_10000287 | 3300013307 | Bacteria | 56080 |
| 654 | Ga0157372_10004400 | 3300013307 | Bacteria | 15026 |
| 655 | Ga0157372_10009796 | 3300013307 | Bacteria | 10191 |
| 656 | Ga0157372_10019261 | 3300013307 | Bacteria | 7349 |
| 657 | Ga0157372_10026210 | 3300013307 | Bacteria | 6344 |
| 658 | Ga0157372_10083897 | 3300013307 | Bacteria | 3609 |
| 659 | Ga0157372_10167878 | 3300013307 | Bacteria | 2538 |
| 660 | Ga0157372_10212888 | 3300013307 | Bacteria | 2240 |
| 661 | Ga0157372_10292855 | 3300013307 | Bacteria | 1893 |
| 662 | Ga0157372_10584194 | 3300013307 | Bacteria | 1302 |
| 663 | Ga0157372_10782370 | 3300013307 | Bacteria | 1109 |
| 664 | Ga0157372_10950816 | 3300013307 | Bacteria | 996 |
| 665 | Ga0157372_11367990 | 3300013307 | Unclassified | 816 |
| 666 | Ga0157375_10055998 | 3300013308 | Bacteria | 3890 |
| 667 | Ga0157375_10333283 | 3300013308 | Bacteria | 1682 |
| 668 | Ga0157375_12774179 | 3300013308 | Bacteria | 586 |
| 669 | Ga0163163_10008073 | 3300014325 | Bacteria | 9326 |
| 670 | Ga0163163_10099375 | 3300014325 | Bacteria | 2931 |
| 671 | Ga0163163_10143975 | 3300014325 | Bacteria | 2427 |
| 672 | Ga0163163_10276857 | 3300014325 | Bacteria | 1729 |
| 673 | Ga0163163_10278786 | 3300014325 | Bacteria | 1723 |
| 674 | Ga0163163_10333072 | 3300014325 | Bacteria | 1573 |
| 675 | Ga0163163_11497311 | 3300014325 | Unclassified | 736 |
| 676 | Ga0182008_10050339 | 3300014497 | Bacteria | 2067 |
| 677 | Ga0157377_10001555 | 3300014745 | Bacteria | 9979 |
| 678 | Ga0157379_10000323 | 3300014968 | Bacteria | 38184 |
| 679 | Ga0157379_10001375 | 3300014968 | Bacteria | 19911 |
| 680 | Ga0157379_10020278 | 3300014968 | Bacteria | 5877 |
| 681 | Ga0157379_10075613 | 3300014968 | Bacteria | 3016 |
| 682 | Ga0157379_10111753 | 3300014968 | Bacteria | 2454 |
| 683 | Ga0157379_10741048 | 3300014968 | Bacteria | 924 |
| 684 | Ga0157379_11130808 | 3300014968 | Bacteria | 751 |
| 685 | Ga0157379_11957107 | 3300014968 | Bacteria | 578 |
| 686 | Ga0157376_10019818 | 3300014969 | Bacteria | 5192 |
| 687 | Ga0157376_10182461 | 3300014969 | Bacteria | 1920 |
| 688 | Ga0157376_10959739 | 3300014969 | Bacteria | 876 |
| 689 | Ga0157376_11264933 | 3300014969 | Bacteria | 767 |
| 690 | Ga0157376_11494338 | 3300014969 | Bacteria | 708 |
| 691 | Ga0157376_12695778 | 3300014969 | Bacteria | 537 |
| 692 | Ga0182006_1020623 | 3300015261 | Bacteria | 2759 |
| 693 | Ga0182007_10009845 | 3300015262 | Bacteria | 3815 |
| 694 | Ga0182005_1067548 | 3300015265 | Bacteria | 980 |
| 695 | Ga0182005_1126475 | 3300015265 | Unclassified | 731 |
| 696 | Ga0197907_10098072 | 3300020069 | Bacteria | 649 |
| 697 | Ga0197907_10740934 | 3300020069 | Unclassified | 543 |
| 698 | Ga0197907_10815525 | 3300020069 | Unclassified | 807 |
| 699 | Ga0197907_11155002 | 3300020069 | Bacteria | 787 |
| 700 | Ga0206356_10401914 | 3300020070 | Bacteria | 849 |
| 701 | Ga0206356_11007705 | 3300020070 | Unclassified | 701 |
| 702 | Ga0206356_11052062 | 3300020070 | Bacteria | 2162 |
| 703 | Ga0206356_11552040 | 3300020070 | Unclassified | 892 |
| 704 | Ga0206349_1668343 | 3300020075 | Unclassified | 640 |
| 705 | Ga0206355_1081738 | 3300020076 | Unclassified | 1285 |
| 706 | Ga0206355_1429875 | 3300020076 | Bacteria | 2161 |
| 707 | Ga0206351_10191672 | 3300020077 | Unclassified | 817 |
| 708 | Ga0206351_10927832 | 3300020077 | Bacteria | 704 |
| 709 | Ga0206352_10940195 | 3300020078 | Bacteria | 850 |
| 710 | Ga0206352_11149266 | 3300020078 | Bacteria | 860 |
| 711 | Ga0206350_10070795 | 3300020080 | Bacteria | 537 |
| 712 | Ga0206350_10157797 | 3300020080 | Unclassified | 1507 |
| 713 | Ga0206350_10458796 | 3300020080 | Bacteria | 704 |
| 714 | Ga0206350_11419293 | 3300020080 | Unclassified | 744 |
| 715 | Ga0206354_10336299 | 3300020081 | Bacteria | 1679 |
| 716 | Ga0206354_10951279 | 3300020081 | Bacteria | 1514 |
| 717 | Ga0206353_11427356 | 3300020082 | Bacteria | 1375 |
| 718 | Ga0206353_11575536 | 3300020082 | Bacteria | 1541 |
| 719 | Ga0154015_1524408 | 3300020610 | Bacteria | 1762 |
| 720 | Ga0213872_10013951 | 3300021361 | Bacteria | 3757 |
| 721 | Ga0213876_10667011 | 3300021384 | Bacteria | 553 |
| 722 | Ga0213871_10313805 | 3300021441 | Unclassified | 508 |
| 723 | Ga0224712_10096438 | 3300022467 | Bacteria | 1247 |
| 724 | Ga0224712_10102869 | 3300022467 | Unclassified | 1214 |
| 725 | Ga0224712_10364793 | 3300022467 | Unclassified | 684 |
| 726 | Ga0224712_10580099 | 3300022467 | Unclassified | 546 |
| 727 | Ga0207697_10289069 | 3300025315 | Unclassified | 727 |
| 728 | Ga0207656_10267201 | 3300025321 | Bacteria | 841 |
| 729 | Ga0207692_10043918 | 3300025898 | Bacteria | 2227 |
| 730 | Ga0207692_10647388 | 3300025898 | Unclassified | 683 |
| 731 | Ga0207642_10502341 | 3300025899 | Unclassified | 743 |
| 732 | Ga0207642_11081006 | 3300025899 | Bacteria | 518 |
| 733 | Ga0207710_10022104 | 3300025900 | Bacteria | 2729 |
| 734 | Ga0207680_10071713 | 3300025903 | Bacteria | 2148 |
| 735 | Ga0207680_11086145 | 3300025903 | Bacteria | 572 |
| 736 | Ga0207647_10011120 | 3300025904 | Bacteria | 6323 |
| 737 | Ga0207685_10051104 | 3300025905 | Bacteria | 1595 |
| 738 | Ga0207699_10086730 | 3300025906 | Bacteria | 1956 |
| 739 | Ga0207699_10230218 | 3300025906 | Bacteria | 1269 |
| 740 | Ga0207699_10368901 | 3300025906 | Bacteria | 1017 |
| 741 | Ga0207645_10312428 | 3300025907 | Bacteria | 1047 |
| 742 | Ga0207643_10010452 | 3300025908 | Bacteria | 4999 |
| 743 | Ga0207643_10862646 | 3300025908 | Bacteria | 587 |
| 744 | Ga0207705_10031642 | 3300025909 | Bacteria | 3778 |
| 745 | Ga0207705_10057261 | 3300025909 | Bacteria | 2811 |
| 746 | Ga0207705_10289106 | 3300025909 | Bacteria | 1256 |
| 747 | Ga0207705_10557667 | 3300025909 | Bacteria | 891 |
| 748 | Ga0207684_10003813 | 3300025910 | Bacteria | 14538 |
| 749 | Ga0207684_10208962 | 3300025910 | Bacteria | 1684 |
| 750 | Ga0207684_10286064 | 3300025910 | Unclassified | 1422 |
| 751 | Ga0207654_10623793 | 3300025911 | Bacteria | 771 |
| 752 | Ga0207707_10001110 | 3300025912 | Bacteria | 25554 |
| 753 | Ga0207707_10005825 | 3300025912 | Bacteria | 10768 |
| 754 | Ga0207707_10106254 | 3300025912 | Bacteria | 2454 |
| 755 | Ga0207707_10153740 | 3300025912 | Bacteria | 2012 |
| 756 | Ga0207707_10324631 | 3300025912 | Unclassified | 1328 |
| 757 | Ga0207707_10464548 | 3300025912 | Bacteria | 1082 |
| 758 | Ga0207707_10816657 | 3300025912 | Unclassified | 776 |
| 759 | Ga0207695_10018355 | 3300025913 | Bacteria | 8093 |
| 760 | Ga0207695_10061347 | 3300025913 | Bacteria | 3886 |
| 761 | Ga0207695_10101990 | 3300025913 | Bacteria | 2863 |
| 762 | Ga0207695_10135331 | 3300025913 | Bacteria | 2418 |
| 763 | Ga0207695_10147529 | 3300025913 | Bacteria | 2295 |
| 764 | Ga0207695_10275618 | 3300025913 | Bacteria | 1577 |
| 765 | Ga0207695_10506211 | 3300025913 | Bacteria | 1089 |
| 766 | Ga0207695_10711638 | 3300025913 | Unclassified | 885 |
| 767 | Ga0207695_11685343 | 3300025913 | Bacteria | 515 |
| 768 | Ga0207671_11112623 | 3300025914 | Unclassified | 620 |
| 769 | Ga0207671_11420451 | 3300025914 | Unclassified | 537 |
| 770 | Ga0207693_10010671 | 3300025915 | Bacteria | 7457 |
| 771 | Ga0207693_10067804 | 3300025915 | Unclassified | 2794 |
| 772 | Ga0207693_10254859 | 3300025915 | Unclassified | 1377 |
| 773 | Ga0207693_10468117 | 3300025915 | Bacteria | 984 |
| 774 | Ga0207693_10539606 | 3300025915 | Bacteria | 910 |
| 775 | Ga0207693_11148830 | 3300025915 | Unclassified | 588 |
| 776 | Ga0207693_11303364 | 3300025915 | Unclassified | 543 |
| 777 | Ga0207663_10000026 | 3300025916 | Bacteria | 109142 |
| 778 | Ga0207663_10018814 | 3300025916 | Bacteria | 3880 |
| 779 | Ga0207663_10042253 | 3300025916 | Bacteria | 2784 |
| 780 | Ga0207663_10047717 | 3300025916 | Bacteria | 2646 |
| 781 | Ga0207663_10192029 | 3300025916 | Unclassified | 1467 |
| 782 | Ga0207663_10587281 | 3300025916 | Bacteria | 874 |
| 783 | Ga0207663_10762125 | 3300025916 | Bacteria | 769 |
| 784 | Ga0207663_11500308 | 3300025916 | Bacteria | 543 |
| 785 | Ga0207660_10001738 | 3300025917 | Bacteria | 14598 |
| 786 | Ga0207660_10125857 | 3300025917 | Bacteria | 1946 |
| 787 | Ga0207660_10172558 | 3300025917 | Bacteria | 1675 |
| 788 | Ga0207660_10557420 | 3300025917 | Bacteria | 932 |
| 789 | Ga0207660_10616931 | 3300025917 | Bacteria | 884 |
| 790 | Ga0207660_11324309 | 3300025917 | Bacteria | 585 |
| 791 | Ga0207662_10367738 | 3300025918 | Unclassified | 969 |
| 792 | Ga0207657_10000545 | 3300025919 | Bacteria | 40246 |
| 793 | Ga0207657_10105535 | 3300025919 | Bacteria | 2332 |
| 794 | Ga0207657_10219733 | 3300025919 | Bacteria | 1523 |
| 795 | Ga0207657_10370903 | 3300025919 | Bacteria | 1128 |
| 796 | Ga0207657_10543810 | 3300025919 | Bacteria | 908 |
| 797 | Ga0207657_11047085 | 3300025919 | Unclassified | 625 |
| 798 | Ga0207649_10112862 | 3300025920 | Bacteria | 1819 |
| 799 | Ga0207649_10309756 | 3300025920 | Bacteria | 1157 |
| 800 | Ga0207649_10315114 | 3300025920 | Bacteria | 1148 |
| 801 | Ga0207652_10001268 | 3300025921 | Bacteria | 22477 |
| 802 | Ga0207652_10011513 | 3300025921 | Bacteria | 7131 |
| 803 | Ga0207652_10074351 | 3300025921 | Bacteria | 2959 |
| 804 | Ga0207652_10101182 | 3300025921 | Bacteria | 2545 |
| 805 | Ga0207652_10309847 | 3300025921 | Bacteria | 1425 |
| 806 | Ga0207652_10410144 | 3300025921 | Bacteria | 1222 |
| 807 | Ga0207652_10510945 | 3300025921 | Bacteria | 1081 |
| 808 | Ga0207652_10555182 | 3300025921 | Bacteria | 1032 |
| 809 | Ga0207652_11661199 | 3300025921 | Bacteria | 543 |
| 810 | Ga0207646_10013472 | 3300025922 | Bacteria | 7818 |
| 811 | Ga0207646_10245554 | 3300025922 | Bacteria | 1617 |
| 812 | Ga0207646_10311501 | 3300025922 | Bacteria | 1422 |
| 813 | Ga0207681_10010109 | 3300025923 | Bacteria | 5774 |
| 814 | Ga0207694_10027358 | 3300025924 | Bacteria | 4343 |
| 815 | Ga0207694_10034291 | 3300025924 | Bacteria | 3891 |
| 816 | Ga0207694_10102366 | 3300025924 | Bacteria | 2271 |
| 817 | Ga0207694_10173028 | 3300025924 | Bacteria | 1749 |
| 818 | Ga0207694_10182772 | 3300025924 | Bacteria | 1701 |
| 819 | Ga0207694_11862834 | 3300025924 | Unclassified | 505 |
| 820 | Ga0207650_10007755 | 3300025925 | Bacteria | 7318 |
| 821 | Ga0207650_10273319 | 3300025925 | Bacteria | 1374 |
| 822 | Ga0207650_11453312 | 3300025925 | Bacteria | 583 |
| 823 | Ga0207659_10582890 | 3300025926 | Unclassified | 953 |
| 824 | Ga0207659_10620811 | 3300025926 | Bacteria | 922 |
| 825 | Ga0207687_10457059 | 3300025927 | Bacteria | 1060 |
| 826 | Ga0207700_10006948 | 3300025928 | Bacteria | 6885 |
| 827 | Ga0207700_10038228 | 3300025928 | Bacteria | 3482 |
| 828 | Ga0207700_10064900 | 3300025928 | Bacteria | 2783 |
| 829 | Ga0207700_10208916 | 3300025928 | Bacteria | 1649 |
| 830 | Ga0207700_10242099 | 3300025928 | Bacteria | 1538 |
| 831 | Ga0207700_10399652 | 3300025928 | Bacteria | 1204 |
| 832 | Ga0207700_11499294 | 3300025928 | Unclassified | 598 |
| 833 | Ga0207664_10048243 | 3300025929 | Bacteria | 3348 |
| 834 | Ga0207664_10147020 | 3300025929 | Bacteria | 1999 |
| 835 | Ga0207664_10154715 | 3300025929 | Bacteria | 1951 |
| 836 | Ga0207664_10230956 | 3300025929 | Bacteria | 1608 |
| 837 | Ga0207664_10290571 | 3300025929 | Bacteria | 1436 |
| 838 | Ga0207664_10377818 | 3300025929 | Bacteria | 1257 |
| 839 | Ga0207664_10417338 | 3300025929 | Bacteria | 1195 |
| 840 | Ga0207664_10507416 | 3300025929 | Unclassified | 1080 |
| 841 | Ga0207664_10530397 | 3300025929 | Bacteria | 1055 |
| 842 | Ga0207664_10554744 | 3300025929 | Unclassified | 1031 |
| 843 | Ga0207644_11487869 | 3300025931 | Bacteria | 568 |
| 844 | Ga0207690_10056564 | 3300025932 | Bacteria | 2647 |
| 845 | Ga0207690_10508769 | 3300025932 | Bacteria | 975 |
| 846 | Ga0207706_10174174 | 3300025933 | Bacteria | 1890 |
| 847 | Ga0207706_10236421 | 3300025933 | Unclassified | 1597 |
| 848 | Ga0207706_10330260 | 3300025933 | Unclassified | 1327 |
| 849 | Ga0207686_10102370 | 3300025934 | Bacteria | 1915 |
| 850 | Ga0207686_10107654 | 3300025934 | Bacteria | 1874 |
| 851 | Ga0207686_10138016 | 3300025934 | Bacteria | 1681 |
| 852 | Ga0207686_10455411 | 3300025934 | Bacteria | 985 |
| 853 | Ga0207686_10723764 | 3300025934 | Bacteria | 793 |
| 854 | Ga0207670_10098641 | 3300025936 | Bacteria | 2082 |
| 855 | Ga0207670_10425609 | 3300025936 | Bacteria | 1066 |
| 856 | Ga0207670_10650922 | 3300025936 | Bacteria | 869 |
| 857 | Ga0207670_11138048 | 3300025936 | Bacteria | 660 |
| 858 | Ga0207669_10179794 | 3300025937 | Bacteria | 1515 |
| 859 | Ga0207704_10004100 | 3300025938 | Bacteria | 6638 |
| 860 | Ga0207704_10004645 | 3300025938 | Bacteria | 6295 |
| 861 | Ga0207704_10416017 | 3300025938 | Bacteria | 1065 |
| 862 | Ga0207704_11050762 | 3300025938 | Unclassified | 690 |
| 863 | Ga0207665_10252236 | 3300025939 | Bacteria | 1304 |
| 864 | Ga0207665_10450556 | 3300025939 | Bacteria | 988 |
| 865 | Ga0207665_11065747 | 3300025939 | Unclassified | 644 |
| 866 | Ga0207711_10003977 | 3300025941 | Bacteria | 12713 |
| 867 | Ga0207711_10021908 | 3300025941 | Bacteria | 5339 |
| 868 | Ga0207711_10028562 | 3300025941 | Bacteria | 4695 |
| 869 | Ga0207711_10186065 | 3300025941 | Bacteria | 1891 |
| 870 | Ga0207689_10000845 | 3300025942 | Bacteria | 29447 |
| 871 | Ga0207689_10199150 | 3300025942 | Bacteria | 1653 |
| 872 | Ga0207689_10493926 | 3300025942 | Bacteria | 1025 |
| 873 | Ga0207689_10601737 | 3300025942 | Bacteria | 925 |
| 874 | Ga0207661_10026846 | 3300025944 | Bacteria | 4393 |
| 875 | Ga0207661_10144685 | 3300025944 | Bacteria | 2049 |
| 876 | Ga0207661_10359906 | 3300025944 | Bacteria | 1314 |
| 877 | Ga0207661_11258991 | 3300025944 | Bacteria | 680 |
| 878 | Ga0207661_11497760 | 3300025944 | Unclassified | 618 |
| 879 | Ga0207661_11503685 | 3300025944 | Unclassified | 617 |
| 880 | Ga0207679_10006295 | 3300025945 | Bacteria | 7492 |
| 881 | Ga0207679_10029218 | 3300025945 | Bacteria | 3836 |
| 882 | Ga0207679_10166980 | 3300025945 | Bacteria | 1808 |
| 883 | Ga0207679_10612648 | 3300025945 | Bacteria | 982 |
| 884 | Ga0207679_10668441 | 3300025945 | Bacteria | 941 |
| 885 | Ga0207679_11051564 | 3300025945 | Bacteria | 747 |
| 886 | Ga0207679_11326560 | 3300025945 | Unclassified | 660 |
| 887 | Ga0207667_10000163 | 3300025949 | Bacteria | 98321 |
| 888 | Ga0207667_10000827 | 3300025949 | Bacteria | 39994 |
| 889 | Ga0207667_10006364 | 3300025949 | Bacteria | 14314 |
| 890 | Ga0207667_10018660 | 3300025949 | Bacteria | 7772 |
| 891 | Ga0207667_10033680 | 3300025949 | Bacteria | 5506 |
| 892 | Ga0207667_10356801 | 3300025949 | Bacteria | 1491 |
| 893 | Ga0207667_10366831 | 3300025949 | Bacteria | 1468 |
| 894 | Ga0207667_10474362 | 3300025949 | Bacteria | 1270 |
| 895 | Ga0207667_10686535 | 3300025949 | Unclassified | 1027 |
| 896 | Ga0207667_10750598 | 3300025949 | Bacteria | 975 |
| 897 | Ga0207667_10946711 | 3300025949 | Bacteria | 851 |
| 898 | Ga0207667_11430794 | 3300025949 | Bacteria | 664 |
| 899 | Ga0207667_11903306 | 3300025949 | Unclassified | 557 |
| 900 | Ga0207651_10015414 | 3300025960 | Unclassified | 4441 |
| 901 | Ga0207651_11135050 | 3300025960 | Bacteria | 701 |
| 902 | Ga0207668_10039783 | 3300025972 | Bacteria | 3168 |
| 903 | Ga0207640_10282438 | 3300025981 | Bacteria | 1305 |
| 904 | Ga0207640_10358399 | 3300025981 | Bacteria | 1174 |
| 905 | Ga0207640_10740021 | 3300025981 | Bacteria | 847 |
| 906 | Ga0207658_10148531 | 3300025986 | Bacteria | 1906 |
| 907 | Ga0207658_10534512 | 3300025986 | Bacteria | 1048 |
| 908 | Ga0207677_10338871 | 3300026023 | Bacteria | 1256 |
| 909 | Ga0207677_11893277 | 3300026023 | Bacteria | 554 |
| 910 | Ga0207703_10003111 | 3300026035 | Bacteria | 14014 |
| 911 | Ga0207703_10011078 | 3300026035 | Bacteria | 7025 |
| 912 | Ga0207703_10013425 | 3300026035 | Bacteria | 6380 |
| 913 | Ga0207703_10683730 | 3300026035 | Bacteria | 975 |
| 914 | Ga0207703_12187563 | 3300026035 | Bacteria | 529 |
| 915 | Ga0207639_10369803 | 3300026041 | Unclassified | 1285 |
| 916 | Ga0207639_10371511 | 3300026041 | Bacteria | 1282 |
| 917 | Ga0207639_10788223 | 3300026041 | Unclassified | 885 |
| 918 | Ga0207678_10006945 | 3300026067 | Bacteria | 10048 |
| 919 | Ga0207678_10896576 | 3300026067 | Unclassified | 784 |
| 920 | Ga0207702_10000612 | 3300026078 | Bacteria | 39396 |
| 921 | Ga0207702_10002903 | 3300026078 | Bacteria | 16043 |
| 922 | Ga0207702_10004408 | 3300026078 | Bacteria | 12538 |
| 923 | Ga0207702_10113079 | 3300026078 | Bacteria | 2417 |
| 924 | Ga0207702_10234084 | 3300026078 | Bacteria | 1718 |
| 925 | Ga0207702_12096128 | 3300026078 | Bacteria | 555 |
| 926 | Ga0207641_10018946 | 3300026088 | Bacteria | 5645 |
| 927 | Ga0207641_10392967 | 3300026088 | Unclassified | 1330 |
| 928 | Ga0207641_11879955 | 3300026088 | Bacteria | 600 |
| 929 | Ga0207648_10009935 | 3300026089 | Bacteria | 9067 |
| 930 | Ga0207648_10025289 | 3300026089 | Bacteria | 5290 |
| 931 | Ga0207676_10004570 | 3300026095 | Bacteria | 9803 |
| 932 | Ga0207676_10011892 | 3300026095 | Bacteria | 6227 |
| 933 | Ga0207676_10026867 | 3300026095 | Bacteria | 4282 |
| 934 | Ga0207676_11181031 | 3300026095 | Bacteria | 758 |
| 935 | Ga0207674_10000599 | 3300026116 | Bacteria | 47369 |
| 936 | Ga0207674_10001299 | 3300026116 | Bacteria | 32627 |
| 937 | Ga0207674_10014078 | 3300026116 | Bacteria | 8836 |
| 938 | Ga0207674_10135017 | 3300026116 | Bacteria | 2429 |
| 939 | Ga0207675_100001110 | 3300026118 | Bacteria | 26637 |
| 940 | Ga0207675_100188294 | 3300026118 | Bacteria | 1978 |
| 941 | Ga0207675_100882794 | 3300026118 | Bacteria | 910 |
| 942 | Ga0207683_10389759 | 3300026121 | Bacteria | 1281 |
| 943 | Ga0207683_11342412 | 3300026121 | Bacteria | 662 |
| 944 | Ga0207698_10137098 | 3300026142 | Bacteria | 2101 |
| 945 | Ga0207698_10488790 | 3300026142 | Bacteria | 1195 |
| 946 | Ga0207698_10630157 | 3300026142 | Bacteria | 1060 |
| 947 | Ga0207698_10896398 | 3300026142 | Bacteria | 894 |
| 948 | Ga0265357_1028107 | 3300028023 | Bacteria | 636 |
| 949 | Ga0268266_10024459 | 3300028379 | Bacteria | 5135 |
| 950 | Ga0268265_10025195 | 3300028380 | Unclassified | 4219 |
| 951 | Ga0268265_10366251 | 3300028380 | Bacteria | 1321 |
| 952 | Ga0268264_10000872 | 3300028381 | Bacteria | 31948 |
| 953 | Ga0268264_10375857 | 3300028381 | Bacteria | 1359 |
| 954 | Ga0265319_1117839 | 3300028563 | Bacteria | 828 |
| 955 | Ga0265762_1015812 | 3300030760 | Bacteria | 1367 |
| 956 | Ga0265767_118987 | 3300030836 | Bacteria | 512 |
| 957 | Ga0265773_1005643 | 3300031018 | Bacteria | 917 |
| 958 | Ga0265760_10038412 | 3300031090 | Bacteria | 1423 |
| 959 | Ga0265330_10241210 | 3300031235 | Bacteria | 762 |
| 960 | Ga0265332_10245446 | 3300031238 | Bacteria | 741 |
| 961 | Ga0265320_10564358 | 3300031240 | Bacteria | 503 |
| 962 | Ga0265329_10023016 | 3300031242 | Bacteria | 2079 |
| 963 | Ga0265340_10035244 | 3300031247 | Bacteria | 2486 |
| 964 | Ga0265331_10066094 | 3300031250 | Bacteria | 1699 |
| 965 | Ga0265316_10008727 | 3300031344 | Bacteria | 9378 |
| 966 | Ga0265316_10024535 | 3300031344 | Bacteria | 5048 |
| 967 | Ga0265316_10329073 | 3300031344 | Bacteria | 1109 |
| 968 | Ga0265316_10494313 | 3300031344 | Bacteria | 874 |
| 969 | Ga0265316_11013928 | 3300031344 | Bacteria | 577 |
| 970 | Ga0307408_100221861 | 3300031548 | Bacteria | 1543 |
| 971 | Ga0265314_10105678 | 3300031711 | Bacteria | 1800 |
| 972 | Ga0265314_10121462 | 3300031711 | Bacteria | 1644 |
| 973 | Ga0265314_10476405 | 3300031711 | Bacteria | 661 |
| 974 | Ga0265342_10285740 | 3300031712 | Bacteria | 872 |
| 975 | Ga0307409_101049463 | 3300031995 | Unclassified | 835 |
| 976 | Ga0307415_100824076 | 3300032126 | Bacteria | 849 |
| 977 | Ga0307415_100994197 | 3300032126 | Bacteria | 779 |
| 978 | Ga0316583_10222812 | 3300032133 | Unclassified | 654 |
| 979 | Ga0316212_1005758 | 3300033547 | Bacteria | 1797 |
| 980 | Ga0373926_0020319 | 3300035083 | Bacteria | 2294 |
| 981 | Ga0373929_0159156 | 3300035085 | Bacteria | 611 |
| 982 | Ga0373934_0082392 | 3300035086 | Bacteria | 1293 |
| 983 | Ga0373936_0438465 | 3300035113 | Bacteria | 603 |
| 984 | Ga0373953_0067996 | 3300035117 | Unclassified | 1466 |
| 985 | Ga0373953_0170848 | 3300035117 | Bacteria | 936 |
| 986 | Ga0373954_0095587 | 3300035118 | Bacteria | 1430 |
| 987 | Ga0373954_0235239 | 3300035118 | Bacteria | 902 |
| 988 | Ga0373956_0236865 | 3300035119 | Bacteria | 867 |
| 989 | Ga0373943_0036145 | 3300035170 | Bacteria | 2365 |
| 990 | Ga0373943_0045362 | 3300035170 | Bacteria | 2142 |
| 991 | Ga0373955_0094599 | 3300035172 | Bacteria | 1708 |
| 992 | Ga0373955_0845396 | 3300035172 | Unclassified | 563 |
| 993 | Ga0373931_0486445 | 3300035691 | Bacteria | 794 |
| 994 | Ga0373935_0016406 | 3300035692 | Bacteria | 4481 |
| 995 | Ga0373935_0179068 | 3300035692 | Bacteria | 1455 |
| 996 | Ga0373927_0006677 | 3300035695 | Bacteria | 7852 |
| 997 | Ga0373927_0041162 | 3300035695 | Bacteria | 2997 |
| 998 | Ga0373927_0404182 | 3300035695 | Bacteria | 901 |
| 999 | Ga0373927_0729493 | 3300035695 | Bacteria | 655 |
| 1000 | Ga0373933_0112529 | 3300035724 | Bacteria | 1699 |
| 1001 | Ga0373933_0688328 | 3300035724 | Unclassified | 672 |
| 1002 | Ga0373947_0058297 | 3300035725 | Bacteria | 2340 |
| 1003 | Ga0373947_0470957 | 3300035725 | Unclassified | 852 |
| 1004 | Ga0373937_0104317 | 3300036401 | Unclassified | 2634 |
| 1005 | Ga0373937_0140386 | 3300036401 | Bacteria | 2260 |
| 1006 | Ga0373937_0251807 | 3300036401 | Bacteria | 1665 |
| 1007 | Ga0373937_0267129 | 3300036401 | Bacteria | 1614 |
| 1008 | Ga0373937_0501704 | 3300036401 | Unclassified | 1153 |
| 1009 | Ga0373937_0635291 | 3300036401 | Bacteria | 1013 |
| 1010 | Ga0373925_0351968 | 3300037068 | Bacteria | 1196 |
| 1011 | Ga0395899_0206275 | 3300037312 | Bacteria | 1368 |
| 1012 | Ga0395899_0652675 | 3300037312 | Bacteria | 665 |
| 1013 | Ga0395900_0060652 | 3300037418 | Bacteria | 3892 |
| 1014 | Ga0395900_0291088 | 3300037418 | Bacteria | 1622 |
| 1015 | Ga0395898_0082684 | 3300037466 | Bacteria | 3095 |
| 1016 | Ga0436364_0181287 | 3300037853 | Bacteria | 641 |
| 1017 | Ga0436364_0654329 | 3300037853 | Bacteria | 10688 |
| 1018 | Ga0436364_1338884 | 3300037853 | Unclassified | 982 |
| 1019 | Ga0395901_0160056 | 3300038443 | Bacteria | 2365 |
| 1020 | Ga0395901_0271118 | 3300038443 | Bacteria | 1765 |
| 1021 | Ga0395901_0392554 | 3300038443 | Bacteria | 1427 |
| 1022 | Ga0436365_0316424 | 3300039437 | Unclassified | 4062 |
| 1023 | Ga0436365_1658177 | 3300039437 | Bacteria | 1154 |
| 1024 | Ga0436360_0344554 | 3300039438 | Unclassified | 750 |
| 1025 | Ga0436360_0762903 | 3300039438 | Bacteria | 506 |
| 1026 | Ga0436361_0461868 | 3300039447 | Bacteria | 17644 |
| 1027 | Ga0436363_1042151 | 3300039450 | Unclassified | 1039 |
| 1028 | Ga0436362_0444124 | 3300039453 | Bacteria | 799 |
| 1029 | Ga0451787_005017 | 3300041441 | Bacteria | 974 |
| 1030 | Ga0451839_0591775 | 3300041496 | Unclassified | 528 |
| 1031 | Ga0451843_1744014 | 3300041509 | Bacteria | 591 |
| 1032 | Ga0450894_039415 | 3300042131 | Bacteria | 676 |
| 1033 | Ga0451577_0603934 | 3300042876 | Bacteria | 996 |
| 1034 | Ga0466969_0065024 | 3300044656 | Bacteria | 1764 |
| 1035 | Ga0466969_0160387 | 3300044656 | Bacteria | 1033 |
| 1036 | Ga0453683_0074846 | 3300044673 | Bacteria | 2120 |
| 1037 | Ga0466966_0000513 | 3300044684 | Bacteria | 24684 |
| 1038 | Ga0466966_0193617 | 3300044684 | Bacteria | 1231 |
| 1039 | Ga0466966_0265662 | 3300044684 | Bacteria | 1033 |
| 1040 | Ga0466961_0316846 | 3300044693 | Unclassified | 951 |
| 1041 | Ga0466963_0000041 | 3300044694 | Bacteria | 41829 |
| 1042 | Ga0466963_0567510 | 3300044694 | Bacteria | 801 |
| 1043 | Ga0466971_0310626 | 3300044719 | Unclassified | 758 |
| 1044 | Ga0466968_0449880 | 3300044735 | Bacteria | 637 |
| 1045 | Ga0466970_0337929 | 3300044765 | Bacteria | 853 |
| 1046 | Ga0466957_0235335 | 3300044842 | Bacteria | 1214 |
| 1047 | Ga0466957_1310403 | 3300044842 | Bacteria | 526 |
| 1048 | Ga0466959_0020950 | 3300045049 | Bacteria | 4819 |
| 1049 | Ga0466959_0158154 | 3300045049 | Bacteria | 1594 |
| 1050 | Ga0466959_0688553 | 3300045049 | Bacteria | 685 |
| 1051 | Ga0466959_1145905 | 3300045049 | Unclassified | 517 |
| 1052 | Ga0451576_1838328 | 3300045051 | Bacteria | 626 |
| 1053 | Ga0466958_0021289 | 3300045836 | Unclassified | 3787 |
| 1054 | Ga0466958_0555158 | 3300045836 | Bacteria | 746 |
| 1055 | Ga0466958_0850781 | 3300045836 | Bacteria | 595 |
| 1056 | Ga0466967_0000566 | 3300045976 | Bacteria | 18166 |
| 1057 | Ga0466967_0004442 | 3300045976 | Bacteria | 9458 |
| 1058 | Ga0466967_0019630 | 3300045976 | Bacteria | 5441 |
| 1059 | Ga0466967_0194001 | 3300045976 | Unclassified | 1921 |
| 1060 | Ga0495592_0254430 | 3300046454 | Bacteria | 1159 |
| 1061 | Ga0495592_0306740 | 3300046454 | Bacteria | 1030 |
| 1062 | Ga0495651_0001752 | 3300046462 | Bacteria | 16745 |
| 1063 | Ga0495651_0422165 | 3300046462 | Bacteria | 867 |
| 1064 | Ga0495580_0004971 | 3300046472 | Bacteria | 11106 |
| 1065 | Ga0495580_0006128 | 3300046472 | Bacteria | 9836 |
| 1066 | Ga0495582_0172079 | 3300046473 | Bacteria | 1233 |
| 1067 | Ga0495662_0211314 | 3300046476 | Bacteria | 956 |
| 1068 | Ga0495662_0528541 | 3300046476 | Bacteria | 578 |
| 1069 | Ga0495664_0733219 | 3300046477 | Bacteria | 583 |
| 1070 | Ga0495594_0031366 | 3300046499 | Bacteria | 2880 |
| 1071 | Ga0495594_0049706 | 3300046499 | Bacteria | 2305 |
| 1072 | Ga0495628_0217375 | 3300046516 | Bacteria | 1436 |
| 1073 | Ga0495630_0196560 | 3300046517 | Bacteria | 1539 |
| 1074 | Ga0495630_0342578 | 3300046517 | Bacteria | 1144 |
| 1075 | Ga0495666_0058454 | 3300046526 | Bacteria | 1845 |
| 1076 | Ga0495652_0064163 | 3300046529 | Bacteria | 3090 |
| 1077 | Ga0495652_0237388 | 3300046529 | Bacteria | 1359 |
| 1078 | Ga0495665_0010453 | 3300046531 | Bacteria | 5022 |
| 1079 | Ga0495665_0123090 | 3300046531 | Bacteria | 1358 |
| 1080 | Ga0495640_0180550 | 3300046533 | Bacteria | 1345 |
| 1081 | Ga0495640_0201602 | 3300046533 | Bacteria | 1261 |
| 1082 | Ga0495586_0209238 | 3300046535 | Bacteria | 1107 |
| 1083 | Ga0495587_0137991 | 3300046536 | Bacteria | 1393 |
| 1084 | Ga0495587_0220222 | 3300046536 | Bacteria | 1070 |
| 1085 | Ga0495645_0153148 | 3300046543 | Bacteria | 1600 |
| 1086 | Ga0495667_0029553 | 3300046559 | Unclassified | 3689 |
| 1087 | Ga0495634_0479232 | 3300046642 | Bacteria | 731 |
| 1088 | Ga0495635_0131966 | 3300046663 | Bacteria | 1703 |
| 1089 | Ga0495635_0163015 | 3300046663 | Bacteria | 1517 |
| 1090 | Ga0495657_0537599 | 3300046675 | Bacteria | 679 |
| 1091 | Ga0495599_0088341 | 3300046678 | Bacteria | 1935 |
| 1092 | Ga0495599_0152181 | 3300046678 | Bacteria | 1432 |
| 1093 | Ga0495599_0222345 | 3300046678 | Bacteria | 1155 |
| 1094 | Ga0495623_0028412 | 3300046679 | Unclassified | 3598 |
| 1095 | Ga0495646_0327537 | 3300046680 | Bacteria | 806 |
| 1096 | Ga0495658_0601236 | 3300046683 | Bacteria | 705 |
| 1097 | Ga0495613_0081924 | 3300046689 | Unclassified | 2344 |
| 1098 | Ga0495613_0393711 | 3300046689 | Bacteria | 946 |
| 1099 | Ga0495624_0147243 | 3300046690 | Bacteria | 1441 |
| 1100 | Ga0495670_0695266 | 3300046691 | Unclassified | 555 |
| 1101 | Ga0495600_0177708 | 3300046809 | Bacteria | 1372 |
| 1102 | Ga0495600_0520434 | 3300046809 | Bacteria | 729 |
| 1103 | Ga0495581_0199797 | 3300047315 | Bacteria | 1170 |
| 1104 | Ga0495581_0448366 | 3300047315 | Bacteria | 751 |
| 1105 | Ga0495604_0079173 | 3300047317 | Unclassified | 2465 |
| 1106 | Ga0495636_0514344 | 3300047318 | Bacteria | 580 |
| 1107 | Ga0495674_0022255 | 3300047319 | Bacteria | 5845 |
| 1108 | Ga0495674_0087370 | 3300047319 | Bacteria | 2668 |
| 1109 | Ga0495674_0097651 | 3300047319 | Bacteria | 2502 |
| 1110 | Ga0495674_0226016 | 3300047319 | Bacteria | 1546 |
| 1111 | Ga0495674_1215705 | 3300047319 | Unclassified | 569 |
| 1112 | Ga0495674_1235901 | 3300047319 | Bacteria | 563 |
| 1113 | Ga0495675_0011403 | 3300047444 | Bacteria | 5578 |
| 1114 | Ga0495675_0210443 | 3300047444 | Bacteria | 1181 |
| 1115 | Ga0495684_0006742 | 3300047471 | Bacteria | 8915 |
| 1116 | Ga0495684_0020161 | 3300047471 | Bacteria | 5135 |
| 1117 | Ga0495684_0576974 | 3300047471 | Bacteria | 762 |
| 1118 | Ga0495593_0491600 | 3300047673 | Bacteria | 615 |
| 1119 | Ga0495602_0015970 | 3300048088 | Bacteria | 7559 |
| 1120 | Ga0495602_0382435 | 3300048088 | Unclassified | 1008 |
| 1121 | Ga0495602_0813310 | 3300048088 | Bacteria | 627 |
| 1122 | Ga0495614_0314817 | 3300048089 | Bacteria | 725 |
| 1123 | Ga0496101_0722926 | 3300048904 | Bacteria | 786 |
| 1124 | Ga0496102_0107781 | 3300048905 | Bacteria | 2594 |
| 1125 | Ga0496103_0020250 | 3300048906 | Bacteria | 3996 |
| 1126 | Ga0496103_0275569 | 3300048906 | Unclassified | 1082 |
| 1127 | Ga0496108_0000127 | 3300048911 | Bacteria | 75144 |
| 1128 | Ga0496108_0034478 | 3300048911 | Bacteria | 4206 |
| 1129 | Ga0496109_0018774 | 3300048912 | Bacteria | 6082 |
| 1130 | Ga0496110_0118328 | 3300048913 | Bacteria | 2386 |
| 1131 | Ga0496110_0334144 | 3300048913 | Bacteria | 1380 |
| 1132 | Ga0496110_1825365 | 3300048913 | Unclassified | 518 |
| 1133 | Ga0496112_0136162 | 3300048915 | Bacteria | 2426 |
| 1134 | Ga0496112_0163457 | 3300048915 | Bacteria | 2192 |
| 1135 | Ga0496112_0230136 | 3300048915 | Bacteria | 1808 |
| 1136 | Ga0496113_0416049 | 3300048916 | Bacteria | 1080 |
| 1137 | Ga0496115_0995080 | 3300048918 | Unclassified | 641 |
| 1138 | Ga0496125_0438267 | 3300048928 | Bacteria | 752 |
| 1139 | Ga0496126_0020359 | 3300048929 | Bacteria | 6509 |
| 1140 | Ga0496126_0279324 | 3300048929 | Bacteria | 1384 |
| 1141 | Ga0501031_0811210 | 3300049568 | Bacteria | 600 |
| 1142 | Ga0501037_0000739 | 3300049573 | Bacteria | 24789 |
| 1143 | Ga0501046_0009333 | 3300049580 | Bacteria | 8486 |
| 1144 | Ga0501047_0386756 | 3300049581 | Bacteria | 1233 |
| 1145 | Ga0501067_0008685 | 3300049583 | Bacteria | 5629 |
| 1146 | Ga0501067_0281690 | 3300049583 | Unclassified | 926 |
| 1147 | Ga0501072_1099388 | 3300049588 | Bacteria | 619 |
| 1148 | Ga0501073_0099581 | 3300049589 | Unclassified | 2018 |
| 1149 | Ga0501076_0154614 | 3300049592 | Bacteria | 1867 |
| 1150 | Ga0501076_0315349 | 3300049592 | Bacteria | 1283 |
| 1151 | Ga0501077_0101339 | 3300049593 | Bacteria | 1825 |
| 1152 | Ga0501077_0108270 | 3300049593 | Bacteria | 1761 |
| 1153 | Ga0501257_262518 | 3300049686 | Bacteria | 515 |
| 1154 | Ga0501080_0348589 | 3300049742 | Bacteria | 1337 |
| 1155 | Ga0501083_0002624 | 3300049744 | Bacteria | 12390 |
| 1156 | Ga0501035_0297130 | 3300049822 | Bacteria | 1361 |
| 1157 | Ga0501035_0466648 | 3300049822 | Bacteria | 1043 |
| 1158 | Ga0501045_0297940 | 3300049824 | Bacteria | 1200 |
| 1159 | nmdc:mga05p37_111824_c1 | 3300050507 | Bacteria | 3359 |
| 1160 | nmdc:mga09592_1328130_c1 | 3300050508 | Bacteria | 590 |
| 1161 | nmdc:mga0qj67_187857_c1 | 3300050509 | Bacteria | 1679 |
| 1162 | nmdc:mga06r32_121954_c1 | 3300050510 | Bacteria | 2572 |
| 1163 | nmdc:mga06r32_1801598_c1 | 3300050510 | Bacteria | 548 |
| 1164 | nmdc:mga06r32_18146_c1 | 3300050510 | Bacteria | 6437 |
| 1165 | nmdc:mga08y16_366151_c1 | 3300050511 | Bacteria | 1479 |
| 1166 | nmdc:mga0n895_1312370_c1 | 3300050512 | Bacteria | 694 |
| 1167 | nmdc:mga0n895_251439_c1 | 3300050512 | Bacteria | 1794 |
| 1168 | nmdc:mga0n895_347934_c1 | 3300050512 | Bacteria | 1501 |
| 1169 | nmdc:mga0n895_352971_c1 | 3300050512 | Bacteria | 1489 |
| 1170 | nmdc:mga0n895_544146_c1 | 3300050512 | Bacteria | 1167 |
| 1171 | nmdc:mga0rr50_22911_c1 | 3300050513 | Bacteria | 4296 |
| 1172 | nmdc:mga0rr50_44903_c1 | 3300050513 | Bacteria | 3244 |
| 1173 | nmdc:mga08x19_3423_c1 | 3300050514 | Bacteria | 9464 |
| 1174 | nmdc:mga08x19_42_c1 | 3300050514 | Bacteria | 150509 |
| 1175 | nmdc:mga08x19_60212_c1 | 3300050514 | Bacteria | 2459 |
| 1176 | nmdc:mga08x19_960767_c1 | 3300050514 | Bacteria | 607 |
| 1177 | nmdc:mga0a205_10341_c1 | 3300050515 | Bacteria | 8577 |
| 1178 | nmdc:mga0a205_11635_c1 | 3300050515 | Bacteria | 4917 |
| 1179 | nmdc:mga0a205_675153_c1 | 3300050515 | Bacteria | 884 |
| 1180 | Ga0495601_0008427 | 3300053077 | Bacteria | 6091 |
| 1181 | Ga0495612_0043467 | 3300053078 | Bacteria | 1836 |
| 1182 | Ga0495612_0370807 | 3300053078 | Bacteria | 648 |
| 1183 | Ga0500635_0021759 | 3300053080 | Bacteria | 1980 |
| 1184 | Ga0500646_0197267 | 3300053090 | Bacteria | 689 |
| 1185 | Ga0500555_181302 | 3300053103 | Bacteria | 509 |
| 1186 | Ga0500595_000320 | 3300053119 | Bacteria | 31611 |
| 1187 | Ga0500559_0179236 | 3300053136 | Bacteria | 998 |
| 1188 | Ga0500568_0029491 | 3300053139 | Bacteria | 2276 |
| 1189 | Ga0500590_288028 | 3300053148 | Bacteria | 626 |
| 1190 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 1191 | Ga0500645_062767 | 3300053730 | Bacteria | 1073 |
| 1192 | Ga0501084_0032813 | 3300054114 | Bacteria | 4345 |
| 1193 | Ga0587066_011929 | 3300059490 | Unclassified | 1286 |
| 1194 | Ga0587066_024070 | 3300059490 | Unclassified | 1033 |
| 1195 | Ga0587066_048807 | 3300059490 | Bacteria | 825 |
| 1196 | Ga0587066_094882 | 3300059490 | Bacteria | 669 |
| 1197 | Ga0587070_169095 | 3300059491 | Bacteria | 561 |
| 1198 | Ga0587073_0094789 | 3300059492 | Unclassified | 765 |
| 1199 | Ga0587073_0099364 | 3300059492 | Bacteria | 754 |
| 1200 | Ga0587077_003208 | 3300059493 | Unclassified | 2033 |
| 1201 | Ga0587077_011641 | 3300059493 | Unclassified | 1389 |
| 1202 | Ga0587077_051295 | 3300059493 | Bacteria | 864 |
| 1203 | Ga0587080_181933 | 3300059503 | Bacteria | 504 |
| 1204 | Ga0587082_058540 | 3300059504 | Bacteria | 754 |
| 1205 | Ga0587082_115067 | 3300059504 | Bacteria | 602 |
| 1206 | Ga0587083_0091879 | 3300059505 | Bacteria | 742 |
| 1207 | Ga0587083_0118195 | 3300059505 | Unclassified | 682 |
| 1208 | Ga0587085_008364 | 3300059506 | Bacteria | 1318 |
| 1209 | Ga0587086_099029 | 3300059507 | Unclassified | 535 |
| 1210 | Ga0587088_068321 | 3300059508 | Bacteria | 735 |
| 1211 | Ga0587088_086396 | 3300059508 | Bacteria | 680 |
| 1212 | Ga0587089_020292 | 3300059509 | Bacteria | 914 |
| 1213 | Ga0587090_053991 | 3300059510 | Bacteria | 744 |
| 1214 | Ga0587091_006440 | 3300059511 | Bacteria | 1650 |
| 1215 | Ga0587091_044360 | 3300059511 | Bacteria | 890 |
| 1216 | Ga0587091_114043 | 3300059511 | Bacteria | 649 |
| 1217 | Ga0587094_070437 | 3300059513 | Unclassified | 629 |
| 1218 | Ga0587094_112394 | 3300059513 | Unclassified | 537 |
| 1219 | Ga0587095_018029 | 3300059514 | Bacteria | 659 |
| 1220 | Ga0587106_020695 | 3300059605 | Bacteria | 973 |
| 1221 | Ga0587099_003167 | 3300059622 | Bacteria | 1351 |
| 1222 | Ga0587099_054697 | 3300059622 | Bacteria | 540 |
| 1223 | Ga0587113_001431 | 3300059625 | Bacteria | 1574 |
| 1224 | Ga0587113_023198 | 3300059625 | Bacteria | 666 |
| 1225 | Ga0587128_027920 | 3300059630 | Bacteria | 915 |
| 1226 | Ga0587130_037882 | 3300059631 | Bacteria | 574 |
| 1227 | Ga0587067_102046 | 3300059640 | Bacteria | 665 |
| 1228 | Ga0587068_137148 | 3300059641 | Bacteria | 543 |
| 1229 | Ga0587069_079038 | 3300059642 | Unclassified | 639 |
| 1230 | Ga0587069_090912 | 3300059642 | Bacteria | 610 |
| 1231 | Ga0587075_035754 | 3300059644 | Bacteria | 812 |
| 1232 | Ga0587075_104809 | 3300059644 | Bacteria | 569 |
| 1233 | Ga0587076_057266 | 3300059645 | Unclassified | 777 |
| 1234 | Ga0587076_068030 | 3300059645 | Bacteria | 733 |
| 1235 | Ga0587078_003416 | 3300059646 | Bacteria | 1607 |
| 1236 | Ga0587078_033149 | 3300059646 | Bacteria | 704 |
| 1237 | Ga0587078_069629 | 3300059646 | Unclassified | 547 |
| 1238 | Ga0587079_041102 | 3300059647 | Bacteria | 934 |
| 1239 | Ga0587079_081440 | 3300059647 | Bacteria | 741 |
| 1240 | Ga0587102_057556 | 3300059649 | Bacteria | 536 |
| 1241 | Ga0587107_040311 | 3300059652 | Unclassified | 752 |
| 1242 | Ga0587107_083373 | 3300059652 | Bacteria | 605 |
| 1243 | Ga0587107_153922 | 3300059652 | Unclassified | 501 |
| 1244 | Ga0587110_020899 | 3300059654 | Bacteria | 740 |
| 1245 | Ga0587114_009695 | 3300059655 | Bacteria | 1160 |
| 1246 | Ga0587060_019037 | 3300060243 | Bacteria | 644 |
| 1247 | Ga0587060_027715 | 3300060243 | Unclassified | 566 |
| 1248 | Ga0587060_028602 | 3300060243 | Unclassified | 560 |
| 1249 | Ga0587071_030033 | 3300060344 | Bacteria | 1042 |
| 1250 | Ga0587071_042949 | 3300060344 | Bacteria | 912 |
| 1251 | Ga0587071_138982 | 3300060344 | Unclassified | 595 |
| 1252 | Ga0587111_0020562 | 3300060346 | Unclassified | 1264 |
| 1253 | Ga0587111_0071641 | 3300060346 | Bacteria | 810 |
| 1254 | Ga0501082_0042240 | 3300060353 | Bacteria | 3931 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_100052914 | Ga0070683_1000529144 | 74 |
| 2 | 3300005337 | Ga0070682_100158085 | Ga0070682_1001580852 | 74 |
| 3 | 3300005339 | Ga0070660_100178381 | Ga0070660_1001783812 | 74 |
| 4 | 3300005345 | Ga0070692_10172236 | Ga0070692_101722361 | 74 |
| 5 | 3300005366 | Ga0070659_100005672 | Ga0070659_1000056724 | 74 |
| 6 | 3300005434 | Ga0070709_10198254 | Ga0070709_101982542 | 74 |
| 7 | 3300005435 | Ga0070714_100008559 | Ga0070714_1000085592 | 74 |
| 8 | 3300005455 | Ga0070663_100222803 | Ga0070663_1002228032 | 74 |
| 9 | 3300005458 | Ga0070681_10053214 | Ga0070681_100532143 | 74 |
| 10 | 3300005535 | Ga0070684_100102391 | Ga0070684_1001023914 | 74 |
| 11 | 3300005539 | Ga0068853_100023953 | Ga0068853_1000239534 | 74 |
| 12 | 3300005547 | Ga0070693_100036873 | Ga0070693_1000368734 | 74 |
| 13 | 3300005564 | Ga0070664_100003262 | Ga0070664_1000032626 | 74 |
| 14 | 3300005578 | Ga0068854_100010285 | Ga0068854_1000102856 | 74 |
| 15 | 3300005614 | Ga0068856_100025816 | Ga0068856_1000258166 | 74 |
| 16 | 3300005834 | Ga0068851_10005651 | Ga0068851_100056512 | 74 |
| 17 | 3300009174 | Ga0105241_10012600 | Ga0105241_100126003 | 74 |
| 18 | 3300009551 | Ga0105238_10028767 | Ga0105238_100287673 | 74 |
| 19 | 3300010375 | Ga0105239_10101256 | Ga0105239_101012562 | 74 |
| 20 | 3300013100 | Ga0157373_10003194 | Ga0157373_100031946 | 74 |
| 21 | 3300013102 | Ga0157371_10160659 | Ga0157371_101606592 | 74 |
| 22 | 3300013104 | Ga0157370_10045791 | Ga0157370_100457913 | 74 |
| 23 | 3300013105 | Ga0157369_10104452 | Ga0157369_101044523 | 74 |
| 24 | 3300013307 | Ga0157372_10584194 | Ga0157372_105841942 | 74 |
| 25 | 3300020070 | Ga0206356_11052062 | Ga0206356_110520623 | 74 |
| 26 | 3300020081 | Ga0206354_10951279 | Ga0206354_109512792 | 74 |
| 27 | 3300020082 | Ga0206353_11575536 | Ga0206353_115755363 | 74 |
| 28 | 3300025321 | Ga0207656_10267201 | Ga0207656_102672012 | 74 |
| 29 | 3300025906 | Ga0207699_10086730 | Ga0207699_100867302 | 74 |
| 30 | 3300025911 | Ga0207654_10623793 | Ga0207654_106237932 | 74 |
| 31 | 3300025912 | Ga0207707_10005825 | Ga0207707_1000582510 | 74 |
| 32 | 3300025913 | Ga0207695_10018355 | Ga0207695_100183553 | 74 |
| 33 | 3300025919 | Ga0207657_10000545 | Ga0207657_100005459 | 74 |
| 34 | 3300025920 | Ga0207649_10112862 | Ga0207649_101128621 | 74 |
| 35 | 3300025921 | Ga0207652_10011513 | Ga0207652_100115134 | 74 |
| 36 | 3300025924 | Ga0207694_10034291 | Ga0207694_100342914 | 74 |
| 37 | 3300025945 | Ga0207679_10006295 | Ga0207679_100062957 | 74 |
| 38 | 3300025949 | Ga0207667_10018660 | Ga0207667_100186601 | 74 |
| 39 | 3300026067 | Ga0207678_10006945 | Ga0207678_100069455 | 74 |
| 40 | 3300026078 | Ga0207702_12096128 | Ga0207702_120961282 | 74 |
| 41 | 3300026116 | Ga0207674_10000599 | Ga0207674_1000059914 | 74 |
| 42 | 3300037312 | Ga0395899_0652675 | Ga0395899_0652675_324_614 | 74 |
| 43 | 3300038443 | Ga0395901_0160056 | Ga0395901_0160056_1388_1678 | 74 |
| 44 | 3300005458 | Ga0070681_11220825 | Ga0070681_112208252 | 79 |
| 45 | 3300005563 | Ga0068855_100452362 | Ga0068855_1004523622 | 79 |
| 46 | 3300005616 | Ga0068852_100917667 | Ga0068852_1009176672 | 79 |
| 47 | 3300009093 | Ga0105240_10216638 | Ga0105240_102166383 | 79 |
| 48 | 3300013100 | Ga0157373_11499334 | Ga0157373_114993341 | 79 |
| 49 | 3300013104 | Ga0157370_10016839 | Ga0157370_100168396 | 79 |
| 50 | 3300014968 | Ga0157379_11130808 | Ga0157379_111308082 | 79 |
| 51 | 3300025913 | Ga0207695_10275618 | Ga0207695_102756182 | 79 |
| 52 | 3300025949 | Ga0207667_10366831 | Ga0207667_103668312 | 79 |
| 53 | 3300026142 | Ga0207698_10896398 | Ga0207698_108963981 | 79 |
| 54 | 3300035695 | Ga0373927_0404182 | Ga0373927_0404182_592_879 | 79 |
| 55 | 3300006880 | Ga0075429_101554111 | Ga0075429_1015541111 | 82 |
| 56 | 3300035085 | Ga0373929_0159156 | Ga0373929_0159156_84_425 | 82 |
| 57 | 3300050508 | nmdc:mga09592_1328130_c1 | nmdc:mga09592_1328130_c1_95_358 | 82 |
| 58 | 3300005445 | Ga0070708_100704655 | Ga0070708_1007046552 | 83 |
| 59 | 3300005467 | Ga0070706_100004512 | Ga0070706_1000045126 | 83 |
| 60 | 3300005468 | Ga0070707_100019321 | Ga0070707_1000193214 | 83 |
| 61 | 3300005468 | Ga0070707_100070745 | Ga0070707_1000707454 | 83 |
| 62 | 3300005471 | Ga0070698_100003066 | Ga0070698_10000306616 | 83 |
| 63 | 3300005518 | Ga0070699_100010361 | Ga0070699_1000103616 | 83 |
| 64 | 3300005536 | Ga0070697_100038980 | Ga0070697_1000389804 | 83 |
| 65 | 3300006028 | Ga0070717_10071819 | Ga0070717_100718194 | 83 |
| 66 | 3300006028 | Ga0070717_10233836 | Ga0070717_102338362 | 83 |
| 67 | 3300009147 | Ga0114129_10676335 | Ga0114129_106763352 | 83 |
| 68 | 3300009553 | Ga0105249_11158952 | Ga0105249_111589522 | 83 |
| 69 | 3300025910 | Ga0207684_10003813 | Ga0207684_100038137 | 83 |
| 70 | 3300025922 | Ga0207646_10013472 | Ga0207646_100134725 | 83 |
| 71 | 3300026023 | Ga0207677_11893277 | Ga0207677_118932771 | 83 |
| 72 | 3300032133 | Ga0316583_10222812 | Ga0316583_102228122 | 83 |
| 73 | 3300041496 | Ga0451839_0591775 | Ga0451839_0591775_106_372 | 83 |
| 74 | 3300042876 | Ga0451577_0603934 | Ga0451577_0603934_22_306 | 83 |
| 75 | 3300045976 | Ga0466967_0194001 | Ga0466967_0194001_925_1209 | 83 |
| 76 | 3300005290 | Ga0065712_10127583 | Ga0065712_101275832 | 84 |
| 77 | 3300005329 | Ga0070683_100038660 | Ga0070683_1000386604 | 84 |
| 78 | 3300005329 | Ga0070683_100043720 | Ga0070683_1000437204 | 84 |
| 79 | 3300005329 | Ga0070683_100068057 | Ga0070683_1000680572 | 84 |
| 80 | 3300005334 | Ga0068869_101385045 | Ga0068869_1013850452 | 84 |
| 81 | 3300005335 | Ga0070666_10947841 | Ga0070666_109478412 | 84 |
| 82 | 3300005336 | Ga0070680_100152520 | Ga0070680_1001525203 | 84 |
| 83 | 3300005339 | Ga0070660_100165686 | Ga0070660_1001656862 | 84 |
| 84 | 3300005343 | Ga0070687_100140135 | Ga0070687_1001401351 | 84 |
| 85 | 3300005344 | Ga0070661_100190755 | Ga0070661_1001907552 | 84 |
| 86 | 3300005354 | Ga0070675_100314509 | Ga0070675_1003145092 | 84 |
| 87 | 3300005355 | Ga0070671_100227365 | Ga0070671_1002273652 | 84 |
| 88 | 3300005367 | Ga0070667_100335736 | Ga0070667_1003357362 | 84 |
| 89 | 3300005435 | Ga0070714_100173109 | Ga0070714_1001731093 | 84 |
| 90 | 3300005436 | Ga0070713_100054101 | Ga0070713_1000541013 | 84 |
| 91 | 3300005436 | Ga0070713_100253781 | Ga0070713_1002537812 | 84 |
| 92 | 3300005436 | Ga0070713_100596834 | Ga0070713_1005968342 | 84 |
| 93 | 3300005437 | Ga0070710_10297599 | Ga0070710_102975991 | 84 |
| 94 | 3300005439 | Ga0070711_100002998 | Ga0070711_1000029986 | 84 |
| 95 | 3300005439 | Ga0070711_101149337 | Ga0070711_1011493372 | 84 |
| 96 | 3300005456 | Ga0070678_100506091 | Ga0070678_1005060912 | 84 |
| 97 | 3300005458 | Ga0070681_10000034 | Ga0070681_1000003430 | 84 |
| 98 | 3300005458 | Ga0070681_10124433 | Ga0070681_101244332 | 84 |
| 99 | 3300005458 | Ga0070681_10257813 | Ga0070681_102578132 | 84 |
| 100 | 3300005459 | Ga0068867_100013806 | Ga0068867_1000138064 | 84 |
| 101 | 3300005459 | Ga0068867_100312526 | Ga0068867_1003125261 | 84 |
| 102 | 3300005466 | Ga0070685_10516900 | Ga0070685_105169001 | 84 |
| 103 | 3300005467 | Ga0070706_102027529 | Ga0070706_1020275291 | 84 |
| 104 | 3300005530 | Ga0070679_100565309 | Ga0070679_1005653091 | 84 |
| 105 | 3300005535 | Ga0070684_100141434 | Ga0070684_1001414342 | 84 |
| 106 | 3300005535 | Ga0070684_100426222 | Ga0070684_1004262222 | 84 |
| 107 | 3300005563 | Ga0068855_100001570 | Ga0068855_10000157018 | 84 |
| 108 | 3300005563 | Ga0068855_100002685 | Ga0068855_10000268514 | 84 |
| 109 | 3300005563 | Ga0068855_101753069 | Ga0068855_1017530692 | 84 |
| 110 | 3300005564 | Ga0070664_100166698 | Ga0070664_1001666982 | 84 |
| 111 | 3300005577 | Ga0068857_100001766 | Ga0068857_10000176613 | 84 |
| 112 | 3300005578 | Ga0068854_100014415 | Ga0068854_1000144153 | 84 |
| 113 | 3300005614 | Ga0068856_100000494 | Ga0068856_10000049416 | 84 |
| 114 | 3300005614 | Ga0068856_100000571 | Ga0068856_10000057130 | 84 |
| 115 | 3300005614 | Ga0068856_100956440 | Ga0068856_1009564402 | 84 |
| 116 | 3300005616 | Ga0068852_100069129 | Ga0068852_1000691293 | 84 |
| 117 | 3300005616 | Ga0068852_100251898 | Ga0068852_1002518982 | 84 |
| 118 | 3300005618 | Ga0068864_100013098 | Ga0068864_1000130987 | 84 |
| 119 | 3300005618 | Ga0068864_101128535 | Ga0068864_1011285352 | 84 |
| 120 | 3300005718 | Ga0068866_10407211 | Ga0068866_104072112 | 84 |
| 121 | 3300005834 | Ga0068851_10064097 | Ga0068851_100640972 | 84 |
| 122 | 3300005841 | Ga0068863_100131057 | Ga0068863_1001310572 | 84 |
| 123 | 3300005841 | Ga0068863_101859382 | Ga0068863_1018593822 | 84 |
| 124 | 3300005842 | Ga0068858_100001544 | Ga0068858_10000154417 | 84 |
| 125 | 3300005842 | Ga0068858_100041995 | Ga0068858_1000419952 | 84 |
| 126 | 3300005842 | Ga0068858_100254555 | Ga0068858_1002545552 | 84 |
| 127 | 3300005842 | Ga0068858_101848427 | Ga0068858_1018484271 | 84 |
| 128 | 3300005843 | Ga0068860_100079065 | Ga0068860_1000790652 | 84 |
| 129 | 3300006028 | Ga0070717_10024241 | Ga0070717_100242412 | 84 |
| 130 | 3300006028 | Ga0070717_10118244 | Ga0070717_101182442 | 84 |
| 131 | 3300006028 | Ga0070717_10762431 | Ga0070717_107624311 | 84 |
| 132 | 3300006028 | Ga0070717_11902935 | Ga0070717_119029352 | 84 |
| 133 | 3300006163 | Ga0070715_10472278 | Ga0070715_104722781 | 84 |
| 134 | 3300006175 | Ga0070712_100006231 | Ga0070712_10000623110 | 84 |
| 135 | 3300006175 | Ga0070712_101044626 | Ga0070712_1010446261 | 84 |
| 136 | 3300006186 | Ga0075369_10588796 | Ga0075369_105887962 | 84 |
| 137 | 3300006195 | Ga0075366_10596748 | Ga0075366_105967482 | 84 |
| 138 | 3300006237 | Ga0097621_100000229 | Ga0097621_10000022913 | 84 |
| 139 | 3300006237 | Ga0097621_100137848 | Ga0097621_1001378482 | 84 |
| 140 | 3300006237 | Ga0097621_100386003 | Ga0097621_1003860032 | 84 |
| 141 | 3300006353 | Ga0075370_10553726 | Ga0075370_105537261 | 84 |
| 142 | 3300006353 | Ga0075370_10863884 | Ga0075370_108638842 | 84 |
| 143 | 3300006358 | Ga0068871_100000071 | Ga0068871_10000007138 | 84 |
| 144 | 3300006358 | Ga0068871_100078544 | Ga0068871_1000785442 | 84 |
| 145 | 3300006881 | Ga0068865_100007241 | Ga0068865_1000072418 | 84 |
| 146 | 3300007076 | Ga0075435_100879516 | Ga0075435_1008795161 | 84 |
| 147 | 3300009093 | Ga0105240_10099336 | Ga0105240_100993362 | 84 |
| 148 | 3300009093 | Ga0105240_10331838 | Ga0105240_103318382 | 84 |
| 149 | 3300009093 | Ga0105240_10941884 | Ga0105240_109418841 | 84 |
| 150 | 3300009174 | Ga0105241_10035957 | Ga0105241_100359572 | 84 |
| 151 | 3300009177 | Ga0105248_10006560 | Ga0105248_100065609 | 84 |
| 152 | 3300009177 | Ga0105248_10027109 | Ga0105248_100271093 | 84 |
| 153 | 3300009177 | Ga0105248_10158876 | Ga0105248_101588761 | 84 |
| 154 | 3300009545 | Ga0105237_10000998 | Ga0105237_1000099837 | 84 |
| 155 | 3300009545 | Ga0105237_10076207 | Ga0105237_100762072 | 84 |
| 156 | 3300009545 | Ga0105237_10146511 | Ga0105237_101465112 | 84 |
| 157 | 3300009545 | Ga0105237_10373749 | Ga0105237_103737491 | 84 |
| 158 | 3300009545 | Ga0105237_10475712 | Ga0105237_104757122 | 84 |
| 159 | 3300009551 | Ga0105238_10131860 | Ga0105238_101318602 | 84 |
| 160 | 3300010375 | Ga0105239_10039915 | Ga0105239_100399153 | 84 |
| 161 | 3300010375 | Ga0105239_10380145 | Ga0105239_103801452 | 84 |
| 162 | 3300011119 | Ga0105246_10050958 | Ga0105246_100509582 | 84 |
| 163 | 3300013102 | Ga0157371_10022249 | Ga0157371_100222493 | 84 |
| 164 | 3300013105 | Ga0157369_10118771 | Ga0157369_101187712 | 84 |
| 165 | 3300013105 | Ga0157369_10274083 | Ga0157369_102740832 | 84 |
| 166 | 3300013296 | Ga0157374_10001377 | Ga0157374_100013775 | 84 |
| 167 | 3300013296 | Ga0157374_10001647 | Ga0157374_1000164711 | 84 |
| 168 | 3300013297 | Ga0157378_10000733 | Ga0157378_1000073317 | 84 |
| 169 | 3300013297 | Ga0157378_10005107 | Ga0157378_100051072 | 84 |
| 170 | 3300013306 | Ga0163162_11266017 | Ga0163162_112660172 | 84 |
| 171 | 3300013307 | Ga0157372_10000287 | Ga0157372_1000028726 | 84 |
| 172 | 3300013307 | Ga0157372_10004400 | Ga0157372_100044005 | 84 |
| 173 | 3300013307 | Ga0157372_10009796 | Ga0157372_100097962 | 84 |
| 174 | 3300013307 | Ga0157372_10292855 | Ga0157372_102928552 | 84 |
| 175 | 3300014325 | Ga0163163_10333072 | Ga0163163_103330722 | 84 |
| 176 | 3300014968 | Ga0157379_10741048 | Ga0157379_107410482 | 84 |
| 177 | 3300014969 | Ga0157376_10019818 | Ga0157376_100198184 | 84 |
| 178 | 3300021384 | Ga0213876_10667011 | Ga0213876_106670111 | 84 |
| 179 | 3300025898 | Ga0207692_10647388 | Ga0207692_106473881 | 84 |
| 180 | 3300025904 | Ga0207647_10011120 | Ga0207647_100111204 | 84 |
| 181 | 3300025906 | Ga0207699_10368901 | Ga0207699_103689011 | 84 |
| 182 | 3300025913 | Ga0207695_10061347 | Ga0207695_100613472 | 84 |
| 183 | 3300025913 | Ga0207695_10135331 | Ga0207695_101353312 | 84 |
| 184 | 3300025915 | Ga0207693_10010671 | Ga0207693_100106712 | 84 |
| 185 | 3300025916 | Ga0207663_10042253 | Ga0207663_100422532 | 84 |
| 186 | 3300025917 | Ga0207660_10125857 | Ga0207660_101258572 | 84 |
| 187 | 3300025924 | Ga0207694_10173028 | Ga0207694_101730283 | 84 |
| 188 | 3300025924 | Ga0207694_10182772 | Ga0207694_101827722 | 84 |
| 189 | 3300025928 | Ga0207700_10038228 | Ga0207700_100382283 | 84 |
| 190 | 3300025928 | Ga0207700_10064900 | Ga0207700_100649003 | 84 |
| 191 | 3300025928 | Ga0207700_10399652 | Ga0207700_103996521 | 84 |
| 192 | 3300025929 | Ga0207664_10048243 | Ga0207664_100482434 | 84 |
| 193 | 3300025929 | Ga0207664_10147020 | Ga0207664_101470203 | 84 |
| 194 | 3300025929 | Ga0207664_10290571 | Ga0207664_102905713 | 84 |
| 195 | 3300025929 | Ga0207664_10530397 | Ga0207664_105303972 | 84 |
| 196 | 3300025933 | Ga0207706_10236421 | Ga0207706_102364212 | 84 |
| 197 | 3300025938 | Ga0207704_10004100 | Ga0207704_100041002 | 84 |
| 198 | 3300025938 | Ga0207704_10004645 | Ga0207704_100046453 | 84 |
| 199 | 3300025941 | Ga0207711_10003977 | Ga0207711_100039774 | 84 |
| 200 | 3300025941 | Ga0207711_10021908 | Ga0207711_100219085 | 84 |
| 201 | 3300025942 | Ga0207689_10493926 | Ga0207689_104939262 | 84 |
| 202 | 3300025944 | Ga0207661_10026846 | Ga0207661_100268464 | 84 |
| 203 | 3300025944 | Ga0207661_10144685 | Ga0207661_101446852 | 84 |
| 204 | 3300025945 | Ga0207679_10029218 | Ga0207679_100292184 | 84 |
| 205 | 3300025945 | Ga0207679_10166980 | Ga0207679_101669801 | 84 |
| 206 | 3300025949 | Ga0207667_10000827 | Ga0207667_1000082734 | 84 |
| 207 | 3300026035 | Ga0207703_10011078 | Ga0207703_100110785 | 84 |
| 208 | 3300026035 | Ga0207703_10013425 | Ga0207703_100134252 | 84 |
| 209 | 3300026078 | Ga0207702_10000612 | Ga0207702_100006122 | 84 |
| 210 | 3300026078 | Ga0207702_10004408 | Ga0207702_100044082 | 84 |
| 211 | 3300026088 | Ga0207641_10392967 | Ga0207641_103929672 | 84 |
| 212 | 3300026088 | Ga0207641_11879955 | Ga0207641_118799552 | 84 |
| 213 | 3300026089 | Ga0207648_10009935 | Ga0207648_100099357 | 84 |
| 214 | 3300026095 | Ga0207676_10004570 | Ga0207676_100045703 | 84 |
| 215 | 3300026095 | Ga0207676_10011892 | Ga0207676_100118925 | 84 |
| 216 | 3300026116 | Ga0207674_10001299 | Ga0207674_1000129913 | 84 |
| 217 | 3300026118 | Ga0207675_100188294 | Ga0207675_1001882942 | 84 |
| 218 | 3300026121 | Ga0207683_10389759 | Ga0207683_103897591 | 84 |
| 219 | 3300026121 | Ga0207683_11342412 | Ga0207683_113424122 | 84 |
| 220 | 3300028563 | Ga0265319_1117839 | Ga0265319_11178392 | 84 |
| 221 | 3300031238 | Ga0265332_10245446 | Ga0265332_102454461 | 84 |
| 222 | 3300031240 | Ga0265320_10564358 | Ga0265320_105643582 | 84 |
| 223 | 3300031242 | Ga0265329_10023016 | Ga0265329_100230163 | 84 |
| 224 | 3300031247 | Ga0265340_10035244 | Ga0265340_100352444 | 84 |
| 225 | 3300031250 | Ga0265331_10066094 | Ga0265331_100660942 | 84 |
| 226 | 3300031344 | Ga0265316_10008727 | Ga0265316_100087278 | 84 |
| 227 | 3300031344 | Ga0265316_10494313 | Ga0265316_104943131 | 84 |
| 228 | 3300031711 | Ga0265314_10105678 | Ga0265314_101056782 | 84 |
| 229 | 3300031712 | Ga0265342_10285740 | Ga0265342_102857402 | 84 |
| 230 | 3300035113 | Ga0373936_0438465 | Ga0373936_0438465_41_334 | 84 |
| 231 | 3300035170 | Ga0373943_0045362 | Ga0373943_0045362_714_992 | 84 |
| 232 | 3300035172 | Ga0373955_0845396 | Ga0373955_0845396_260_553 | 84 |
| 233 | 3300036401 | Ga0373937_0267129 | Ga0373937_0267129_446_739 | 84 |
| 234 | 3300039437 | Ga0436365_1658177 | Ga0436365_1658177_210_482 | 84 |
| 235 | 3300044684 | Ga0466966_0265662 | Ga0466966_0265662_653_946 | 84 |
| 236 | 3300044735 | Ga0466968_0449880 | Ga0466968_0449880_62_331 | 84 |
| 237 | 3300045049 | Ga0466959_0158154 | Ga0466959_0158154_216_491 | 84 |
| 238 | 3300048904 | Ga0496101_0722926 | Ga0496101_0722926_425_718 | 84 |
| 239 | 3300048915 | Ga0496112_0136162 | Ga0496112_0136162_1985_2278 | 84 |
| 240 | 3300050510 | nmdc:mga06r32_1801598_c1 | nmdc:mga06r32_1801598_c1_268_531 | 84 |
| 241 | 3300053078 | Ga0495612_0370807 | Ga0495612_0370807_269_562 | 84 |
| 242 | 3300059490 | Ga0587066_094882 | Ga0587066_094882_380_646 | 84 |
| 243 | 3300003316 | rootH1_10074194 | rootH1_100741941 | 85 |
| 244 | 3300003323 | rootH1_10118688 | rootH1_101186883 | 85 |
| 245 | 3300004799 | Ga0058863_10169016 | Ga0058863_101690162 | 85 |
| 246 | 3300004799 | Ga0058863_11328245 | Ga0058863_113282452 | 85 |
| 247 | 3300004799 | Ga0058863_11972463 | Ga0058863_119724631 | 85 |
| 248 | 3300004800 | Ga0058861_10035870 | Ga0058861_100358701 | 85 |
| 249 | 3300004803 | Ga0058862_12838737 | Ga0058862_128387372 | 85 |
| 250 | 3300005262 | Ga0065165_1001397 | Ga0065165_10013974 | 85 |
| 251 | 3300005327 | Ga0070658_10208422 | Ga0070658_102084221 | 85 |
| 252 | 3300005327 | Ga0070658_10348612 | Ga0070658_103486121 | 85 |
| 253 | 3300005329 | Ga0070683_100307367 | Ga0070683_1003073672 | 85 |
| 254 | 3300005334 | Ga0068869_101269207 | Ga0068869_1012692072 | 85 |
| 255 | 3300005336 | Ga0070680_100107381 | Ga0070680_1001073813 | 85 |
| 256 | 3300005336 | Ga0070680_100286226 | Ga0070680_1002862262 | 85 |
| 257 | 3300005336 | Ga0070680_100560506 | Ga0070680_1005605062 | 85 |
| 258 | 3300005336 | Ga0070680_100994740 | Ga0070680_1009947402 | 85 |
| 259 | 3300005336 | Ga0070680_101115834 | Ga0070680_1011158341 | 85 |
| 260 | 3300005336 | Ga0070680_101321102 | Ga0070680_1013211021 | 85 |
| 261 | 3300005337 | Ga0070682_100289385 | Ga0070682_1002893852 | 85 |
| 262 | 3300005338 | Ga0068868_100002997 | Ga0068868_10000299711 | 85 |
| 263 | 3300005339 | Ga0070660_100014330 | Ga0070660_1000143304 | 85 |
| 264 | 3300005339 | Ga0070660_100618630 | Ga0070660_1006186302 | 85 |
| 265 | 3300005339 | Ga0070660_100836793 | Ga0070660_1008367932 | 85 |
| 266 | 3300005340 | Ga0070689_100842324 | Ga0070689_1008423242 | 85 |
| 267 | 3300005341 | Ga0070691_10522192 | Ga0070691_105221922 | 85 |
| 268 | 3300005354 | Ga0070675_100333965 | Ga0070675_1003339652 | 85 |
| 269 | 3300005354 | Ga0070675_101087962 | Ga0070675_1010879622 | 85 |
| 270 | 3300005356 | Ga0070674_100189458 | Ga0070674_1001894582 | 85 |
| 271 | 3300005356 | Ga0070674_100733963 | Ga0070674_1007339632 | 85 |
| 272 | 3300005366 | Ga0070659_100146655 | Ga0070659_1001466553 | 85 |
| 273 | 3300005367 | Ga0070667_100299692 | Ga0070667_1002996922 | 85 |
| 274 | 3300005434 | Ga0070709_10022458 | Ga0070709_100224584 | 85 |
| 275 | 3300005434 | Ga0070709_10028444 | Ga0070709_100284442 | 85 |
| 276 | 3300005434 | Ga0070709_10173118 | Ga0070709_101731182 | 85 |
| 277 | 3300005434 | Ga0070709_10218868 | Ga0070709_102188682 | 85 |
| 278 | 3300005435 | Ga0070714_100079767 | Ga0070714_1000797672 | 85 |
| 279 | 3300005435 | Ga0070714_100169170 | Ga0070714_1001691702 | 85 |
| 280 | 3300005435 | Ga0070714_100200496 | Ga0070714_1002004962 | 85 |
| 281 | 3300005435 | Ga0070714_100273817 | Ga0070714_1002738172 | 85 |
| 282 | 3300005435 | Ga0070714_100571329 | Ga0070714_1005713292 | 85 |
| 283 | 3300005435 | Ga0070714_100832148 | Ga0070714_1008321482 | 85 |
| 284 | 3300005435 | Ga0070714_101467519 | Ga0070714_1014675192 | 85 |
| 285 | 3300005435 | Ga0070714_101860292 | Ga0070714_1018602922 | 85 |
| 286 | 3300005436 | Ga0070713_100031891 | Ga0070713_1000318912 | 85 |
| 287 | 3300005436 | Ga0070713_101262329 | Ga0070713_1012623292 | 85 |
| 288 | 3300005436 | Ga0070713_101485823 | Ga0070713_1014858232 | 85 |
| 289 | 3300005436 | Ga0070713_101651276 | Ga0070713_1016512762 | 85 |
| 290 | 3300005437 | Ga0070710_10049421 | Ga0070710_100494214 | 85 |
| 291 | 3300005437 | Ga0070710_10650914 | Ga0070710_106509142 | 85 |
| 292 | 3300005439 | Ga0070711_100009164 | Ga0070711_1000091647 | 85 |
| 293 | 3300005439 | Ga0070711_100245733 | Ga0070711_1002457332 | 85 |
| 294 | 3300005439 | Ga0070711_100600650 | Ga0070711_1006006501 | 85 |
| 295 | 3300005439 | Ga0070711_101741672 | Ga0070711_1017416722 | 85 |
| 296 | 3300005441 | Ga0070700_100220340 | Ga0070700_1002203402 | 85 |
| 297 | 3300005445 | Ga0070708_100101920 | Ga0070708_1001019202 | 85 |
| 298 | 3300005445 | Ga0070708_100430714 | Ga0070708_1004307141 | 85 |
| 299 | 3300005455 | Ga0070663_100942412 | Ga0070663_1009424121 | 85 |
| 300 | 3300005457 | Ga0070662_100348908 | Ga0070662_1003489082 | 85 |
| 301 | 3300005458 | Ga0070681_10000866 | Ga0070681_1000086610 | 85 |
| 302 | 3300005458 | Ga0070681_10004801 | Ga0070681_100048015 | 85 |
| 303 | 3300005458 | Ga0070681_10015551 | Ga0070681_100155512 | 85 |
| 304 | 3300005458 | Ga0070681_10066651 | Ga0070681_100666513 | 85 |
| 305 | 3300005458 | Ga0070681_10110791 | Ga0070681_101107912 | 85 |
| 306 | 3300005458 | Ga0070681_10331415 | Ga0070681_103314151 | 85 |
| 307 | 3300005458 | Ga0070681_10480312 | Ga0070681_104803122 | 85 |
| 308 | 3300005458 | Ga0070681_10849360 | Ga0070681_108493602 | 85 |
| 309 | 3300005459 | Ga0068867_100038423 | Ga0068867_1000384231 | 85 |
| 310 | 3300005467 | Ga0070706_100031340 | Ga0070706_1000313407 | 85 |
| 311 | 3300005467 | Ga0070706_100233730 | Ga0070706_1002337301 | 85 |
| 312 | 3300005468 | Ga0070707_100062647 | Ga0070707_1000626473 | 85 |
| 313 | 3300005468 | Ga0070707_100386866 | Ga0070707_1003868662 | 85 |
| 314 | 3300005468 | Ga0070707_100644972 | Ga0070707_1006449722 | 85 |
| 315 | 3300005468 | Ga0070707_100702543 | Ga0070707_1007025432 | 85 |
| 316 | 3300005468 | Ga0070707_101267169 | Ga0070707_1012671692 | 85 |
| 317 | 3300005471 | Ga0070698_100048069 | Ga0070698_1000480693 | 85 |
| 318 | 3300005471 | Ga0070698_100082784 | Ga0070698_1000827842 | 85 |
| 319 | 3300005471 | Ga0070698_100422048 | Ga0070698_1004220481 | 85 |
| 320 | 3300005518 | Ga0070699_100095096 | Ga0070699_1000950962 | 85 |
| 321 | 3300005518 | Ga0070699_100562450 | Ga0070699_1005624502 | 85 |
| 322 | 3300005518 | Ga0070699_100781710 | Ga0070699_1007817102 | 85 |
| 323 | 3300005518 | Ga0070699_101204775 | Ga0070699_1012047752 | 85 |
| 324 | 3300005530 | Ga0070679_100004353 | Ga0070679_1000043538 | 85 |
| 325 | 3300005530 | Ga0070679_100278304 | Ga0070679_1002783043 | 85 |
| 326 | 3300005530 | Ga0070679_100311181 | Ga0070679_1003111812 | 85 |
| 327 | 3300005530 | Ga0070679_100749370 | Ga0070679_1007493702 | 85 |
| 328 | 3300005530 | Ga0070679_101238367 | Ga0070679_1012383672 | 85 |
| 329 | 3300005535 | Ga0070684_100032814 | Ga0070684_1000328144 | 85 |
| 330 | 3300005535 | Ga0070684_100090844 | Ga0070684_1000908442 | 85 |
| 331 | 3300005535 | Ga0070684_100149776 | Ga0070684_1001497763 | 85 |
| 332 | 3300005535 | Ga0070684_102140132 | Ga0070684_1021401322 | 85 |
| 333 | 3300005536 | Ga0070697_100159347 | Ga0070697_1001593472 | 85 |
| 334 | 3300005536 | Ga0070697_100254727 | Ga0070697_1002547272 | 85 |
| 335 | 3300005539 | Ga0068853_100054558 | Ga0068853_1000545584 | 85 |
| 336 | 3300005539 | Ga0068853_100788036 | Ga0068853_1007880361 | 85 |
| 337 | 3300005549 | Ga0070704_100214449 | Ga0070704_1002144492 | 85 |
| 338 | 3300005563 | Ga0068855_100004336 | Ga0068855_10000433614 | 85 |
| 339 | 3300005563 | Ga0068855_100008443 | Ga0068855_1000084439 | 85 |
| 340 | 3300005563 | Ga0068855_100184044 | Ga0068855_1001840442 | 85 |
| 341 | 3300005563 | Ga0068855_100308434 | Ga0068855_1003084342 | 85 |
| 342 | 3300005563 | Ga0068855_100456708 | Ga0068855_1004567082 | 85 |
| 343 | 3300005563 | Ga0068855_100488219 | Ga0068855_1004882192 | 85 |
| 344 | 3300005563 | Ga0068855_100922035 | Ga0068855_1009220352 | 85 |
| 345 | 3300005563 | Ga0068855_102033078 | Ga0068855_1020330781 | 85 |
| 346 | 3300005564 | Ga0070664_101188301 | Ga0070664_1011883012 | 85 |
| 347 | 3300005564 | Ga0070664_102389646 | Ga0070664_1023896462 | 85 |
| 348 | 3300005578 | Ga0068854_101500153 | Ga0068854_1015001532 | 85 |
| 349 | 3300005614 | Ga0068856_100244501 | Ga0068856_1002445012 | 85 |
| 350 | 3300005614 | Ga0068856_100503913 | Ga0068856_1005039132 | 85 |
| 351 | 3300005614 | Ga0068856_100757148 | Ga0068856_1007571481 | 85 |
| 352 | 3300005616 | Ga0068852_100027091 | Ga0068852_1000270916 | 85 |
| 353 | 3300005616 | Ga0068852_100079200 | Ga0068852_1000792002 | 85 |
| 354 | 3300005616 | Ga0068852_100801204 | Ga0068852_1008012042 | 85 |
| 355 | 3300005616 | Ga0068852_100899419 | Ga0068852_1008994192 | 85 |
| 356 | 3300005618 | Ga0068864_101387445 | Ga0068864_1013874452 | 85 |
| 357 | 3300005618 | Ga0068864_101890436 | Ga0068864_1018904362 | 85 |
| 358 | 3300005718 | Ga0068866_10124922 | Ga0068866_101249222 | 85 |
| 359 | 3300005718 | Ga0068866_10279063 | Ga0068866_102790631 | 85 |
| 360 | 3300005841 | Ga0068863_100088618 | Ga0068863_1000886184 | 85 |
| 361 | 3300005842 | Ga0068858_102118706 | Ga0068858_1021187061 | 85 |
| 362 | 3300006028 | Ga0070717_10022337 | Ga0070717_100223374 | 85 |
| 363 | 3300006028 | Ga0070717_10067404 | Ga0070717_100674043 | 85 |
| 364 | 3300006028 | Ga0070717_10067722 | Ga0070717_100677222 | 85 |
| 365 | 3300006028 | Ga0070717_10082774 | Ga0070717_100827743 | 85 |
| 366 | 3300006028 | Ga0070717_10132130 | Ga0070717_101321303 | 85 |
| 367 | 3300006028 | Ga0070717_10180915 | Ga0070717_101809152 | 85 |
| 368 | 3300006028 | Ga0070717_10484587 | Ga0070717_104845872 | 85 |
| 369 | 3300006028 | Ga0070717_10551574 | Ga0070717_105515742 | 85 |
| 370 | 3300006028 | Ga0070717_10725068 | Ga0070717_107250682 | 85 |
| 371 | 3300006028 | Ga0070717_10974339 | Ga0070717_109743392 | 85 |
| 372 | 3300006163 | Ga0070715_10072093 | Ga0070715_100720932 | 85 |
| 373 | 3300006163 | Ga0070715_10287454 | Ga0070715_102874542 | 85 |
| 374 | 3300006173 | Ga0070716_100015742 | Ga0070716_1000157424 | 85 |
| 375 | 3300006173 | Ga0070716_100074910 | Ga0070716_1000749103 | 85 |
| 376 | 3300006173 | Ga0070716_100126690 | Ga0070716_1001266902 | 85 |
| 377 | 3300006173 | Ga0070716_100161478 | Ga0070716_1001614782 | 85 |
| 378 | 3300006173 | Ga0070716_100336149 | Ga0070716_1003361493 | 85 |
| 379 | 3300006173 | Ga0070716_101284460 | Ga0070716_1012844602 | 85 |
| 380 | 3300006175 | Ga0070712_100082778 | Ga0070712_1000827782 | 85 |
| 381 | 3300006175 | Ga0070712_100150532 | Ga0070712_1001505322 | 85 |
| 382 | 3300006175 | Ga0070712_100530535 | Ga0070712_1005305351 | 85 |
| 383 | 3300006175 | Ga0070712_100558024 | Ga0070712_1005580241 | 85 |
| 384 | 3300006175 | Ga0070712_100579700 | Ga0070712_1005797002 | 85 |
| 385 | 3300006175 | Ga0070712_101485410 | Ga0070712_1014854102 | 85 |
| 386 | 3300006175 | Ga0070712_101727666 | Ga0070712_1017276662 | 85 |
| 387 | 3300006175 | Ga0070712_101931714 | Ga0070712_1019317142 | 85 |
| 388 | 3300006358 | Ga0068871_100058479 | Ga0068871_1000584794 | 85 |
| 389 | 3300006358 | Ga0068871_100489008 | Ga0068871_1004890082 | 85 |
| 390 | 3300006358 | Ga0068871_100796269 | Ga0068871_1007962692 | 85 |
| 391 | 3300006844 | Ga0075428_100091508 | Ga0075428_1000915083 | 85 |
| 392 | 3300006847 | Ga0075431_100149163 | Ga0075431_1001491633 | 85 |
| 393 | 3300006847 | Ga0075431_101463496 | Ga0075431_1014634962 | 85 |
| 394 | 3300006852 | Ga0075433_10074837 | Ga0075433_100748373 | 85 |
| 395 | 3300006852 | Ga0075433_10603100 | Ga0075433_106031002 | 85 |
| 396 | 3300006852 | Ga0075433_10893613 | Ga0075433_108936131 | 85 |
| 397 | 3300006871 | Ga0075434_100092177 | Ga0075434_1000921773 | 85 |
| 398 | 3300006871 | Ga0075434_100235761 | Ga0075434_1002357612 | 85 |
| 399 | 3300006914 | Ga0075436_100003624 | Ga0075436_1000036242 | 85 |
| 400 | 3300006914 | Ga0075436_100763269 | Ga0075436_1007632691 | 85 |
| 401 | 3300006914 | Ga0075436_100832783 | Ga0075436_1008327832 | 85 |
| 402 | 3300006914 | Ga0075436_101327608 | Ga0075436_1013276082 | 85 |
| 403 | 3300007076 | Ga0075435_100057986 | Ga0075435_1000579862 | 85 |
| 404 | 3300007265 | Ga0099794_10057241 | Ga0099794_100572413 | 85 |
| 405 | 3300007788 | Ga0099795_10002569 | Ga0099795_100025693 | 85 |
| 406 | 3300007788 | Ga0099795_10441934 | Ga0099795_104419342 | 85 |
| 407 | 3300009093 | Ga0105240_10171524 | Ga0105240_101715244 | 85 |
| 408 | 3300009093 | Ga0105240_10293649 | Ga0105240_102936493 | 85 |
| 409 | 3300009093 | Ga0105240_10721310 | Ga0105240_107213102 | 85 |
| 410 | 3300009093 | Ga0105240_12560500 | Ga0105240_125605002 | 85 |
| 411 | 3300009094 | Ga0111539_10461367 | Ga0111539_104613673 | 85 |
| 412 | 3300009098 | Ga0105245_13039597 | Ga0105245_130395972 | 85 |
| 413 | 3300009147 | Ga0114129_10017580 | Ga0114129_100175807 | 85 |
| 414 | 3300009148 | Ga0105243_10752150 | Ga0105243_107521502 | 85 |
| 415 | 3300009174 | Ga0105241_10060437 | Ga0105241_100604374 | 85 |
| 416 | 3300009174 | Ga0105241_12696890 | Ga0105241_126968902 | 85 |
| 417 | 3300009176 | Ga0105242_10190421 | Ga0105242_101904213 | 85 |
| 418 | 3300009176 | Ga0105242_11216657 | Ga0105242_112166572 | 85 |
| 419 | 3300009177 | Ga0105248_10260273 | Ga0105248_102602733 | 85 |
| 420 | 3300009177 | Ga0105248_11941565 | Ga0105248_119415652 | 85 |
| 421 | 3300009177 | Ga0105248_12632921 | Ga0105248_126329211 | 85 |
| 422 | 3300009545 | Ga0105237_10537681 | Ga0105237_105376812 | 85 |
| 423 | 3300009545 | Ga0105237_10761076 | Ga0105237_107610763 | 85 |
| 424 | 3300009545 | Ga0105237_12458177 | Ga0105237_124581771 | 85 |
| 425 | 3300009551 | Ga0105238_12797190 | Ga0105238_127971902 | 85 |
| 426 | 3300009551 | Ga0105238_13024992 | Ga0105238_130249921 | 85 |
| 427 | 3300010159 | Ga0099796_10073709 | Ga0099796_100737092 | 85 |
| 428 | 3300010375 | Ga0105239_10603711 | Ga0105239_106037112 | 85 |
| 429 | 3300013100 | Ga0157373_10041300 | Ga0157373_100413003 | 85 |
| 430 | 3300013100 | Ga0157373_10459769 | Ga0157373_104597692 | 85 |
| 431 | 3300013102 | Ga0157371_10505176 | Ga0157371_105051762 | 85 |
| 432 | 3300013104 | Ga0157370_10046476 | Ga0157370_100464764 | 85 |
| 433 | 3300013104 | Ga0157370_10602076 | Ga0157370_106020761 | 85 |
| 434 | 3300013104 | Ga0157370_11242881 | Ga0157370_112428812 | 85 |
| 435 | 3300013105 | Ga0157369_10010175 | Ga0157369_100101752 | 85 |
| 436 | 3300013105 | Ga0157369_10184412 | Ga0157369_101844123 | 85 |
| 437 | 3300013105 | Ga0157369_10212090 | Ga0157369_102120902 | 85 |
| 438 | 3300013105 | Ga0157369_10327375 | Ga0157369_103273752 | 85 |
| 439 | 3300013105 | Ga0157369_11041982 | Ga0157369_110419822 | 85 |
| 440 | 3300013105 | Ga0157369_11132291 | Ga0157369_111322912 | 85 |
| 441 | 3300013105 | Ga0157369_11798127 | Ga0157369_117981271 | 85 |
| 442 | 3300013296 | Ga0157374_10026911 | Ga0157374_100269116 | 85 |
| 443 | 3300013296 | Ga0157374_10178983 | Ga0157374_101789832 | 85 |
| 444 | 3300013296 | Ga0157374_10239311 | Ga0157374_102393113 | 85 |
| 445 | 3300013296 | Ga0157374_11405916 | Ga0157374_114059162 | 85 |
| 446 | 3300013297 | Ga0157378_10526648 | Ga0157378_105266481 | 85 |
| 447 | 3300013297 | Ga0157378_11381374 | Ga0157378_113813742 | 85 |
| 448 | 3300013297 | Ga0157378_12046943 | Ga0157378_120469432 | 85 |
| 449 | 3300013306 | Ga0163162_10034415 | Ga0163162_100344154 | 85 |
| 450 | 3300013307 | Ga0157372_10026210 | Ga0157372_100262107 | 85 |
| 451 | 3300013307 | Ga0157372_10083897 | Ga0157372_100838975 | 85 |
| 452 | 3300013307 | Ga0157372_10212888 | Ga0157372_102128884 | 85 |
| 453 | 3300013307 | Ga0157372_11367990 | Ga0157372_113679902 | 85 |
| 454 | 3300013308 | Ga0157375_10333283 | Ga0157375_103332832 | 85 |
| 455 | 3300014325 | Ga0163163_10099375 | Ga0163163_100993752 | 85 |
| 456 | 3300014325 | Ga0163163_10276857 | Ga0163163_102768572 | 85 |
| 457 | 3300014325 | Ga0163163_11497311 | Ga0163163_114973112 | 85 |
| 458 | 3300014968 | Ga0157379_10075613 | Ga0157379_100756134 | 85 |
| 459 | 3300014969 | Ga0157376_10182461 | Ga0157376_101824612 | 85 |
| 460 | 3300014969 | Ga0157376_11264933 | Ga0157376_112649332 | 85 |
| 461 | 3300014969 | Ga0157376_11494338 | Ga0157376_114943382 | 85 |
| 462 | 3300015265 | Ga0182005_1126475 | Ga0182005_11264752 | 85 |
| 463 | 3300020069 | Ga0197907_10098072 | Ga0197907_100980722 | 85 |
| 464 | 3300020069 | Ga0197907_10740934 | Ga0197907_107409341 | 85 |
| 465 | 3300020069 | Ga0197907_11155002 | Ga0197907_111550022 | 85 |
| 466 | 3300020070 | Ga0206356_10401914 | Ga0206356_104019142 | 85 |
| 467 | 3300020070 | Ga0206356_11007705 | Ga0206356_110077052 | 85 |
| 468 | 3300020070 | Ga0206356_11552040 | Ga0206356_115520403 | 85 |
| 469 | 3300020076 | Ga0206355_1081738 | Ga0206355_10817382 | 85 |
| 470 | 3300020076 | Ga0206355_1429875 | Ga0206355_14298752 | 85 |
| 471 | 3300020077 | Ga0206351_10191672 | Ga0206351_101916722 | 85 |
| 472 | 3300020077 | Ga0206351_10927832 | Ga0206351_109278322 | 85 |
| 473 | 3300020078 | Ga0206352_10940195 | Ga0206352_109401952 | 85 |
| 474 | 3300020078 | Ga0206352_11149266 | Ga0206352_111492662 | 85 |
| 475 | 3300020080 | Ga0206350_10070795 | Ga0206350_100707952 | 85 |
| 476 | 3300020080 | Ga0206350_10157797 | Ga0206350_101577972 | 85 |
| 477 | 3300020080 | Ga0206350_10458796 | Ga0206350_104587961 | 85 |
| 478 | 3300020081 | Ga0206354_10336299 | Ga0206354_103362992 | 85 |
| 479 | 3300020082 | Ga0206353_11427356 | Ga0206353_114273562 | 85 |
| 480 | 3300020610 | Ga0154015_1524408 | Ga0154015_15244082 | 85 |
| 481 | 3300021361 | Ga0213872_10013951 | Ga0213872_100139512 | 85 |
| 482 | 3300022467 | Ga0224712_10096438 | Ga0224712_100964382 | 85 |
| 483 | 3300022467 | Ga0224712_10102869 | Ga0224712_101028692 | 85 |
| 484 | 3300022467 | Ga0224712_10364793 | Ga0224712_103647932 | 85 |
| 485 | 3300022467 | Ga0224712_10580099 | Ga0224712_105800992 | 85 |
| 486 | 3300025906 | Ga0207699_10230218 | Ga0207699_102302182 | 85 |
| 487 | 3300025909 | Ga0207705_10031642 | Ga0207705_100316422 | 85 |
| 488 | 3300025909 | Ga0207705_10557667 | Ga0207705_105576672 | 85 |
| 489 | 3300025910 | Ga0207684_10208962 | Ga0207684_102089623 | 85 |
| 490 | 3300025910 | Ga0207684_10286064 | Ga0207684_102860642 | 85 |
| 491 | 3300025912 | Ga0207707_10001110 | Ga0207707_100011109 | 85 |
| 492 | 3300025912 | Ga0207707_10153740 | Ga0207707_101537402 | 85 |
| 493 | 3300025912 | Ga0207707_10324631 | Ga0207707_103246311 | 85 |
| 494 | 3300025912 | Ga0207707_10464548 | Ga0207707_104645482 | 85 |
| 495 | 3300025913 | Ga0207695_10101990 | Ga0207695_101019902 | 85 |
| 496 | 3300025913 | Ga0207695_10147529 | Ga0207695_101475293 | 85 |
| 497 | 3300025913 | Ga0207695_10506211 | Ga0207695_105062111 | 85 |
| 498 | 3300025914 | Ga0207671_11112623 | Ga0207671_111126232 | 85 |
| 499 | 3300025914 | Ga0207671_11420451 | Ga0207671_114204511 | 85 |
| 500 | 3300025915 | Ga0207693_10067804 | Ga0207693_100678042 | 85 |
| 501 | 3300025915 | Ga0207693_10254859 | Ga0207693_102548592 | 85 |
| 502 | 3300025915 | Ga0207693_10468117 | Ga0207693_104681172 | 85 |
| 503 | 3300025915 | Ga0207693_11148830 | Ga0207693_111488302 | 85 |
| 504 | 3300025915 | Ga0207693_11303364 | Ga0207693_113033641 | 85 |
| 505 | 3300025916 | Ga0207663_10018814 | Ga0207663_100188146 | 85 |
| 506 | 3300025916 | Ga0207663_10192029 | Ga0207663_101920292 | 85 |
| 507 | 3300025916 | Ga0207663_10587281 | Ga0207663_105872812 | 85 |
| 508 | 3300025916 | Ga0207663_10762125 | Ga0207663_107621251 | 85 |
| 509 | 3300025916 | Ga0207663_11500308 | Ga0207663_115003082 | 85 |
| 510 | 3300025917 | Ga0207660_10001738 | Ga0207660_1000173811 | 85 |
| 511 | 3300025917 | Ga0207660_10172558 | Ga0207660_101725583 | 85 |
| 512 | 3300025917 | Ga0207660_10557420 | Ga0207660_105574202 | 85 |
| 513 | 3300025917 | Ga0207660_10616931 | Ga0207660_106169312 | 85 |
| 514 | 3300025919 | Ga0207657_10105535 | Ga0207657_101055352 | 85 |
| 515 | 3300025919 | Ga0207657_10370903 | Ga0207657_103709032 | 85 |
| 516 | 3300025919 | Ga0207657_10543810 | Ga0207657_105438102 | 85 |
| 517 | 3300025919 | Ga0207657_11047085 | Ga0207657_110470851 | 85 |
| 518 | 3300025921 | Ga0207652_10001268 | Ga0207652_100012681 | 85 |
| 519 | 3300025921 | Ga0207652_10074351 | Ga0207652_100743512 | 85 |
| 520 | 3300025921 | Ga0207652_10101182 | Ga0207652_101011823 | 85 |
| 521 | 3300025921 | Ga0207652_10410144 | Ga0207652_104101441 | 85 |
| 522 | 3300025921 | Ga0207652_10510945 | Ga0207652_105109452 | 85 |
| 523 | 3300025921 | Ga0207652_10555182 | Ga0207652_105551822 | 85 |
| 524 | 3300025921 | Ga0207652_11661199 | Ga0207652_116611991 | 85 |
| 525 | 3300025922 | Ga0207646_10245554 | Ga0207646_102455543 | 85 |
| 526 | 3300025922 | Ga0207646_10311501 | Ga0207646_103115013 | 85 |
| 527 | 3300025924 | Ga0207694_10027358 | Ga0207694_100273581 | 85 |
| 528 | 3300025924 | Ga0207694_10102366 | Ga0207694_101023662 | 85 |
| 529 | 3300025924 | Ga0207694_11862834 | Ga0207694_118628342 | 85 |
| 530 | 3300025925 | Ga0207650_11453312 | Ga0207650_114533122 | 85 |
| 531 | 3300025927 | Ga0207687_10457059 | Ga0207687_104570591 | 85 |
| 532 | 3300025928 | Ga0207700_10006948 | Ga0207700_100069482 | 85 |
| 533 | 3300025928 | Ga0207700_10208916 | Ga0207700_102089162 | 85 |
| 534 | 3300025928 | Ga0207700_11499294 | Ga0207700_114992941 | 85 |
| 535 | 3300025929 | Ga0207664_10154715 | Ga0207664_101547153 | 85 |
| 536 | 3300025929 | Ga0207664_10417338 | Ga0207664_104173381 | 85 |
| 537 | 3300025929 | Ga0207664_10507416 | Ga0207664_105074162 | 85 |
| 538 | 3300025929 | Ga0207664_10554744 | Ga0207664_105547442 | 85 |
| 539 | 3300025931 | Ga0207644_11487869 | Ga0207644_114878691 | 85 |
| 540 | 3300025932 | Ga0207690_10056564 | Ga0207690_100565644 | 85 |
| 541 | 3300025933 | Ga0207706_10174174 | Ga0207706_101741743 | 85 |
| 542 | 3300025934 | Ga0207686_10455411 | Ga0207686_104554112 | 85 |
| 543 | 3300025934 | Ga0207686_10723764 | Ga0207686_107237642 | 85 |
| 544 | 3300025936 | Ga0207670_10098641 | Ga0207670_100986412 | 85 |
| 545 | 3300025936 | Ga0207670_10650922 | Ga0207670_106509222 | 85 |
| 546 | 3300025937 | Ga0207669_10179794 | Ga0207669_101797942 | 85 |
| 547 | 3300025939 | Ga0207665_10252236 | Ga0207665_102522361 | 85 |
| 548 | 3300025939 | Ga0207665_10450556 | Ga0207665_104505562 | 85 |
| 549 | 3300025939 | Ga0207665_11065747 | Ga0207665_110657472 | 85 |
| 550 | 3300025941 | Ga0207711_10186065 | Ga0207711_101860652 | 85 |
| 551 | 3300025942 | Ga0207689_10199150 | Ga0207689_101991502 | 85 |
| 552 | 3300025942 | Ga0207689_10601737 | Ga0207689_106017371 | 85 |
| 553 | 3300025944 | Ga0207661_11258991 | Ga0207661_112589912 | 85 |
| 554 | 3300025944 | Ga0207661_11497760 | Ga0207661_114977601 | 85 |
| 555 | 3300025944 | Ga0207661_11503685 | Ga0207661_115036852 | 85 |
| 556 | 3300025945 | Ga0207679_10612648 | Ga0207679_106126482 | 85 |
| 557 | 3300025945 | Ga0207679_10668441 | Ga0207679_106684412 | 85 |
| 558 | 3300025945 | Ga0207679_11051564 | Ga0207679_110515642 | 85 |
| 559 | 3300025949 | Ga0207667_10000163 | Ga0207667_100001638 | 85 |
| 560 | 3300025949 | Ga0207667_10006364 | Ga0207667_100063643 | 85 |
| 561 | 3300025949 | Ga0207667_10474362 | Ga0207667_104743622 | 85 |
| 562 | 3300025949 | Ga0207667_10686535 | Ga0207667_106865352 | 85 |
| 563 | 3300025949 | Ga0207667_10946711 | Ga0207667_109467112 | 85 |
| 564 | 3300025949 | Ga0207667_11430794 | Ga0207667_114307941 | 85 |
| 565 | 3300025949 | Ga0207667_11903306 | Ga0207667_119033062 | 85 |
| 566 | 3300025981 | Ga0207640_10358399 | Ga0207640_103583992 | 85 |
| 567 | 3300025981 | Ga0207640_10740021 | Ga0207640_107400212 | 85 |
| 568 | 3300026041 | Ga0207639_10788223 | Ga0207639_107882232 | 85 |
| 569 | 3300026067 | Ga0207678_10896576 | Ga0207678_108965762 | 85 |
| 570 | 3300026078 | Ga0207702_10002903 | Ga0207702_100029032 | 85 |
| 571 | 3300026078 | Ga0207702_10113079 | Ga0207702_101130792 | 85 |
| 572 | 3300026078 | Ga0207702_10234084 | Ga0207702_102340842 | 85 |
| 573 | 3300026095 | Ga0207676_11181031 | Ga0207676_111810312 | 85 |
| 574 | 3300026118 | Ga0207675_100882794 | Ga0207675_1008827941 | 85 |
| 575 | 3300026142 | Ga0207698_10488790 | Ga0207698_104887902 | 85 |
| 576 | 3300026142 | Ga0207698_10630157 | Ga0207698_106301572 | 85 |
| 577 | 3300028023 | Ga0265357_1028107 | Ga0265357_10281071 | 85 |
| 578 | 3300030760 | Ga0265762_1015812 | Ga0265762_10158122 | 85 |
| 579 | 3300030836 | Ga0265767_118987 | Ga0265767_1189871 | 85 |
| 580 | 3300031018 | Ga0265773_1005643 | Ga0265773_10056432 | 85 |
| 581 | 3300031090 | Ga0265760_10038412 | Ga0265760_100384121 | 85 |
| 582 | 3300031344 | Ga0265316_10024535 | Ga0265316_100245353 | 85 |
| 583 | 3300031344 | Ga0265316_11013928 | Ga0265316_110139282 | 85 |
| 584 | 3300032126 | Ga0307415_100824076 | Ga0307415_1008240762 | 85 |
| 585 | 3300033547 | Ga0316212_1005758 | Ga0316212_10057582 | 85 |
| 586 | 3300035083 | Ga0373926_0020319 | Ga0373926_0020319_1194_1466 | 85 |
| 587 | 3300035086 | Ga0373934_0082392 | Ga0373934_0082392_461_733 | 85 |
| 588 | 3300035117 | Ga0373953_0067996 | Ga0373953_0067996_75_347 | 85 |
| 589 | 3300035117 | Ga0373953_0170848 | Ga0373953_0170848_510_782 | 85 |
| 590 | 3300035118 | Ga0373954_0095587 | Ga0373954_0095587_59_331 | 85 |
| 591 | 3300035118 | Ga0373954_0235239 | Ga0373954_0235239_240_506 | 85 |
| 592 | 3300035119 | Ga0373956_0236865 | Ga0373956_0236865_174_446 | 85 |
| 593 | 3300035170 | Ga0373943_0036145 | Ga0373943_0036145_815_1078 | 85 |
| 594 | 3300035172 | Ga0373955_0094599 | Ga0373955_0094599_183_449 | 85 |
| 595 | 3300035691 | Ga0373931_0486445 | Ga0373931_0486445_278_550 | 85 |
| 596 | 3300035692 | Ga0373935_0016406 | Ga0373935_0016406_3733_4005 | 85 |
| 597 | 3300035692 | Ga0373935_0179068 | Ga0373935_0179068_586_858 | 85 |
| 598 | 3300035695 | Ga0373927_0006677 | Ga0373927_0006677_6568_6840 | 85 |
| 599 | 3300035695 | Ga0373927_0041162 | Ga0373927_0041162_1927_2223 | 85 |
| 600 | 3300035695 | Ga0373927_0729493 | Ga0373927_0729493_254_526 | 85 |
| 601 | 3300035724 | Ga0373933_0112529 | Ga0373933_0112529_578_850 | 85 |
| 602 | 3300035724 | Ga0373933_0688328 | Ga0373933_0688328_321_614 | 85 |
| 603 | 3300035725 | Ga0373947_0058297 | Ga0373947_0058297_1581_1853 | 85 |
| 604 | 3300035725 | Ga0373947_0470957 | Ga0373947_0470957_363_656 | 85 |
| 605 | 3300036401 | Ga0373937_0104317 | Ga0373937_0104317_362_625 | 85 |
| 606 | 3300036401 | Ga0373937_0140386 | Ga0373937_0140386_1318_1590 | 85 |
| 607 | 3300036401 | Ga0373937_0251807 | Ga0373937_0251807_987_1262 | 85 |
| 608 | 3300036401 | Ga0373937_0501704 | Ga0373937_0501704_803_1099 | 85 |
| 609 | 3300036401 | Ga0373937_0635291 | Ga0373937_0635291_563_835 | 85 |
| 610 | 3300037068 | Ga0373925_0351968 | Ga0373925_0351968_100_372 | 85 |
| 611 | 3300037418 | Ga0395900_0291088 | Ga0395900_0291088_1087_1350 | 85 |
| 612 | 3300037853 | Ga0436364_0181287 | Ga0436364_0181287_98_394 | 85 |
| 613 | 3300037853 | Ga0436364_0654329 | Ga0436364_0654329_5177_5440 | 85 |
| 614 | 3300037853 | Ga0436364_1338884 | Ga0436364_1338884_206_469 | 85 |
| 615 | 3300038443 | Ga0395901_0392554 | Ga0395901_0392554_1145_1408 | 85 |
| 616 | 3300039437 | Ga0436365_0316424 | Ga0436365_0316424_2641_2937 | 85 |
| 617 | 3300039447 | Ga0436361_0461868 | Ga0436361_0461868_10026_10289 | 85 |
| 618 | 3300039450 | Ga0436363_1042151 | Ga0436363_1042151_132_425 | 85 |
| 619 | 3300041509 | Ga0451843_1744014 | Ga0451843_1744014_19_291 | 85 |
| 620 | 3300042131 | Ga0450894_039415 | Ga0450894_039415_256_519 | 85 |
| 621 | 3300044694 | Ga0466963_0000041 | Ga0466963_0000041_16949_17227 | 85 |
| 622 | 3300044694 | Ga0466963_0567510 | Ga0466963_0567510_145_429 | 85 |
| 623 | 3300044842 | Ga0466957_0235335 | Ga0466957_0235335_916_1194 | 85 |
| 624 | 3300044842 | Ga0466957_1310403 | Ga0466957_1310403_82_360 | 85 |
| 625 | 3300045049 | Ga0466959_1145905 | Ga0466959_1145905_13_297 | 85 |
| 626 | 3300045836 | Ga0466958_0850781 | Ga0466958_0850781_51_344 | 85 |
| 627 | 3300045976 | Ga0466967_0000566 | Ga0466967_0000566_13443_13721 | 85 |
| 628 | 3300045976 | Ga0466967_0019630 | Ga0466967_0019630_3907_4182 | 85 |
| 629 | 3300046454 | Ga0495592_0254430 | Ga0495592_0254430_31_294 | 85 |
| 630 | 3300046454 | Ga0495592_0306740 | Ga0495592_0306740_498_770 | 85 |
| 631 | 3300046462 | Ga0495651_0001752 | Ga0495651_0001752_15873_16145 | 85 |
| 632 | 3300046462 | Ga0495651_0422165 | Ga0495651_0422165_560_832 | 85 |
| 633 | 3300046472 | Ga0495580_0004971 | Ga0495580_0004971_9476_9748 | 85 |
| 634 | 3300046473 | Ga0495582_0172079 | Ga0495582_0172079_310_582 | 85 |
| 635 | 3300046476 | Ga0495662_0211314 | Ga0495662_0211314_643_915 | 85 |
| 636 | 3300046499 | Ga0495594_0049706 | Ga0495594_0049706_527_799 | 85 |
| 637 | 3300046517 | Ga0495630_0196560 | Ga0495630_0196560_784_1047 | 85 |
| 638 | 3300046517 | Ga0495630_0342578 | Ga0495630_0342578_481_753 | 85 |
| 639 | 3300046526 | Ga0495666_0058454 | Ga0495666_0058454_1360_1632 | 85 |
| 640 | 3300046529 | Ga0495652_0064163 | Ga0495652_0064163_2798_3070 | 85 |
| 641 | 3300046529 | Ga0495652_0237388 | Ga0495652_0237388_86_358 | 85 |
| 642 | 3300046531 | Ga0495665_0123090 | Ga0495665_0123090_873_1145 | 85 |
| 643 | 3300046533 | Ga0495640_0180550 | Ga0495640_0180550_149_421 | 85 |
| 644 | 3300046533 | Ga0495640_0201602 | Ga0495640_0201602_288_560 | 85 |
| 645 | 3300046535 | Ga0495586_0209238 | Ga0495586_0209238_239_535 | 85 |
| 646 | 3300046536 | Ga0495587_0220222 | Ga0495587_0220222_338_610 | 85 |
| 647 | 3300046543 | Ga0495645_0153148 | Ga0495645_0153148_785_1054 | 85 |
| 648 | 3300046559 | Ga0495667_0029553 | Ga0495667_0029553_951_1223 | 85 |
| 649 | 3300046663 | Ga0495635_0131966 | Ga0495635_0131966_110_382 | 85 |
| 650 | 3300046663 | Ga0495635_0163015 | Ga0495635_0163015_600_872 | 85 |
| 651 | 3300046675 | Ga0495657_0537599 | Ga0495657_0537599_147_419 | 85 |
| 652 | 3300046678 | Ga0495599_0152181 | Ga0495599_0152181_732_1004 | 85 |
| 653 | 3300046678 | Ga0495599_0222345 | Ga0495599_0222345_762_1025 | 85 |
| 654 | 3300046679 | Ga0495623_0028412 | Ga0495623_0028412_866_1138 | 85 |
| 655 | 3300046683 | Ga0495658_0601236 | Ga0495658_0601236_281_553 | 85 |
| 656 | 3300046689 | Ga0495613_0081924 | Ga0495613_0081924_1061_1333 | 85 |
| 657 | 3300046689 | Ga0495613_0393711 | Ga0495613_0393711_234_506 | 85 |
| 658 | 3300046691 | Ga0495670_0695266 | Ga0495670_0695266_122_394 | 85 |
| 659 | 3300046809 | Ga0495600_0177708 | Ga0495600_0177708_522_794 | 85 |
| 660 | 3300046809 | Ga0495600_0520434 | Ga0495600_0520434_153_425 | 85 |
| 661 | 3300047315 | Ga0495581_0199797 | Ga0495581_0199797_376_648 | 85 |
| 662 | 3300047317 | Ga0495604_0079173 | Ga0495604_0079173_2166_2438 | 85 |
| 663 | 3300047318 | Ga0495636_0514344 | Ga0495636_0514344_156_428 | 85 |
| 664 | 3300047319 | Ga0495674_0097651 | Ga0495674_0097651_426_698 | 85 |
| 665 | 3300047319 | Ga0495674_0226016 | Ga0495674_0226016_82_354 | 85 |
| 666 | 3300047319 | Ga0495674_1215705 | Ga0495674_1215705_128_400 | 85 |
| 667 | 3300047319 | Ga0495674_1235901 | Ga0495674_1235901_79_342 | 85 |
| 668 | 3300047444 | Ga0495675_0011403 | Ga0495675_0011403_2132_2404 | 85 |
| 669 | 3300047444 | Ga0495675_0210443 | Ga0495675_0210443_681_944 | 85 |
| 670 | 3300047471 | Ga0495684_0006742 | Ga0495684_0006742_4132_4404 | 85 |
| 671 | 3300047471 | Ga0495684_0020161 | Ga0495684_0020161_2619_2891 | 85 |
| 672 | 3300047471 | Ga0495684_0576974 | Ga0495684_0576974_31_294 | 85 |
| 673 | 3300047673 | Ga0495593_0491600 | Ga0495593_0491600_138_410 | 85 |
| 674 | 3300048088 | Ga0495602_0015970 | Ga0495602_0015970_2480_2752 | 85 |
| 675 | 3300048088 | Ga0495602_0382435 | Ga0495602_0382435_534_806 | 85 |
| 676 | 3300048088 | Ga0495602_0813310 | Ga0495602_0813310_341_607 | 85 |
| 677 | 3300048089 | Ga0495614_0314817 | Ga0495614_0314817_358_630 | 85 |
| 678 | 3300048906 | Ga0496103_0020250 | Ga0496103_0020250_2304_2576 | 85 |
| 679 | 3300048911 | Ga0496108_0000127 | Ga0496108_0000127_35176_35439 | 85 |
| 680 | 3300048913 | Ga0496110_0118328 | Ga0496110_0118328_231_503 | 85 |
| 681 | 3300048913 | Ga0496110_0334144 | Ga0496110_0334144_398_661 | 85 |
| 682 | 3300048913 | Ga0496110_1825365 | Ga0496110_1825365_129_392 | 85 |
| 683 | 3300048915 | Ga0496112_0163457 | Ga0496112_0163457_462_767 | 85 |
| 684 | 3300048915 | Ga0496112_0230136 | Ga0496112_0230136_917_1180 | 85 |
| 685 | 3300048916 | Ga0496113_0416049 | Ga0496113_0416049_567_839 | 85 |
| 686 | 3300048918 | Ga0496115_0995080 | Ga0496115_0995080_73_357 | 85 |
| 687 | 3300048928 | Ga0496125_0438267 | Ga0496125_0438267_258_539 | 85 |
| 688 | 3300048929 | Ga0496126_0020359 | Ga0496126_0020359_3696_3977 | 85 |
| 689 | 3300049583 | Ga0501067_0281690 | Ga0501067_0281690_595_891 | 85 |
| 690 | 3300049589 | Ga0501073_0099581 | Ga0501073_0099581_821_1117 | 85 |
| 691 | 3300049593 | Ga0501077_0101339 | Ga0501077_0101339_1166_1462 | 85 |
| 692 | 3300049686 | Ga0501257_262518 | Ga0501257_262518_140_412 | 85 |
| 693 | 3300050507 | nmdc:mga05p37_111824_c1 | nmdc:mga05p37_111824_c1_2958_3230 | 85 |
| 694 | 3300050510 | nmdc:mga06r32_121954_c1 | nmdc:mga06r32_121954_c1_2141_2404 | 85 |
| 695 | 3300050511 | nmdc:mga08y16_366151_c1 | nmdc:mga08y16_366151_c1_107_400 | 85 |
| 696 | 3300050512 | nmdc:mga0n895_544146_c1 | nmdc:mga0n895_544146_c1_777_1049 | 85 |
| 697 | 3300050513 | nmdc:mga0rr50_44903_c1 | nmdc:mga0rr50_44903_c1_2260_2535 | 85 |
| 698 | 3300050514 | nmdc:mga08x19_3423_c1 | nmdc:mga08x19_3423_c1_6444_6716 | 85 |
| 699 | 3300050515 | nmdc:mga0a205_10341_c1 | nmdc:mga0a205_10341_c1_6940_7212 | 85 |
| 700 | 3300050515 | nmdc:mga0a205_11635_c1 | nmdc:mga0a205_11635_c1_1841_2104 | 85 |
| 701 | 3300053156 | Ga0500622_0000002 | Ga0500622_0000002_116565_116828 | 85 |
| 702 | 3300054114 | Ga0501084_0032813 | Ga0501084_0032813_270_566 | 85 |
| 703 | 3300059490 | Ga0587066_011929 | Ga0587066_011929_879_1151 | 85 |
| 704 | 3300059490 | Ga0587066_024070 | Ga0587066_024070_59_334 | 85 |
| 705 | 3300059490 | Ga0587066_048807 | Ga0587066_048807_322_600 | 85 |
| 706 | 3300059491 | Ga0587070_169095 | Ga0587070_169095_227_505 | 85 |
| 707 | 3300059492 | Ga0587073_0094789 | Ga0587073_0094789_191_463 | 85 |
| 708 | 3300059492 | Ga0587073_0099364 | Ga0587073_0099364_203_481 | 85 |
| 709 | 3300059493 | Ga0587077_003208 | Ga0587077_003208_985_1263 | 85 |
| 710 | 3300059493 | Ga0587077_011641 | Ga0587077_011641_719_991 | 85 |
| 711 | 3300059493 | Ga0587077_051295 | Ga0587077_051295_260_538 | 85 |
| 712 | 3300059503 | Ga0587080_181933 | Ga0587080_181933_204_482 | 85 |
| 713 | 3300059504 | Ga0587082_058540 | Ga0587082_058540_107_379 | 85 |
| 714 | 3300059504 | Ga0587082_115067 | Ga0587082_115067_171_449 | 85 |
| 715 | 3300059505 | Ga0587083_0091879 | Ga0587083_0091879_259_537 | 85 |
| 716 | 3300059505 | Ga0587083_0118195 | Ga0587083_0118195_226_504 | 85 |
| 717 | 3300059506 | Ga0587085_008364 | Ga0587085_008364_393_665 | 85 |
| 718 | 3300059507 | Ga0587086_099029 | Ga0587086_099029_118_396 | 85 |
| 719 | 3300059508 | Ga0587088_068321 | Ga0587088_068321_254_532 | 85 |
| 720 | 3300059508 | Ga0587088_086396 | Ga0587088_086396_292_564 | 85 |
| 721 | 3300059509 | Ga0587089_020292 | Ga0587089_020292_217_495 | 85 |
| 722 | 3300059510 | Ga0587090_053991 | Ga0587090_053991_254_532 | 85 |
| 723 | 3300059511 | Ga0587091_006440 | Ga0587091_006440_260_538 | 85 |
| 724 | 3300059511 | Ga0587091_044360 | Ga0587091_044360_502_774 | 85 |
| 725 | 3300059511 | Ga0587091_114043 | Ga0587091_114043_166_444 | 85 |
| 726 | 3300059513 | Ga0587094_070437 | Ga0587094_070437_172_450 | 85 |
| 727 | 3300059513 | Ga0587094_112394 | Ga0587094_112394_115_387 | 85 |
| 728 | 3300059514 | Ga0587095_018029 | Ga0587095_018029_120_398 | 85 |
| 729 | 3300059605 | Ga0587106_020695 | Ga0587106_020695_372_650 | 85 |
| 730 | 3300059622 | Ga0587099_003167 | Ga0587099_003167_106_384 | 85 |
| 731 | 3300059622 | Ga0587099_054697 | Ga0587099_054697_204_482 | 85 |
| 732 | 3300059625 | Ga0587113_001431 | Ga0587113_001431_972_1250 | 85 |
| 733 | 3300059625 | Ga0587113_023198 | Ga0587113_023198_185_463 | 85 |
| 734 | 3300059630 | Ga0587128_027920 | Ga0587128_027920_432_710 | 85 |
| 735 | 3300059631 | Ga0587130_037882 | Ga0587130_037882_94_372 | 85 |
| 736 | 3300059640 | Ga0587067_102046 | Ga0587067_102046_204_482 | 85 |
| 737 | 3300059641 | Ga0587068_137148 | Ga0587068_137148_62_340 | 85 |
| 738 | 3300059642 | Ga0587069_079038 | Ga0587069_079038_221_499 | 85 |
| 739 | 3300059642 | Ga0587069_090912 | Ga0587069_090912_80_358 | 85 |
| 740 | 3300059644 | Ga0587075_035754 | Ga0587075_035754_250_528 | 85 |
| 741 | 3300059644 | Ga0587075_104809 | Ga0587075_104809_79_351 | 85 |
| 742 | 3300059645 | Ga0587076_057266 | Ga0587076_057266_256_534 | 85 |
| 743 | 3300059645 | Ga0587076_068030 | Ga0587076_068030_254_532 | 85 |
| 744 | 3300059646 | Ga0587078_003416 | Ga0587078_003416_361_639 | 85 |
| 745 | 3300059646 | Ga0587078_033149 | Ga0587078_033149_208_480 | 85 |
| 746 | 3300059646 | Ga0587078_069629 | Ga0587078_069629_154_432 | 85 |
| 747 | 3300059647 | Ga0587079_041102 | Ga0587079_041102_562_840 | 85 |
| 748 | 3300059647 | Ga0587079_081440 | Ga0587079_081440_204_482 | 85 |
| 749 | 3300059649 | Ga0587102_057556 | Ga0587102_057556_109_375 | 85 |
| 750 | 3300059652 | Ga0587107_040311 | Ga0587107_040311_249_527 | 85 |
| 751 | 3300059652 | Ga0587107_083373 | Ga0587107_083373_204_482 | 85 |
| 752 | 3300059652 | Ga0587107_153922 | Ga0587107_153922_19_291 | 85 |
| 753 | 3300059654 | Ga0587110_020899 | Ga0587110_020899_279_557 | 85 |
| 754 | 3300059655 | Ga0587114_009695 | Ga0587114_009695_656_934 | 85 |
| 755 | 3300060243 | Ga0587060_019037 | Ga0587060_019037_165_443 | 85 |
| 756 | 3300060243 | Ga0587060_027715 | Ga0587060_027715_139_417 | 85 |
| 757 | 3300060243 | Ga0587060_028602 | Ga0587060_028602_76_348 | 85 |
| 758 | 3300060344 | Ga0587071_030033 | Ga0587071_030033_747_1025 | 85 |
| 759 | 3300060344 | Ga0587071_042949 | Ga0587071_042949_432_710 | 85 |
| 760 | 3300060344 | Ga0587071_138982 | Ga0587071_138982_144_422 | 85 |
| 761 | 3300060346 | Ga0587111_0020562 | Ga0587111_0020562_286_558 | 85 |
| 762 | 3300060346 | Ga0587111_0071641 | Ga0587111_0071641_383_655 | 85 |
| 763 | 3300060353 | Ga0501082_0042240 | Ga0501082_0042240_558_854 | 85 |
| 764 | 3300001978 | JGI24747J21853_1012948 | JGI24747J21853_10129481 | 86 |
| 765 | 3300001991 | JGI24743J22301_10006256 | JGI24743J22301_100062562 | 86 |
| 766 | 3300002073 | JGI24745J21846_1039197 | JGI24745J21846_10391971 | 86 |
| 767 | 3300002155 | JGI24033J26618_1047475 | JGI24033J26618_10474751 | 86 |
| 768 | 3300002239 | JGI24034J26672_10006364 | JGI24034J26672_100063642 | 86 |
| 769 | 3300005290 | Ga0065712_10533850 | Ga0065712_105338502 | 86 |
| 770 | 3300005293 | Ga0065715_10447627 | Ga0065715_104476272 | 86 |
| 771 | 3300005295 | Ga0065707_10161803 | Ga0065707_101618032 | 86 |
| 772 | 3300005295 | Ga0065707_10612311 | Ga0065707_106123111 | 86 |
| 773 | 3300005327 | Ga0070658_10067908 | Ga0070658_100679083 | 86 |
| 774 | 3300005327 | Ga0070658_10169186 | Ga0070658_101691862 | 86 |
| 775 | 3300005328 | Ga0070676_10028309 | Ga0070676_100283092 | 86 |
| 776 | 3300005330 | Ga0070690_100055358 | Ga0070690_1000553582 | 86 |
| 777 | 3300005330 | Ga0070690_101283815 | Ga0070690_1012838151 | 86 |
| 778 | 3300005331 | Ga0070670_100003945 | Ga0070670_1000039458 | 86 |
| 779 | 3300005331 | Ga0070670_100038379 | Ga0070670_1000383792 | 86 |
| 780 | 3300005333 | Ga0070677_10008635 | Ga0070677_100086352 | 86 |
| 781 | 3300005333 | Ga0070677_10666361 | Ga0070677_106663612 | 86 |
| 782 | 3300005334 | Ga0068869_100001726 | Ga0068869_10000172612 | 86 |
| 783 | 3300005334 | Ga0068869_100043396 | Ga0068869_1000433965 | 86 |
| 784 | 3300005335 | Ga0070666_10018142 | Ga0070666_100181425 | 86 |
| 785 | 3300005335 | Ga0070666_10054209 | Ga0070666_100542092 | 86 |
| 786 | 3300005335 | Ga0070666_10076867 | Ga0070666_100768672 | 86 |
| 787 | 3300005335 | Ga0070666_10113694 | Ga0070666_101136943 | 86 |
| 788 | 3300005336 | Ga0070680_100075561 | Ga0070680_1000755612 | 86 |
| 789 | 3300005336 | Ga0070680_100153174 | Ga0070680_1001531742 | 86 |
| 790 | 3300005336 | Ga0070680_100612333 | Ga0070680_1006123332 | 86 |
| 791 | 3300005337 | Ga0070682_100008051 | Ga0070682_1000080517 | 86 |
| 792 | 3300005337 | Ga0070682_100126134 | Ga0070682_1001261341 | 86 |
| 793 | 3300005337 | Ga0070682_100774831 | Ga0070682_1007748312 | 86 |
| 794 | 3300005338 | Ga0068868_100020426 | Ga0068868_1000204263 | 86 |
| 795 | 3300005338 | Ga0068868_100290804 | Ga0068868_1002908042 | 86 |
| 796 | 3300005338 | Ga0068868_101152182 | Ga0068868_1011521821 | 86 |
| 797 | 3300005339 | Ga0070660_100084372 | Ga0070660_1000843722 | 86 |
| 798 | 3300005339 | Ga0070660_100087160 | Ga0070660_1000871603 | 86 |
| 799 | 3300005339 | Ga0070660_100100200 | Ga0070660_1001002001 | 86 |
| 800 | 3300005339 | Ga0070660_101126500 | Ga0070660_1011265002 | 86 |
| 801 | 3300005340 | Ga0070689_100067085 | Ga0070689_1000670853 | 86 |
| 802 | 3300005340 | Ga0070689_100110645 | Ga0070689_1001106452 | 86 |
| 803 | 3300005340 | Ga0070689_100327815 | Ga0070689_1003278152 | 86 |
| 804 | 3300005340 | Ga0070689_100399077 | Ga0070689_1003990772 | 86 |
| 805 | 3300005343 | Ga0070687_100001840 | Ga0070687_1000018406 | 86 |
| 806 | 3300005343 | Ga0070687_100464332 | Ga0070687_1004643322 | 86 |
| 807 | 3300005344 | Ga0070661_100073479 | Ga0070661_1000734792 | 86 |
| 808 | 3300005344 | Ga0070661_100168682 | Ga0070661_1001686822 | 86 |
| 809 | 3300005344 | Ga0070661_100957281 | Ga0070661_1009572811 | 86 |
| 810 | 3300005344 | Ga0070661_101680762 | Ga0070661_1016807621 | 86 |
| 811 | 3300005345 | Ga0070692_10291007 | Ga0070692_102910071 | 86 |
| 812 | 3300005347 | Ga0070668_100003692 | Ga0070668_1000036924 | 86 |
| 813 | 3300005347 | Ga0070668_100081837 | Ga0070668_1000818373 | 86 |
| 814 | 3300005353 | Ga0070669_100003850 | Ga0070669_1000038507 | 86 |
| 815 | 3300005353 | Ga0070669_100005119 | Ga0070669_1000051195 | 86 |
| 816 | 3300005353 | Ga0070669_100015754 | Ga0070669_1000157543 | 86 |
| 817 | 3300005354 | Ga0070675_100009409 | Ga0070675_1000094098 | 86 |
| 818 | 3300005354 | Ga0070675_100271021 | Ga0070675_1002710213 | 86 |
| 819 | 3300005354 | Ga0070675_100632150 | Ga0070675_1006321502 | 86 |
| 820 | 3300005354 | Ga0070675_101983338 | Ga0070675_1019833381 | 86 |
| 821 | 3300005355 | Ga0070671_100171947 | Ga0070671_1001719474 | 86 |
| 822 | 3300005355 | Ga0070671_100365827 | Ga0070671_1003658273 | 86 |
| 823 | 3300005356 | Ga0070674_100211449 | Ga0070674_1002114493 | 86 |
| 824 | 3300005356 | Ga0070674_100421931 | Ga0070674_1004219312 | 86 |
| 825 | 3300005356 | Ga0070674_100517064 | Ga0070674_1005170642 | 86 |
| 826 | 3300005364 | Ga0070673_100029628 | Ga0070673_1000296282 | 86 |
| 827 | 3300005364 | Ga0070673_100588816 | Ga0070673_1005888162 | 86 |
| 828 | 3300005364 | Ga0070673_101218483 | Ga0070673_1012184832 | 86 |
| 829 | 3300005365 | Ga0070688_100091372 | Ga0070688_1000913723 | 86 |
| 830 | 3300005365 | Ga0070688_100317300 | Ga0070688_1003173002 | 86 |
| 831 | 3300005365 | Ga0070688_100820135 | Ga0070688_1008201351 | 86 |
| 832 | 3300005365 | Ga0070688_101812804 | Ga0070688_1018128041 | 86 |
| 833 | 3300005366 | Ga0070659_100002666 | Ga0070659_10000266612 | 86 |
| 834 | 3300005366 | Ga0070659_100020948 | Ga0070659_1000209485 | 86 |
| 835 | 3300005366 | Ga0070659_100344500 | Ga0070659_1003445001 | 86 |
| 836 | 3300005366 | Ga0070659_100590702 | Ga0070659_1005907021 | 86 |
| 837 | 3300005367 | Ga0070667_100012858 | Ga0070667_1000128583 | 86 |
| 838 | 3300005367 | Ga0070667_100039392 | Ga0070667_1000393923 | 86 |
| 839 | 3300005367 | Ga0070667_100138543 | Ga0070667_1001385433 | 86 |
| 840 | 3300005434 | Ga0070709_10013822 | Ga0070709_100138221 | 86 |
| 841 | 3300005434 | Ga0070709_10101067 | Ga0070709_101010671 | 86 |
| 842 | 3300005434 | Ga0070709_10157872 | Ga0070709_101578722 | 86 |
| 843 | 3300005434 | Ga0070709_10827624 | Ga0070709_108276241 | 86 |
| 844 | 3300005437 | Ga0070710_10032552 | Ga0070710_100325523 | 86 |
| 845 | 3300005439 | Ga0070711_100003181 | Ga0070711_1000031816 | 86 |
| 846 | 3300005441 | Ga0070700_100353091 | Ga0070700_1003530912 | 86 |
| 847 | 3300005444 | Ga0070694_100036045 | Ga0070694_1000360451 | 86 |
| 848 | 3300005445 | Ga0070708_100112405 | Ga0070708_1001124052 | 86 |
| 849 | 3300005445 | Ga0070708_100173433 | Ga0070708_1001734332 | 86 |
| 850 | 3300005455 | Ga0070663_100018203 | Ga0070663_1000182031 | 86 |
| 851 | 3300005455 | Ga0070663_100020969 | Ga0070663_1000209694 | 86 |
| 852 | 3300005455 | Ga0070663_100140869 | Ga0070663_1001408692 | 86 |
| 853 | 3300005455 | Ga0070663_100870956 | Ga0070663_1008709562 | 86 |
| 854 | 3300005456 | Ga0070678_100978581 | Ga0070678_1009785812 | 86 |
| 855 | 3300005456 | Ga0070678_101463464 | Ga0070678_1014634641 | 86 |
| 856 | 3300005457 | Ga0070662_100002683 | Ga0070662_1000026835 | 86 |
| 857 | 3300005457 | Ga0070662_100019519 | Ga0070662_1000195194 | 86 |
| 858 | 3300005457 | Ga0070662_100319859 | Ga0070662_1003198592 | 86 |
| 859 | 3300005458 | Ga0070681_10587272 | Ga0070681_105872723 | 86 |
| 860 | 3300005458 | Ga0070681_11092996 | Ga0070681_110929961 | 86 |
| 861 | 3300005459 | Ga0068867_100002188 | Ga0068867_10000218813 | 86 |
| 862 | 3300005459 | Ga0068867_100003854 | Ga0068867_1000038548 | 86 |
| 863 | 3300005459 | Ga0068867_100046167 | Ga0068867_1000461675 | 86 |
| 864 | 3300005459 | Ga0068867_100929926 | Ga0068867_1009299261 | 86 |
| 865 | 3300005459 | Ga0068867_101267561 | Ga0068867_1012675612 | 86 |
| 866 | 3300005459 | Ga0068867_101273963 | Ga0068867_1012739631 | 86 |
| 867 | 3300005466 | Ga0070685_10020596 | Ga0070685_100205962 | 86 |
| 868 | 3300005466 | Ga0070685_10203978 | Ga0070685_102039782 | 86 |
| 869 | 3300005467 | Ga0070706_101018619 | Ga0070706_1010186192 | 86 |
| 870 | 3300005471 | Ga0070698_100251452 | Ga0070698_1002514522 | 86 |
| 871 | 3300005518 | Ga0070699_100273406 | Ga0070699_1002734063 | 86 |
| 872 | 3300005518 | Ga0070699_102115654 | Ga0070699_1021156541 | 86 |
| 873 | 3300005530 | Ga0070679_100131869 | Ga0070679_1001318693 | 86 |
| 874 | 3300005530 | Ga0070679_100509907 | Ga0070679_1005099071 | 86 |
| 875 | 3300005530 | Ga0070679_100687620 | Ga0070679_1006876202 | 86 |
| 876 | 3300005530 | Ga0070679_101154407 | Ga0070679_1011544072 | 86 |
| 877 | 3300005535 | Ga0070684_100009298 | Ga0070684_1000092982 | 86 |
| 878 | 3300005535 | Ga0070684_100032072 | Ga0070684_1000320724 | 86 |
| 879 | 3300005535 | Ga0070684_100139502 | Ga0070684_1001395023 | 86 |
| 880 | 3300005535 | Ga0070684_100366017 | Ga0070684_1003660172 | 86 |
| 881 | 3300005535 | Ga0070684_100637644 | Ga0070684_1006376441 | 86 |
| 882 | 3300005535 | Ga0070684_101002781 | Ga0070684_1010027812 | 86 |
| 883 | 3300005536 | Ga0070697_100083399 | Ga0070697_1000833993 | 86 |
| 884 | 3300005536 | Ga0070697_100929069 | Ga0070697_1009290692 | 86 |
| 885 | 3300005536 | Ga0070697_101541598 | Ga0070697_1015415982 | 86 |
| 886 | 3300005539 | Ga0068853_100006343 | Ga0068853_10000634310 | 86 |
| 887 | 3300005539 | Ga0068853_100023709 | Ga0068853_1000237095 | 86 |
| 888 | 3300005539 | Ga0068853_100136453 | Ga0068853_1001364532 | 86 |
| 889 | 3300005539 | Ga0068853_100208592 | Ga0068853_1002085922 | 86 |
| 890 | 3300005539 | Ga0068853_100474674 | Ga0068853_1004746742 | 86 |
| 891 | 3300005539 | Ga0068853_100560559 | Ga0068853_1005605591 | 86 |
| 892 | 3300005543 | Ga0070672_100131384 | Ga0070672_1001313841 | 86 |
| 893 | 3300005543 | Ga0070672_101200556 | Ga0070672_1012005561 | 86 |
| 894 | 3300005543 | Ga0070672_101270673 | Ga0070672_1012706732 | 86 |
| 895 | 3300005544 | Ga0070686_100001440 | Ga0070686_10000144012 | 86 |
| 896 | 3300005544 | Ga0070686_100007852 | Ga0070686_1000078523 | 86 |
| 897 | 3300005544 | Ga0070686_100049173 | Ga0070686_1000491733 | 86 |
| 898 | 3300005545 | Ga0070695_100032054 | Ga0070695_1000320542 | 86 |
| 899 | 3300005545 | Ga0070695_100208066 | Ga0070695_1002080662 | 86 |
| 900 | 3300005545 | Ga0070695_100972452 | Ga0070695_1009724521 | 86 |
| 901 | 3300005547 | Ga0070693_100010082 | Ga0070693_1000100822 | 86 |
| 902 | 3300005547 | Ga0070693_100198595 | Ga0070693_1001985952 | 86 |
| 903 | 3300005548 | Ga0070665_100008136 | Ga0070665_10000813611 | 86 |
| 904 | 3300005548 | Ga0070665_100066861 | Ga0070665_1000668614 | 86 |
| 905 | 3300005549 | Ga0070704_100142682 | Ga0070704_1001426821 | 86 |
| 906 | 3300005563 | Ga0068855_100008940 | Ga0068855_1000089402 | 86 |
| 907 | 3300005563 | Ga0068855_100064834 | Ga0068855_1000648343 | 86 |
| 908 | 3300005563 | Ga0068855_100304257 | Ga0068855_1003042573 | 86 |
| 909 | 3300005563 | Ga0068855_100514410 | Ga0068855_1005144102 | 86 |
| 910 | 3300005563 | Ga0068855_100553639 | Ga0068855_1005536392 | 86 |
| 911 | 3300005563 | Ga0068855_100929057 | Ga0068855_1009290571 | 86 |
| 912 | 3300005564 | Ga0070664_100012731 | Ga0070664_1000127312 | 86 |
| 913 | 3300005564 | Ga0070664_100081223 | Ga0070664_1000812232 | 86 |
| 914 | 3300005564 | Ga0070664_100199625 | Ga0070664_1001996253 | 86 |
| 915 | 3300005564 | Ga0070664_100212178 | Ga0070664_1002121782 | 86 |
| 916 | 3300005564 | Ga0070664_100215277 | Ga0070664_1002152771 | 86 |
| 917 | 3300005564 | Ga0070664_100994725 | Ga0070664_1009947252 | 86 |
| 918 | 3300005577 | Ga0068857_100008687 | Ga0068857_1000086874 | 86 |
| 919 | 3300005577 | Ga0068857_100136799 | Ga0068857_1001367993 | 86 |
| 920 | 3300005577 | Ga0068857_100193153 | Ga0068857_1001931531 | 86 |
| 921 | 3300005577 | Ga0068857_100262556 | Ga0068857_1002625561 | 86 |
| 922 | 3300005577 | Ga0068857_100634991 | Ga0068857_1006349912 | 86 |
| 923 | 3300005578 | Ga0068854_100014154 | Ga0068854_1000141545 | 86 |
| 924 | 3300005578 | Ga0068854_100267898 | Ga0068854_1002678982 | 86 |
| 925 | 3300005578 | Ga0068854_100409927 | Ga0068854_1004099272 | 86 |
| 926 | 3300005578 | Ga0068854_100433188 | Ga0068854_1004331883 | 86 |
| 927 | 3300005578 | Ga0068854_100492617 | Ga0068854_1004926172 | 86 |
| 928 | 3300005578 | Ga0068854_100579220 | Ga0068854_1005792202 | 86 |
| 929 | 3300005614 | Ga0068856_100012826 | Ga0068856_1000128268 | 86 |
| 930 | 3300005614 | Ga0068856_100020988 | Ga0068856_1000209885 | 86 |
| 931 | 3300005614 | Ga0068856_100067395 | Ga0068856_1000673954 | 86 |
| 932 | 3300005615 | Ga0070702_100010550 | Ga0070702_1000105505 | 86 |
| 933 | 3300005615 | Ga0070702_100151567 | Ga0070702_1001515672 | 86 |
| 934 | 3300005615 | Ga0070702_100585260 | Ga0070702_1005852602 | 86 |
| 935 | 3300005616 | Ga0068852_100019955 | Ga0068852_1000199552 | 86 |
| 936 | 3300005616 | Ga0068852_100054256 | Ga0068852_1000542562 | 86 |
| 937 | 3300005616 | Ga0068852_100098365 | Ga0068852_1000983652 | 86 |
| 938 | 3300005616 | Ga0068852_100375349 | Ga0068852_1003753492 | 86 |
| 939 | 3300005616 | Ga0068852_102272074 | Ga0068852_1022720742 | 86 |
| 940 | 3300005616 | Ga0068852_102805074 | Ga0068852_1028050742 | 86 |
| 941 | 3300005617 | Ga0068859_100000492 | Ga0068859_10000049237 | 86 |
| 942 | 3300005617 | Ga0068859_100074505 | Ga0068859_1000745054 | 86 |
| 943 | 3300005618 | Ga0068864_100000824 | Ga0068864_10000082421 | 86 |
| 944 | 3300005618 | Ga0068864_100065215 | Ga0068864_1000652155 | 86 |
| 945 | 3300005618 | Ga0068864_100167207 | Ga0068864_1001672072 | 86 |
| 946 | 3300005618 | Ga0068864_100195582 | Ga0068864_1001955823 | 86 |
| 947 | 3300005618 | Ga0068864_100230741 | Ga0068864_1002307412 | 86 |
| 948 | 3300005718 | Ga0068866_10012445 | Ga0068866_100124452 | 86 |
| 949 | 3300005718 | Ga0068866_10019171 | Ga0068866_100191713 | 86 |
| 950 | 3300005718 | Ga0068866_10315632 | Ga0068866_103156322 | 86 |
| 951 | 3300005718 | Ga0068866_10649388 | Ga0068866_106493882 | 86 |
| 952 | 3300005719 | Ga0068861_100011158 | Ga0068861_1000111587 | 86 |
| 953 | 3300005719 | Ga0068861_100063942 | Ga0068861_1000639423 | 86 |
| 954 | 3300005834 | Ga0068851_10014132 | Ga0068851_100141326 | 86 |
| 955 | 3300005834 | Ga0068851_10045214 | Ga0068851_100452143 | 86 |
| 956 | 3300005834 | Ga0068851_10076787 | Ga0068851_100767872 | 86 |
| 957 | 3300005840 | Ga0068870_10013857 | Ga0068870_100138573 | 86 |
| 958 | 3300005840 | Ga0068870_10047272 | Ga0068870_100472723 | 86 |
| 959 | 3300005841 | Ga0068863_100002384 | Ga0068863_1000023848 | 86 |
| 960 | 3300005841 | Ga0068863_100340322 | Ga0068863_1003403222 | 86 |
| 961 | 3300005842 | Ga0068858_100001288 | Ga0068858_1000012886 | 86 |
| 962 | 3300005842 | Ga0068858_100021746 | Ga0068858_1000217468 | 86 |
| 963 | 3300005842 | Ga0068858_101029876 | Ga0068858_1010298761 | 86 |
| 964 | 3300005843 | Ga0068860_100005288 | Ga0068860_1000052884 | 86 |
| 965 | 3300005843 | Ga0068860_100048364 | Ga0068860_1000483645 | 86 |
| 966 | 3300005843 | Ga0068860_100389342 | Ga0068860_1003893422 | 86 |
| 967 | 3300005844 | Ga0068862_100009136 | Ga0068862_1000091363 | 86 |
| 968 | 3300005844 | Ga0068862_100028003 | Ga0068862_1000280032 | 86 |
| 969 | 3300005844 | Ga0068862_100234747 | Ga0068862_1002347473 | 86 |
| 970 | 3300006028 | Ga0070717_10339978 | Ga0070717_103399782 | 86 |
| 971 | 3300006028 | Ga0070717_10538846 | Ga0070717_105388462 | 86 |
| 972 | 3300006173 | Ga0070716_100018398 | Ga0070716_1000183982 | 86 |
| 973 | 3300006173 | Ga0070716_100599832 | Ga0070716_1005998322 | 86 |
| 974 | 3300006173 | Ga0070716_100762141 | Ga0070716_1007621412 | 86 |
| 975 | 3300006175 | Ga0070712_101860946 | Ga0070712_1018609462 | 86 |
| 976 | 3300006178 | Ga0075367_11088914 | Ga0075367_110889141 | 86 |
| 977 | 3300006237 | Ga0097621_100000693 | Ga0097621_10000069314 | 86 |
| 978 | 3300006237 | Ga0097621_100141888 | Ga0097621_1001418883 | 86 |
| 979 | 3300006237 | Ga0097621_100148402 | Ga0097621_1001484023 | 86 |
| 980 | 3300006237 | Ga0097621_100200184 | Ga0097621_1002001841 | 86 |
| 981 | 3300006358 | Ga0068871_100000385 | Ga0068871_10000038520 | 86 |
| 982 | 3300006358 | Ga0068871_100680070 | Ga0068871_1006800702 | 86 |
| 983 | 3300006358 | Ga0068871_100969087 | Ga0068871_1009690873 | 86 |
| 984 | 3300006847 | Ga0075431_100112124 | Ga0075431_1001121242 | 86 |
| 985 | 3300006852 | Ga0075433_10083094 | Ga0075433_100830942 | 86 |
| 986 | 3300006852 | Ga0075433_10250864 | Ga0075433_102508642 | 86 |
| 987 | 3300006871 | Ga0075434_100339306 | Ga0075434_1003393062 | 86 |
| 988 | 3300006871 | Ga0075434_100501817 | Ga0075434_1005018172 | 86 |
| 989 | 3300006871 | Ga0075434_100651057 | Ga0075434_1006510572 | 86 |
| 990 | 3300006871 | Ga0075434_101123744 | Ga0075434_1011237443 | 86 |
| 991 | 3300006881 | Ga0068865_100008484 | Ga0068865_1000084843 | 86 |
| 992 | 3300006881 | Ga0068865_100055079 | Ga0068865_1000550792 | 86 |
| 993 | 3300006881 | Ga0068865_100341961 | Ga0068865_1003419611 | 86 |
| 994 | 3300006881 | Ga0068865_101606070 | Ga0068865_1016060702 | 86 |
| 995 | 3300006914 | Ga0075436_100000697 | Ga0075436_1000006977 | 86 |
| 996 | 3300006914 | Ga0075436_100147844 | Ga0075436_1001478441 | 86 |
| 997 | 3300006914 | Ga0075436_101050582 | Ga0075436_1010505821 | 86 |
| 998 | 3300006931 | Ga0097620_100000492 | Ga0097620_10000049237 | 86 |
| 999 | 3300006931 | Ga0097620_100074504 | Ga0097620_1000745043 | 86 |
| 1000 | 3300007076 | Ga0075435_100040851 | Ga0075435_1000408512 | 86 |
| 1001 | 3300007076 | Ga0075435_100659858 | Ga0075435_1006598582 | 86 |
| 1002 | 3300007076 | Ga0075435_100711358 | Ga0075435_1007113582 | 86 |
| 1003 | 3300007265 | Ga0099794_10045534 | Ga0099794_100455341 | 86 |
| 1004 | 3300007788 | Ga0099795_10083995 | Ga0099795_100839953 | 86 |
| 1005 | 3300007788 | Ga0099795_10332724 | Ga0099795_103327241 | 86 |
| 1006 | 3300009093 | Ga0105240_10049521 | Ga0105240_100495217 | 86 |
| 1007 | 3300009093 | Ga0105240_10167885 | Ga0105240_101678852 | 86 |
| 1008 | 3300009093 | Ga0105240_10190823 | Ga0105240_101908233 | 86 |
| 1009 | 3300009094 | Ga0111539_10840582 | Ga0111539_108405821 | 86 |
| 1010 | 3300009098 | Ga0105245_10045147 | Ga0105245_100451474 | 86 |
| 1011 | 3300009098 | Ga0105245_10090667 | Ga0105245_100906672 | 86 |
| 1012 | 3300009098 | Ga0105245_11629084 | Ga0105245_116290841 | 86 |
| 1013 | 3300009101 | Ga0105247_10009761 | Ga0105247_100097617 | 86 |
| 1014 | 3300009101 | Ga0105247_10033696 | Ga0105247_100336961 | 86 |
| 1015 | 3300009101 | Ga0105247_10534996 | Ga0105247_105349962 | 86 |
| 1016 | 3300009101 | Ga0105247_11488170 | Ga0105247_114881701 | 86 |
| 1017 | 3300009147 | Ga0114129_10613916 | Ga0114129_106139161 | 86 |
| 1018 | 3300009148 | Ga0105243_10024167 | Ga0105243_100241674 | 86 |
| 1019 | 3300009148 | Ga0105243_10262795 | Ga0105243_102627951 | 86 |
| 1020 | 3300009148 | Ga0105243_10555437 | Ga0105243_105554372 | 86 |
| 1021 | 3300009174 | Ga0105241_10089093 | Ga0105241_100890932 | 86 |
| 1022 | 3300009174 | Ga0105241_10176533 | Ga0105241_101765331 | 86 |
| 1023 | 3300009176 | Ga0105242_10003389 | Ga0105242_1000338912 | 86 |
| 1024 | 3300009176 | Ga0105242_10083140 | Ga0105242_100831403 | 86 |
| 1025 | 3300009176 | Ga0105242_10161211 | Ga0105242_101612113 | 86 |
| 1026 | 3300009176 | Ga0105242_12984224 | Ga0105242_129842241 | 86 |
| 1027 | 3300009177 | Ga0105248_10014540 | Ga0105248_100145405 | 86 |
| 1028 | 3300009177 | Ga0105248_10042946 | Ga0105248_100429464 | 86 |
| 1029 | 3300009177 | Ga0105248_13136286 | Ga0105248_131362862 | 86 |
| 1030 | 3300009545 | Ga0105237_10120418 | Ga0105237_101204184 | 86 |
| 1031 | 3300009545 | Ga0105237_10163256 | Ga0105237_101632562 | 86 |
| 1032 | 3300009545 | Ga0105237_11360921 | Ga0105237_113609212 | 86 |
| 1033 | 3300009551 | Ga0105238_10820039 | Ga0105238_108200392 | 86 |
| 1034 | 3300009551 | Ga0105238_12119577 | Ga0105238_121195771 | 86 |
| 1035 | 3300009553 | Ga0105249_10025015 | Ga0105249_100250153 | 86 |
| 1036 | 3300009553 | Ga0105249_10039963 | Ga0105249_100399634 | 86 |
| 1037 | 3300009553 | Ga0105249_10149807 | Ga0105249_101498072 | 86 |
| 1038 | 3300009553 | Ga0105249_10168008 | Ga0105249_101680083 | 86 |
| 1039 | 3300009553 | Ga0105249_12589822 | Ga0105249_125898221 | 86 |
| 1040 | 3300010159 | Ga0099796_10255621 | Ga0099796_102556211 | 86 |
| 1041 | 3300010375 | Ga0105239_10028158 | Ga0105239_100281588 | 86 |
| 1042 | 3300010375 | Ga0105239_10231297 | Ga0105239_102312972 | 86 |
| 1043 | 3300010375 | Ga0105239_10256097 | Ga0105239_102560973 | 86 |
| 1044 | 3300010375 | Ga0105239_10889992 | Ga0105239_108899922 | 86 |
| 1045 | 3300011119 | Ga0105246_10015894 | Ga0105246_100158943 | 86 |
| 1046 | 3300011119 | Ga0105246_10055236 | Ga0105246_100552362 | 86 |
| 1047 | 3300011119 | Ga0105246_10238306 | Ga0105246_102383062 | 86 |
| 1048 | 3300012500 | Ga0157314_1056418 | Ga0157314_10564182 | 86 |
| 1049 | 3300013100 | Ga0157373_10002380 | Ga0157373_100023806 | 86 |
| 1050 | 3300013100 | Ga0157373_10077482 | Ga0157373_100774822 | 86 |
| 1051 | 3300013100 | Ga0157373_10144300 | Ga0157373_101443003 | 86 |
| 1052 | 3300013102 | Ga0157371_10002907 | Ga0157371_100029074 | 86 |
| 1053 | 3300013102 | Ga0157371_10045463 | Ga0157371_100454632 | 86 |
| 1054 | 3300013104 | Ga0157370_10008943 | Ga0157370_1000894314 | 86 |
| 1055 | 3300013104 | Ga0157370_10183386 | Ga0157370_101833863 | 86 |
| 1056 | 3300013104 | Ga0157370_10243312 | Ga0157370_102433122 | 86 |
| 1057 | 3300013104 | Ga0157370_10491969 | Ga0157370_104919692 | 86 |
| 1058 | 3300013105 | Ga0157369_10018225 | Ga0157369_100182257 | 86 |
| 1059 | 3300013105 | Ga0157369_10021280 | Ga0157369_100212807 | 86 |
| 1060 | 3300013105 | Ga0157369_10060664 | Ga0157369_100606644 | 86 |
| 1061 | 3300013105 | Ga0157369_11209324 | Ga0157369_112093242 | 86 |
| 1062 | 3300013105 | Ga0157369_11607726 | Ga0157369_116077261 | 86 |
| 1063 | 3300013296 | Ga0157374_10069083 | Ga0157374_100690833 | 86 |
| 1064 | 3300013296 | Ga0157374_10140347 | Ga0157374_101403472 | 86 |
| 1065 | 3300013296 | Ga0157374_10525369 | Ga0157374_105253691 | 86 |
| 1066 | 3300013297 | Ga0157378_10062863 | Ga0157378_100628632 | 86 |
| 1067 | 3300013297 | Ga0157378_10078132 | Ga0157378_100781323 | 86 |
| 1068 | 3300013297 | Ga0157378_10119801 | Ga0157378_101198012 | 86 |
| 1069 | 3300013297 | Ga0157378_10125230 | Ga0157378_101252303 | 86 |
| 1070 | 3300013297 | Ga0157378_10671165 | Ga0157378_106711653 | 86 |
| 1071 | 3300013306 | Ga0163162_10339319 | Ga0163162_103393191 | 86 |
| 1072 | 3300013306 | Ga0163162_10764455 | Ga0163162_107644552 | 86 |
| 1073 | 3300013307 | Ga0157372_10019261 | Ga0157372_100192611 | 86 |
| 1074 | 3300013307 | Ga0157372_10167878 | Ga0157372_101678784 | 86 |
| 1075 | 3300013307 | Ga0157372_10782370 | Ga0157372_107823702 | 86 |
| 1076 | 3300013307 | Ga0157372_10950816 | Ga0157372_109508162 | 86 |
| 1077 | 3300013308 | Ga0157375_10055998 | Ga0157375_100559984 | 86 |
| 1078 | 3300013308 | Ga0157375_12774179 | Ga0157375_127741791 | 86 |
| 1079 | 3300014325 | Ga0163163_10008073 | Ga0163163_100080732 | 86 |
| 1080 | 3300014325 | Ga0163163_10143975 | Ga0163163_101439753 | 86 |
| 1081 | 3300014325 | Ga0163163_10278786 | Ga0163163_102787862 | 86 |
| 1082 | 3300014497 | Ga0182008_10050339 | Ga0182008_100503393 | 86 |
| 1083 | 3300014745 | Ga0157377_10001555 | Ga0157377_100015557 | 86 |
| 1084 | 3300014968 | Ga0157379_10000323 | Ga0157379_1000032320 | 86 |
| 1085 | 3300014968 | Ga0157379_10001375 | Ga0157379_1000137510 | 86 |
| 1086 | 3300014968 | Ga0157379_10020278 | Ga0157379_100202784 | 86 |
| 1087 | 3300014968 | Ga0157379_10111753 | Ga0157379_101117533 | 86 |
| 1088 | 3300014968 | Ga0157379_11957107 | Ga0157379_119571072 | 86 |
| 1089 | 3300014969 | Ga0157376_10959739 | Ga0157376_109597392 | 86 |
| 1090 | 3300014969 | Ga0157376_12695778 | Ga0157376_126957782 | 86 |
| 1091 | 3300015261 | Ga0182006_1020623 | Ga0182006_10206234 | 86 |
| 1092 | 3300015262 | Ga0182007_10009845 | Ga0182007_100098451 | 86 |
| 1093 | 3300015265 | Ga0182005_1067548 | Ga0182005_10675482 | 86 |
| 1094 | 3300020069 | Ga0197907_10815525 | Ga0197907_108155252 | 86 |
| 1095 | 3300020075 | Ga0206349_1668343 | Ga0206349_16683432 | 86 |
| 1096 | 3300020080 | Ga0206350_11419293 | Ga0206350_114192932 | 86 |
| 1097 | 3300021441 | Ga0213871_10313805 | Ga0213871_103138052 | 86 |
| 1098 | 3300025315 | Ga0207697_10289069 | Ga0207697_102890691 | 86 |
| 1099 | 3300025898 | Ga0207692_10043918 | Ga0207692_100439182 | 86 |
| 1100 | 3300025899 | Ga0207642_10502341 | Ga0207642_105023412 | 86 |
| 1101 | 3300025899 | Ga0207642_11081006 | Ga0207642_110810062 | 86 |
| 1102 | 3300025900 | Ga0207710_10022104 | Ga0207710_100221042 | 86 |
| 1103 | 3300025903 | Ga0207680_10071713 | Ga0207680_100717133 | 86 |
| 1104 | 3300025903 | Ga0207680_11086145 | Ga0207680_110861452 | 86 |
| 1105 | 3300025905 | Ga0207685_10051104 | Ga0207685_100511042 | 86 |
| 1106 | 3300025907 | Ga0207645_10312428 | Ga0207645_103124283 | 86 |
| 1107 | 3300025908 | Ga0207643_10010452 | Ga0207643_100104524 | 86 |
| 1108 | 3300025908 | Ga0207643_10862646 | Ga0207643_108626462 | 86 |
| 1109 | 3300025909 | Ga0207705_10057261 | Ga0207705_100572613 | 86 |
| 1110 | 3300025909 | Ga0207705_10289106 | Ga0207705_102891062 | 86 |
| 1111 | 3300025912 | Ga0207707_10106254 | Ga0207707_101062542 | 86 |
| 1112 | 3300025912 | Ga0207707_10816657 | Ga0207707_108166571 | 86 |
| 1113 | 3300025913 | Ga0207695_10711638 | Ga0207695_107116382 | 86 |
| 1114 | 3300025913 | Ga0207695_11685343 | Ga0207695_116853431 | 86 |
| 1115 | 3300025915 | Ga0207693_10539606 | Ga0207693_105396062 | 86 |
| 1116 | 3300025916 | Ga0207663_10000026 | Ga0207663_1000002626 | 86 |
| 1117 | 3300025916 | Ga0207663_10047717 | Ga0207663_100477173 | 86 |
| 1118 | 3300025917 | Ga0207660_11324309 | Ga0207660_113243091 | 86 |
| 1119 | 3300025918 | Ga0207662_10367738 | Ga0207662_103677382 | 86 |
| 1120 | 3300025919 | Ga0207657_10219733 | Ga0207657_102197332 | 86 |
| 1121 | 3300025920 | Ga0207649_10309756 | Ga0207649_103097561 | 86 |
| 1122 | 3300025920 | Ga0207649_10315114 | Ga0207649_103151142 | 86 |
| 1123 | 3300025921 | Ga0207652_10309847 | Ga0207652_103098473 | 86 |
| 1124 | 3300025923 | Ga0207681_10010109 | Ga0207681_100101095 | 86 |
| 1125 | 3300025925 | Ga0207650_10007755 | Ga0207650_100077554 | 86 |
| 1126 | 3300025925 | Ga0207650_10273319 | Ga0207650_102733193 | 86 |
| 1127 | 3300025926 | Ga0207659_10582890 | Ga0207659_105828902 | 86 |
| 1128 | 3300025926 | Ga0207659_10620811 | Ga0207659_106208113 | 86 |
| 1129 | 3300025928 | Ga0207700_10242099 | Ga0207700_102420991 | 86 |
| 1130 | 3300025929 | Ga0207664_10230956 | Ga0207664_102309561 | 86 |
| 1131 | 3300025929 | Ga0207664_10377818 | Ga0207664_103778182 | 86 |
| 1132 | 3300025932 | Ga0207690_10508769 | Ga0207690_105087692 | 86 |
| 1133 | 3300025933 | Ga0207706_10330260 | Ga0207706_103302602 | 86 |
| 1134 | 3300025934 | Ga0207686_10102370 | Ga0207686_101023703 | 86 |
| 1135 | 3300025934 | Ga0207686_10107654 | Ga0207686_101076543 | 86 |
| 1136 | 3300025934 | Ga0207686_10138016 | Ga0207686_101380162 | 86 |
| 1137 | 3300025936 | Ga0207670_10425609 | Ga0207670_104256092 | 86 |
| 1138 | 3300025936 | Ga0207670_11138048 | Ga0207670_111380482 | 86 |
| 1139 | 3300025938 | Ga0207704_10416017 | Ga0207704_104160172 | 86 |
| 1140 | 3300025938 | Ga0207704_11050762 | Ga0207704_110507621 | 86 |
| 1141 | 3300025941 | Ga0207711_10028562 | Ga0207711_100285622 | 86 |
| 1142 | 3300025942 | Ga0207689_10000845 | Ga0207689_1000084519 | 86 |
| 1143 | 3300025944 | Ga0207661_10359906 | Ga0207661_103599061 | 86 |
| 1144 | 3300025945 | Ga0207679_11326560 | Ga0207679_113265601 | 86 |
| 1145 | 3300025949 | Ga0207667_10033680 | Ga0207667_100336804 | 86 |
| 1146 | 3300025949 | Ga0207667_10356801 | Ga0207667_103568013 | 86 |
| 1147 | 3300025949 | Ga0207667_10750598 | Ga0207667_107505983 | 86 |
| 1148 | 3300025960 | Ga0207651_10015414 | Ga0207651_100154145 | 86 |
| 1149 | 3300025960 | Ga0207651_11135050 | Ga0207651_111350502 | 86 |
| 1150 | 3300025972 | Ga0207668_10039783 | Ga0207668_100397834 | 86 |
| 1151 | 3300025981 | Ga0207640_10282438 | Ga0207640_102824381 | 86 |
| 1152 | 3300025986 | Ga0207658_10148531 | Ga0207658_101485312 | 86 |
| 1153 | 3300025986 | Ga0207658_10534512 | Ga0207658_105345122 | 86 |
| 1154 | 3300026023 | Ga0207677_10338871 | Ga0207677_103388712 | 86 |
| 1155 | 3300026035 | Ga0207703_10003111 | Ga0207703_1000311111 | 86 |
| 1156 | 3300026035 | Ga0207703_10683730 | Ga0207703_106837302 | 86 |
| 1157 | 3300026035 | Ga0207703_12187563 | Ga0207703_121875631 | 86 |
| 1158 | 3300026041 | Ga0207639_10369803 | Ga0207639_103698033 | 86 |
| 1159 | 3300026041 | Ga0207639_10371511 | Ga0207639_103715113 | 86 |
| 1160 | 3300026088 | Ga0207641_10018946 | Ga0207641_100189464 | 86 |
| 1161 | 3300026089 | Ga0207648_10025289 | Ga0207648_100252894 | 86 |
| 1162 | 3300026095 | Ga0207676_10026867 | Ga0207676_100268673 | 86 |
| 1163 | 3300026116 | Ga0207674_10014078 | Ga0207674_100140782 | 86 |
| 1164 | 3300026116 | Ga0207674_10135017 | Ga0207674_101350172 | 86 |
| 1165 | 3300026118 | Ga0207675_100001110 | Ga0207675_10000111022 | 86 |
| 1166 | 3300026142 | Ga0207698_10137098 | Ga0207698_101370982 | 86 |
| 1167 | 3300028379 | Ga0268266_10024459 | Ga0268266_100244592 | 86 |
| 1168 | 3300028380 | Ga0268265_10025195 | Ga0268265_100251955 | 86 |
| 1169 | 3300028380 | Ga0268265_10366251 | Ga0268265_103662512 | 86 |
| 1170 | 3300028381 | Ga0268264_10000872 | Ga0268264_1000087214 | 86 |
| 1171 | 3300028381 | Ga0268264_10375857 | Ga0268264_103758572 | 86 |
| 1172 | 3300031235 | Ga0265330_10241210 | Ga0265330_102412102 | 86 |
| 1173 | 3300031344 | Ga0265316_10329073 | Ga0265316_103290732 | 86 |
| 1174 | 3300031548 | Ga0307408_100221861 | Ga0307408_1002218613 | 86 |
| 1175 | 3300031711 | Ga0265314_10121462 | Ga0265314_101214621 | 86 |
| 1176 | 3300031711 | Ga0265314_10476405 | Ga0265314_104764052 | 86 |
| 1177 | 3300031995 | Ga0307409_101049463 | Ga0307409_1010494631 | 86 |
| 1178 | 3300032126 | Ga0307415_100994197 | Ga0307415_1009941971 | 86 |
| 1179 | 3300037312 | Ga0395899_0206275 | Ga0395899_0206275_168_482 | 86 |
| 1180 | 3300037418 | Ga0395900_0060652 | Ga0395900_0060652_1484_1747 | 86 |
| 1181 | 3300037466 | Ga0395898_0082684 | Ga0395898_0082684_1642_1956 | 86 |
| 1182 | 3300038443 | Ga0395901_0271118 | Ga0395901_0271118_146_460 | 86 |
| 1183 | 3300039438 | Ga0436360_0344554 | Ga0436360_0344554_204_473 | 86 |
| 1184 | 3300039438 | Ga0436360_0762903 | Ga0436360_0762903_73_342 | 86 |
| 1185 | 3300039453 | Ga0436362_0444124 | Ga0436362_0444124_189_458 | 86 |
| 1186 | 3300041441 | Ga0451787_005017 | Ga0451787_005017_380_688 | 86 |
| 1187 | 3300044656 | Ga0466969_0065024 | Ga0466969_0065024_823_1089 | 86 |
| 1188 | 3300044656 | Ga0466969_0160387 | Ga0466969_0160387_636_902 | 86 |
| 1189 | 3300044673 | Ga0453683_0074846 | Ga0453683_0074846_886_1149 | 86 |
| 1190 | 3300044684 | Ga0466966_0000513 | Ga0466966_0000513_744_1010 | 86 |
| 1191 | 3300044684 | Ga0466966_0193617 | Ga0466966_0193617_149_415 | 86 |
| 1192 | 3300044693 | Ga0466961_0316846 | Ga0466961_0316846_119_385 | 86 |
| 1193 | 3300044719 | Ga0466971_0310626 | Ga0466971_0310626_252_518 | 86 |
| 1194 | 3300044765 | Ga0466970_0337929 | Ga0466970_0337929_128_394 | 86 |
| 1195 | 3300045049 | Ga0466959_0020950 | Ga0466959_0020950_1054_1320 | 86 |
| 1196 | 3300045049 | Ga0466959_0688553 | Ga0466959_0688553_271_537 | 86 |
| 1197 | 3300045051 | Ga0451576_1838328 | Ga0451576_1838328_257_604 | 86 |
| 1198 | 3300045836 | Ga0466958_0021289 | Ga0466958_0021289_1131_1397 | 86 |
| 1199 | 3300045836 | Ga0466958_0555158 | Ga0466958_0555158_384_650 | 86 |
| 1200 | 3300045976 | Ga0466967_0004442 | Ga0466967_0004442_2464_2727 | 86 |
| 1201 | 3300046472 | Ga0495580_0006128 | Ga0495580_0006128_830_1093 | 86 |
| 1202 | 3300046476 | Ga0495662_0528541 | Ga0495662_0528541_172_438 | 86 |
| 1203 | 3300046477 | Ga0495664_0733219 | Ga0495664_0733219_25_291 | 86 |
| 1204 | 3300046499 | Ga0495594_0031366 | Ga0495594_0031366_129_392 | 86 |
| 1205 | 3300046516 | Ga0495628_0217375 | Ga0495628_0217375_878_1144 | 86 |
| 1206 | 3300046531 | Ga0495665_0010453 | Ga0495665_0010453_166_429 | 86 |
| 1207 | 3300046536 | Ga0495587_0137991 | Ga0495587_0137991_277_588 | 86 |
| 1208 | 3300046642 | Ga0495634_0479232 | Ga0495634_0479232_438_704 | 86 |
| 1209 | 3300046678 | Ga0495599_0088341 | Ga0495599_0088341_222_488 | 86 |
| 1210 | 3300046680 | Ga0495646_0327537 | Ga0495646_0327537_95_358 | 86 |
| 1211 | 3300046690 | Ga0495624_0147243 | Ga0495624_0147243_748_1011 | 86 |
| 1212 | 3300047315 | Ga0495581_0448366 | Ga0495581_0448366_129_392 | 86 |
| 1213 | 3300047319 | Ga0495674_0022255 | Ga0495674_0022255_304_567 | 86 |
| 1214 | 3300047319 | Ga0495674_0087370 | Ga0495674_0087370_1180_1446 | 86 |
| 1215 | 3300048905 | Ga0496102_0107781 | Ga0496102_0107781_509_826 | 86 |
| 1216 | 3300048906 | Ga0496103_0275569 | Ga0496103_0275569_245_562 | 86 |
| 1217 | 3300048911 | Ga0496108_0034478 | Ga0496108_0034478_877_1194 | 86 |
| 1218 | 3300048912 | Ga0496109_0018774 | Ga0496109_0018774_4739_5056 | 86 |
| 1219 | 3300048929 | Ga0496126_0279324 | Ga0496126_0279324_845_1117 | 86 |
| 1220 | 3300049568 | Ga0501031_0811210 | Ga0501031_0811210_264_527 | 86 |
| 1221 | 3300049573 | Ga0501037_0000739 | Ga0501037_0000739_13487_13753 | 86 |
| 1222 | 3300049580 | Ga0501046_0009333 | Ga0501046_0009333_2291_2557 | 86 |
| 1223 | 3300049581 | Ga0501047_0386756 | Ga0501047_0386756_165_470 | 86 |
| 1224 | 3300049583 | Ga0501067_0008685 | Ga0501067_0008685_189_455 | 86 |
| 1225 | 3300049588 | Ga0501072_1099388 | Ga0501072_1099388_57_332 | 86 |
| 1226 | 3300049592 | Ga0501076_0154614 | Ga0501076_0154614_1553_1819 | 86 |
| 1227 | 3300049592 | Ga0501076_0315349 | Ga0501076_0315349_680_946 | 86 |
| 1228 | 3300049593 | Ga0501077_0108270 | Ga0501077_0108270_512_778 | 86 |
| 1229 | 3300049742 | Ga0501080_0348589 | Ga0501080_0348589_995_1309 | 86 |
| 1230 | 3300049744 | Ga0501083_0002624 | Ga0501083_0002624_11070_11339 | 86 |
| 1231 | 3300049822 | Ga0501035_0297130 | Ga0501035_0297130_476_742 | 86 |
| 1232 | 3300049822 | Ga0501035_0466648 | Ga0501035_0466648_351_665 | 86 |
| 1233 | 3300049824 | Ga0501045_0297940 | Ga0501045_0297940_619_885 | 86 |
| 1234 | 3300050509 | nmdc:mga0qj67_187857_c1 | nmdc:mga0qj67_187857_c1_172_456 | 86 |
| 1235 | 3300050510 | nmdc:mga06r32_18146_c1 | nmdc:mga06r32_18146_c1_1361_1645 | 86 |
| 1236 | 3300050512 | nmdc:mga0n895_1312370_c1 | nmdc:mga0n895_1312370_c1_37_303 | 86 |
| 1237 | 3300050512 | nmdc:mga0n895_251439_c1 | nmdc:mga0n895_251439_c1_1088_1372 | 86 |
| 1238 | 3300050512 | nmdc:mga0n895_347934_c1 | nmdc:mga0n895_347934_c1_1183_1491 | 86 |
| 1239 | 3300050512 | nmdc:mga0n895_352971_c1 | nmdc:mga0n895_352971_c1_358_675 | 86 |
| 1240 | 3300050513 | nmdc:mga0rr50_22911_c1 | nmdc:mga0rr50_22911_c1_3580_3864 | 86 |
| 1241 | 3300050514 | nmdc:mga08x19_42_c1 | nmdc:mga08x19_42_c1_138102_138368 | 86 |
| 1242 | 3300050514 | nmdc:mga08x19_60212_c1 | nmdc:mga08x19_60212_c1_1781_2065 | 86 |
| 1243 | 3300050514 | nmdc:mga08x19_960767_c1 | nmdc:mga08x19_960767_c1_226_492 | 86 |
| 1244 | 3300050515 | nmdc:mga0a205_675153_c1 | nmdc:mga0a205_675153_c1_140_406 | 86 |
| 1245 | 3300053077 | Ga0495601_0008427 | Ga0495601_0008427_1931_2197 | 86 |
| 1246 | 3300053078 | Ga0495612_0043467 | Ga0495612_0043467_400_666 | 86 |
| 1247 | 3300053080 | Ga0500635_0021759 | Ga0500635_0021759_154_465 | 86 |
| 1248 | 3300053090 | Ga0500646_0197267 | Ga0500646_0197267_53_361 | 86 |
| 1249 | 3300053103 | Ga0500555_181302 | Ga0500555_181302_74_382 | 86 |
| 1250 | 3300053119 | Ga0500595_000320 | Ga0500595_000320_3668_3979 | 86 |
| 1251 | 3300053136 | Ga0500559_0179236 | Ga0500559_0179236_23_334 | 86 |
| 1252 | 3300053139 | Ga0500568_0029491 | Ga0500568_0029491_1320_1628 | 86 |
| 1253 | 3300053148 | Ga0500590_288028 | Ga0500590_288028_148_459 | 86 |
| 1254 | 3300053730 | Ga0500645_062767 | Ga0500645_062767_656_964 | 86 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ida-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9206 | 1 | 86 |
| 2ida-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9106 | 1 | 86 |
| 4fjc-assembly1.cif.gz_E | structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module | 0.8329 | 19 | 86 |
| 3phd-assembly1.cif.gz_B | crystal structure of human hdac6 in complex with ubiquitin | 0.8318 | 4 | 86 |
| 3phd-assembly1.cif.gz_D | crystal structure of human hdac6 in complex with ubiquitin | 0.8286 | 4 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1ME85_192_270_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.9476 | 33 | 46 | 3.30.40.10 |
| af_Q10N73_174_281_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.9209 | 33 | 46 | 3.30.40.10 |
| 2idaA01 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.9206 | 1 | 86 | 3.30.40.10 |
| 2idaA01 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.9106 | 1 | 86 | 3.30.40.10 |
| af_A4IA95_233_330_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.9048 | 20 | 86 | 3.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656TSE6-F1-model_v4 | deleted | 1.005 | 21 | 86 |
|
| AF-A0A538H4T4-F1-model_v4 | UBP-type zinc finger domain-containing protein | 1.004 | 37 | 85 |
GO:0008270
|
| AF-A0A0F6W6X5-F1-model_v4 | Putative Glutathione-regulated potassium-efflux system protein KefB | 1.003 | 20 | 85 |
GO:0008270
|
| AF-A0A359E811-F1-model_v4 | UBP-type domain-containing protein | 1.002 | 21 | 86 |
GO:0008270
|
| AF-A0A1Q4ZYX5-F1-model_v4 | deleted | 1.002 | 16 | 84 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar