F492250
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1255 | 418 | 1246 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300049765|Ga0501268_017905|Ga0501268_017905_10_1167 |
| Length | 385 |
| Sequence | VDFGAGQPLSGQQGERQARRARADDGEFQHAGILRAARDWRPAGISCALCVTAPQDFAMQYRRLGRAGLQVSELSLGSWVTYHNQVDTKTATEMLAAAFDAGINFFDNAEVYAQGESEVVMGQAFKALGWNRLDYIVSSKFFWGLTRDGVTTTNRKDTLNRKYLMQAVDGSLKRLQLEHIDLIYCHRPDPHTPIEETVWAMSDIIRQGKALYWGTSEWSAADIRAAWDIAERHHLHKPVVEQPQYHLFHRRRVEQEYARLYDDIGLGLTTWSPLASGLLTGKYAAGIPAGSRASLDSMAWLREHLQDRAKNEAVGQLGDIAAELGCNTAQLAIAWINRNPRVSSVILGASRIEQLRDNLGALAVTPKLTPDVVERIDAIAKPLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 3 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 4 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 5 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 6 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 7 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 8 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 9 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 10 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 112 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 145 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 219 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 230 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 233 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 234 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 241 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 242 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 243 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 244 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 247 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 248 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 249 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 251 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 252 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 253 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 254 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 255 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 259 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 260 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 261 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 262 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 263 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 264 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 267 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 270 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 276 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 277 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 278 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 280 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 281 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 283 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 284 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 285 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 286 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 287 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 288 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 289 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 291 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 292 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 293 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 294 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 295 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 296 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 297 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 298 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 299 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 300 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 301 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 302 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 303 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 304 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 305 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 306 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 307 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 308 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 312 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 313 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 314 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 362 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 363 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 364 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 365 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 366 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 377 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 378 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 379 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 380 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 381 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 384 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 385 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 389 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 390 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 391 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 392 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 393 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 394 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 398 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 409 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 412 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 413 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 415 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 416 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 417 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.82 |
| Nodule | 0.32 |
| Rhizoplane | 3.35 |
| Rhizosphere | 88.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1002080 | 3300002076 | Bacteria | 2822 |
| 2 | JGI24034J26672_10002936 | 3300002239 | Bacteria | 2362 |
| 3 | rootH1_10043368 | 3300003316 | Bacteria | 6592 |
| 4 | rootL2_10002418 | 3300003322 | Bacteria | 24582 |
| 5 | rootL2_10012665 | 3300003322 | Bacteria | 5554 |
| 6 | rootL2_10027947 | 3300003322 | Bacteria | 28083 |
| 7 | Ga0055525_1000100 | 3300003759 | Bacteria | 136467 |
| 8 | Ga0055526_1013302 | 3300003771 | Bacteria | 3493 |
| 9 | Ga0055524_1001523 | 3300003775 | Bacteria | 13107 |
| 10 | Ga0055530_10001128 | 3300003791 | Bacteria | 20838 |
| 11 | Ga0055540_1000110 | 3300003792 | Bacteria | 88766 |
| 12 | Ga0055540_1025877 | 3300003792 | Bacteria | 1429 |
| 13 | Ga0055531_10000042 | 3300003794 | Bacteria | 134368 |
| 14 | Ga0055531_10004790 | 3300003794 | Bacteria | 8086 |
| 15 | Ga0055531_10009863 | 3300003794 | Bacteria | 4833 |
| 16 | Ga0065165_1000063 | 3300005262 | Bacteria | 176477 |
| 17 | Ga0065165_1001135 | 3300005262 | Bacteria | 31247 |
| 18 | Ga0065712_10120426 | 3300005290 | Bacteria | 1678 |
| 19 | Ga0065712_10123062 | 3300005290 | Bacteria | 1643 |
| 20 | Ga0065715_10021485 | 3300005293 | Bacteria | 1658 |
| 21 | Ga0065715_10117495 | 3300005293 | Bacteria | 2346 |
| 22 | Ga0065715_10180442 | 3300005293 | Bacteria | 1480 |
| 23 | Ga0065715_10215931 | 3300005293 | Bacteria | 1293 |
| 24 | Ga0070658_10004627 | 3300005327 | Bacteria | 11186 |
| 25 | Ga0070658_10016650 | 3300005327 | Bacteria | 5883 |
| 26 | Ga0070658_10021183 | 3300005327 | Bacteria | 5208 |
| 27 | Ga0070658_10028225 | 3300005327 | Bacteria | 4505 |
| 28 | Ga0070658_10146558 | 3300005327 | Bacteria | 1974 |
| 29 | Ga0070658_10252075 | 3300005327 | Bacteria | 1498 |
| 30 | Ga0070658_10297209 | 3300005327 | Bacteria | 1376 |
| 31 | Ga0070658_10325533 | 3300005327 | Bacteria | 1313 |
| 32 | Ga0070676_10002080 | 3300005328 | Bacteria | 10184 |
| 33 | Ga0070676_10008552 | 3300005328 | Bacteria | 5518 |
| 34 | Ga0070676_10009207 | 3300005328 | Bacteria | 5338 |
| 35 | Ga0070676_10009874 | 3300005328 | Bacteria | 5166 |
| 36 | Ga0070683_100006919 | 3300005329 | Bacteria | 9532 |
| 37 | Ga0070683_100012189 | 3300005329 | Bacteria | 7462 |
| 38 | Ga0070683_100015781 | 3300005329 | Bacteria | 6640 |
| 39 | Ga0070683_100032256 | 3300005329 | Bacteria | 4770 |
| 40 | Ga0070683_100142843 | 3300005329 | Bacteria | 2267 |
| 41 | Ga0070683_100151045 | 3300005329 | Bacteria | 2202 |
| 42 | Ga0070690_100012720 | 3300005330 | Bacteria | 4955 |
| 43 | Ga0070690_100042902 | 3300005330 | Bacteria | 2866 |
| 44 | Ga0070690_100134126 | 3300005330 | Bacteria | 1675 |
| 45 | Ga0070670_100001353 | 3300005331 | Bacteria | 19634 |
| 46 | Ga0070670_100008746 | 3300005331 | Bacteria | 8646 |
| 47 | Ga0070670_100032189 | 3300005331 | Bacteria | 4517 |
| 48 | Ga0070670_100038102 | 3300005331 | Bacteria | 4134 |
| 49 | Ga0070670_100105606 | 3300005331 | Bacteria | 2426 |
| 50 | Ga0070670_100131201 | 3300005331 | Bacteria | 2164 |
| 51 | Ga0070670_100220130 | 3300005331 | Bacteria | 1651 |
| 52 | Ga0070670_100232103 | 3300005331 | Bacteria | 1606 |
| 53 | Ga0070677_10000110 | 3300005333 | Bacteria | 26795 |
| 54 | Ga0068869_100012867 | 3300005334 | Bacteria | 5540 |
| 55 | Ga0068869_100015623 | 3300005334 | Bacteria | 5099 |
| 56 | Ga0068869_100064331 | 3300005334 | Bacteria | 2697 |
| 57 | Ga0068869_100078582 | 3300005334 | Bacteria | 2457 |
| 58 | Ga0068869_100234090 | 3300005334 | Bacteria | 1461 |
| 59 | Ga0068869_100270925 | 3300005334 | Bacteria | 1362 |
| 60 | Ga0070666_10001273 | 3300005335 | Bacteria | 15250 |
| 61 | Ga0070666_10040552 | 3300005335 | Bacteria | 3107 |
| 62 | Ga0070666_10070705 | 3300005335 | Bacteria | 2374 |
| 63 | Ga0070666_10187410 | 3300005335 | Bacteria | 1453 |
| 64 | Ga0070666_10340621 | 3300005335 | Bacteria | 1072 |
| 65 | Ga0070680_100028583 | 3300005336 | Bacteria | 4473 |
| 66 | Ga0070680_100082259 | 3300005336 | Bacteria | 2657 |
| 67 | Ga0070680_100129783 | 3300005336 | Bacteria | 2108 |
| 68 | Ga0068868_100002706 | 3300005338 | Bacteria | 12298 |
| 69 | Ga0068868_100080400 | 3300005338 | Bacteria | 2612 |
| 70 | Ga0068868_100177232 | 3300005338 | Bacteria | 1767 |
| 71 | Ga0068868_100246410 | 3300005338 | Bacteria | 1503 |
| 72 | Ga0070660_100003196 | 3300005339 | Bacteria | 11261 |
| 73 | Ga0070660_100015363 | 3300005339 | Bacteria | 5525 |
| 74 | Ga0070660_100038166 | 3300005339 | Bacteria | 3645 |
| 75 | Ga0070660_100041670 | 3300005339 | Bacteria | 3500 |
| 76 | Ga0070660_100068544 | 3300005339 | Bacteria | 2765 |
| 77 | Ga0070660_100160746 | 3300005339 | Bacteria | 1810 |
| 78 | Ga0070660_100253827 | 3300005339 | Bacteria | 1435 |
| 79 | Ga0070660_100316268 | 3300005339 | Bacteria | 1282 |
| 80 | Ga0070689_100003000 | 3300005340 | Bacteria | 11102 |
| 81 | Ga0070689_100030747 | 3300005340 | Bacteria | 4076 |
| 82 | Ga0070689_100079246 | 3300005340 | Bacteria | 2576 |
| 83 | Ga0070687_100019948 | 3300005343 | Bacteria | 3127 |
| 84 | Ga0070687_100042290 | 3300005343 | Bacteria | 2308 |
| 85 | Ga0070661_100002328 | 3300005344 | Bacteria | 13044 |
| 86 | Ga0070661_100002858 | 3300005344 | Bacteria | 11869 |
| 87 | Ga0070661_100007616 | 3300005344 | Bacteria | 7468 |
| 88 | Ga0070661_100009841 | 3300005344 | Bacteria | 6632 |
| 89 | Ga0070661_100013147 | 3300005344 | Bacteria | 5809 |
| 90 | Ga0070661_100020626 | 3300005344 | Bacteria | 4701 |
| 91 | Ga0070661_100093097 | 3300005344 | Bacteria | 2233 |
| 92 | Ga0070661_100103772 | 3300005344 | Bacteria | 2117 |
| 93 | Ga0070661_100127160 | 3300005344 | Bacteria | 1912 |
| 94 | Ga0070661_100127416 | 3300005344 | Bacteria | 1910 |
| 95 | Ga0070661_100198627 | 3300005344 | Bacteria | 1531 |
| 96 | Ga0070692_10023349 | 3300005345 | Bacteria | 3030 |
| 97 | Ga0070692_10049852 | 3300005345 | Bacteria | 2173 |
| 98 | Ga0070668_100001262 | 3300005347 | Bacteria | 18067 |
| 99 | Ga0070668_100003150 | 3300005347 | Bacteria | 12166 |
| 100 | Ga0070668_100005925 | 3300005347 | Bacteria | 9059 |
| 101 | Ga0070668_100006020 | 3300005347 | Bacteria | 8996 |
| 102 | Ga0070668_100107682 | 3300005347 | Bacteria | 2215 |
| 103 | Ga0070668_100117466 | 3300005347 | Bacteria | 2122 |
| 104 | Ga0070669_100007697 | 3300005353 | Bacteria | 7701 |
| 105 | Ga0070669_100012475 | 3300005353 | Bacteria | 6029 |
| 106 | Ga0070669_100020170 | 3300005353 | Bacteria | 4760 |
| 107 | Ga0070669_100087040 | 3300005353 | Bacteria | 2335 |
| 108 | Ga0070675_100001224 | 3300005354 | Bacteria | 18668 |
| 109 | Ga0070675_100001731 | 3300005354 | Bacteria | 16099 |
| 110 | Ga0070675_100020955 | 3300005354 | Bacteria | 5220 |
| 111 | Ga0070675_100035986 | 3300005354 | Bacteria | 4026 |
| 112 | Ga0070675_100080009 | 3300005354 | Bacteria | 2724 |
| 113 | Ga0070675_100214793 | 3300005354 | Bacteria | 1673 |
| 114 | Ga0070671_100008129 | 3300005355 | Bacteria | 8398 |
| 115 | Ga0070671_100010339 | 3300005355 | Bacteria | 7486 |
| 116 | Ga0070671_100025515 | 3300005355 | Bacteria | 4850 |
| 117 | Ga0070671_100033147 | 3300005355 | Bacteria | 4271 |
| 118 | Ga0070671_100033312 | 3300005355 | Bacteria | 4259 |
| 119 | Ga0070671_100034014 | 3300005355 | Bacteria | 4218 |
| 120 | Ga0070671_100041370 | 3300005355 | Bacteria | 3830 |
| 121 | Ga0070674_100000281 | 3300005356 | Bacteria | 24879 |
| 122 | Ga0070674_100002429 | 3300005356 | Bacteria | 10301 |
| 123 | Ga0070674_100003681 | 3300005356 | Bacteria | 8640 |
| 124 | Ga0070674_100014235 | 3300005356 | Bacteria | 4941 |
| 125 | Ga0070674_100016440 | 3300005356 | Bacteria | 4637 |
| 126 | Ga0070674_100097692 | 3300005356 | Bacteria | 2133 |
| 127 | Ga0070674_100402220 | 3300005356 | Bacteria | 1119 |
| 128 | Ga0070673_100001293 | 3300005364 | Bacteria | 14580 |
| 129 | Ga0070673_100014449 | 3300005364 | Bacteria | 5501 |
| 130 | Ga0070673_100021463 | 3300005364 | Bacteria | 4683 |
| 131 | Ga0070673_100046063 | 3300005364 | Bacteria | 3385 |
| 132 | Ga0070673_100070687 | 3300005364 | Bacteria | 2802 |
| 133 | Ga0070673_100128158 | 3300005364 | Bacteria | 2126 |
| 134 | Ga0070673_100144417 | 3300005364 | Bacteria | 2010 |
| 135 | Ga0070673_100198799 | 3300005364 | Bacteria | 1726 |
| 136 | Ga0070688_100001354 | 3300005365 | Bacteria | 12169 |
| 137 | Ga0070688_100002366 | 3300005365 | Bacteria | 9518 |
| 138 | Ga0070659_100009750 | 3300005366 | Bacteria | 7058 |
| 139 | Ga0070659_100014617 | 3300005366 | Bacteria | 5869 |
| 140 | Ga0070659_100021722 | 3300005366 | Bacteria | 4893 |
| 141 | Ga0070659_100024523 | 3300005366 | Bacteria | 4623 |
| 142 | Ga0070659_100029139 | 3300005366 | Bacteria | 4265 |
| 143 | Ga0070659_100148008 | 3300005366 | Bacteria | 1914 |
| 144 | Ga0070659_100213888 | 3300005366 | Bacteria | 1589 |
| 145 | Ga0070667_100002647 | 3300005367 | Bacteria | 15512 |
| 146 | Ga0070667_100007248 | 3300005367 | Bacteria | 9212 |
| 147 | Ga0070667_100019486 | 3300005367 | Bacteria | 5629 |
| 148 | Ga0070667_100119394 | 3300005367 | Bacteria | 2293 |
| 149 | Ga0070667_100134744 | 3300005367 | Bacteria | 2159 |
| 150 | Ga0070667_100172614 | 3300005367 | Bacteria | 1909 |
| 151 | Ga0070709_10016041 | 3300005434 | Bacteria | 4269 |
| 152 | Ga0070709_10028498 | 3300005434 | Bacteria | 3331 |
| 153 | Ga0070709_10048878 | 3300005434 | Bacteria | 2641 |
| 154 | Ga0070714_100004236 | 3300005435 | Bacteria | 10802 |
| 155 | Ga0070714_100085883 | 3300005435 | Bacteria | 2749 |
| 156 | Ga0070714_100126120 | 3300005435 | Bacteria | 2282 |
| 157 | Ga0070713_100056141 | 3300005436 | Bacteria | 3275 |
| 158 | Ga0070710_10010524 | 3300005437 | Bacteria | 4546 |
| 159 | Ga0070701_10005635 | 3300005438 | Bacteria | 5195 |
| 160 | Ga0070711_100002733 | 3300005439 | Bacteria | 10119 |
| 161 | Ga0070711_100050733 | 3300005439 | Bacteria | 2846 |
| 162 | Ga0070711_100089823 | 3300005439 | Bacteria | 2211 |
| 163 | Ga0070700_100017255 | 3300005441 | Bacteria | 4123 |
| 164 | Ga0070708_100033437 | 3300005445 | Bacteria | 4467 |
| 165 | Ga0070708_100235573 | 3300005445 | Bacteria | 1718 |
| 166 | Ga0070663_100004048 | 3300005455 | Bacteria | 8557 |
| 167 | Ga0070663_100006933 | 3300005455 | Bacteria | 6862 |
| 168 | Ga0070663_100014606 | 3300005455 | Bacteria | 5045 |
| 169 | Ga0070663_100116301 | 3300005455 | Bacteria | 2015 |
| 170 | Ga0070663_100233320 | 3300005455 | Bacteria | 1450 |
| 171 | Ga0070663_100263997 | 3300005455 | Bacteria | 1366 |
| 172 | Ga0070663_100394314 | 3300005455 | Bacteria | 1130 |
| 173 | Ga0070678_100001716 | 3300005456 | Bacteria | 11769 |
| 174 | Ga0070678_100003910 | 3300005456 | Bacteria | 8375 |
| 175 | Ga0070678_100005336 | 3300005456 | Bacteria | 7417 |
| 176 | Ga0070678_100013613 | 3300005456 | Bacteria | 5109 |
| 177 | Ga0070678_100018511 | 3300005456 | Bacteria | 4515 |
| 178 | Ga0070678_100100101 | 3300005456 | Bacteria | 2244 |
| 179 | Ga0070678_100153837 | 3300005456 | Bacteria | 1856 |
| 180 | Ga0070678_100212692 | 3300005456 | Bacteria | 1603 |
| 181 | Ga0070662_100000721 | 3300005457 | Bacteria | 20263 |
| 182 | Ga0070662_100004835 | 3300005457 | Bacteria | 8537 |
| 183 | Ga0070662_100068874 | 3300005457 | Bacteria | 2603 |
| 184 | Ga0070662_100130333 | 3300005457 | Bacteria | 1938 |
| 185 | Ga0070681_10000413 | 3300005458 | Bacteria | 34680 |
| 186 | Ga0070681_10112882 | 3300005458 | Bacteria | 2657 |
| 187 | Ga0070681_10187435 | 3300005458 | Bacteria | 1989 |
| 188 | Ga0070681_10324597 | 3300005458 | Bacteria | 1449 |
| 189 | Ga0068867_100000076 | 3300005459 | Bacteria | 59983 |
| 190 | Ga0068867_100002927 | 3300005459 | Bacteria | 12032 |
| 191 | Ga0068867_100010338 | 3300005459 | Bacteria | 6584 |
| 192 | Ga0068867_100010405 | 3300005459 | Bacteria | 6563 |
| 193 | Ga0068867_100030407 | 3300005459 | Bacteria | 3896 |
| 194 | Ga0068867_100057073 | 3300005459 | Bacteria | 2891 |
| 195 | Ga0068867_100063871 | 3300005459 | Bacteria | 2737 |
| 196 | Ga0068867_100091242 | 3300005459 | Bacteria | 2312 |
| 197 | Ga0068867_100091748 | 3300005459 | Bacteria | 2306 |
| 198 | Ga0070685_10001322 | 3300005466 | Bacteria | 13022 |
| 199 | Ga0070685_10001523 | 3300005466 | Bacteria | 12225 |
| 200 | Ga0070685_10140690 | 3300005466 | Bacteria | 1519 |
| 201 | Ga0070706_100007656 | 3300005467 | Bacteria | 10105 |
| 202 | Ga0070706_100032233 | 3300005467 | Bacteria | 4833 |
| 203 | Ga0070706_100102357 | 3300005467 | Bacteria | 2662 |
| 204 | Ga0070707_100097289 | 3300005468 | Bacteria | 2851 |
| 205 | Ga0070707_100099250 | 3300005468 | Bacteria | 2821 |
| 206 | Ga0070707_100155510 | 3300005468 | Bacteria | 2227 |
| 207 | Ga0070707_100221463 | 3300005468 | Bacteria | 1843 |
| 208 | Ga0070698_100091533 | 3300005471 | Bacteria | 3024 |
| 209 | Ga0070699_100004993 | 3300005518 | Bacteria | 11696 |
| 210 | Ga0070699_100024281 | 3300005518 | Bacteria | 5223 |
| 211 | Ga0070699_100084335 | 3300005518 | Bacteria | 2772 |
| 212 | Ga0070699_100162481 | 3300005518 | Bacteria | 1977 |
| 213 | Ga0070679_100001227 | 3300005530 | Bacteria | 22510 |
| 214 | Ga0070679_100032042 | 3300005530 | Bacteria | 5197 |
| 215 | Ga0070679_100058921 | 3300005530 | Bacteria | 3827 |
| 216 | Ga0070679_100091089 | 3300005530 | Bacteria | 3037 |
| 217 | Ga0070679_100124627 | 3300005530 | Bacteria | 2559 |
| 218 | Ga0070684_100006324 | 3300005535 | Bacteria | 9152 |
| 219 | Ga0070684_100007308 | 3300005535 | Bacteria | 8583 |
| 220 | Ga0070684_100019383 | 3300005535 | Bacteria | 5626 |
| 221 | Ga0070684_100034421 | 3300005535 | Bacteria | 4331 |
| 222 | Ga0070684_100305629 | 3300005535 | Bacteria | 1460 |
| 223 | Ga0070697_100255099 | 3300005536 | Bacteria | 1500 |
| 224 | Ga0068853_100001754 | 3300005539 | Bacteria | 15915 |
| 225 | Ga0068853_100006320 | 3300005539 | Bacteria | 9402 |
| 226 | Ga0068853_100012996 | 3300005539 | Bacteria | 6788 |
| 227 | Ga0068853_100017300 | 3300005539 | Bacteria | 5952 |
| 228 | Ga0068853_100019057 | 3300005539 | Bacteria | 5685 |
| 229 | Ga0068853_100030917 | 3300005539 | Bacteria | 4525 |
| 230 | Ga0068853_100129921 | 3300005539 | Bacteria | 2254 |
| 231 | Ga0068853_100182743 | 3300005539 | Bacteria | 1902 |
| 232 | Ga0068853_100278580 | 3300005539 | Bacteria | 1541 |
| 233 | Ga0070672_100000121 | 3300005543 | Bacteria | 40117 |
| 234 | Ga0070672_100000724 | 3300005543 | Bacteria | 19541 |
| 235 | Ga0070672_100006701 | 3300005543 | Bacteria | 7763 |
| 236 | Ga0070672_100007386 | 3300005543 | Bacteria | 7452 |
| 237 | Ga0070672_100023411 | 3300005543 | Bacteria | 4553 |
| 238 | Ga0070672_100044854 | 3300005543 | Bacteria | 3416 |
| 239 | Ga0070672_100049179 | 3300005543 | Bacteria | 3279 |
| 240 | Ga0070672_100127203 | 3300005543 | Bacteria | 2091 |
| 241 | Ga0070672_100135358 | 3300005543 | Bacteria | 2029 |
| 242 | Ga0070686_100015482 | 3300005544 | Bacteria | 4419 |
| 243 | Ga0070695_100061764 | 3300005545 | Bacteria | 2431 |
| 244 | Ga0070695_100128804 | 3300005545 | Bacteria | 1742 |
| 245 | Ga0070696_100017248 | 3300005546 | Bacteria | 4872 |
| 246 | Ga0070696_100038720 | 3300005546 | Bacteria | 3291 |
| 247 | Ga0070696_100118507 | 3300005546 | Bacteria | 1914 |
| 248 | Ga0070693_100001243 | 3300005547 | Bacteria | 11519 |
| 249 | Ga0070665_100002011 | 3300005548 | Bacteria | 22862 |
| 250 | Ga0070665_100003069 | 3300005548 | Bacteria | 17984 |
| 251 | Ga0070665_100008870 | 3300005548 | Bacteria | 10182 |
| 252 | Ga0070665_100104125 | 3300005548 | Bacteria | 2840 |
| 253 | Ga0070665_100112883 | 3300005548 | Bacteria | 2720 |
| 254 | Ga0070665_100305700 | 3300005548 | Bacteria | 1593 |
| 255 | Ga0070704_100012540 | 3300005549 | Bacteria | 5236 |
| 256 | Ga0068855_100000453 | 3300005563 | Bacteria | 50677 |
| 257 | Ga0068855_100015192 | 3300005563 | Bacteria | 9272 |
| 258 | Ga0068855_100030735 | 3300005563 | Bacteria | 6421 |
| 259 | Ga0068855_100069746 | 3300005563 | Bacteria | 4090 |
| 260 | Ga0068855_100102570 | 3300005563 | Bacteria | 3293 |
| 261 | Ga0068855_100214938 | 3300005563 | Bacteria | 2159 |
| 262 | Ga0070664_100000225 | 3300005564 | Bacteria | 40336 |
| 263 | Ga0070664_100001099 | 3300005564 | Bacteria | 21380 |
| 264 | Ga0070664_100003164 | 3300005564 | Bacteria | 13302 |
| 265 | Ga0070664_100025828 | 3300005564 | Bacteria | 4870 |
| 266 | Ga0070664_100042812 | 3300005564 | Bacteria | 3821 |
| 267 | Ga0070664_100052164 | 3300005564 | Bacteria | 3463 |
| 268 | Ga0070664_100069951 | 3300005564 | Bacteria | 3004 |
| 269 | Ga0070664_100140517 | 3300005564 | Bacteria | 2126 |
| 270 | Ga0070664_100183684 | 3300005564 | Bacteria | 1860 |
| 271 | Ga0070664_100216952 | 3300005564 | Bacteria | 1711 |
| 272 | Ga0068857_100019014 | 3300005577 | Bacteria | 6027 |
| 273 | Ga0068857_100039154 | 3300005577 | Bacteria | 4199 |
| 274 | Ga0068857_100046513 | 3300005577 | Bacteria | 3851 |
| 275 | Ga0068854_100001711 | 3300005578 | Bacteria | 13371 |
| 276 | Ga0068854_100002211 | 3300005578 | Bacteria | 11975 |
| 277 | Ga0068854_100008998 | 3300005578 | Bacteria | 6434 |
| 278 | Ga0068854_100012434 | 3300005578 | Bacteria | 5574 |
| 279 | Ga0068854_100029754 | 3300005578 | Bacteria | 3783 |
| 280 | Ga0068854_100165657 | 3300005578 | Bacteria | 1716 |
| 281 | Ga0068856_100000980 | 3300005614 | Bacteria | 30458 |
| 282 | Ga0068856_100007412 | 3300005614 | Bacteria | 10706 |
| 283 | Ga0068856_100007820 | 3300005614 | Bacteria | 10439 |
| 284 | Ga0068856_100010154 | 3300005614 | Bacteria | 9150 |
| 285 | Ga0068856_100018411 | 3300005614 | Bacteria | 6769 |
| 286 | Ga0068856_100024027 | 3300005614 | Bacteria | 5930 |
| 287 | Ga0068856_100082117 | 3300005614 | Bacteria | 3198 |
| 288 | Ga0068856_100631791 | 3300005614 | Bacteria | 1091 |
| 289 | Ga0070702_100017945 | 3300005615 | Bacteria | 3660 |
| 290 | Ga0068852_100005521 | 3300005616 | Bacteria | 9065 |
| 291 | Ga0068852_100005781 | 3300005616 | Bacteria | 8881 |
| 292 | Ga0068852_100011366 | 3300005616 | Bacteria | 6698 |
| 293 | Ga0068852_100048531 | 3300005616 | Bacteria | 3628 |
| 294 | Ga0068852_100052531 | 3300005616 | Bacteria | 3503 |
| 295 | Ga0068852_100053251 | 3300005616 | Bacteria | 3482 |
| 296 | Ga0068852_100059604 | 3300005616 | Bacteria | 3311 |
| 297 | Ga0068852_100087899 | 3300005616 | Bacteria | 2774 |
| 298 | Ga0068852_100094816 | 3300005616 | Bacteria | 2678 |
| 299 | Ga0068852_100102441 | 3300005616 | Bacteria | 2587 |
| 300 | Ga0068852_100128372 | 3300005616 | Bacteria | 2332 |
| 301 | Ga0068852_100144730 | 3300005616 | Bacteria | 2203 |
| 302 | Ga0068852_100153040 | 3300005616 | Bacteria | 2147 |
| 303 | Ga0068852_100183434 | 3300005616 | Bacteria | 1969 |
| 304 | Ga0068859_100008179 | 3300005617 | Bacteria | 10608 |
| 305 | Ga0068859_100019260 | 3300005617 | Bacteria | 6857 |
| 306 | Ga0068859_100120357 | 3300005617 | Bacteria | 2692 |
| 307 | Ga0068859_100138766 | 3300005617 | Bacteria | 2505 |
| 308 | Ga0068859_100224881 | 3300005617 | Bacteria | 1965 |
| 309 | Ga0068864_100003021 | 3300005618 | Bacteria | 13903 |
| 310 | Ga0068864_100003215 | 3300005618 | Bacteria | 13492 |
| 311 | Ga0068864_100003388 | 3300005618 | Bacteria | 13175 |
| 312 | Ga0068864_100004994 | 3300005618 | Bacteria | 10869 |
| 313 | Ga0068864_100006896 | 3300005618 | Bacteria | 9311 |
| 314 | Ga0068864_100012967 | 3300005618 | Bacteria | 6897 |
| 315 | Ga0068864_100012983 | 3300005618 | Bacteria | 6894 |
| 316 | Ga0068864_100017103 | 3300005618 | Bacteria | 6046 |
| 317 | Ga0068864_100043933 | 3300005618 | Bacteria | 3827 |
| 318 | Ga0068864_100051250 | 3300005618 | Bacteria | 3555 |
| 319 | Ga0068864_100186145 | 3300005618 | Bacteria | 1901 |
| 320 | Ga0068866_10001300 | 3300005718 | Bacteria | 10812 |
| 321 | Ga0068866_10003042 | 3300005718 | Bacteria | 6920 |
| 322 | Ga0068866_10056168 | 3300005718 | Bacteria | 2024 |
| 323 | Ga0068861_100003681 | 3300005719 | Bacteria | 10226 |
| 324 | Ga0068861_100019950 | 3300005719 | Bacteria | 4793 |
| 325 | Ga0068861_100074947 | 3300005719 | Bacteria | 2633 |
| 326 | Ga0068861_100252661 | 3300005719 | Bacteria | 1505 |
| 327 | Ga0068851_10001504 | 3300005834 | Bacteria | 10227 |
| 328 | Ga0068851_10001952 | 3300005834 | Bacteria | 9062 |
| 329 | Ga0068851_10005110 | 3300005834 | Bacteria | 5947 |
| 330 | Ga0068870_10004649 | 3300005840 | Bacteria | 5921 |
| 331 | Ga0068870_10011360 | 3300005840 | Bacteria | 4127 |
| 332 | Ga0068863_100002944 | 3300005841 | Bacteria | 16823 |
| 333 | Ga0068863_100006136 | 3300005841 | Bacteria | 11785 |
| 334 | Ga0068863_100012415 | 3300005841 | Bacteria | 8226 |
| 335 | Ga0068863_100078939 | 3300005841 | Bacteria | 3117 |
| 336 | Ga0068863_100106689 | 3300005841 | Bacteria | 2665 |
| 337 | Ga0068863_100211302 | 3300005841 | Bacteria | 1869 |
| 338 | Ga0068863_100265844 | 3300005841 | Bacteria | 1659 |
| 339 | Ga0068863_100359834 | 3300005841 | Bacteria | 1418 |
| 340 | Ga0068858_100001489 | 3300005842 | Bacteria | 24134 |
| 341 | Ga0068858_100001809 | 3300005842 | Bacteria | 21766 |
| 342 | Ga0068858_100009131 | 3300005842 | Bacteria | 9478 |
| 343 | Ga0068858_100012375 | 3300005842 | Bacteria | 8044 |
| 344 | Ga0068858_100014246 | 3300005842 | Bacteria | 7497 |
| 345 | Ga0068858_100073212 | 3300005842 | Bacteria | 3181 |
| 346 | Ga0068860_100030385 | 3300005843 | Bacteria | 5196 |
| 347 | Ga0068860_100036536 | 3300005843 | Bacteria | 4706 |
| 348 | Ga0068860_100070370 | 3300005843 | Bacteria | 3326 |
| 349 | Ga0068860_100109777 | 3300005843 | Bacteria | 2636 |
| 350 | Ga0068860_100225374 | 3300005843 | Bacteria | 1821 |
| 351 | Ga0068862_100032352 | 3300005844 | Bacteria | 4419 |
| 352 | Ga0068862_100036091 | 3300005844 | Bacteria | 4188 |
| 353 | Ga0068862_100501604 | 3300005844 | Bacteria | 1152 |
| 354 | Ga0075365_10107573 | 3300006038 | Bacteria | 1915 |
| 355 | Ga0075365_10160636 | 3300006038 | Bacteria | 1565 |
| 356 | Ga0075368_10015453 | 3300006042 | Bacteria | 2833 |
| 357 | Ga0075363_100018085 | 3300006048 | Bacteria | 3505 |
| 358 | Ga0075364_10053083 | 3300006051 | Bacteria | 2649 |
| 359 | Ga0075364_10069798 | 3300006051 | Bacteria | 2312 |
| 360 | Ga0070716_100011574 | 3300006173 | Bacteria | 4445 |
| 361 | Ga0075367_10071027 | 3300006178 | Bacteria | 2094 |
| 362 | Ga0075369_10011589 | 3300006186 | Bacteria | 3471 |
| 363 | Ga0075366_10073654 | 3300006195 | Bacteria | 2036 |
| 364 | Ga0075366_10111179 | 3300006195 | Bacteria | 1648 |
| 365 | Ga0075366_10145124 | 3300006195 | Bacteria | 1436 |
| 366 | Ga0097621_100013385 | 3300006237 | Bacteria | 6115 |
| 367 | Ga0097621_100014480 | 3300006237 | Bacteria | 5902 |
| 368 | Ga0097621_100015566 | 3300006237 | Bacteria | 5728 |
| 369 | Ga0097621_100024903 | 3300006237 | Bacteria | 4678 |
| 370 | Ga0097621_100038425 | 3300006237 | Bacteria | 3841 |
| 371 | Ga0097621_100223620 | 3300006237 | Bacteria | 1641 |
| 372 | Ga0097621_100363334 | 3300006237 | Bacteria | 1290 |
| 373 | Ga0075370_10000588 | 3300006353 | Bacteria | 14049 |
| 374 | Ga0075370_10007627 | 3300006353 | Bacteria | 5521 |
| 375 | Ga0075370_10015758 | 3300006353 | Bacteria | 4054 |
| 376 | Ga0075370_10016857 | 3300006353 | Bacteria | 3938 |
| 377 | Ga0075370_10026463 | 3300006353 | Bacteria | 3214 |
| 378 | Ga0075370_10096251 | 3300006353 | Bacteria | 1710 |
| 379 | Ga0068871_100007455 | 3300006358 | Bacteria | 7820 |
| 380 | Ga0068871_100007492 | 3300006358 | Bacteria | 7807 |
| 381 | Ga0068871_100023997 | 3300006358 | Bacteria | 4726 |
| 382 | Ga0068871_100047622 | 3300006358 | Bacteria | 3458 |
| 383 | Ga0068871_100064259 | 3300006358 | Bacteria | 3005 |
| 384 | Ga0068871_100503920 | 3300006358 | Bacteria | 1091 |
| 385 | Ga0075431_100125652 | 3300006847 | Bacteria | 2646 |
| 386 | Ga0075433_10051025 | 3300006852 | Bacteria | 3601 |
| 387 | Ga0075434_100005141 | 3300006871 | Bacteria | 11879 |
| 388 | Ga0075434_100316150 | 3300006871 | Bacteria | 1582 |
| 389 | Ga0075429_100012528 | 3300006880 | Bacteria | 7357 |
| 390 | Ga0068865_100002377 | 3300006881 | Bacteria | 11089 |
| 391 | Ga0068865_100036709 | 3300006881 | Bacteria | 3305 |
| 392 | Ga0068865_100110781 | 3300006881 | Bacteria | 2025 |
| 393 | Ga0068865_100124275 | 3300006881 | Bacteria | 1924 |
| 394 | Ga0075436_100000450 | 3300006914 | Bacteria | 26442 |
| 395 | Ga0075436_100040453 | 3300006914 | Bacteria | 3217 |
| 396 | Ga0075436_100049197 | 3300006914 | Bacteria | 2909 |
| 397 | Ga0075436_100097161 | 3300006914 | Bacteria | 2049 |
| 398 | Ga0097620_100008179 | 3300006931 | Bacteria | 10608 |
| 399 | Ga0097620_100019260 | 3300006931 | Bacteria | 6857 |
| 400 | Ga0097620_100120356 | 3300006931 | Bacteria | 2692 |
| 401 | Ga0097620_100138763 | 3300006931 | Bacteria | 2505 |
| 402 | Ga0097620_100224901 | 3300006931 | Bacteria | 1965 |
| 403 | Ga0099823_1000028 | 3300006944 | Bacteria | 69723 |
| 404 | Ga0079104_1000233 | 3300006946 | Bacteria | 75184 |
| 405 | Ga0075435_100015802 | 3300007076 | Bacteria | 5681 |
| 406 | Ga0105240_10008957 | 3300009093 | Bacteria | 14229 |
| 407 | Ga0105240_10024631 | 3300009093 | Bacteria | 7928 |
| 408 | Ga0105240_10046164 | 3300009093 | Bacteria | 5522 |
| 409 | Ga0111539_10037540 | 3300009094 | Bacteria | 5848 |
| 410 | Ga0105245_10023867 | 3300009098 | Bacteria | 5367 |
| 411 | Ga0105245_10132843 | 3300009098 | Bacteria | 2336 |
| 412 | Ga0105245_10136895 | 3300009098 | Bacteria | 2302 |
| 413 | Ga0105245_10332858 | 3300009098 | Bacteria | 1499 |
| 414 | Ga0105245_10378274 | 3300009098 | Bacteria | 1409 |
| 415 | Ga0105247_10028923 | 3300009101 | Bacteria | 3355 |
| 416 | Ga0105247_10145471 | 3300009101 | Bacteria | 1557 |
| 417 | Ga0105247_10148766 | 3300009101 | Bacteria | 1541 |
| 418 | Ga0114129_10161325 | 3300009147 | Bacteria | 3062 |
| 419 | Ga0114129_10294619 | 3300009147 | Bacteria | 2164 |
| 420 | Ga0114129_10600994 | 3300009147 | Bacteria | 1425 |
| 421 | Ga0105243_10005306 | 3300009148 | Bacteria | 10073 |
| 422 | Ga0105243_10022010 | 3300009148 | Bacteria | 4842 |
| 423 | Ga0105243_10038828 | 3300009148 | Bacteria | 3709 |
| 424 | Ga0105243_10043773 | 3300009148 | Bacteria | 3509 |
| 425 | Ga0105243_10272335 | 3300009148 | Bacteria | 1521 |
| 426 | Ga0105241_10001246 | 3300009174 | Bacteria | 19419 |
| 427 | Ga0105241_10018060 | 3300009174 | Bacteria | 5185 |
| 428 | Ga0105241_10431362 | 3300009174 | Bacteria | 1162 |
| 429 | Ga0105242_10064186 | 3300009176 | Bacteria | 3026 |
| 430 | Ga0105242_10066151 | 3300009176 | Bacteria | 2984 |
| 431 | Ga0105242_10099391 | 3300009176 | Bacteria | 2463 |
| 432 | Ga0105242_10140587 | 3300009176 | Bacteria | 2094 |
| 433 | Ga0105242_10374105 | 3300009176 | Bacteria | 1322 |
| 434 | Ga0105242_10594179 | 3300009176 | Bacteria | 1068 |
| 435 | Ga0105248_10002109 | 3300009177 | Bacteria | 22030 |
| 436 | Ga0105248_10003500 | 3300009177 | Bacteria | 17423 |
| 437 | Ga0105248_10041720 | 3300009177 | Bacteria | 5145 |
| 438 | Ga0105248_10103598 | 3300009177 | Bacteria | 3208 |
| 439 | Ga0105248_10108637 | 3300009177 | Bacteria | 3128 |
| 440 | Ga0105248_10197642 | 3300009177 | Bacteria | 2266 |
| 441 | Ga0105248_10262360 | 3300009177 | Bacteria | 1945 |
| 442 | Ga0105237_10002827 | 3300009545 | Bacteria | 21113 |
| 443 | Ga0105237_10036249 | 3300009545 | Bacteria | 4989 |
| 444 | Ga0105237_10051155 | 3300009545 | Bacteria | 4150 |
| 445 | Ga0105238_10000931 | 3300009551 | Bacteria | 29986 |
| 446 | Ga0105238_10011759 | 3300009551 | Bacteria | 8822 |
| 447 | Ga0105238_10021461 | 3300009551 | Bacteria | 6577 |
| 448 | Ga0105238_10121296 | 3300009551 | Bacteria | 2594 |
| 449 | Ga0105238_10317688 | 3300009551 | Bacteria | 1543 |
| 450 | Ga0105238_10320999 | 3300009551 | Bacteria | 1535 |
| 451 | Ga0105238_10344764 | 3300009551 | Bacteria | 1478 |
| 452 | Ga0105249_10053561 | 3300009553 | Bacteria | 3688 |
| 453 | Ga0105249_10131014 | 3300009553 | Bacteria | 2394 |
| 454 | Ga0105249_10231327 | 3300009553 | Bacteria | 1823 |
| 455 | Ga0105239_10003016 | 3300010375 | Bacteria | 20980 |
| 456 | Ga0105239_10047674 | 3300010375 | Bacteria | 4695 |
| 457 | Ga0105239_10152516 | 3300010375 | Bacteria | 2579 |
| 458 | Ga0105239_10168187 | 3300010375 | Bacteria | 2451 |
| 459 | Ga0105239_10278259 | 3300010375 | Bacteria | 1883 |
| 460 | Ga0105239_10338345 | 3300010375 | Bacteria | 1698 |
| 461 | Ga0105239_10738454 | 3300010375 | Bacteria | 1126 |
| 462 | Ga0105246_10051067 | 3300011119 | Bacteria | 2838 |
| 463 | Ga0105246_10107836 | 3300011119 | Bacteria | 2040 |
| 464 | Ga0157319_1000018 | 3300012497 | Bacteria | 98831 |
| 465 | Ga0157373_10000649 | 3300013100 | Bacteria | 27382 |
| 466 | Ga0157373_10001504 | 3300013100 | Bacteria | 17780 |
| 467 | Ga0157373_10008726 | 3300013100 | Bacteria | 7515 |
| 468 | Ga0157373_10038750 | 3300013100 | Bacteria | 3415 |
| 469 | Ga0157373_10093769 | 3300013100 | Bacteria | 2114 |
| 470 | Ga0157371_10000638 | 3300013102 | Bacteria | 41588 |
| 471 | Ga0157371_10032114 | 3300013102 | Bacteria | 3779 |
| 472 | Ga0157371_10038122 | 3300013102 | Bacteria | 3439 |
| 473 | Ga0157371_10064586 | 3300013102 | Bacteria | 2593 |
| 474 | Ga0157371_10155259 | 3300013102 | Bacteria | 1633 |
| 475 | Ga0157370_10002443 | 3300013104 | Bacteria | 22408 |
| 476 | Ga0157370_10005978 | 3300013104 | Bacteria | 13542 |
| 477 | Ga0157370_10011477 | 3300013104 | Bacteria | 9261 |
| 478 | Ga0157370_10012817 | 3300013104 | Bacteria | 8667 |
| 479 | Ga0157370_10029242 | 3300013104 | Bacteria | 5412 |
| 480 | Ga0157370_10050818 | 3300013104 | Bacteria | 3961 |
| 481 | Ga0157370_10073452 | 3300013104 | Bacteria | 3227 |
| 482 | Ga0157370_10117936 | 3300013104 | Bacteria | 2480 |
| 483 | Ga0157370_10275977 | 3300013104 | Bacteria | 1553 |
| 484 | Ga0157370_10293931 | 3300013104 | Bacteria | 1500 |
| 485 | Ga0157369_10003589 | 3300013105 | Bacteria | 18428 |
| 486 | Ga0157369_10084966 | 3300013105 | Bacteria | 3382 |
| 487 | Ga0157369_10088888 | 3300013105 | Bacteria | 3298 |
| 488 | Ga0157369_10215608 | 3300013105 | Bacteria | 2011 |
| 489 | Ga0157369_10478974 | 3300013105 | Bacteria | 1288 |
| 490 | Ga0157374_10013256 | 3300013296 | Bacteria | 7191 |
| 491 | Ga0157374_10014532 | 3300013296 | Bacteria | 6890 |
| 492 | Ga0157374_10025251 | 3300013296 | Bacteria | 5331 |
| 493 | Ga0157374_10025342 | 3300013296 | Bacteria | 5324 |
| 494 | Ga0157374_10046648 | 3300013296 | Bacteria | 4014 |
| 495 | Ga0157374_10049943 | 3300013296 | Bacteria | 3886 |
| 496 | Ga0157374_10254048 | 3300013296 | Bacteria | 1730 |
| 497 | Ga0157374_10460869 | 3300013296 | Bacteria | 1273 |
| 498 | Ga0157374_10586127 | 3300013296 | Bacteria | 1124 |
| 499 | Ga0157378_10015438 | 3300013297 | Bacteria | 6690 |
| 500 | Ga0157378_10019789 | 3300013297 | Bacteria | 5920 |
| 501 | Ga0157378_10108058 | 3300013297 | Bacteria | 2547 |
| 502 | Ga0157378_10376176 | 3300013297 | Bacteria | 1394 |
| 503 | Ga0163162_10010226 | 3300013306 | Bacteria | 9115 |
| 504 | Ga0163162_10030008 | 3300013306 | Bacteria | 5384 |
| 505 | Ga0163162_10219859 | 3300013306 | Bacteria | 2029 |
| 506 | Ga0157372_10039758 | 3300013307 | Bacteria | 5192 |
| 507 | Ga0157372_10045419 | 3300013307 | Bacteria | 4873 |
| 508 | Ga0157372_10084764 | 3300013307 | Bacteria | 3593 |
| 509 | Ga0157372_10097486 | 3300013307 | Bacteria | 3353 |
| 510 | Ga0157372_10098850 | 3300013307 | Bacteria | 3329 |
| 511 | Ga0157372_10136264 | 3300013307 | Bacteria | 2827 |
| 512 | Ga0157375_10000552 | 3300013308 | Bacteria | 33621 |
| 513 | Ga0157375_10104651 | 3300013308 | Bacteria | 2919 |
| 514 | Ga0157375_10105087 | 3300013308 | Bacteria | 2913 |
| 515 | Ga0157375_10201464 | 3300013308 | Bacteria | 2146 |
| 516 | Ga0157375_10342380 | 3300013308 | Bacteria | 1661 |
| 517 | Ga0157375_10765066 | 3300013308 | Bacteria | 1116 |
| 518 | Ga0163163_10014450 | 3300014325 | Bacteria | 7256 |
| 519 | Ga0163163_10033485 | 3300014325 | Bacteria | 4971 |
| 520 | Ga0163163_10072501 | 3300014325 | Bacteria | 3433 |
| 521 | Ga0163163_10101651 | 3300014325 | Bacteria | 2897 |
| 522 | Ga0157380_10010386 | 3300014326 | Bacteria | 6697 |
| 523 | Ga0157380_10038888 | 3300014326 | Bacteria | 3696 |
| 524 | Ga0157380_10110771 | 3300014326 | Bacteria | 2306 |
| 525 | Ga0157377_10000006 | 3300014745 | Bacteria | 419853 |
| 526 | Ga0157377_10017024 | 3300014745 | Bacteria | 3754 |
| 527 | Ga0157377_10177573 | 3300014745 | Bacteria | 1336 |
| 528 | Ga0157379_10008664 | 3300014968 | Bacteria | 8859 |
| 529 | Ga0157379_10014570 | 3300014968 | Bacteria | 6896 |
| 530 | Ga0157379_10019963 | 3300014968 | Bacteria | 5921 |
| 531 | Ga0157379_10055126 | 3300014968 | Bacteria | 3552 |
| 532 | Ga0157379_10101584 | 3300014968 | Bacteria | 2581 |
| 533 | Ga0157379_10119953 | 3300014968 | Bacteria | 2365 |
| 534 | Ga0157379_10413034 | 3300014968 | Bacteria | 1242 |
| 535 | Ga0157376_10002032 | 3300014969 | Bacteria | 13573 |
| 536 | Ga0157376_10016427 | 3300014969 | Bacteria | 5619 |
| 537 | Ga0157376_10275772 | 3300014969 | Bacteria | 1581 |
| 538 | Ga0163161_10011419 | 3300017792 | Bacteria | 6160 |
| 539 | Ga0163161_10022976 | 3300017792 | Bacteria | 4394 |
| 540 | Ga0163161_10031806 | 3300017792 | Bacteria | 3763 |
| 541 | Ga0163161_10081871 | 3300017792 | Bacteria | 2378 |
| 542 | Ga0163161_10088263 | 3300017792 | Bacteria | 2292 |
| 543 | Ga0163161_10185645 | 3300017792 | Bacteria | 1596 |
| 544 | Ga0163161_10350400 | 3300017792 | Bacteria | 1173 |
| 545 | Ga0213872_10000299 | 3300021361 | Bacteria | 42359 |
| 546 | Ga0213872_10001215 | 3300021361 | Bacteria | 17431 |
| 547 | Ga0213872_10005774 | 3300021361 | Bacteria | 6293 |
| 548 | Ga0213872_10011797 | 3300021361 | Bacteria | 4129 |
| 549 | Ga0209563_100112 | 3300025230 | Bacteria | 136524 |
| 550 | Ga0209258_106994 | 3300025242 | Bacteria | 1710 |
| 551 | Ga0209759_1001653 | 3300025256 | Bacteria | 11725 |
| 552 | Ga0209673_1002680 | 3300025273 | Bacteria | 11863 |
| 553 | Ga0209564_1000131 | 3300025295 | Bacteria | 192177 |
| 554 | Ga0209758_1000367 | 3300025297 | Bacteria | 80207 |
| 555 | Ga0209050_1000596 | 3300025298 | Bacteria | 57689 |
| 556 | Ga0209050_1001057 | 3300025298 | Bacteria | 33847 |
| 557 | Ga0209050_1002537 | 3300025298 | Bacteria | 15264 |
| 558 | Ga0209256_1001842 | 3300025299 | Bacteria | 19699 |
| 559 | Ga0209256_1001867 | 3300025299 | Bacteria | 19447 |
| 560 | Ga0209051_1000148 | 3300025303 | Bacteria | 132600 |
| 561 | Ga0209051_1000953 | 3300025303 | Bacteria | 28382 |
| 562 | Ga0209051_1001133 | 3300025303 | Bacteria | 24392 |
| 563 | Ga0209051_1017641 | 3300025303 | Bacteria | 3184 |
| 564 | Ga0209257_1000016 | 3300025304 | Bacteria | 908015 |
| 565 | Ga0209257_1000380 | 3300025304 | Bacteria | 88824 |
| 566 | Ga0209257_1001173 | 3300025304 | Bacteria | 33131 |
| 567 | Ga0209257_1001971 | 3300025304 | Bacteria | 22101 |
| 568 | Ga0209257_1010980 | 3300025304 | Bacteria | 4452 |
| 569 | Ga0209257_1011952 | 3300025304 | Bacteria | 4091 |
| 570 | Ga0207697_10000014 | 3300025315 | Bacteria | 59917 |
| 571 | Ga0207656_10004561 | 3300025321 | Bacteria | 4848 |
| 572 | Ga0207656_10011011 | 3300025321 | Bacteria | 3405 |
| 573 | Ga0207656_10017951 | 3300025321 | Bacteria | 2778 |
| 574 | Ga0207656_10049367 | 3300025321 | Bacteria | 1814 |
| 575 | Ga0207682_10000063 | 3300025893 | Bacteria | 46817 |
| 576 | Ga0207682_10000095 | 3300025893 | Bacteria | 41132 |
| 577 | Ga0207682_10008608 | 3300025893 | Bacteria | 4034 |
| 578 | Ga0207682_10008799 | 3300025893 | Bacteria | 3992 |
| 579 | Ga0207682_10035747 | 3300025893 | Bacteria | 2008 |
| 580 | Ga0207642_10001503 | 3300025899 | Bacteria | 7183 |
| 581 | Ga0207642_10010704 | 3300025899 | Bacteria | 3245 |
| 582 | Ga0207688_10003995 | 3300025901 | Bacteria | 8034 |
| 583 | Ga0207680_10015227 | 3300025903 | Bacteria | 4008 |
| 584 | Ga0207680_10052613 | 3300025903 | Bacteria | 2441 |
| 585 | Ga0207680_10053699 | 3300025903 | Bacteria | 2420 |
| 586 | Ga0207680_10071438 | 3300025903 | Bacteria | 2152 |
| 587 | Ga0207680_10115127 | 3300025903 | Bacteria | 1751 |
| 588 | Ga0207699_10057676 | 3300025906 | Bacteria | 2320 |
| 589 | Ga0207645_10000195 | 3300025907 | Bacteria | 49424 |
| 590 | Ga0207645_10000272 | 3300025907 | Bacteria | 42718 |
| 591 | Ga0207645_10007040 | 3300025907 | Bacteria | 8006 |
| 592 | Ga0207645_10043389 | 3300025907 | Bacteria | 2878 |
| 593 | Ga0207645_10046857 | 3300025907 | Bacteria | 2761 |
| 594 | Ga0207645_10188371 | 3300025907 | Bacteria | 1355 |
| 595 | Ga0207645_10245835 | 3300025907 | Bacteria | 1183 |
| 596 | Ga0207643_10001264 | 3300025908 | Bacteria | 14806 |
| 597 | Ga0207643_10015155 | 3300025908 | Bacteria | 4193 |
| 598 | Ga0207643_10087762 | 3300025908 | Bacteria | 1809 |
| 599 | Ga0207705_10019028 | 3300025909 | Bacteria | 4912 |
| 600 | Ga0207705_10068271 | 3300025909 | Bacteria | 2574 |
| 601 | Ga0207705_10109288 | 3300025909 | Bacteria | 2041 |
| 602 | Ga0207705_10130123 | 3300025909 | Bacteria | 1873 |
| 603 | Ga0207684_10010783 | 3300025910 | Bacteria | 8021 |
| 604 | Ga0207684_10017161 | 3300025910 | Bacteria | 6213 |
| 605 | Ga0207654_10040018 | 3300025911 | Bacteria | 2640 |
| 606 | Ga0207707_10003509 | 3300025912 | Bacteria | 13888 |
| 607 | Ga0207707_10013024 | 3300025912 | Bacteria | 7241 |
| 608 | Ga0207707_10038346 | 3300025912 | Bacteria | 4187 |
| 609 | Ga0207707_10161743 | 3300025912 | Bacteria | 1957 |
| 610 | Ga0207695_10004581 | 3300025913 | Bacteria | 18783 |
| 611 | Ga0207695_10005581 | 3300025913 | Bacteria | 16617 |
| 612 | Ga0207671_10002906 | 3300025914 | Bacteria | 17691 |
| 613 | Ga0207671_10113162 | 3300025914 | Bacteria | 2067 |
| 614 | Ga0207671_10445060 | 3300025914 | Bacteria | 1032 |
| 615 | Ga0207693_10000153 | 3300025915 | Bacteria | 63886 |
| 616 | Ga0207693_10014403 | 3300025915 | Bacteria | 6359 |
| 617 | Ga0207693_10050525 | 3300025915 | Bacteria | 3265 |
| 618 | Ga0207663_10036617 | 3300025916 | Bacteria | 2953 |
| 619 | Ga0207660_10005727 | 3300025917 | Bacteria | 8062 |
| 620 | Ga0207660_10102503 | 3300025917 | Bacteria | 2139 |
| 621 | Ga0207660_10266821 | 3300025917 | Bacteria | 1355 |
| 622 | Ga0207662_10008788 | 3300025918 | Bacteria | 5541 |
| 623 | Ga0207662_10112987 | 3300025918 | Bacteria | 1695 |
| 624 | Ga0207657_10000409 | 3300025919 | Bacteria | 45340 |
| 625 | Ga0207657_10004564 | 3300025919 | Bacteria | 14645 |
| 626 | Ga0207657_10006048 | 3300025919 | Bacteria | 12581 |
| 627 | Ga0207657_10035422 | 3300025919 | Bacteria | 4476 |
| 628 | Ga0207657_10037570 | 3300025919 | Bacteria | 4322 |
| 629 | Ga0207657_10043449 | 3300025919 | Bacteria | 3958 |
| 630 | Ga0207657_10043737 | 3300025919 | Bacteria | 3942 |
| 631 | Ga0207657_10114852 | 3300025919 | Bacteria | 2219 |
| 632 | Ga0207657_10151935 | 3300025919 | Bacteria | 1885 |
| 633 | Ga0207657_10162359 | 3300025919 | Bacteria | 1814 |
| 634 | Ga0207657_10222252 | 3300025919 | Bacteria | 1513 |
| 635 | Ga0207649_10003601 | 3300025920 | Bacteria | 8464 |
| 636 | Ga0207649_10007126 | 3300025920 | Bacteria | 6079 |
| 637 | Ga0207649_10007390 | 3300025920 | Bacteria | 5977 |
| 638 | Ga0207649_10019187 | 3300025920 | Bacteria | 3905 |
| 639 | Ga0207649_10056447 | 3300025920 | Bacteria | 2452 |
| 640 | Ga0207652_10002018 | 3300025921 | Bacteria | 17506 |
| 641 | Ga0207652_10030735 | 3300025921 | Bacteria | 4501 |
| 642 | Ga0207652_10239563 | 3300025921 | Bacteria | 1635 |
| 643 | Ga0207646_10021842 | 3300025922 | Bacteria | 5906 |
| 644 | Ga0207646_10072499 | 3300025922 | Bacteria | 3076 |
| 645 | Ga0207646_10160640 | 3300025922 | Bacteria | 2027 |
| 646 | Ga0207681_10113098 | 3300025923 | Bacteria | 1978 |
| 647 | Ga0207694_10012399 | 3300025924 | Bacteria | 6423 |
| 648 | Ga0207694_10051392 | 3300025924 | Bacteria | 3195 |
| 649 | Ga0207694_10123967 | 3300025924 | Bacteria | 2065 |
| 650 | Ga0207694_10246142 | 3300025924 | Bacteria | 1462 |
| 651 | Ga0207694_10247391 | 3300025924 | Bacteria | 1458 |
| 652 | Ga0207694_10296665 | 3300025924 | Bacteria | 1330 |
| 653 | Ga0207650_10000846 | 3300025925 | Bacteria | 23178 |
| 654 | Ga0207650_10001899 | 3300025925 | Bacteria | 14741 |
| 655 | Ga0207650_10004762 | 3300025925 | Bacteria | 9269 |
| 656 | Ga0207650_10006005 | 3300025925 | Bacteria | 8284 |
| 657 | Ga0207650_10009384 | 3300025925 | Bacteria | 6687 |
| 658 | Ga0207650_10013079 | 3300025925 | Bacteria | 5740 |
| 659 | Ga0207650_10036806 | 3300025925 | Bacteria | 3562 |
| 660 | Ga0207650_10067924 | 3300025925 | Bacteria | 2676 |
| 661 | Ga0207650_10161341 | 3300025925 | Bacteria | 1776 |
| 662 | Ga0207659_10002575 | 3300025926 | Bacteria | 10800 |
| 663 | Ga0207659_10004373 | 3300025926 | Bacteria | 8539 |
| 664 | Ga0207659_10006715 | 3300025926 | Bacteria | 7069 |
| 665 | Ga0207659_10010964 | 3300025926 | Bacteria | 5710 |
| 666 | Ga0207659_10057886 | 3300025926 | Bacteria | 2781 |
| 667 | Ga0207659_10083027 | 3300025926 | Bacteria | 2374 |
| 668 | Ga0207659_10088744 | 3300025926 | Bacteria | 2304 |
| 669 | Ga0207659_10241261 | 3300025926 | Bacteria | 1462 |
| 670 | Ga0207687_10006544 | 3300025927 | Bacteria | 7694 |
| 671 | Ga0207687_10153484 | 3300025927 | Bacteria | 1760 |
| 672 | Ga0207700_10036066 | 3300025928 | Bacteria | 3568 |
| 673 | Ga0207700_10059555 | 3300025928 | Bacteria | 2888 |
| 674 | Ga0207664_10008735 | 3300025929 | Bacteria | 7083 |
| 675 | Ga0207664_10030560 | 3300025929 | Bacteria | 4114 |
| 676 | Ga0207644_10004197 | 3300025931 | Bacteria | 9351 |
| 677 | Ga0207644_10006681 | 3300025931 | Bacteria | 7515 |
| 678 | Ga0207644_10011530 | 3300025931 | Bacteria | 5851 |
| 679 | Ga0207644_10012979 | 3300025931 | Bacteria | 5543 |
| 680 | Ga0207644_10017416 | 3300025931 | Bacteria | 4850 |
| 681 | Ga0207644_10025283 | 3300025931 | Bacteria | 4083 |
| 682 | Ga0207644_10053412 | 3300025931 | Bacteria | 2907 |
| 683 | Ga0207644_10059361 | 3300025931 | Bacteria | 2766 |
| 684 | Ga0207644_10068055 | 3300025931 | Bacteria | 2597 |
| 685 | Ga0207644_10093222 | 3300025931 | Bacteria | 2248 |
| 686 | Ga0207644_10191165 | 3300025931 | Bacteria | 1609 |
| 687 | Ga0207690_10011683 | 3300025932 | Bacteria | 5251 |
| 688 | Ga0207690_10019689 | 3300025932 | Bacteria | 4160 |
| 689 | Ga0207690_10284496 | 3300025932 | Bacteria | 1289 |
| 690 | Ga0207690_10288491 | 3300025932 | Bacteria | 1280 |
| 691 | Ga0207690_10433819 | 3300025932 | Bacteria | 1053 |
| 692 | Ga0207706_10000232 | 3300025933 | Bacteria | 60892 |
| 693 | Ga0207706_10009312 | 3300025933 | Bacteria | 9017 |
| 694 | Ga0207706_10014346 | 3300025933 | Bacteria | 7181 |
| 695 | Ga0207706_10017282 | 3300025933 | Bacteria | 6500 |
| 696 | Ga0207706_10064159 | 3300025933 | Bacteria | 3233 |
| 697 | Ga0207706_10085827 | 3300025933 | Bacteria | 2767 |
| 698 | Ga0207686_10008700 | 3300025934 | Bacteria | 5484 |
| 699 | Ga0207709_10010741 | 3300025935 | Bacteria | 5044 |
| 700 | Ga0207709_10038651 | 3300025935 | Bacteria | 2844 |
| 701 | Ga0207709_10096773 | 3300025935 | Bacteria | 1942 |
| 702 | Ga0207670_10037114 | 3300025936 | Bacteria | 3174 |
| 703 | Ga0207670_10062133 | 3300025936 | Bacteria | 2552 |
| 704 | Ga0207670_10128255 | 3300025936 | Bacteria | 1854 |
| 705 | Ga0207669_10000968 | 3300025937 | Bacteria | 12162 |
| 706 | Ga0207669_10008441 | 3300025937 | Bacteria | 4837 |
| 707 | Ga0207669_10015132 | 3300025937 | Bacteria | 3882 |
| 708 | Ga0207669_10023946 | 3300025937 | Bacteria | 3272 |
| 709 | Ga0207669_10065278 | 3300025937 | Bacteria | 2257 |
| 710 | Ga0207669_10151151 | 3300025937 | Bacteria | 1626 |
| 711 | Ga0207704_10033559 | 3300025938 | Bacteria | 2920 |
| 712 | Ga0207704_10098281 | 3300025938 | Bacteria | 1944 |
| 713 | Ga0207704_10273462 | 3300025938 | Bacteria | 1280 |
| 714 | Ga0207665_10003325 | 3300025939 | Bacteria | 10770 |
| 715 | Ga0207665_10048457 | 3300025939 | Bacteria | 2852 |
| 716 | Ga0207665_10050819 | 3300025939 | Bacteria | 2789 |
| 717 | Ga0207691_10000175 | 3300025940 | Bacteria | 60250 |
| 718 | Ga0207691_10000370 | 3300025940 | Bacteria | 45317 |
| 719 | Ga0207691_10000406 | 3300025940 | Bacteria | 43071 |
| 720 | Ga0207691_10004936 | 3300025940 | Bacteria | 12872 |
| 721 | Ga0207691_10006303 | 3300025940 | Bacteria | 11451 |
| 722 | Ga0207691_10006393 | 3300025940 | Bacteria | 11380 |
| 723 | Ga0207691_10014981 | 3300025940 | Bacteria | 7382 |
| 724 | Ga0207691_10043866 | 3300025940 | Bacteria | 4119 |
| 725 | Ga0207691_10078079 | 3300025940 | Bacteria | 2981 |
| 726 | Ga0207691_10081812 | 3300025940 | Bacteria | 2902 |
| 727 | Ga0207691_10125516 | 3300025940 | Bacteria | 2271 |
| 728 | Ga0207691_10143884 | 3300025940 | Bacteria | 2100 |
| 729 | Ga0207711_10000677 | 3300025941 | Bacteria | 33809 |
| 730 | Ga0207711_10011337 | 3300025941 | Bacteria | 7404 |
| 731 | Ga0207711_10048113 | 3300025941 | Bacteria | 3648 |
| 732 | Ga0207711_10059114 | 3300025941 | Bacteria | 3300 |
| 733 | Ga0207711_10064515 | 3300025941 | Bacteria | 3164 |
| 734 | Ga0207711_10075441 | 3300025941 | Bacteria | 2935 |
| 735 | Ga0207711_10091407 | 3300025941 | Bacteria | 2677 |
| 736 | Ga0207711_10141991 | 3300025941 | Bacteria | 2161 |
| 737 | Ga0207711_10257234 | 3300025941 | Bacteria | 1604 |
| 738 | Ga0207711_10371780 | 3300025941 | Bacteria | 1326 |
| 739 | Ga0207689_10002874 | 3300025942 | Bacteria | 15876 |
| 740 | Ga0207689_10003356 | 3300025942 | Bacteria | 14651 |
| 741 | Ga0207689_10006514 | 3300025942 | Bacteria | 10309 |
| 742 | Ga0207689_10017634 | 3300025942 | Bacteria | 6035 |
| 743 | Ga0207689_10030246 | 3300025942 | Bacteria | 4513 |
| 744 | Ga0207689_10260367 | 3300025942 | Bacteria | 1435 |
| 745 | Ga0207661_10005335 | 3300025944 | Bacteria | 9047 |
| 746 | Ga0207661_10045320 | 3300025944 | Bacteria | 3480 |
| 747 | Ga0207661_10082591 | 3300025944 | Bacteria | 2656 |
| 748 | Ga0207661_10115910 | 3300025944 | Bacteria | 2274 |
| 749 | Ga0207661_10128142 | 3300025944 | Bacteria | 2170 |
| 750 | Ga0207661_10236884 | 3300025944 | Bacteria | 1618 |
| 751 | Ga0207679_10007974 | 3300025945 | Bacteria | 6734 |
| 752 | Ga0207679_10012424 | 3300025945 | Bacteria | 5553 |
| 753 | Ga0207679_10016751 | 3300025945 | Bacteria | 4870 |
| 754 | Ga0207679_10030704 | 3300025945 | Bacteria | 3754 |
| 755 | Ga0207679_10133208 | 3300025945 | Bacteria | 1997 |
| 756 | Ga0207679_10209639 | 3300025945 | Bacteria | 1633 |
| 757 | Ga0207667_10000860 | 3300025949 | Bacteria | 39081 |
| 758 | Ga0207667_10001380 | 3300025949 | Bacteria | 30442 |
| 759 | Ga0207667_10003655 | 3300025949 | Bacteria | 18970 |
| 760 | Ga0207667_10008779 | 3300025949 | Bacteria | 11969 |
| 761 | Ga0207667_10030332 | 3300025949 | Bacteria | 5851 |
| 762 | Ga0207667_10128814 | 3300025949 | Bacteria | 2606 |
| 763 | Ga0207667_10199460 | 3300025949 | Bacteria | 2053 |
| 764 | Ga0207667_10319761 | 3300025949 | Bacteria | 1585 |
| 765 | Ga0207667_10380813 | 3300025949 | Bacteria | 1437 |
| 766 | Ga0207651_10002106 | 3300025960 | Bacteria | 9396 |
| 767 | Ga0207651_10012926 | 3300025960 | Bacteria | 4750 |
| 768 | Ga0207651_10021398 | 3300025960 | Bacteria | 3930 |
| 769 | Ga0207651_10021533 | 3300025960 | Bacteria | 3921 |
| 770 | Ga0207651_10029248 | 3300025960 | Bacteria | 3488 |
| 771 | Ga0207651_10039799 | 3300025960 | Bacteria | 3103 |
| 772 | Ga0207651_10282087 | 3300025960 | Bacteria | 1373 |
| 773 | Ga0207651_10331527 | 3300025960 | Bacteria | 1275 |
| 774 | Ga0207712_10210107 | 3300025961 | Bacteria | 1549 |
| 775 | Ga0207668_10000588 | 3300025972 | Bacteria | 22596 |
| 776 | Ga0207668_10066180 | 3300025972 | Bacteria | 2560 |
| 777 | Ga0207668_10115860 | 3300025972 | Bacteria | 2019 |
| 778 | Ga0207668_10359237 | 3300025972 | Bacteria | 1220 |
| 779 | Ga0207640_10007254 | 3300025981 | Bacteria | 6114 |
| 780 | Ga0207640_10019268 | 3300025981 | Bacteria | 4028 |
| 781 | Ga0207640_10025022 | 3300025981 | Bacteria | 3609 |
| 782 | Ga0207640_10046560 | 3300025981 | Bacteria | 2791 |
| 783 | Ga0207640_10109120 | 3300025981 | Bacteria | 1957 |
| 784 | Ga0207640_10128890 | 3300025981 | Bacteria | 1825 |
| 785 | Ga0207658_10004294 | 3300025986 | Bacteria | 9925 |
| 786 | Ga0207658_10012167 | 3300025986 | Bacteria | 5869 |
| 787 | Ga0207658_10029131 | 3300025986 | Bacteria | 3895 |
| 788 | Ga0207658_10073100 | 3300025986 | Bacteria | 2602 |
| 789 | Ga0207658_10118225 | 3300025986 | Bacteria | 2108 |
| 790 | Ga0207658_10221610 | 3300025986 | Bacteria | 1592 |
| 791 | Ga0207658_10278265 | 3300025986 | Bacteria | 1433 |
| 792 | Ga0207677_10000568 | 3300026023 | Bacteria | 23256 |
| 793 | Ga0207677_10005073 | 3300026023 | Bacteria | 7117 |
| 794 | Ga0207677_10019960 | 3300026023 | Bacteria | 4058 |
| 795 | Ga0207677_10077614 | 3300026023 | Bacteria | 2369 |
| 796 | Ga0207677_10116070 | 3300026023 | Bacteria | 2004 |
| 797 | Ga0207677_10174372 | 3300026023 | Bacteria | 1685 |
| 798 | Ga0207677_10317897 | 3300026023 | Bacteria | 1293 |
| 799 | Ga0207703_10003052 | 3300026035 | Bacteria | 14164 |
| 800 | Ga0207703_10015842 | 3300026035 | Bacteria | 5882 |
| 801 | Ga0207703_10133865 | 3300026035 | Bacteria | 2144 |
| 802 | Ga0207639_10023753 | 3300026041 | Bacteria | 4428 |
| 803 | Ga0207639_10028265 | 3300026041 | Bacteria | 4092 |
| 804 | Ga0207639_10044448 | 3300026041 | Bacteria | 3341 |
| 805 | Ga0207639_10060210 | 3300026041 | Bacteria | 2929 |
| 806 | Ga0207639_10077914 | 3300026041 | Bacteria | 2614 |
| 807 | Ga0207639_10280504 | 3300026041 | Bacteria | 1465 |
| 808 | Ga0207678_10000060 | 3300026067 | Bacteria | 85708 |
| 809 | Ga0207678_10001630 | 3300026067 | Bacteria | 20581 |
| 810 | Ga0207678_10004372 | 3300026067 | Bacteria | 12704 |
| 811 | Ga0207678_10004440 | 3300026067 | Bacteria | 12618 |
| 812 | Ga0207678_10009412 | 3300026067 | Bacteria | 8598 |
| 813 | Ga0207678_10025143 | 3300026067 | Bacteria | 5199 |
| 814 | Ga0207678_10152589 | 3300026067 | Bacteria | 1973 |
| 815 | Ga0207678_10166047 | 3300026067 | Bacteria | 1885 |
| 816 | Ga0207708_10000766 | 3300026075 | Bacteria | 24175 |
| 817 | Ga0207708_10334594 | 3300026075 | Bacteria | 1239 |
| 818 | Ga0207702_10003001 | 3300026078 | Bacteria | 15691 |
| 819 | Ga0207702_10004735 | 3300026078 | Bacteria | 12021 |
| 820 | Ga0207702_10017663 | 3300026078 | Bacteria | 5903 |
| 821 | Ga0207702_10098884 | 3300026078 | Bacteria | 2571 |
| 822 | Ga0207702_10240838 | 3300026078 | Unclassified | 1695 |
| 823 | Ga0207702_10252410 | 3300026078 | Bacteria | 1657 |
| 824 | Ga0207702_10487553 | 3300026078 | Bacteria | 1200 |
| 825 | Ga0207641_10005500 | 3300026088 | Bacteria | 10803 |
| 826 | Ga0207641_10027119 | 3300026088 | Bacteria | 4730 |
| 827 | Ga0207641_10027318 | 3300026088 | Bacteria | 4713 |
| 828 | Ga0207641_10058733 | 3300026088 | Bacteria | 3274 |
| 829 | Ga0207641_10090534 | 3300026088 | Bacteria | 2675 |
| 830 | Ga0207641_10111602 | 3300026088 | Bacteria | 2425 |
| 831 | Ga0207641_10186108 | 3300026088 | Bacteria | 1905 |
| 832 | Ga0207641_10364665 | 3300026088 | Bacteria | 1380 |
| 833 | Ga0207648_10000023 | 3300026089 | Bacteria | 134519 |
| 834 | Ga0207648_10000885 | 3300026089 | Bacteria | 33754 |
| 835 | Ga0207648_10001587 | 3300026089 | Bacteria | 24915 |
| 836 | Ga0207648_10003000 | 3300026089 | Bacteria | 17836 |
| 837 | Ga0207648_10005713 | 3300026089 | Bacteria | 12464 |
| 838 | Ga0207648_10006509 | 3300026089 | Bacteria | 11599 |
| 839 | Ga0207648_10067742 | 3300026089 | Bacteria | 3111 |
| 840 | Ga0207648_10077572 | 3300026089 | Bacteria | 2896 |
| 841 | Ga0207676_10000487 | 3300026095 | Bacteria | 33269 |
| 842 | Ga0207676_10005256 | 3300026095 | Bacteria | 9163 |
| 843 | Ga0207676_10007017 | 3300026095 | Bacteria | 7979 |
| 844 | Ga0207676_10024837 | 3300026095 | Bacteria | 4439 |
| 845 | Ga0207676_10036016 | 3300026095 | Bacteria | 3761 |
| 846 | Ga0207676_10054047 | 3300026095 | Bacteria | 3145 |
| 847 | Ga0207676_10084458 | 3300026095 | Bacteria | 2588 |
| 848 | Ga0207676_10119767 | 3300026095 | Bacteria | 2217 |
| 849 | Ga0207676_10466973 | 3300026095 | Bacteria | 1193 |
| 850 | Ga0207674_10000045 | 3300026116 | Bacteria | 122251 |
| 851 | Ga0207674_10000380 | 3300026116 | Bacteria | 57884 |
| 852 | Ga0207674_10008292 | 3300026116 | Bacteria | 12034 |
| 853 | Ga0207674_10011058 | 3300026116 | Bacteria | 10149 |
| 854 | Ga0207674_10031960 | 3300026116 | Bacteria | 5524 |
| 855 | Ga0207674_10288182 | 3300026116 | Bacteria | 1591 |
| 856 | Ga0207675_100000982 | 3300026118 | Bacteria | 28316 |
| 857 | Ga0207675_100006003 | 3300026118 | Bacteria | 11559 |
| 858 | Ga0207675_100010997 | 3300026118 | Bacteria | 8479 |
| 859 | Ga0207675_100034419 | 3300026118 | Bacteria | 4724 |
| 860 | Ga0207675_100100927 | 3300026118 | Bacteria | 2719 |
| 861 | Ga0207683_10000009 | 3300026121 | Bacteria | 150281 |
| 862 | Ga0207683_10001803 | 3300026121 | Bacteria | 18967 |
| 863 | Ga0207683_10002654 | 3300026121 | Bacteria | 15624 |
| 864 | Ga0207683_10002918 | 3300026121 | Bacteria | 14907 |
| 865 | Ga0207683_10007175 | 3300026121 | Bacteria | 9553 |
| 866 | Ga0207683_10009314 | 3300026121 | Bacteria | 8368 |
| 867 | Ga0207683_10016707 | 3300026121 | Bacteria | 6245 |
| 868 | Ga0207683_10019254 | 3300026121 | Bacteria | 5828 |
| 869 | Ga0207683_10033501 | 3300026121 | Bacteria | 4462 |
| 870 | Ga0207683_10050124 | 3300026121 | Bacteria | 3656 |
| 871 | Ga0207683_10092890 | 3300026121 | Bacteria | 2689 |
| 872 | Ga0207698_10001195 | 3300026142 | Bacteria | 15126 |
| 873 | Ga0207698_10004886 | 3300026142 | Bacteria | 8219 |
| 874 | Ga0207698_10016132 | 3300026142 | Bacteria | 5026 |
| 875 | Ga0207698_10019585 | 3300026142 | Bacteria | 4636 |
| 876 | Ga0207698_10050176 | 3300026142 | Bacteria | 3181 |
| 877 | Ga0207698_10106664 | 3300026142 | Bacteria | 2337 |
| 878 | Ga0207698_10162162 | 3300026142 | Bacteria | 1957 |
| 879 | Ga0207698_10168457 | 3300026142 | Bacteria | 1926 |
| 880 | Ga0207698_10186360 | 3300026142 | Bacteria | 1844 |
| 881 | Ga0209281_1000076 | 3300027111 | Bacteria | 263350 |
| 882 | Ga0209389_1007702 | 3300027296 | Bacteria | 9514 |
| 883 | Ga0209981_1007750 | 3300027378 | Bacteria | 1452 |
| 884 | Ga0209968_1005124 | 3300027526 | Bacteria | 1965 |
| 885 | Ga0209970_1018051 | 3300027614 | Bacteria | 1183 |
| 886 | Ga0209966_1000360 | 3300027695 | Bacteria | 13904 |
| 887 | Ga0209966_1006848 | 3300027695 | Bacteria | 1988 |
| 888 | Ga0209974_10009106 | 3300027876 | Bacteria | 3373 |
| 889 | Ga0209974_10017653 | 3300027876 | Bacteria | 2365 |
| 890 | Ga0207428_10057082 | 3300027907 | Bacteria | 3100 |
| 891 | Ga0268266_10002814 | 3300028379 | Bacteria | 18146 |
| 892 | Ga0268266_10028922 | 3300028379 | Bacteria | 4710 |
| 893 | Ga0268266_10035048 | 3300028379 | Bacteria | 4268 |
| 894 | Ga0268266_10083838 | 3300028379 | Bacteria | 2782 |
| 895 | Ga0268266_10181860 | 3300028379 | Bacteria | 1915 |
| 896 | Ga0268265_10027125 | 3300028380 | Bacteria | 4084 |
| 897 | Ga0268265_10115987 | 3300028380 | Bacteria | 2196 |
| 898 | Ga0268265_10216209 | 3300028380 | Bacteria | 1674 |
| 899 | Ga0268265_10375890 | 3300028380 | Bacteria | 1305 |
| 900 | Ga0268264_10016423 | 3300028381 | Bacteria | 6060 |
| 901 | Ga0268264_10103061 | 3300028381 | Bacteria | 2484 |
| 902 | Ga0268264_10464604 | 3300028381 | Bacteria | 1228 |
| 903 | Ga0307515_10000109 | 3300028794 | Bacteria | 195895 |
| 904 | Ga0307515_10004774 | 3300028794 | Bacteria | 27760 |
| 905 | Ga0307515_10024496 | 3300028794 | Bacteria | 10513 |
| 906 | Ga0307515_10122066 | 3300028794 | Bacteria | 2942 |
| 907 | Ga0265330_10002031 | 3300031235 | Bacteria | 11231 |
| 908 | Ga0265332_10001320 | 3300031238 | Bacteria | 14074 |
| 909 | Ga0265328_10014756 | 3300031239 | Bacteria | 3071 |
| 910 | Ga0265325_10020658 | 3300031241 | Bacteria | 3628 |
| 911 | Ga0265329_10002673 | 3300031242 | Bacteria | 8024 |
| 912 | Ga0265339_10043404 | 3300031249 | Bacteria | 2487 |
| 913 | Ga0265331_10000782 | 3300031250 | Bacteria | 26477 |
| 914 | Ga0265331_10007011 | 3300031250 | Bacteria | 6576 |
| 915 | Ga0265327_10000149 | 3300031251 | Bacteria | 150385 |
| 916 | Ga0265327_10001316 | 3300031251 | Bacteria | 32359 |
| 917 | Ga0265327_10002079 | 3300031251 | Bacteria | 22367 |
| 918 | Ga0265327_10008910 | 3300031251 | Bacteria | 7364 |
| 919 | Ga0265327_10100592 | 3300031251 | Unclassified | 1395 |
| 920 | Ga0265327_10110845 | 3300031251 | Bacteria | 1311 |
| 921 | Ga0265316_10001831 | 3300031344 | Bacteria | 22378 |
| 922 | Ga0265316_10015971 | 3300031344 | Bacteria | 6534 |
| 923 | Ga0307513_10006129 | 3300031456 | Bacteria | 15780 |
| 924 | Ga0307509_10033425 | 3300031507 | Bacteria | 5661 |
| 925 | Ga0307408_100000006 | 3300031548 | Bacteria | 472824 |
| 926 | Ga0307408_100022760 | 3300031548 | Bacteria | 4262 |
| 927 | Ga0307408_100024311 | 3300031548 | Bacteria | 4135 |
| 928 | Ga0307508_10000237 | 3300031616 | Bacteria | 67014 |
| 929 | Ga0307514_10000200 | 3300031649 | Bacteria | 167194 |
| 930 | Ga0316579_10017242 | 3300031691 | Bacteria | 3165 |
| 931 | Ga0265314_10024215 | 3300031711 | Bacteria | 4606 |
| 932 | Ga0316576_10019850 | 3300031727 | Bacteria | 4610 |
| 933 | Ga0316576_10126795 | 3300031727 | Bacteria | 1918 |
| 934 | Ga0316578_10036520 | 3300031728 | Bacteria | 2827 |
| 935 | Ga0316578_10075217 | 3300031728 | Bacteria | 2003 |
| 936 | Ga0307516_10000476 | 3300031730 | Bacteria | 53151 |
| 937 | Ga0307516_10004137 | 3300031730 | Bacteria | 18093 |
| 938 | Ga0307405_10000531 | 3300031731 | Bacteria | 14441 |
| 939 | Ga0307405_10005429 | 3300031731 | Bacteria | 6147 |
| 940 | Ga0307405_10006086 | 3300031731 | Bacteria | 5902 |
| 941 | Ga0316577_10072871 | 3300031733 | Bacteria | 1917 |
| 942 | Ga0307413_10002488 | 3300031824 | Bacteria | 7506 |
| 943 | Ga0307413_10007240 | 3300031824 | Bacteria | 5135 |
| 944 | Ga0307413_10028776 | 3300031824 | Bacteria | 3100 |
| 945 | Ga0307410_10002348 | 3300031852 | Bacteria | 9114 |
| 946 | Ga0307410_10002777 | 3300031852 | Bacteria | 8565 |
| 947 | Ga0307406_10005190 | 3300031901 | Bacteria | 7114 |
| 948 | Ga0307407_10006878 | 3300031903 | Bacteria | 5104 |
| 949 | Ga0307407_10011931 | 3300031903 | Bacteria | 4158 |
| 950 | Ga0307407_10102592 | 3300031903 | Bacteria | 1779 |
| 951 | Ga0307412_10011462 | 3300031911 | Bacteria | 5138 |
| 952 | Ga0307412_10017944 | 3300031911 | Bacteria | 4245 |
| 953 | Ga0307412_10313904 | 3300031911 | Bacteria | 1244 |
| 954 | Ga0307409_100000296 | 3300031995 | Bacteria | 20197 |
| 955 | Ga0307409_100008896 | 3300031995 | Bacteria | 6130 |
| 956 | Ga0307409_100283352 | 3300031995 | Bacteria | 1533 |
| 957 | Ga0307416_100004316 | 3300032002 | Bacteria | 8540 |
| 958 | Ga0307416_100019849 | 3300032002 | Bacteria | 4776 |
| 959 | Ga0307416_100065620 | 3300032002 | Bacteria | 2984 |
| 960 | Ga0307416_100564011 | 3300032002 | Bacteria | 1214 |
| 961 | Ga0307416_100613769 | 3300032002 | Bacteria | 1169 |
| 962 | Ga0307414_10018807 | 3300032004 | Bacteria | 4265 |
| 963 | Ga0307414_10020468 | 3300032004 | Bacteria | 4125 |
| 964 | Ga0307411_10000157 | 3300032005 | Bacteria | 21587 |
| 965 | Ga0307411_10001828 | 3300032005 | Bacteria | 9028 |
| 966 | Ga0307411_10023364 | 3300032005 | Bacteria | 3660 |
| 967 | Ga0307411_10027937 | 3300032005 | Bacteria | 3422 |
| 968 | Ga0307411_10135527 | 3300032005 | Bacteria | 1807 |
| 969 | Ga0307415_100030255 | 3300032126 | Bacteria | 3472 |
| 970 | Ga0307415_100041448 | 3300032126 | Bacteria | 3057 |
| 971 | Ga0316585_10043512 | 3300032137 | Bacteria | 1434 |
| 972 | Ga0316580_10026199 | 3300032139 | Bacteria | 1802 |
| 973 | Ga0307510_10225780 | 3300033180 | Bacteria | 1380 |
| 974 | Ga0373944_0021853 | 3300035089 | Bacteria | 1856 |
| 975 | Ga0373949_0036540 | 3300035090 | Bacteria | 1192 |
| 976 | Ga0373939_0000172 | 3300035114 | Bacteria | 17838 |
| 977 | Ga0373939_0078301 | 3300035114 | Bacteria | 1092 |
| 978 | Ga0373954_0002732 | 3300035118 | Bacteria | 7426 |
| 979 | Ga0373956_0045582 | 3300035119 | Bacteria | 1957 |
| 980 | Ga0373957_0002773 | 3300035120 | Bacteria | 5043 |
| 981 | Ga0373960_0000838 | 3300035121 | Bacteria | 6489 |
| 982 | Ga0373943_0058774 | 3300035170 | Bacteria | 1915 |
| 983 | Ga0373946_0020385 | 3300035171 | Bacteria | 2562 |
| 984 | Ga0373924_0011368 | 3300035410 | Bacteria | 3305 |
| 985 | Ga0373931_0000138 | 3300035691 | Bacteria | 33181 |
| 986 | Ga0373931_0008388 | 3300035691 | Bacteria | 4899 |
| 987 | Ga0373931_0143868 | 3300035691 | Bacteria | 1384 |
| 988 | Ga0373931_0259984 | 3300035691 | Bacteria | 1059 |
| 989 | Ga0373927_0020224 | 3300035695 | Bacteria | 4365 |
| 990 | Ga0373927_0149886 | 3300035695 | Bacteria | 1527 |
| 991 | Ga0373927_0249703 | 3300035695 | Bacteria | 1166 |
| 992 | Ga0373933_0033639 | 3300035724 | Bacteria | 2983 |
| 993 | Ga0373933_0063845 | 3300035724 | Bacteria | 2227 |
| 994 | Ga0373933_0173888 | 3300035724 | Bacteria | 1371 |
| 995 | Ga0373947_0006647 | 3300035725 | Bacteria | 6711 |
| 996 | Ga0373947_0018891 | 3300035725 | Bacteria | 3971 |
| 997 | Ga0373937_0000885 | 3300036401 | Bacteria | 25664 |
| 998 | Ga0373937_0012826 | 3300036401 | Bacteria | 7381 |
| 999 | Ga0373937_0068780 | 3300036401 | Bacteria | 3264 |
| 1000 | Ga0373937_0089311 | 3300036401 | Bacteria | 2853 |
| 1001 | Ga0373937_0094166 | 3300036401 | Bacteria | 2777 |
| 1002 | Ga0316582_0066241 | 3300036647 | Bacteria | 2328 |
| 1003 | Ga0316582_0194431 | 3300036647 | Bacteria | 1382 |
| 1004 | Ga0316584_0238463 | 3300036712 | Bacteria | 1331 |
| 1005 | Ga0373925_0006042 | 3300037068 | Bacteria | 8956 |
| 1006 | Ga0373925_0111719 | 3300037068 | Bacteria | 2112 |
| 1007 | Ga0395899_0200723 | 3300037312 | Bacteria | 1391 |
| 1008 | Ga0395905_0000642 | 3300037471 | Bacteria | 46676 |
| 1009 | Ga0395905_0014790 | 3300037471 | Bacteria | 7441 |
| 1010 | Ga0395905_0332159 | 3300037471 | Bacteria | 1411 |
| 1011 | Ga0316581_0007165 | 3300037588 | Bacteria | 2983 |
| 1012 | Ga0395901_0016261 | 3300038443 | Bacteria | 7579 |
| 1013 | Ga0242420_007333 | 3300038996 | Bacteria | 1767 |
| 1014 | Ga0436365_0314337 | 3300039437 | Bacteria | 3805 |
| 1015 | Ga0436361_0041271 | 3300039447 | Bacteria | 10750 |
| 1016 | Ga0436361_0313405 | 3300039447 | Bacteria | 87904 |
| 1017 | Ga0436361_0427460 | 3300039447 | Bacteria | 107545 |
| 1018 | Ga0436361_0587522 | 3300039447 | Bacteria | 5273 |
| 1019 | Ga0436361_0813019 | 3300039447 | Bacteria | 1758 |
| 1020 | Ga0436361_0919876 | 3300039447 | Bacteria | 112731 |
| 1021 | Ga0436361_1046311 | 3300039447 | Bacteria | 5131 |
| 1022 | Ga0451787_337636 | 3300041441 | Bacteria | 1906 |
| 1023 | Ga0451851_0324073 | 3300041507 | Bacteria | 1254 |
| 1024 | Ga0451853_3266585 | 3300041512 | Bacteria | 1911 |
| 1025 | Ga0451853_3309104 | 3300041512 | Bacteria | 1176 |
| 1026 | Ga0439431_0020814 | 3300041997 | Bacteria | 1570 |
| 1027 | Ga0450917_000104 | 3300042120 | Bacteria | 5203 |
| 1028 | Ga0450888_000032 | 3300042126 | Bacteria | 9836 |
| 1029 | Ga0450890_001624 | 3300042127 | Bacteria | 3225 |
| 1030 | Ga0450890_002449 | 3300042127 | Bacteria | 2557 |
| 1031 | Ga0439434_0003833 | 3300042435 | Bacteria | 4395 |
| 1032 | Ga0439434_0039862 | 3300042435 | Bacteria | 1442 |
| 1033 | Ga0439459_0001155 | 3300042438 | Bacteria | 3832 |
| 1034 | Ga0451577_0005058 | 3300042876 | Bacteria | 13616 |
| 1035 | Ga0451577_0008299 | 3300042876 | Bacteria | 10107 |
| 1036 | Ga0451577_0055602 | 3300042876 | Bacteria | 3531 |
| 1037 | Ga0466969_0000123 | 3300044656 | Bacteria | 41546 |
| 1038 | Ga0466969_0011706 | 3300044656 | Bacteria | 4640 |
| 1039 | Ga0466969_0053525 | 3300044656 | Bacteria | 1979 |
| 1040 | Ga0453683_0002257 | 3300044673 | Bacteria | 15226 |
| 1041 | Ga0453683_0047332 | 3300044673 | Bacteria | 2696 |
| 1042 | Ga0453683_0092397 | 3300044673 | Bacteria | 1897 |
| 1043 | Ga0466965_0000144 | 3300044683 | Bacteria | 20908 |
| 1044 | Ga0466965_0014529 | 3300044683 | Bacteria | 3729 |
| 1045 | Ga0466966_0001180 | 3300044684 | Bacteria | 16743 |
| 1046 | Ga0466966_0002933 | 3300044684 | Bacteria | 11238 |
| 1047 | Ga0466966_0016277 | 3300044684 | Bacteria | 4917 |
| 1048 | Ga0466961_0002198 | 3300044693 | Bacteria | 12138 |
| 1049 | Ga0466961_0017217 | 3300044693 | Bacteria | 4642 |
| 1050 | Ga0466963_0024519 | 3300044694 | Bacteria | 3840 |
| 1051 | Ga0466963_0071821 | 3300044694 | Bacteria | 2330 |
| 1052 | Ga0466964_0023294 | 3300044706 | Bacteria | 2407 |
| 1053 | Ga0466964_0041491 | 3300044706 | Bacteria | 1861 |
| 1054 | Ga0453684_0016947 | 3300044712 | Bacteria | 11328 |
| 1055 | Ga0453684_0019353 | 3300044712 | Bacteria | 10370 |
| 1056 | Ga0453684_0054309 | 3300044712 | Bacteria | 5219 |
| 1057 | Ga0453684_0057170 | 3300044712 | Bacteria | 5052 |
| 1058 | Ga0453684_0210842 | 3300044712 | Bacteria | 2258 |
| 1059 | Ga0453684_0235626 | 3300044712 | Bacteria | 2110 |
| 1060 | Ga0453684_0384656 | 3300044712 | Bacteria | 1575 |
| 1061 | Ga0453684_0586369 | 3300044712 | Bacteria | 1224 |
| 1062 | Ga0466971_0003216 | 3300044719 | Bacteria | 6968 |
| 1063 | Ga0466971_0011365 | 3300044719 | Bacteria | 3899 |
| 1064 | Ga0466971_0017330 | 3300044719 | Bacteria | 3185 |
| 1065 | Ga0466968_0006730 | 3300044735 | Bacteria | 4344 |
| 1066 | Ga0466970_0003580 | 3300044765 | Bacteria | 7571 |
| 1067 | Ga0466970_0018148 | 3300044765 | Bacteria | 3640 |
| 1068 | Ga0466970_0021220 | 3300044765 | Bacteria | 3382 |
| 1069 | Ga0466957_0003922 | 3300044842 | Bacteria | 8225 |
| 1070 | Ga0466957_0005762 | 3300044842 | Bacteria | 6959 |
| 1071 | Ga0466959_0000054 | 3300045049 | Bacteria | 79861 |
| 1072 | Ga0466959_0021344 | 3300045049 | Bacteria | 4775 |
| 1073 | Ga0466959_0076780 | 3300045049 | Bacteria | 2411 |
| 1074 | Ga0451576_0000001 | 3300045051 | Bacteria | 1802108 |
| 1075 | Ga0451576_0051380 | 3300045051 | Bacteria | 4322 |
| 1076 | Ga0451576_0123825 | 3300045051 | Bacteria | 2693 |
| 1077 | Ga0451576_0256130 | 3300045051 | Bacteria | 1829 |
| 1078 | Ga0451576_0589834 | 3300045051 | Bacteria | 1168 |
| 1079 | Ga0466958_0174932 | 3300045836 | Bacteria | 1360 |
| 1080 | Ga0495590_0014854 | 3300046457 | Bacteria | 2838 |
| 1081 | Ga0495629_0033378 | 3300046459 | Bacteria | 3640 |
| 1082 | Ga0495651_0131591 | 3300046462 | Bacteria | 1826 |
| 1083 | Ga0495653_0099806 | 3300046463 | Bacteria | 2106 |
| 1084 | Ga0495580_0124571 | 3300046472 | Bacteria | 1789 |
| 1085 | Ga0495580_0210435 | 3300046472 | Bacteria | 1338 |
| 1086 | Ga0495639_0016287 | 3300046475 | Bacteria | 3226 |
| 1087 | Ga0495639_0140454 | 3300046475 | Bacteria | 1161 |
| 1088 | Ga0495662_0020205 | 3300046476 | Bacteria | 3221 |
| 1089 | Ga0495664_0037911 | 3300046477 | Bacteria | 2845 |
| 1090 | Ga0495585_0031454 | 3300046492 | Bacteria | 3012 |
| 1091 | Ga0495618_0141184 | 3300046514 | Bacteria | 1541 |
| 1092 | Ga0495630_0152593 | 3300046517 | Bacteria | 1758 |
| 1093 | Ga0495630_0248054 | 3300046517 | Bacteria | 1360 |
| 1094 | Ga0495632_0055816 | 3300046519 | Bacteria | 1932 |
| 1095 | Ga0495632_0073119 | 3300046519 | Bacteria | 1644 |
| 1096 | Ga0495643_0017219 | 3300046522 | Bacteria | 4228 |
| 1097 | Ga0495586_0097404 | 3300046535 | Bacteria | 1630 |
| 1098 | Ga0495621_0009828 | 3300046539 | Bacteria | 2918 |
| 1099 | Ga0495621_0022302 | 3300046539 | Bacteria | 2097 |
| 1100 | Ga0495621_0032286 | 3300046539 | Bacteria | 1799 |
| 1101 | Ga0495597_0011120 | 3300046542 | Bacteria | 4369 |
| 1102 | Ga0495645_0030864 | 3300046543 | Bacteria | 3904 |
| 1103 | Ga0495645_0033343 | 3300046543 | Bacteria | 3757 |
| 1104 | Ga0495645_0236527 | 3300046543 | Bacteria | 1221 |
| 1105 | Ga0495625_0032909 | 3300046660 | Bacteria | 3838 |
| 1106 | Ga0495659_0005751 | 3300046664 | Bacteria | 3911 |
| 1107 | Ga0495657_0197629 | 3300046675 | Bacteria | 1227 |
| 1108 | Ga0495623_0084968 | 3300046679 | Bacteria | 1952 |
| 1109 | Ga0495647_0045978 | 3300046681 | Bacteria | 1679 |
| 1110 | Ga0495658_0023095 | 3300046683 | Bacteria | 3299 |
| 1111 | Ga0495658_0192097 | 3300046683 | Bacteria | 1270 |
| 1112 | Ga0495613_0015093 | 3300046689 | Bacteria | 5736 |
| 1113 | Ga0495613_0111604 | 3300046689 | Bacteria | 1970 |
| 1114 | Ga0495670_0087790 | 3300046691 | Bacteria | 1589 |
| 1115 | Ga0495649_0006739 | 3300046694 | Bacteria | 7116 |
| 1116 | Ga0495600_0019071 | 3300046809 | Bacteria | 4377 |
| 1117 | Ga0495581_0040029 | 3300047315 | Bacteria | 2713 |
| 1118 | Ga0495636_0050144 | 3300047318 | Bacteria | 1747 |
| 1119 | Ga0495680_0058280 | 3300047322 | Bacteria | 2985 |
| 1120 | Ga0495687_000863 | 3300047443 | Bacteria | 32127 |
| 1121 | Ga0495675_0138740 | 3300047444 | Bacteria | 1508 |
| 1122 | Ga0495684_0010031 | 3300047471 | Bacteria | 7323 |
| 1123 | Ga0495684_0102509 | 3300047471 | Bacteria | 2163 |
| 1124 | Ga0495614_0082581 | 3300048089 | Bacteria | 1393 |
| 1125 | Ga0495626_0067502 | 3300048091 | Bacteria | 1615 |
| 1126 | Ga0496100_0471867 | 3300048903 | Bacteria | 964 |
| 1127 | Ga0496101_0032221 | 3300048904 | Bacteria | 3687 |
| 1128 | Ga0496101_0157020 | 3300048904 | Bacteria | 1743 |
| 1129 | Ga0496101_0238712 | 3300048904 | Bacteria | 1414 |
| 1130 | Ga0496102_0004391 | 3300048905 | Bacteria | 11912 |
| 1131 | Ga0496102_0123790 | 3300048905 | Bacteria | 2416 |
| 1132 | Ga0496102_0205793 | 3300048905 | Bacteria | 1855 |
| 1133 | Ga0496102_0352409 | 3300048905 | Bacteria | 1386 |
| 1134 | Ga0496102_0565404 | 3300048905 | Bacteria | 1060 |
| 1135 | Ga0496103_0010291 | 3300048906 | Bacteria | 5532 |
| 1136 | Ga0496103_0043052 | 3300048906 | Bacteria | 2779 |
| 1137 | Ga0496104_0025445 | 3300048907 | Bacteria | 5456 |
| 1138 | Ga0496104_0044281 | 3300048907 | Bacteria | 4182 |
| 1139 | Ga0496104_0046798 | 3300048907 | Bacteria | 4075 |
| 1140 | Ga0496105_0007858 | 3300048908 | Bacteria | 8281 |
| 1141 | Ga0496106_0016578 | 3300048909 | Bacteria | 5452 |
| 1142 | Ga0496106_0035206 | 3300048909 | Bacteria | 3744 |
| 1143 | Ga0496107_0004959 | 3300048910 | Bacteria | 9059 |
| 1144 | Ga0496107_0136223 | 3300048910 | Bacteria | 1814 |
| 1145 | Ga0496107_0158474 | 3300048910 | Bacteria | 1677 |
| 1146 | Ga0496108_0003315 | 3300048911 | Bacteria | 12939 |
| 1147 | Ga0496108_0137943 | 3300048911 | Bacteria | 2100 |
| 1148 | Ga0496108_0149187 | 3300048911 | Bacteria | 2017 |
| 1149 | Ga0496108_0475932 | 3300048911 | Bacteria | 1091 |
| 1150 | Ga0496109_0004780 | 3300048912 | Bacteria | 11306 |
| 1151 | Ga0496109_0028429 | 3300048912 | Bacteria | 5000 |
| 1152 | Ga0496109_0184211 | 3300048912 | Bacteria | 1962 |
| 1153 | Ga0496109_0205998 | 3300048912 | Bacteria | 1849 |
| 1154 | Ga0496109_0266685 | 3300048912 | Bacteria | 1613 |
| 1155 | Ga0496110_0006092 | 3300048913 | Bacteria | 9502 |
| 1156 | Ga0496110_0204183 | 3300048913 | Bacteria | 1796 |
| 1157 | Ga0496110_0219614 | 3300048913 | Bacteria | 1728 |
| 1158 | Ga0496110_0396062 | 3300048913 | Bacteria | 1259 |
| 1159 | Ga0496112_0000710 | 3300048915 | Bacteria | 23117 |
| 1160 | Ga0496112_0053740 | 3300048915 | Bacteria | 3956 |
| 1161 | Ga0496114_0017071 | 3300048917 | Bacteria | 5855 |
| 1162 | Ga0496114_0043990 | 3300048917 | Bacteria | 3703 |
| 1163 | Ga0496114_0400635 | 3300048917 | Bacteria | 1215 |
| 1164 | Ga0496115_0010832 | 3300048918 | Bacteria | 6820 |
| 1165 | Ga0496115_0072150 | 3300048918 | Bacteria | 2801 |
| 1166 | Ga0496115_0455891 | 3300048918 | Bacteria | 1032 |
| 1167 | Ga0496124_0053200 | 3300048927 | Bacteria | 3434 |
| 1168 | Ga0501291_013785 | 3300049514 | Bacteria | 1201 |
| 1169 | Ga0501300_002056 | 3300049523 | Bacteria | 3003 |
| 1170 | Ga0501034_0015916 | 3300049571 | Bacteria | 7718 |
| 1171 | Ga0501043_0000018 | 3300049579 | Bacteria | 161101 |
| 1172 | Ga0501046_0000042 | 3300049580 | Bacteria | 151850 |
| 1173 | Ga0501047_0000052 | 3300049581 | Bacteria | 153448 |
| 1174 | Ga0501047_0101856 | 3300049581 | Bacteria | 2751 |
| 1175 | Ga0501048_0010225 | 3300049582 | Bacteria | 7017 |
| 1176 | Ga0501067_0012644 | 3300049583 | Bacteria | 4682 |
| 1177 | Ga0501070_0006503 | 3300049586 | Bacteria | 9938 |
| 1178 | Ga0501073_0086176 | 3300049589 | Bacteria | 2184 |
| 1179 | Ga0501074_0053822 | 3300049590 | Bacteria | 2903 |
| 1180 | Ga0501077_0240070 | 3300049593 | Bacteria | 1152 |
| 1181 | Ga0501198_000042 | 3300049649 | Bacteria | 45595 |
| 1182 | Ga0501201_002787 | 3300049651 | Bacteria | 1597 |
| 1183 | Ga0501206_002112 | 3300049653 | Bacteria | 2511 |
| 1184 | Ga0501206_006650 | 3300049653 | Bacteria | 1504 |
| 1185 | Ga0501211_003040 | 3300049658 | Bacteria | 1745 |
| 1186 | Ga0501222_000016 | 3300049662 | Bacteria | 80046 |
| 1187 | Ga0501222_002427 | 3300049662 | Bacteria | 2587 |
| 1188 | Ga0501223_005309 | 3300049663 | Bacteria | 2714 |
| 1189 | Ga0501235_009142 | 3300049669 | Bacteria | 2164 |
| 1190 | Ga0501249_012855 | 3300049679 | Bacteria | 1773 |
| 1191 | Ga0501255_003581 | 3300049684 | Bacteria | 1452 |
| 1192 | Ga0501221_002963 | 3300049704 | Bacteria | 2797 |
| 1193 | Ga0501080_0009862 | 3300049742 | Bacteria | 8726 |
| 1194 | Ga0501083_0000703 | 3300049744 | Bacteria | 21776 |
| 1195 | Ga0501083_0063016 | 3300049744 | Bacteria | 2473 |
| 1196 | Ga0501232_006067 | 3300049757 | Bacteria | 1226 |
| 1197 | Ga0501263_004038 | 3300049760 | Bacteria | 1598 |
| 1198 | Ga0501265_005461 | 3300049762 | Bacteria | 1466 |
| 1199 | Ga0501267_000881 | 3300049764 | Bacteria | 2456 |
| 1200 | Ga0501268_017905 | 3300049765 | Bacteria | 1185 |
| 1201 | Ga0501269_003052 | 3300049766 | Bacteria | 2035 |
| 1202 | Ga0501045_0006468 | 3300049824 | Bacteria | 8116 |
| 1203 | nmdc:mga03683_12266_c1 | 3300050489 | Bacteria | 3126 |
| 1204 | nmdc:mga00v17_201376_c1 | 3300050491 | Bacteria | 1287 |
| 1205 | nmdc:mga0k408_135126_c1 | 3300050493 | Bacteria | 1465 |
| 1206 | nmdc:mga0k408_20287_c1 | 3300050493 | Bacteria | 3722 |
| 1207 | nmdc:mga0k408_20982_c1 | 3300050493 | Bacteria | 3666 |
| 1208 | nmdc:mga0k408_47063_c1 | 3300050493 | Bacteria | 2492 |
| 1209 | nmdc:mga0k408_5366_c1 | 3300050493 | Bacteria | 6814 |
| 1210 | nmdc:mga06z11_90412_c1 | 3300050494 | Bacteria | 1661 |
| 1211 | nmdc:mga07m45_121459_c1 | 3300050496 | Bacteria | 1509 |
| 1212 | nmdc:mga07m45_151709_c1 | 3300050496 | Bacteria | 1344 |
| 1213 | nmdc:mga07m45_26147_c1 | 3300050496 | Bacteria | 3206 |
| 1214 | nmdc:mga07m45_39198_c1 | 3300050496 | Bacteria | 2647 |
| 1215 | nmdc:mga07m45_40957_c1 | 3300050496 | Bacteria | 2594 |
| 1216 | nmdc:mga07m45_470_c1 | 3300050496 | Bacteria | 16988 |
| 1217 | nmdc:mga07m45_51695_c1 | 3300050496 | Bacteria | 2318 |
| 1218 | nmdc:mga07m45_771_c1 | 3300050496 | Bacteria | 13760 |
| 1219 | nmdc:mga05p37_242853_c1 | 3300050507 | Bacteria | 2164 |
| 1220 | nmdc:mga05p37_27957_c1 | 3300050507 | Bacteria | 6870 |
| 1221 | nmdc:mga05p37_597279_c1 | 3300050507 | Bacteria | 1247 |
| 1222 | nmdc:mga09592_23891_c1 | 3300050508 | Bacteria | 5051 |
| 1223 | nmdc:mga08y16_10845_c1 | 3300050511 | Bacteria | 9568 |
| 1224 | nmdc:mga08y16_584128_c1 | 3300050511 | Bacteria | 1128 |
| 1225 | nmdc:mga0n895_296823_c1 | 3300050512 | Bacteria | 1638 |
| 1226 | nmdc:mga0n895_69615_c1 | 3300050512 | Bacteria | 3486 |
| 1227 | nmdc:mga0rr50_303739_c1 | 3300050513 | Bacteria | 1335 |
| 1228 | nmdc:mga08x19_224871_c1 | 3300050514 | Bacteria | 1290 |
| 1229 | nmdc:mga08x19_5335_c1 | 3300050514 | Bacteria | 7597 |
| 1230 | nmdc:mga0sz30_42922_c1 | 3300050516 | Bacteria | 1903 |
| 1231 | Ga0495601_0000784 | 3300053077 | Bacteria | 17179 |
| 1232 | Ga0500635_0000018 | 3300053080 | Bacteria | 112805 |
| 1233 | Ga0495595_0073599 | 3300053084 | Bacteria | 1618 |
| 1234 | Ga0495619_0015430 | 3300053085 | Bacteria | 4833 |
| 1235 | Ga0495619_0032076 | 3300053085 | Bacteria | 3407 |
| 1236 | Ga0495619_0126157 | 3300053085 | Bacteria | 1756 |
| 1237 | Ga0500578_0015993 | 3300053086 | Bacteria | 4818 |
| 1238 | Ga0500641_0112612 | 3300053096 | Bacteria | 1171 |
| 1239 | Ga0500658_0022649 | 3300053134 | Bacteria | 2392 |
| 1240 | Ga0500616_0000820 | 3300053153 | Bacteria | 35228 |
| 1241 | Ga0500616_0003173 | 3300053153 | Bacteria | 12802 |
| 1242 | Ga0500622_0005578 | 3300053156 | Bacteria | 7510 |
| 1243 | Ga0500645_043393 | 3300053730 | Bacteria | 1324 |
| 1244 | Ga0501084_0028961 | 3300054114 | Bacteria | 4630 |
| 1245 | Ga0501084_0065152 | 3300054114 | Bacteria | 3048 |
| 1246 | Ga0590071_006731 | 3300059421 | Bacteria | 2726 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10048457 | Ga0207665_100484572 | 249 |
| 2 | 3300035695 | Ga0373927_0249703 | Ga0373927_0249703_13_795 | 257 |
| 3 | 3300009176 | Ga0105242_10594179 | Ga0105242_105941791 | 283 |
| 4 | 3300035724 | Ga0373933_0033639 | Ga0373933_0033639_23_883 | 283 |
| 5 | 3300046683 | Ga0495658_0192097 | Ga0495658_0192097_397_1260 | 283 |
| 6 | 3300048903 | Ga0496100_0471867 | Ga0496100_0471867_83_952 | 283 |
| 7 | 3300036647 | Ga0316582_0066241 | Ga0316582_0066241_32_907 | 284 |
| 8 | 3300037588 | Ga0316581_0007165 | Ga0316581_0007165_88_963 | 284 |
| 9 | 3300044673 | Ga0453683_0092397 | Ga0453683_0092397_243_1133 | 292 |
| 10 | 3300050507 | nmdc:mga05p37_597279_c1 | nmdc:mga05p37_597279_c1_15_905 | 292 |
| 11 | 3300035695 | Ga0373927_0149886 | Ga0373927_0149886_591_1496 | 298 |
| 12 | 3300046514 | Ga0495618_0141184 | Ga0495618_0141184_622_1527 | 298 |
| 13 | 3300048904 | Ga0496101_0238712 | Ga0496101_0238712_11_907 | 298 |
| 14 | 3300048905 | Ga0496102_0565404 | Ga0496102_0565404_140_1039 | 298 |
| 15 | 3300048910 | Ga0496107_0136223 | Ga0496107_0136223_860_1765 | 298 |
| 16 | 3300048913 | Ga0496110_0396062 | Ga0496110_0396062_304_1200 | 298 |
| 17 | 3300053084 | Ga0495595_0073599 | Ga0495595_0073599_26_931 | 298 |
| 18 | 3300035724 | Ga0373933_0173888 | Ga0373933_0173888_16_996 | 305 |
| 19 | 3300036401 | Ga0373937_0000885 | Ga0373937_0000885_22085_23065 | 305 |
| 20 | 3300014745 | Ga0157377_10177573 | Ga0157377_101775732 | 306 |
| 21 | 3300025931 | Ga0207644_10191165 | Ga0207644_101911651 | 306 |
| 22 | 3300046522 | Ga0495643_0017219 | Ga0495643_0017219_2219_3163 | 306 |
| 23 | 3300003792 | Ga0055540_1025877 | Ga0055540_10258772 | 307 |
| 24 | 3300025303 | Ga0209051_1000953 | Ga0209051_100095320 | 307 |
| 25 | 3300031507 | Ga0307509_10033425 | Ga0307509_100334253 | 307 |
| 26 | 3300053077 | Ga0495601_0000784 | Ga0495601_0000784_6064_7056 | 308 |
| 27 | 3300050493 | nmdc:mga0k408_20287_c1 | nmdc:mga0k408_20287_c1_2490_3473 | 310 |
| 28 | 3300005616 | Ga0068852_100183434 | Ga0068852_1001834342 | 311 |
| 29 | 3300044684 | Ga0466966_0002933 | Ga0466966_0002933_1293_2276 | 311 |
| 30 | 3300044693 | Ga0466961_0017217 | Ga0466961_0017217_15_998 | 311 |
| 31 | 3300044706 | Ga0466964_0041491 | Ga0466964_0041491_476_1459 | 311 |
| 32 | 3300044719 | Ga0466971_0003216 | Ga0466971_0003216_4494_5477 | 311 |
| 33 | 3300044735 | Ga0466968_0006730 | Ga0466968_0006730_1119_2102 | 311 |
| 34 | 3300044765 | Ga0466970_0018148 | Ga0466970_0018148_346_1329 | 311 |
| 35 | 3300044842 | Ga0466957_0005762 | Ga0466957_0005762_1306_2289 | 311 |
| 36 | 3300045049 | Ga0466959_0021344 | Ga0466959_0021344_3296_4279 | 311 |
| 37 | 3300045836 | Ga0466958_0174932 | Ga0466958_0174932_345_1328 | 311 |
| 38 | 3300044683 | Ga0466965_0000144 | Ga0466965_0000144_6927_7946 | 313 |
| 39 | 3300041512 | Ga0451853_3309104 | Ga0451853_3309104_147_1094 | 314 |
| 40 | iso_pu_bacteria | 2585428062 | 2587757116 | 314 |
| 41 | iso_pu_bacteria | 2643221544 | 2643741832 | 314 |
| 42 | iso_pu_bacteria | 2643221585 | 2643935098 | 314 |
| 43 | iso_pu_bacteria | 2643221639 | 2644220240 | 314 |
| 44 | iso_pu_bacteria | 2643221646 | 2644259104 | 314 |
| 45 | iso_pu_bacteria | 2643221656 | 2644316585 | 314 |
| 46 | iso_pu_bacteria | 2643221660 | 2644339776 | 314 |
| 47 | iso_pu_bacteria | 2738541337 | 2739053442 | 314 |
| 48 | iso_pu_bacteria | 2886848708 | 2886850993 | 314 |
| 49 | 3300045051 | Ga0451576_0256130 | Ga0451576_0256130_705_1664 | 315 |
| 50 | 3300003316 | rootH1_10043368 | rootH1_100433686 | 318 |
| 51 | 3300003322 | rootL2_10002418 | rootL2_100024185 | 318 |
| 52 | 3300003322 | rootL2_10012665 | rootL2_100126653 | 318 |
| 53 | 3300003322 | rootL2_10027947 | rootL2_100279476 | 318 |
| 54 | 3300003759 | Ga0055525_1000100 | Ga0055525_100010061 | 318 |
| 55 | 3300003771 | Ga0055526_1013302 | Ga0055526_10133022 | 318 |
| 56 | 3300003775 | Ga0055524_1001523 | Ga0055524_10015236 | 318 |
| 57 | 3300003791 | Ga0055530_10001128 | Ga0055530_1000112818 | 318 |
| 58 | 3300003792 | Ga0055540_1000110 | Ga0055540_100011043 | 318 |
| 59 | 3300003794 | Ga0055531_10000042 | Ga0055531_10000042100 | 318 |
| 60 | 3300003794 | Ga0055531_10004790 | Ga0055531_100047905 | 318 |
| 61 | 3300003794 | Ga0055531_10009863 | Ga0055531_100098632 | 318 |
| 62 | 3300005262 | Ga0065165_1000063 | Ga0065165_1000063114 | 318 |
| 63 | 3300005262 | Ga0065165_1001135 | Ga0065165_10011351 | 318 |
| 64 | 3300005290 | Ga0065712_10120426 | Ga0065712_101204262 | 318 |
| 65 | 3300005293 | Ga0065715_10215931 | Ga0065715_102159312 | 318 |
| 66 | 3300005327 | Ga0070658_10016650 | Ga0070658_100166503 | 318 |
| 67 | 3300005327 | Ga0070658_10146558 | Ga0070658_101465582 | 318 |
| 68 | 3300005327 | Ga0070658_10297209 | Ga0070658_102972092 | 318 |
| 69 | 3300005328 | Ga0070676_10009207 | Ga0070676_100092073 | 318 |
| 70 | 3300005331 | Ga0070670_100008746 | Ga0070670_1000087467 | 318 |
| 71 | 3300005334 | Ga0068869_100078582 | Ga0068869_1000785821 | 318 |
| 72 | 3300005338 | Ga0068868_100080400 | Ga0068868_1000804002 | 318 |
| 73 | 3300005338 | Ga0068868_100246410 | Ga0068868_1002464102 | 318 |
| 74 | 3300005339 | Ga0070660_100068544 | Ga0070660_1000685443 | 318 |
| 75 | 3300005339 | Ga0070660_100316268 | Ga0070660_1003162681 | 318 |
| 76 | 3300005344 | Ga0070661_100127160 | Ga0070661_1001271602 | 318 |
| 77 | 3300005353 | Ga0070669_100012475 | Ga0070669_1000124755 | 318 |
| 78 | 3300005354 | Ga0070675_100001224 | Ga0070675_10000122417 | 318 |
| 79 | 3300005355 | Ga0070671_100008129 | Ga0070671_1000081294 | 318 |
| 80 | 3300005355 | Ga0070671_100033147 | Ga0070671_1000331472 | 318 |
| 81 | 3300005356 | Ga0070674_100003681 | Ga0070674_1000036817 | 318 |
| 82 | 3300005356 | Ga0070674_100016440 | Ga0070674_1000164403 | 318 |
| 83 | 3300005364 | Ga0070673_100021463 | Ga0070673_1000214634 | 318 |
| 84 | 3300005364 | Ga0070673_100046063 | Ga0070673_1000460632 | 318 |
| 85 | 3300005364 | Ga0070673_100128158 | Ga0070673_1001281582 | 318 |
| 86 | 3300005364 | Ga0070673_100144417 | Ga0070673_1001444172 | 318 |
| 87 | 3300005364 | Ga0070673_100198799 | Ga0070673_1001987991 | 318 |
| 88 | 3300005366 | Ga0070659_100009750 | Ga0070659_1000097506 | 318 |
| 89 | 3300005366 | Ga0070659_100029139 | Ga0070659_1000291394 | 318 |
| 90 | 3300005367 | Ga0070667_100019486 | Ga0070667_1000194864 | 318 |
| 91 | 3300005445 | Ga0070708_100235573 | Ga0070708_1002355732 | 318 |
| 92 | 3300005455 | Ga0070663_100004048 | Ga0070663_1000040483 | 318 |
| 93 | 3300005455 | Ga0070663_100116301 | Ga0070663_1001163011 | 318 |
| 94 | 3300005456 | Ga0070678_100013613 | Ga0070678_1000136132 | 318 |
| 95 | 3300005456 | Ga0070678_100018511 | Ga0070678_1000185114 | 318 |
| 96 | 3300005456 | Ga0070678_100153837 | Ga0070678_1001538372 | 318 |
| 97 | 3300005457 | Ga0070662_100004835 | Ga0070662_1000048352 | 318 |
| 98 | 3300005457 | Ga0070662_100130333 | Ga0070662_1001303331 | 318 |
| 99 | 3300005459 | Ga0068867_100000076 | Ga0068867_10000007622 | 318 |
| 100 | 3300005459 | Ga0068867_100010405 | Ga0068867_1000104052 | 318 |
| 101 | 3300005459 | Ga0068867_100057073 | Ga0068867_1000570733 | 318 |
| 102 | 3300005467 | Ga0070706_100007656 | Ga0070706_1000076567 | 318 |
| 103 | 3300005468 | Ga0070707_100099250 | Ga0070707_1000992502 | 318 |
| 104 | 3300005535 | Ga0070684_100019383 | Ga0070684_1000193832 | 318 |
| 105 | 3300005539 | Ga0068853_100006320 | Ga0068853_1000063204 | 318 |
| 106 | 3300005539 | Ga0068853_100012996 | Ga0068853_1000129965 | 318 |
| 107 | 3300005543 | Ga0070672_100000121 | Ga0070672_10000012113 | 318 |
| 108 | 3300005543 | Ga0070672_100006701 | Ga0070672_1000067017 | 318 |
| 109 | 3300005545 | Ga0070695_100128804 | Ga0070695_1001288041 | 318 |
| 110 | 3300005548 | Ga0070665_100104125 | Ga0070665_1001041253 | 318 |
| 111 | 3300005564 | Ga0070664_100025828 | Ga0070664_1000258283 | 318 |
| 112 | 3300005564 | Ga0070664_100052164 | Ga0070664_1000521644 | 318 |
| 113 | 3300005614 | Ga0068856_100007820 | Ga0068856_1000078205 | 318 |
| 114 | 3300005616 | Ga0068852_100048531 | Ga0068852_1000485312 | 318 |
| 115 | 3300005616 | Ga0068852_100102441 | Ga0068852_1001024412 | 318 |
| 116 | 3300005616 | Ga0068852_100128372 | Ga0068852_1001283722 | 318 |
| 117 | 3300005616 | Ga0068852_100153040 | Ga0068852_1001530403 | 318 |
| 118 | 3300005617 | Ga0068859_100138766 | Ga0068859_1001387664 | 318 |
| 119 | 3300005618 | Ga0068864_100003215 | Ga0068864_1000032156 | 318 |
| 120 | 3300005618 | Ga0068864_100012983 | Ga0068864_1000129834 | 318 |
| 121 | 3300005618 | Ga0068864_100017103 | Ga0068864_1000171033 | 318 |
| 122 | 3300005841 | Ga0068863_100106689 | Ga0068863_1001066892 | 318 |
| 123 | 3300005841 | Ga0068863_100211302 | Ga0068863_1002113022 | 318 |
| 124 | 3300006038 | Ga0075365_10107573 | Ga0075365_101075732 | 318 |
| 125 | 3300006042 | Ga0075368_10015453 | Ga0075368_100154532 | 318 |
| 126 | 3300006048 | Ga0075363_100018085 | Ga0075363_1000180852 | 318 |
| 127 | 3300006051 | Ga0075364_10053083 | Ga0075364_100530831 | 318 |
| 128 | 3300006051 | Ga0075364_10069798 | Ga0075364_100697985 | 318 |
| 129 | 3300006178 | Ga0075367_10071027 | Ga0075367_100710272 | 318 |
| 130 | 3300006186 | Ga0075369_10011589 | Ga0075369_100115892 | 318 |
| 131 | 3300006195 | Ga0075366_10073654 | Ga0075366_100736542 | 318 |
| 132 | 3300006195 | Ga0075366_10111179 | Ga0075366_101111792 | 318 |
| 133 | 3300006195 | Ga0075366_10145124 | Ga0075366_101451242 | 318 |
| 134 | 3300006237 | Ga0097621_100013385 | Ga0097621_1000133853 | 318 |
| 135 | 3300006237 | Ga0097621_100015566 | Ga0097621_1000155665 | 318 |
| 136 | 3300006353 | Ga0075370_10000588 | Ga0075370_100005887 | 318 |
| 137 | 3300006353 | Ga0075370_10007627 | Ga0075370_100076272 | 318 |
| 138 | 3300006353 | Ga0075370_10015758 | Ga0075370_100157582 | 318 |
| 139 | 3300006353 | Ga0075370_10016857 | Ga0075370_100168572 | 318 |
| 140 | 3300006353 | Ga0075370_10026463 | Ga0075370_100264632 | 318 |
| 141 | 3300006353 | Ga0075370_10096251 | Ga0075370_100962512 | 318 |
| 142 | 3300006358 | Ga0068871_100023997 | Ga0068871_1000239972 | 318 |
| 143 | 3300006931 | Ga0097620_100138763 | Ga0097620_1001387634 | 318 |
| 144 | 3300006944 | Ga0099823_1000028 | Ga0099823_100002817 | 318 |
| 145 | 3300006946 | Ga0079104_1000233 | Ga0079104_100023330 | 318 |
| 146 | 3300009098 | Ga0105245_10136895 | Ga0105245_101368952 | 318 |
| 147 | 3300009098 | Ga0105245_10378274 | Ga0105245_103782742 | 318 |
| 148 | 3300009101 | Ga0105247_10148766 | Ga0105247_101487662 | 318 |
| 149 | 3300009147 | Ga0114129_10161325 | Ga0114129_101613252 | 318 |
| 150 | 3300009147 | Ga0114129_10600994 | Ga0114129_106009942 | 318 |
| 151 | 3300009148 | Ga0105243_10005306 | Ga0105243_100053067 | 318 |
| 152 | 3300009148 | Ga0105243_10038828 | Ga0105243_100388284 | 318 |
| 153 | 3300009176 | Ga0105242_10140587 | Ga0105242_101405872 | 318 |
| 154 | 3300009177 | Ga0105248_10003500 | Ga0105248_100035008 | 318 |
| 155 | 3300009177 | Ga0105248_10041720 | Ga0105248_100417203 | 318 |
| 156 | 3300009177 | Ga0105248_10262360 | Ga0105248_102623603 | 318 |
| 157 | 3300009545 | Ga0105237_10002827 | Ga0105237_100028272 | 318 |
| 158 | 3300009545 | Ga0105237_10051155 | Ga0105237_100511556 | 318 |
| 159 | 3300009551 | Ga0105238_10011759 | Ga0105238_100117594 | 318 |
| 160 | 3300009551 | Ga0105238_10121296 | Ga0105238_101212962 | 318 |
| 161 | 3300009551 | Ga0105238_10320999 | Ga0105238_103209992 | 318 |
| 162 | 3300010375 | Ga0105239_10003016 | Ga0105239_100030162 | 318 |
| 163 | 3300012497 | Ga0157319_1000018 | Ga0157319_10000185 | 318 |
| 164 | 3300013100 | Ga0157373_10093769 | Ga0157373_100937692 | 318 |
| 165 | 3300013102 | Ga0157371_10155259 | Ga0157371_101552592 | 318 |
| 166 | 3300013104 | Ga0157370_10293931 | Ga0157370_102939312 | 318 |
| 167 | 3300013105 | Ga0157369_10088888 | Ga0157369_100888882 | 318 |
| 168 | 3300013296 | Ga0157374_10025251 | Ga0157374_100252514 | 318 |
| 169 | 3300013296 | Ga0157374_10049943 | Ga0157374_100499434 | 318 |
| 170 | 3300013297 | Ga0157378_10376176 | Ga0157378_103761762 | 318 |
| 171 | 3300013306 | Ga0163162_10219859 | Ga0163162_102198592 | 318 |
| 172 | 3300013307 | Ga0157372_10084764 | Ga0157372_100847642 | 318 |
| 173 | 3300013307 | Ga0157372_10098850 | Ga0157372_100988504 | 318 |
| 174 | 3300013308 | Ga0157375_10105087 | Ga0157375_101050871 | 318 |
| 175 | 3300014326 | Ga0157380_10110771 | Ga0157380_101107712 | 318 |
| 176 | 3300014745 | Ga0157377_10000006 | Ga0157377_10000006149 | 318 |
| 177 | 3300014745 | Ga0157377_10017024 | Ga0157377_100170244 | 318 |
| 178 | 3300014968 | Ga0157379_10014570 | Ga0157379_100145704 | 318 |
| 179 | 3300014968 | Ga0157379_10055126 | Ga0157379_100551264 | 318 |
| 180 | 3300014968 | Ga0157379_10101584 | Ga0157379_101015841 | 318 |
| 181 | 3300014969 | Ga0157376_10002032 | Ga0157376_1000203213 | 318 |
| 182 | 3300014969 | Ga0157376_10016427 | Ga0157376_100164272 | 318 |
| 183 | 3300014969 | Ga0157376_10275772 | Ga0157376_102757722 | 318 |
| 184 | 3300017792 | Ga0163161_10011419 | Ga0163161_100114195 | 318 |
| 185 | 3300021361 | Ga0213872_10000299 | Ga0213872_1000029935 | 318 |
| 186 | 3300021361 | Ga0213872_10001215 | Ga0213872_1000121514 | 318 |
| 187 | 3300021361 | Ga0213872_10005774 | Ga0213872_100057743 | 318 |
| 188 | 3300021361 | Ga0213872_10011797 | Ga0213872_100117972 | 318 |
| 189 | 3300025230 | Ga0209563_100112 | Ga0209563_10011262 | 318 |
| 190 | 3300025242 | Ga0209258_106994 | Ga0209258_1069942 | 318 |
| 191 | 3300025256 | Ga0209759_1001653 | Ga0209759_10016533 | 318 |
| 192 | 3300025273 | Ga0209673_1002680 | Ga0209673_10026807 | 318 |
| 193 | 3300025295 | Ga0209564_1000131 | Ga0209564_1000131111 | 318 |
| 194 | 3300025297 | Ga0209758_1000367 | Ga0209758_100036710 | 318 |
| 195 | 3300025298 | Ga0209050_1000596 | Ga0209050_100059655 | 318 |
| 196 | 3300025298 | Ga0209050_1001057 | Ga0209050_100105729 | 318 |
| 197 | 3300025298 | Ga0209050_1002537 | Ga0209050_10025377 | 318 |
| 198 | 3300025299 | Ga0209256_1001842 | Ga0209256_10018426 | 318 |
| 199 | 3300025299 | Ga0209256_1001867 | Ga0209256_10018678 | 318 |
| 200 | 3300025303 | Ga0209051_1000148 | Ga0209051_100014896 | 318 |
| 201 | 3300025303 | Ga0209051_1001133 | Ga0209051_10011338 | 318 |
| 202 | 3300025303 | Ga0209051_1017641 | Ga0209051_10176412 | 318 |
| 203 | 3300025304 | Ga0209257_1000016 | Ga0209257_1000016332 | 318 |
| 204 | 3300025304 | Ga0209257_1000380 | Ga0209257_100038043 | 318 |
| 205 | 3300025304 | Ga0209257_1001173 | Ga0209257_100117315 | 318 |
| 206 | 3300025304 | Ga0209257_1001971 | Ga0209257_10019718 | 318 |
| 207 | 3300025304 | Ga0209257_1010980 | Ga0209257_10109802 | 318 |
| 208 | 3300025304 | Ga0209257_1011952 | Ga0209257_10119522 | 318 |
| 209 | 3300025321 | Ga0207656_10049367 | Ga0207656_100493672 | 318 |
| 210 | 3300025893 | Ga0207682_10008608 | Ga0207682_100086082 | 318 |
| 211 | 3300025893 | Ga0207682_10008799 | Ga0207682_100087992 | 318 |
| 212 | 3300025907 | Ga0207645_10188371 | Ga0207645_101883712 | 318 |
| 213 | 3300025909 | Ga0207705_10019028 | Ga0207705_100190283 | 318 |
| 214 | 3300025909 | Ga0207705_10130123 | Ga0207705_101301231 | 318 |
| 215 | 3300025910 | Ga0207684_10010783 | Ga0207684_100107834 | 318 |
| 216 | 3300025910 | Ga0207684_10017161 | Ga0207684_100171615 | 318 |
| 217 | 3300025913 | Ga0207695_10004581 | Ga0207695_1000458112 | 318 |
| 218 | 3300025914 | Ga0207671_10002906 | Ga0207671_100029062 | 318 |
| 219 | 3300025914 | Ga0207671_10113162 | Ga0207671_101131622 | 318 |
| 220 | 3300025919 | Ga0207657_10043449 | Ga0207657_100434491 | 318 |
| 221 | 3300025922 | Ga0207646_10021842 | Ga0207646_100218427 | 318 |
| 222 | 3300025924 | Ga0207694_10051392 | Ga0207694_100513922 | 318 |
| 223 | 3300025925 | Ga0207650_10000846 | Ga0207650_100008469 | 318 |
| 224 | 3300025925 | Ga0207650_10006005 | Ga0207650_100060056 | 318 |
| 225 | 3300025926 | Ga0207659_10057886 | Ga0207659_100578862 | 318 |
| 226 | 3300025926 | Ga0207659_10241261 | Ga0207659_102412611 | 318 |
| 227 | 3300025931 | Ga0207644_10006681 | Ga0207644_100066813 | 318 |
| 228 | 3300025931 | Ga0207644_10025283 | Ga0207644_100252833 | 318 |
| 229 | 3300025931 | Ga0207644_10053412 | Ga0207644_100534122 | 318 |
| 230 | 3300025931 | Ga0207644_10068055 | Ga0207644_100680552 | 318 |
| 231 | 3300025933 | Ga0207706_10014346 | Ga0207706_100143462 | 318 |
| 232 | 3300025935 | Ga0207709_10010741 | Ga0207709_100107414 | 318 |
| 233 | 3300025937 | Ga0207669_10015132 | Ga0207669_100151324 | 318 |
| 234 | 3300025937 | Ga0207669_10023946 | Ga0207669_100239464 | 318 |
| 235 | 3300025940 | Ga0207691_10000175 | Ga0207691_1000017531 | 318 |
| 236 | 3300025940 | Ga0207691_10014981 | Ga0207691_100149813 | 318 |
| 237 | 3300025941 | Ga0207711_10141991 | Ga0207711_101419912 | 318 |
| 238 | 3300025941 | Ga0207711_10257234 | Ga0207711_102572342 | 318 |
| 239 | 3300025944 | Ga0207661_10128142 | Ga0207661_101281422 | 318 |
| 240 | 3300025945 | Ga0207679_10030704 | Ga0207679_100307044 | 318 |
| 241 | 3300025960 | Ga0207651_10021398 | Ga0207651_100213983 | 318 |
| 242 | 3300025960 | Ga0207651_10039799 | Ga0207651_100397993 | 318 |
| 243 | 3300025960 | Ga0207651_10282087 | Ga0207651_102820872 | 318 |
| 244 | 3300025961 | Ga0207712_10210107 | Ga0207712_102101072 | 318 |
| 245 | 3300026023 | Ga0207677_10116070 | Ga0207677_101160702 | 318 |
| 246 | 3300026067 | Ga0207678_10000060 | Ga0207678_1000006055 | 318 |
| 247 | 3300026078 | Ga0207702_10252410 | Ga0207702_102524101 | 318 |
| 248 | 3300026088 | Ga0207641_10027119 | Ga0207641_100271192 | 318 |
| 249 | 3300026088 | Ga0207641_10186108 | Ga0207641_101861082 | 318 |
| 250 | 3300026089 | Ga0207648_10000023 | Ga0207648_1000002310 | 318 |
| 251 | 3300026089 | Ga0207648_10005713 | Ga0207648_100057136 | 318 |
| 252 | 3300026095 | Ga0207676_10005256 | Ga0207676_100052567 | 318 |
| 253 | 3300026095 | Ga0207676_10084458 | Ga0207676_100844583 | 318 |
| 254 | 3300026095 | Ga0207676_10119767 | Ga0207676_101197672 | 318 |
| 255 | 3300026095 | Ga0207676_10466973 | Ga0207676_104669732 | 318 |
| 256 | 3300026116 | Ga0207674_10288182 | Ga0207674_102881822 | 318 |
| 257 | 3300026121 | Ga0207683_10002654 | Ga0207683_100026549 | 318 |
| 258 | 3300026121 | Ga0207683_10033501 | Ga0207683_100335015 | 318 |
| 259 | 3300026121 | Ga0207683_10050124 | Ga0207683_100501243 | 318 |
| 260 | 3300026142 | Ga0207698_10106664 | Ga0207698_101066641 | 318 |
| 261 | 3300026142 | Ga0207698_10162162 | Ga0207698_101621622 | 318 |
| 262 | 3300026142 | Ga0207698_10186360 | Ga0207698_101863602 | 318 |
| 263 | 3300027111 | Ga0209281_1000076 | Ga0209281_1000076231 | 318 |
| 264 | 3300027296 | Ga0209389_1007702 | Ga0209389_10077023 | 318 |
| 265 | 3300027378 | Ga0209981_1007750 | Ga0209981_10077501 | 318 |
| 266 | 3300027526 | Ga0209968_1005124 | Ga0209968_10051242 | 318 |
| 267 | 3300027695 | Ga0209966_1000360 | Ga0209966_10003606 | 318 |
| 268 | 3300028379 | Ga0268266_10028922 | Ga0268266_100289224 | 318 |
| 269 | 3300028379 | Ga0268266_10181860 | Ga0268266_101818602 | 318 |
| 270 | 3300028794 | Ga0307515_10000109 | Ga0307515_10000109150 | 318 |
| 271 | 3300028794 | Ga0307515_10004774 | Ga0307515_1000477411 | 318 |
| 272 | 3300028794 | Ga0307515_10024496 | Ga0307515_100244965 | 318 |
| 273 | 3300028794 | Ga0307515_10122066 | Ga0307515_101220665 | 318 |
| 274 | 3300031250 | Ga0265331_10007011 | Ga0265331_100070116 | 318 |
| 275 | 3300031251 | Ga0265327_10000149 | Ga0265327_1000014985 | 318 |
| 276 | 3300031251 | Ga0265327_10002079 | Ga0265327_100020795 | 318 |
| 277 | 3300031251 | Ga0265327_10008910 | Ga0265327_100089106 | 318 |
| 278 | 3300031251 | Ga0265327_10100592 | Ga0265327_101005921 | 318 |
| 279 | 3300031344 | Ga0265316_10001831 | Ga0265316_1000183114 | 318 |
| 280 | 3300031456 | Ga0307513_10006129 | Ga0307513_100061296 | 318 |
| 281 | 3300031548 | Ga0307408_100000006 | Ga0307408_100000006310 | 318 |
| 282 | 3300031548 | Ga0307408_100022760 | Ga0307408_1000227602 | 318 |
| 283 | 3300031616 | Ga0307508_10000237 | Ga0307508_1000023713 | 318 |
| 284 | 3300031649 | Ga0307514_10000200 | Ga0307514_1000020018 | 318 |
| 285 | 3300031730 | Ga0307516_10000476 | Ga0307516_1000047629 | 318 |
| 286 | 3300031730 | Ga0307516_10004137 | Ga0307516_100041379 | 318 |
| 287 | 3300031731 | Ga0307405_10005429 | Ga0307405_100054293 | 318 |
| 288 | 3300031824 | Ga0307413_10007240 | Ga0307413_100072406 | 318 |
| 289 | 3300031911 | Ga0307412_10313904 | Ga0307412_103139042 | 318 |
| 290 | 3300031995 | Ga0307409_100283352 | Ga0307409_1002833522 | 318 |
| 291 | 3300032002 | Ga0307416_100065620 | Ga0307416_1000656202 | 318 |
| 292 | 3300032002 | Ga0307416_100564011 | Ga0307416_1005640112 | 318 |
| 293 | 3300032002 | Ga0307416_100613769 | Ga0307416_1006137691 | 318 |
| 294 | 3300032005 | Ga0307411_10001828 | Ga0307411_100018286 | 318 |
| 295 | 3300032005 | Ga0307411_10023364 | Ga0307411_100233642 | 318 |
| 296 | 3300032005 | Ga0307411_10135527 | Ga0307411_101355272 | 318 |
| 297 | 3300033180 | Ga0307510_10225780 | Ga0307510_102257802 | 318 |
| 298 | 3300035089 | Ga0373944_0021853 | Ga0373944_0021853_116_1096 | 318 |
| 299 | 3300035090 | Ga0373949_0036540 | Ga0373949_0036540_172_1155 | 318 |
| 300 | 3300035114 | Ga0373939_0078301 | Ga0373939_0078301_95_1075 | 318 |
| 301 | 3300035691 | Ga0373931_0008388 | Ga0373931_0008388_495_1478 | 318 |
| 302 | 3300035691 | Ga0373931_0143868 | Ga0373931_0143868_333_1316 | 318 |
| 303 | 3300037471 | Ga0395905_0000642 | Ga0395905_0000642_24304_25287 | 318 |
| 304 | 3300037471 | Ga0395905_0332159 | Ga0395905_0332159_257_1240 | 318 |
| 305 | 3300039447 | Ga0436361_0041271 | Ga0436361_0041271_7253_8233 | 318 |
| 306 | 3300039447 | Ga0436361_0313405 | Ga0436361_0313405_48456_49436 | 318 |
| 307 | 3300039447 | Ga0436361_0427460 | Ga0436361_0427460_49877_50857 | 318 |
| 308 | 3300039447 | Ga0436361_0587522 | Ga0436361_0587522_113_1093 | 318 |
| 309 | 3300039447 | Ga0436361_0813019 | Ga0436361_0813019_107_1087 | 318 |
| 310 | 3300039447 | Ga0436361_0919876 | Ga0436361_0919876_37349_38338 | 318 |
| 311 | 3300039447 | Ga0436361_1046311 | Ga0436361_1046311_1677_2657 | 318 |
| 312 | 3300041441 | Ga0451787_337636 | Ga0451787_337636_297_1277 | 318 |
| 313 | 3300041512 | Ga0451853_3266585 | Ga0451853_3266585_197_1177 | 318 |
| 314 | 3300041997 | Ga0439431_0020814 | Ga0439431_0020814_204_1187 | 318 |
| 315 | 3300042120 | Ga0450917_000104 | Ga0450917_000104_3285_4268 | 318 |
| 316 | 3300042126 | Ga0450888_000032 | Ga0450888_000032_1068_2051 | 318 |
| 317 | 3300042127 | Ga0450890_001624 | Ga0450890_001624_2165_3148 | 318 |
| 318 | 3300042127 | Ga0450890_002449 | Ga0450890_002449_1540_2520 | 318 |
| 319 | 3300042435 | Ga0439434_0039862 | Ga0439434_0039862_33_1016 | 318 |
| 320 | 3300042438 | Ga0439459_0001155 | Ga0439459_0001155_2287_3267 | 318 |
| 321 | 3300042876 | Ga0451577_0005058 | Ga0451577_0005058_8171_9151 | 318 |
| 322 | 3300042876 | Ga0451577_0008299 | Ga0451577_0008299_7261_8241 | 318 |
| 323 | 3300044656 | Ga0466969_0000123 | Ga0466969_0000123_13780_14760 | 318 |
| 324 | 3300044656 | Ga0466969_0011706 | Ga0466969_0011706_1006_1986 | 318 |
| 325 | 3300044656 | Ga0466969_0053525 | Ga0466969_0053525_165_1145 | 318 |
| 326 | 3300044683 | Ga0466965_0014529 | Ga0466965_0014529_49_1029 | 318 |
| 327 | 3300044684 | Ga0466966_0001180 | Ga0466966_0001180_9697_10677 | 318 |
| 328 | 3300044684 | Ga0466966_0016277 | Ga0466966_0016277_1757_2737 | 318 |
| 329 | 3300044693 | Ga0466961_0002198 | Ga0466961_0002198_162_1142 | 318 |
| 330 | 3300044694 | Ga0466963_0024519 | Ga0466963_0024519_1114_2094 | 318 |
| 331 | 3300044694 | Ga0466963_0071821 | Ga0466963_0071821_1064_2044 | 318 |
| 332 | 3300044706 | Ga0466964_0023294 | Ga0466964_0023294_1242_2222 | 318 |
| 333 | 3300044712 | Ga0453684_0019353 | Ga0453684_0019353_1666_2646 | 318 |
| 334 | 3300044712 | Ga0453684_0210842 | Ga0453684_0210842_333_1313 | 318 |
| 335 | 3300044712 | Ga0453684_0235626 | Ga0453684_0235626_905_1891 | 318 |
| 336 | 3300044712 | Ga0453684_0384656 | Ga0453684_0384656_431_1411 | 318 |
| 337 | 3300044719 | Ga0466971_0011365 | Ga0466971_0011365_2432_3412 | 318 |
| 338 | 3300044719 | Ga0466971_0017330 | Ga0466971_0017330_1705_2685 | 318 |
| 339 | 3300044765 | Ga0466970_0003580 | Ga0466970_0003580_3077_4057 | 318 |
| 340 | 3300044765 | Ga0466970_0021220 | Ga0466970_0021220_2120_3100 | 318 |
| 341 | 3300044842 | Ga0466957_0003922 | Ga0466957_0003922_3808_4788 | 318 |
| 342 | 3300045049 | Ga0466959_0000054 | Ga0466959_0000054_30893_31873 | 318 |
| 343 | 3300045049 | Ga0466959_0076780 | Ga0466959_0076780_879_1859 | 318 |
| 344 | 3300045051 | Ga0451576_0123825 | Ga0451576_0123825_976_1956 | 318 |
| 345 | 3300045051 | Ga0451576_0589834 | Ga0451576_0589834_116_1096 | 318 |
| 346 | 3300046457 | Ga0495590_0014854 | Ga0495590_0014854_1546_2529 | 318 |
| 347 | 3300046475 | Ga0495639_0140454 | Ga0495639_0140454_57_1037 | 318 |
| 348 | 3300046492 | Ga0495585_0031454 | Ga0495585_0031454_1359_2342 | 318 |
| 349 | 3300046519 | Ga0495632_0055816 | Ga0495632_0055816_403_1386 | 318 |
| 350 | 3300046519 | Ga0495632_0073119 | Ga0495632_0073119_653_1633 | 318 |
| 351 | 3300046535 | Ga0495586_0097404 | Ga0495586_0097404_103_1083 | 318 |
| 352 | 3300046539 | Ga0495621_0009828 | Ga0495621_0009828_1493_2485 | 318 |
| 353 | 3300046542 | Ga0495597_0011120 | Ga0495597_0011120_2700_3683 | 318 |
| 354 | 3300046543 | Ga0495645_0033343 | Ga0495645_0033343_2289_3269 | 318 |
| 355 | 3300046543 | Ga0495645_0236527 | Ga0495645_0236527_138_1118 | 318 |
| 356 | 3300046660 | Ga0495625_0032909 | Ga0495625_0032909_1301_2281 | 318 |
| 357 | 3300046675 | Ga0495657_0197629 | Ga0495657_0197629_230_1210 | 318 |
| 358 | 3300046689 | Ga0495613_0111604 | Ga0495613_0111604_115_1095 | 318 |
| 359 | 3300046691 | Ga0495670_0087790 | Ga0495670_0087790_326_1318 | 318 |
| 360 | 3300046694 | Ga0495649_0006739 | Ga0495649_0006739_4654_5637 | 318 |
| 361 | 3300047443 | Ga0495687_000863 | Ga0495687_000863_26292_27275 | 318 |
| 362 | 3300047444 | Ga0495675_0138740 | Ga0495675_0138740_287_1267 | 318 |
| 363 | 3300047471 | Ga0495684_0102509 | Ga0495684_0102509_731_1711 | 318 |
| 364 | 3300048091 | Ga0495626_0067502 | Ga0495626_0067502_370_1353 | 318 |
| 365 | 3300048905 | Ga0496102_0352409 | Ga0496102_0352409_190_1182 | 318 |
| 366 | 3300048907 | Ga0496104_0044281 | Ga0496104_0044281_119_1102 | 318 |
| 367 | 3300048911 | Ga0496108_0137943 | Ga0496108_0137943_162_1154 | 318 |
| 368 | 3300048911 | Ga0496108_0149187 | Ga0496108_0149187_136_1119 | 318 |
| 369 | 3300048912 | Ga0496109_0205998 | Ga0496109_0205998_308_1291 | 318 |
| 370 | 3300048913 | Ga0496110_0219614 | Ga0496110_0219614_185_1177 | 318 |
| 371 | 3300048918 | Ga0496115_0072150 | Ga0496115_0072150_1307_2290 | 318 |
| 372 | 3300048927 | Ga0496124_0053200 | Ga0496124_0053200_1045_2025 | 318 |
| 373 | 3300049514 | Ga0501291_013785 | Ga0501291_013785_173_1156 | 318 |
| 374 | 3300049523 | Ga0501300_002056 | Ga0501300_002056_1420_2403 | 318 |
| 375 | 3300049571 | Ga0501034_0015916 | Ga0501034_0015916_5961_6938 | 318 |
| 376 | 3300049579 | Ga0501043_0000018 | Ga0501043_0000018_65907_66887 | 318 |
| 377 | 3300049580 | Ga0501046_0000042 | Ga0501046_0000042_65907_66887 | 318 |
| 378 | 3300049581 | Ga0501047_0000052 | Ga0501047_0000052_86562_87542 | 318 |
| 379 | 3300049582 | Ga0501048_0010225 | Ga0501048_0010225_169_1149 | 318 |
| 380 | 3300049649 | Ga0501198_000042 | Ga0501198_000042_34244_35224 | 318 |
| 381 | 3300049651 | Ga0501201_002787 | Ga0501201_002787_499_1482 | 318 |
| 382 | 3300049653 | Ga0501206_002112 | Ga0501206_002112_941_1921 | 318 |
| 383 | 3300049653 | Ga0501206_006650 | Ga0501206_006650_188_1171 | 318 |
| 384 | 3300049658 | Ga0501211_003040 | Ga0501211_003040_511_1494 | 318 |
| 385 | 3300049662 | Ga0501222_000016 | Ga0501222_000016_12168_13148 | 318 |
| 386 | 3300049662 | Ga0501222_002427 | Ga0501222_002427_808_1791 | 318 |
| 387 | 3300049663 | Ga0501223_005309 | Ga0501223_005309_925_1908 | 318 |
| 388 | 3300049669 | Ga0501235_009142 | Ga0501235_009142_572_1555 | 318 |
| 389 | 3300049679 | Ga0501249_012855 | Ga0501249_012855_312_1295 | 318 |
| 390 | 3300049684 | Ga0501255_003581 | Ga0501255_003581_307_1290 | 318 |
| 391 | 3300049704 | Ga0501221_002963 | Ga0501221_002963_75_1058 | 318 |
| 392 | 3300049757 | Ga0501232_006067 | Ga0501232_006067_97_1080 | 318 |
| 393 | 3300049762 | Ga0501265_005461 | Ga0501265_005461_124_1107 | 318 |
| 394 | 3300049764 | Ga0501267_000881 | Ga0501267_000881_1071_2054 | 318 |
| 395 | 3300049766 | Ga0501269_003052 | Ga0501269_003052_948_1931 | 318 |
| 396 | 3300049824 | Ga0501045_0006468 | Ga0501045_0006468_5768_6748 | 318 |
| 397 | 3300050489 | nmdc:mga03683_12266_c1 | nmdc:mga03683_12266_c1_1373_2356 | 318 |
| 398 | 3300050491 | nmdc:mga00v17_201376_c1 | nmdc:mga00v17_201376_c1_156_1139 | 318 |
| 399 | 3300050493 | nmdc:mga0k408_135126_c1 | nmdc:mga0k408_135126_c1_292_1275 | 318 |
| 400 | 3300050493 | nmdc:mga0k408_20982_c1 | nmdc:mga0k408_20982_c1_773_1756 | 318 |
| 401 | 3300050493 | nmdc:mga0k408_47063_c1 | nmdc:mga0k408_47063_c1_888_1868 | 318 |
| 402 | 3300050493 | nmdc:mga0k408_5366_c1 | nmdc:mga0k408_5366_c1_1283_2266 | 318 |
| 403 | 3300050494 | nmdc:mga06z11_90412_c1 | nmdc:mga06z11_90412_c1_10_993 | 318 |
| 404 | 3300050496 | nmdc:mga07m45_121459_c1 | nmdc:mga07m45_121459_c1_435_1418 | 318 |
| 405 | 3300050496 | nmdc:mga07m45_151709_c1 | nmdc:mga07m45_151709_c1_135_1118 | 318 |
| 406 | 3300050496 | nmdc:mga07m45_26147_c1 | nmdc:mga07m45_26147_c1_546_1526 | 318 |
| 407 | 3300050496 | nmdc:mga07m45_39198_c1 | nmdc:mga07m45_39198_c1_1362_2342 | 318 |
| 408 | 3300050496 | nmdc:mga07m45_40957_c1 | nmdc:mga07m45_40957_c1_1509_2492 | 318 |
| 409 | 3300050496 | nmdc:mga07m45_470_c1 | nmdc:mga07m45_470_c1_11626_12609 | 318 |
| 410 | 3300050496 | nmdc:mga07m45_51695_c1 | nmdc:mga07m45_51695_c1_648_1631 | 318 |
| 411 | 3300050496 | nmdc:mga07m45_771_c1 | nmdc:mga07m45_771_c1_6263_7243 | 318 |
| 412 | 3300050507 | nmdc:mga05p37_27957_c1 | nmdc:mga05p37_27957_c1_783_1766 | 318 |
| 413 | 3300050516 | nmdc:mga0sz30_42922_c1 | nmdc:mga0sz30_42922_c1_834_1817 | 318 |
| 414 | 3300053080 | Ga0500635_0000018 | Ga0500635_0000018_94369_95352 | 318 |
| 415 | 3300053085 | Ga0495619_0032076 | Ga0495619_0032076_1221_2201 | 318 |
| 416 | 3300053086 | Ga0500578_0015993 | Ga0500578_0015993_3212_4192 | 318 |
| 417 | 3300053134 | Ga0500658_0022649 | Ga0500658_0022649_118_1098 | 318 |
| 418 | 3300053153 | Ga0500616_0000820 | Ga0500616_0000820_14116_15078 | 318 |
| 419 | 3300053156 | Ga0500622_0005578 | Ga0500622_0005578_6432_7424 | 318 |
| 420 | 3300053730 | Ga0500645_043393 | Ga0500645_043393_207_1187 | 318 |
| 421 | 3300059421 | Ga0590071_006731 | Ga0590071_006731_129_1118 | 318 |
| 422 | 3300005293 | Ga0065715_10021485 | Ga0065715_100214852 | 319 |
| 423 | 3300005327 | Ga0070658_10004627 | Ga0070658_100046272 | 319 |
| 424 | 3300005327 | Ga0070658_10028225 | Ga0070658_100282253 | 319 |
| 425 | 3300005327 | Ga0070658_10252075 | Ga0070658_102520752 | 319 |
| 426 | 3300005327 | Ga0070658_10325533 | Ga0070658_103255332 | 319 |
| 427 | 3300005329 | Ga0070683_100006919 | Ga0070683_10000691910 | 319 |
| 428 | 3300005329 | Ga0070683_100015781 | Ga0070683_1000157813 | 319 |
| 429 | 3300005329 | Ga0070683_100032256 | Ga0070683_1000322563 | 319 |
| 430 | 3300005331 | Ga0070670_100032189 | Ga0070670_1000321892 | 319 |
| 431 | 3300005334 | Ga0068869_100234090 | Ga0068869_1002340901 | 319 |
| 432 | 3300005335 | Ga0070666_10070705 | Ga0070666_100707051 | 319 |
| 433 | 3300005335 | Ga0070666_10340621 | Ga0070666_103406211 | 319 |
| 434 | 3300005336 | Ga0070680_100082259 | Ga0070680_1000822592 | 319 |
| 435 | 3300005338 | Ga0068868_100177232 | Ga0068868_1001772322 | 319 |
| 436 | 3300005339 | Ga0070660_100003196 | Ga0070660_1000031966 | 319 |
| 437 | 3300005339 | Ga0070660_100038166 | Ga0070660_1000381662 | 319 |
| 438 | 3300005339 | Ga0070660_100160746 | Ga0070660_1001607462 | 319 |
| 439 | 3300005339 | Ga0070660_100253827 | Ga0070660_1002538271 | 319 |
| 440 | 3300005340 | Ga0070689_100003000 | Ga0070689_1000030002 | 319 |
| 441 | 3300005340 | Ga0070689_100079246 | Ga0070689_1000792462 | 319 |
| 442 | 3300005343 | Ga0070687_100042290 | Ga0070687_1000422902 | 319 |
| 443 | 3300005344 | Ga0070661_100002858 | Ga0070661_1000028585 | 319 |
| 444 | 3300005344 | Ga0070661_100013147 | Ga0070661_1000131472 | 319 |
| 445 | 3300005344 | Ga0070661_100103772 | Ga0070661_1001037722 | 319 |
| 446 | 3300005344 | Ga0070661_100198627 | Ga0070661_1001986271 | 319 |
| 447 | 3300005345 | Ga0070692_10049852 | Ga0070692_100498522 | 319 |
| 448 | 3300005347 | Ga0070668_100107682 | Ga0070668_1001076821 | 319 |
| 449 | 3300005355 | Ga0070671_100010339 | Ga0070671_1000103392 | 319 |
| 450 | 3300005356 | Ga0070674_100002429 | Ga0070674_10000242910 | 319 |
| 451 | 3300005356 | Ga0070674_100014235 | Ga0070674_1000142355 | 319 |
| 452 | 3300005364 | Ga0070673_100070687 | Ga0070673_1000706873 | 319 |
| 453 | 3300005365 | Ga0070688_100001354 | Ga0070688_10000135413 | 319 |
| 454 | 3300005366 | Ga0070659_100014617 | Ga0070659_1000146172 | 319 |
| 455 | 3300005366 | Ga0070659_100021722 | Ga0070659_1000217223 | 319 |
| 456 | 3300005367 | Ga0070667_100119394 | Ga0070667_1001193941 | 319 |
| 457 | 3300005367 | Ga0070667_100172614 | Ga0070667_1001726141 | 319 |
| 458 | 3300005434 | Ga0070709_10016041 | Ga0070709_100160412 | 319 |
| 459 | 3300005434 | Ga0070709_10048878 | Ga0070709_100488782 | 319 |
| 460 | 3300005435 | Ga0070714_100004236 | Ga0070714_1000042362 | 319 |
| 461 | 3300005435 | Ga0070714_100085883 | Ga0070714_1000858833 | 319 |
| 462 | 3300005435 | Ga0070714_100126120 | Ga0070714_1001261202 | 319 |
| 463 | 3300005436 | Ga0070713_100056141 | Ga0070713_1000561412 | 319 |
| 464 | 3300005437 | Ga0070710_10010524 | Ga0070710_100105242 | 319 |
| 465 | 3300005439 | Ga0070711_100002733 | Ga0070711_1000027337 | 319 |
| 466 | 3300005439 | Ga0070711_100050733 | Ga0070711_1000507332 | 319 |
| 467 | 3300005439 | Ga0070711_100089823 | Ga0070711_1000898232 | 319 |
| 468 | 3300005445 | Ga0070708_100033437 | Ga0070708_1000334373 | 319 |
| 469 | 3300005455 | Ga0070663_100006933 | Ga0070663_1000069336 | 319 |
| 470 | 3300005455 | Ga0070663_100233320 | Ga0070663_1002333202 | 319 |
| 471 | 3300005456 | Ga0070678_100001716 | Ga0070678_10000171612 | 319 |
| 472 | 3300005458 | Ga0070681_10112882 | Ga0070681_101128822 | 319 |
| 473 | 3300005458 | Ga0070681_10324597 | Ga0070681_103245972 | 319 |
| 474 | 3300005459 | Ga0068867_100063871 | Ga0068867_1000638712 | 319 |
| 475 | 3300005466 | Ga0070685_10001322 | Ga0070685_100013228 | 319 |
| 476 | 3300005467 | Ga0070706_100032233 | Ga0070706_1000322333 | 319 |
| 477 | 3300005467 | Ga0070706_100102357 | Ga0070706_1001023572 | 319 |
| 478 | 3300005468 | Ga0070707_100155510 | Ga0070707_1001555101 | 319 |
| 479 | 3300005468 | Ga0070707_100221463 | Ga0070707_1002214632 | 319 |
| 480 | 3300005471 | Ga0070698_100091533 | Ga0070698_1000915333 | 319 |
| 481 | 3300005518 | Ga0070699_100004993 | Ga0070699_1000049937 | 319 |
| 482 | 3300005518 | Ga0070699_100024281 | Ga0070699_1000242815 | 319 |
| 483 | 3300005518 | Ga0070699_100084335 | Ga0070699_1000843353 | 319 |
| 484 | 3300005518 | Ga0070699_100162481 | Ga0070699_1001624812 | 319 |
| 485 | 3300005530 | Ga0070679_100058921 | Ga0070679_1000589212 | 319 |
| 486 | 3300005530 | Ga0070679_100091089 | Ga0070679_1000910893 | 319 |
| 487 | 3300005530 | Ga0070679_100124627 | Ga0070679_1001246272 | 319 |
| 488 | 3300005535 | Ga0070684_100007308 | Ga0070684_1000073086 | 319 |
| 489 | 3300005535 | Ga0070684_100034421 | Ga0070684_1000344212 | 319 |
| 490 | 3300005536 | Ga0070697_100255099 | Ga0070697_1002550992 | 319 |
| 491 | 3300005539 | Ga0068853_100017300 | Ga0068853_1000173005 | 319 |
| 492 | 3300005539 | Ga0068853_100278580 | Ga0068853_1002785802 | 319 |
| 493 | 3300005543 | Ga0070672_100044854 | Ga0070672_1000448542 | 319 |
| 494 | 3300005543 | Ga0070672_100135358 | Ga0070672_1001353582 | 319 |
| 495 | 3300005545 | Ga0070695_100061764 | Ga0070695_1000617642 | 319 |
| 496 | 3300005546 | Ga0070696_100017248 | Ga0070696_1000172485 | 319 |
| 497 | 3300005546 | Ga0070696_100038720 | Ga0070696_1000387202 | 319 |
| 498 | 3300005546 | Ga0070696_100118507 | Ga0070696_1001185072 | 319 |
| 499 | 3300005547 | Ga0070693_100001243 | Ga0070693_1000012438 | 319 |
| 500 | 3300005548 | Ga0070665_100002011 | Ga0070665_10000201123 | 319 |
| 501 | 3300005548 | Ga0070665_100112883 | Ga0070665_1001128833 | 319 |
| 502 | 3300005549 | Ga0070704_100012540 | Ga0070704_1000125405 | 319 |
| 503 | 3300005563 | Ga0068855_100015192 | Ga0068855_1000151926 | 319 |
| 504 | 3300005563 | Ga0068855_100030735 | Ga0068855_1000307357 | 319 |
| 505 | 3300005563 | Ga0068855_100214938 | Ga0068855_1002149382 | 319 |
| 506 | 3300005564 | Ga0070664_100000225 | Ga0070664_10000022539 | 319 |
| 507 | 3300005564 | Ga0070664_100042812 | Ga0070664_1000428122 | 319 |
| 508 | 3300005564 | Ga0070664_100183684 | Ga0070664_1001836842 | 319 |
| 509 | 3300005577 | Ga0068857_100046513 | Ga0068857_1000465134 | 319 |
| 510 | 3300005578 | Ga0068854_100001711 | Ga0068854_1000017116 | 319 |
| 511 | 3300005578 | Ga0068854_100002211 | Ga0068854_1000022119 | 319 |
| 512 | 3300005614 | Ga0068856_100007412 | Ga0068856_1000074123 | 319 |
| 513 | 3300005614 | Ga0068856_100010154 | Ga0068856_1000101547 | 319 |
| 514 | 3300005614 | Ga0068856_100018411 | Ga0068856_1000184114 | 319 |
| 515 | 3300005614 | Ga0068856_100024027 | Ga0068856_1000240272 | 319 |
| 516 | 3300005614 | Ga0068856_100631791 | Ga0068856_1006317911 | 319 |
| 517 | 3300005616 | Ga0068852_100059604 | Ga0068852_1000596044 | 319 |
| 518 | 3300005616 | Ga0068852_100087899 | Ga0068852_1000878992 | 319 |
| 519 | 3300005616 | Ga0068852_100144730 | Ga0068852_1001447302 | 319 |
| 520 | 3300005617 | Ga0068859_100008179 | Ga0068859_1000081794 | 319 |
| 521 | 3300005618 | Ga0068864_100003021 | Ga0068864_1000030214 | 319 |
| 522 | 3300005618 | Ga0068864_100012967 | Ga0068864_1000129673 | 319 |
| 523 | 3300005718 | Ga0068866_10003042 | Ga0068866_100030427 | 319 |
| 524 | 3300005719 | Ga0068861_100252661 | Ga0068861_1002526612 | 319 |
| 525 | 3300005834 | Ga0068851_10001952 | Ga0068851_100019522 | 319 |
| 526 | 3300005834 | Ga0068851_10005110 | Ga0068851_100051103 | 319 |
| 527 | 3300005840 | Ga0068870_10004649 | Ga0068870_100046493 | 319 |
| 528 | 3300005841 | Ga0068863_100078939 | Ga0068863_1000789393 | 319 |
| 529 | 3300005841 | Ga0068863_100265844 | Ga0068863_1002658442 | 319 |
| 530 | 3300005841 | Ga0068863_100359834 | Ga0068863_1003598342 | 319 |
| 531 | 3300005842 | Ga0068858_100001809 | Ga0068858_10000180922 | 319 |
| 532 | 3300005842 | Ga0068858_100014246 | Ga0068858_1000142466 | 319 |
| 533 | 3300005843 | Ga0068860_100036536 | Ga0068860_1000365362 | 319 |
| 534 | 3300005843 | Ga0068860_100225374 | Ga0068860_1002253741 | 319 |
| 535 | 3300005844 | Ga0068862_100036091 | Ga0068862_1000360912 | 319 |
| 536 | 3300005844 | Ga0068862_100501604 | Ga0068862_1005016041 | 319 |
| 537 | 3300006173 | Ga0070716_100011574 | Ga0070716_1000115742 | 319 |
| 538 | 3300006237 | Ga0097621_100363334 | Ga0097621_1003633342 | 319 |
| 539 | 3300006358 | Ga0068871_100503920 | Ga0068871_1005039202 | 319 |
| 540 | 3300006847 | Ga0075431_100125652 | Ga0075431_1001256523 | 319 |
| 541 | 3300006852 | Ga0075433_10051025 | Ga0075433_100510252 | 319 |
| 542 | 3300006871 | Ga0075434_100005141 | Ga0075434_10000514111 | 319 |
| 543 | 3300006871 | Ga0075434_100316150 | Ga0075434_1003161501 | 319 |
| 544 | 3300006880 | Ga0075429_100012528 | Ga0075429_1000125281 | 319 |
| 545 | 3300006881 | Ga0068865_100002377 | Ga0068865_1000023773 | 319 |
| 546 | 3300006914 | Ga0075436_100000450 | Ga0075436_10000045021 | 319 |
| 547 | 3300006914 | Ga0075436_100040453 | Ga0075436_1000404532 | 319 |
| 548 | 3300006914 | Ga0075436_100049197 | Ga0075436_1000491972 | 319 |
| 549 | 3300006914 | Ga0075436_100097161 | Ga0075436_1000971612 | 319 |
| 550 | 3300006931 | Ga0097620_100008179 | Ga0097620_1000081798 | 319 |
| 551 | 3300007076 | Ga0075435_100015802 | Ga0075435_1000158024 | 319 |
| 552 | 3300009093 | Ga0105240_10008957 | Ga0105240_100089575 | 319 |
| 553 | 3300009093 | Ga0105240_10024631 | Ga0105240_100246318 | 319 |
| 554 | 3300009093 | Ga0105240_10046164 | Ga0105240_100461642 | 319 |
| 555 | 3300009098 | Ga0105245_10023867 | Ga0105245_100238676 | 319 |
| 556 | 3300009098 | Ga0105245_10132843 | Ga0105245_101328432 | 319 |
| 557 | 3300009098 | Ga0105245_10332858 | Ga0105245_103328582 | 319 |
| 558 | 3300009101 | Ga0105247_10028923 | Ga0105247_100289232 | 319 |
| 559 | 3300009147 | Ga0114129_10294619 | Ga0114129_102946192 | 319 |
| 560 | 3300009148 | Ga0105243_10272335 | Ga0105243_102723352 | 319 |
| 561 | 3300009174 | Ga0105241_10001246 | Ga0105241_1000124615 | 319 |
| 562 | 3300009174 | Ga0105241_10018060 | Ga0105241_100180604 | 319 |
| 563 | 3300009174 | Ga0105241_10431362 | Ga0105241_104313621 | 319 |
| 564 | 3300009176 | Ga0105242_10099391 | Ga0105242_100993913 | 319 |
| 565 | 3300009176 | Ga0105242_10374105 | Ga0105242_103741052 | 319 |
| 566 | 3300009177 | Ga0105248_10103598 | Ga0105248_101035982 | 319 |
| 567 | 3300009177 | Ga0105248_10197642 | Ga0105248_101976422 | 319 |
| 568 | 3300009545 | Ga0105237_10036249 | Ga0105237_100362496 | 319 |
| 569 | 3300009551 | Ga0105238_10000931 | Ga0105238_1000093110 | 319 |
| 570 | 3300009551 | Ga0105238_10021461 | Ga0105238_100214612 | 319 |
| 571 | 3300009551 | Ga0105238_10317688 | Ga0105238_103176882 | 319 |
| 572 | 3300009551 | Ga0105238_10344764 | Ga0105238_103447642 | 319 |
| 573 | 3300009553 | Ga0105249_10231327 | Ga0105249_102313272 | 319 |
| 574 | 3300010375 | Ga0105239_10047674 | Ga0105239_100476742 | 319 |
| 575 | 3300010375 | Ga0105239_10168187 | Ga0105239_101681872 | 319 |
| 576 | 3300010375 | Ga0105239_10738454 | Ga0105239_107384541 | 319 |
| 577 | 3300011119 | Ga0105246_10107836 | Ga0105246_101078362 | 319 |
| 578 | 3300013100 | Ga0157373_10001504 | Ga0157373_100015046 | 319 |
| 579 | 3300013100 | Ga0157373_10008726 | Ga0157373_100087265 | 319 |
| 580 | 3300013100 | Ga0157373_10038750 | Ga0157373_100387502 | 319 |
| 581 | 3300013102 | Ga0157371_10038122 | Ga0157371_100381223 | 319 |
| 582 | 3300013102 | Ga0157371_10064586 | Ga0157371_100645862 | 319 |
| 583 | 3300013104 | Ga0157370_10005978 | Ga0157370_100059784 | 319 |
| 584 | 3300013104 | Ga0157370_10011477 | Ga0157370_100114774 | 319 |
| 585 | 3300013104 | Ga0157370_10012817 | Ga0157370_100128176 | 319 |
| 586 | 3300013104 | Ga0157370_10029242 | Ga0157370_100292424 | 319 |
| 587 | 3300013104 | Ga0157370_10050818 | Ga0157370_100508182 | 319 |
| 588 | 3300013104 | Ga0157370_10117936 | Ga0157370_101179362 | 319 |
| 589 | 3300013105 | Ga0157369_10003589 | Ga0157369_1000358910 | 319 |
| 590 | 3300013105 | Ga0157369_10084966 | Ga0157369_100849662 | 319 |
| 591 | 3300013296 | Ga0157374_10013256 | Ga0157374_100132565 | 319 |
| 592 | 3300013296 | Ga0157374_10014532 | Ga0157374_100145322 | 319 |
| 593 | 3300013296 | Ga0157374_10046648 | Ga0157374_100466482 | 319 |
| 594 | 3300013296 | Ga0157374_10460869 | Ga0157374_104608691 | 319 |
| 595 | 3300013296 | Ga0157374_10586127 | Ga0157374_105861271 | 319 |
| 596 | 3300013297 | Ga0157378_10015438 | Ga0157378_100154384 | 319 |
| 597 | 3300013297 | Ga0157378_10108058 | Ga0157378_101080583 | 319 |
| 598 | 3300013306 | Ga0163162_10010226 | Ga0163162_100102266 | 319 |
| 599 | 3300013307 | Ga0157372_10039758 | Ga0157372_100397582 | 319 |
| 600 | 3300013307 | Ga0157372_10045419 | Ga0157372_100454195 | 319 |
| 601 | 3300013307 | Ga0157372_10097486 | Ga0157372_100974861 | 319 |
| 602 | 3300013308 | Ga0157375_10000552 | Ga0157375_1000055227 | 319 |
| 603 | 3300013308 | Ga0157375_10201464 | Ga0157375_102014642 | 319 |
| 604 | 3300013308 | Ga0157375_10765066 | Ga0157375_107650661 | 319 |
| 605 | 3300014325 | Ga0163163_10033485 | Ga0163163_100334852 | 319 |
| 606 | 3300014325 | Ga0163163_10072501 | Ga0163163_100725013 | 319 |
| 607 | 3300014325 | Ga0163163_10101651 | Ga0163163_101016513 | 319 |
| 608 | 3300014326 | Ga0157380_10010386 | Ga0157380_100103863 | 319 |
| 609 | 3300014326 | Ga0157380_10038888 | Ga0157380_100388882 | 319 |
| 610 | 3300014968 | Ga0157379_10008664 | Ga0157379_100086645 | 319 |
| 611 | 3300014968 | Ga0157379_10119953 | Ga0157379_101199532 | 319 |
| 612 | 3300025315 | Ga0207697_10000014 | Ga0207697_1000001431 | 319 |
| 613 | 3300025321 | Ga0207656_10011011 | Ga0207656_100110112 | 319 |
| 614 | 3300025899 | Ga0207642_10010704 | Ga0207642_100107042 | 319 |
| 615 | 3300025901 | Ga0207688_10003995 | Ga0207688_100039957 | 319 |
| 616 | 3300025903 | Ga0207680_10052613 | Ga0207680_100526132 | 319 |
| 617 | 3300025903 | Ga0207680_10071438 | Ga0207680_100714382 | 319 |
| 618 | 3300025907 | Ga0207645_10000272 | Ga0207645_1000027233 | 319 |
| 619 | 3300025907 | Ga0207645_10245835 | Ga0207645_102458352 | 319 |
| 620 | 3300025908 | Ga0207643_10001264 | Ga0207643_100012643 | 319 |
| 621 | 3300025908 | Ga0207643_10087762 | Ga0207643_100877622 | 319 |
| 622 | 3300025909 | Ga0207705_10109288 | Ga0207705_101092882 | 319 |
| 623 | 3300025911 | Ga0207654_10040018 | Ga0207654_100400182 | 319 |
| 624 | 3300025912 | Ga0207707_10003509 | Ga0207707_100035095 | 319 |
| 625 | 3300025912 | Ga0207707_10013024 | Ga0207707_100130242 | 319 |
| 626 | 3300025913 | Ga0207695_10005581 | Ga0207695_100055813 | 319 |
| 627 | 3300025914 | Ga0207671_10445060 | Ga0207671_104450601 | 319 |
| 628 | 3300025915 | Ga0207693_10000153 | Ga0207693_1000015345 | 319 |
| 629 | 3300025915 | Ga0207693_10014403 | Ga0207693_100144036 | 319 |
| 630 | 3300025916 | Ga0207663_10036617 | Ga0207663_100366173 | 319 |
| 631 | 3300025917 | Ga0207660_10005727 | Ga0207660_100057276 | 319 |
| 632 | 3300025918 | Ga0207662_10008788 | Ga0207662_100087882 | 319 |
| 633 | 3300025919 | Ga0207657_10004564 | Ga0207657_100045649 | 319 |
| 634 | 3300025919 | Ga0207657_10006048 | Ga0207657_100060483 | 319 |
| 635 | 3300025919 | Ga0207657_10035422 | Ga0207657_100354223 | 319 |
| 636 | 3300025919 | Ga0207657_10043737 | Ga0207657_100437372 | 319 |
| 637 | 3300025919 | Ga0207657_10162359 | Ga0207657_101623592 | 319 |
| 638 | 3300025919 | Ga0207657_10222252 | Ga0207657_102222521 | 319 |
| 639 | 3300025920 | Ga0207649_10003601 | Ga0207649_100036014 | 319 |
| 640 | 3300025920 | Ga0207649_10056447 | Ga0207649_100564472 | 319 |
| 641 | 3300025921 | Ga0207652_10002018 | Ga0207652_100020184 | 319 |
| 642 | 3300025921 | Ga0207652_10239563 | Ga0207652_102395632 | 319 |
| 643 | 3300025922 | Ga0207646_10072499 | Ga0207646_100724992 | 319 |
| 644 | 3300025922 | Ga0207646_10160640 | Ga0207646_101606402 | 319 |
| 645 | 3300025924 | Ga0207694_10012399 | Ga0207694_100123994 | 319 |
| 646 | 3300025924 | Ga0207694_10123967 | Ga0207694_101239672 | 319 |
| 647 | 3300025924 | Ga0207694_10246142 | Ga0207694_102461422 | 319 |
| 648 | 3300025925 | Ga0207650_10004762 | Ga0207650_100047622 | 319 |
| 649 | 3300025925 | Ga0207650_10036806 | Ga0207650_100368063 | 319 |
| 650 | 3300025926 | Ga0207659_10004373 | Ga0207659_100043737 | 319 |
| 651 | 3300025927 | Ga0207687_10006544 | Ga0207687_100065444 | 319 |
| 652 | 3300025928 | Ga0207700_10036066 | Ga0207700_100360663 | 319 |
| 653 | 3300025928 | Ga0207700_10059555 | Ga0207700_100595552 | 319 |
| 654 | 3300025929 | Ga0207664_10008735 | Ga0207664_100087352 | 319 |
| 655 | 3300025929 | Ga0207664_10030560 | Ga0207664_100305602 | 319 |
| 656 | 3300025932 | Ga0207690_10019689 | Ga0207690_100196892 | 319 |
| 657 | 3300025932 | Ga0207690_10288491 | Ga0207690_102884912 | 319 |
| 658 | 3300025932 | Ga0207690_10433819 | Ga0207690_104338191 | 319 |
| 659 | 3300025933 | Ga0207706_10085827 | Ga0207706_100858272 | 319 |
| 660 | 3300025934 | Ga0207686_10008700 | Ga0207686_100087003 | 319 |
| 661 | 3300025936 | Ga0207670_10128255 | Ga0207670_101282552 | 319 |
| 662 | 3300025937 | Ga0207669_10151151 | Ga0207669_101511512 | 319 |
| 663 | 3300025938 | Ga0207704_10273462 | Ga0207704_102734622 | 319 |
| 664 | 3300025939 | Ga0207665_10003325 | Ga0207665_100033259 | 319 |
| 665 | 3300025939 | Ga0207665_10050819 | Ga0207665_100508193 | 319 |
| 666 | 3300025940 | Ga0207691_10078079 | Ga0207691_100780793 | 319 |
| 667 | 3300025940 | Ga0207691_10081812 | Ga0207691_100818122 | 319 |
| 668 | 3300025940 | Ga0207691_10125516 | Ga0207691_101255162 | 319 |
| 669 | 3300025941 | Ga0207711_10000677 | Ga0207711_1000067719 | 319 |
| 670 | 3300025941 | Ga0207711_10059114 | Ga0207711_100591142 | 319 |
| 671 | 3300025941 | Ga0207711_10075441 | Ga0207711_100754412 | 319 |
| 672 | 3300025942 | Ga0207689_10002874 | Ga0207689_100028749 | 319 |
| 673 | 3300025942 | Ga0207689_10030246 | Ga0207689_100302465 | 319 |
| 674 | 3300025944 | Ga0207661_10005335 | Ga0207661_100053353 | 319 |
| 675 | 3300025944 | Ga0207661_10045320 | Ga0207661_100453203 | 319 |
| 676 | 3300025944 | Ga0207661_10082591 | Ga0207661_100825912 | 319 |
| 677 | 3300025944 | Ga0207661_10115910 | Ga0207661_101159102 | 319 |
| 678 | 3300025944 | Ga0207661_10236884 | Ga0207661_102368842 | 319 |
| 679 | 3300025945 | Ga0207679_10012424 | Ga0207679_100124242 | 319 |
| 680 | 3300025945 | Ga0207679_10016751 | Ga0207679_100167512 | 319 |
| 681 | 3300025949 | Ga0207667_10000860 | Ga0207667_1000086026 | 319 |
| 682 | 3300025949 | Ga0207667_10003655 | Ga0207667_1000365517 | 319 |
| 683 | 3300025949 | Ga0207667_10008779 | Ga0207667_100087795 | 319 |
| 684 | 3300025949 | Ga0207667_10030332 | Ga0207667_100303322 | 319 |
| 685 | 3300025949 | Ga0207667_10319761 | Ga0207667_103197612 | 319 |
| 686 | 3300025949 | Ga0207667_10380813 | Ga0207667_103808131 | 319 |
| 687 | 3300025960 | Ga0207651_10002106 | Ga0207651_100021069 | 319 |
| 688 | 3300025960 | Ga0207651_10029248 | Ga0207651_100292482 | 319 |
| 689 | 3300025981 | Ga0207640_10007254 | Ga0207640_100072543 | 319 |
| 690 | 3300025981 | Ga0207640_10109120 | Ga0207640_101091202 | 319 |
| 691 | 3300025986 | Ga0207658_10029131 | Ga0207658_100291313 | 319 |
| 692 | 3300025986 | Ga0207658_10221610 | Ga0207658_102216102 | 319 |
| 693 | 3300025986 | Ga0207658_10278265 | Ga0207658_102782651 | 319 |
| 694 | 3300026023 | Ga0207677_10000568 | Ga0207677_100005682 | 319 |
| 695 | 3300026023 | Ga0207677_10077614 | Ga0207677_100776142 | 319 |
| 696 | 3300026035 | Ga0207703_10003052 | Ga0207703_100030528 | 319 |
| 697 | 3300026035 | Ga0207703_10015842 | Ga0207703_100158424 | 319 |
| 698 | 3300026041 | Ga0207639_10023753 | Ga0207639_100237533 | 319 |
| 699 | 3300026067 | Ga0207678_10009412 | Ga0207678_100094124 | 319 |
| 700 | 3300026075 | Ga0207708_10334594 | Ga0207708_103345942 | 319 |
| 701 | 3300026078 | Ga0207702_10004735 | Ga0207702_100047355 | 319 |
| 702 | 3300026078 | Ga0207702_10017663 | Ga0207702_100176635 | 319 |
| 703 | 3300026078 | Ga0207702_10240838 | Ga0207702_102408382 | 319 |
| 704 | 3300026078 | Ga0207702_10487553 | Ga0207702_104875532 | 319 |
| 705 | 3300026088 | Ga0207641_10090534 | Ga0207641_100905342 | 319 |
| 706 | 3300026088 | Ga0207641_10364665 | Ga0207641_103646652 | 319 |
| 707 | 3300026089 | Ga0207648_10077572 | Ga0207648_100775722 | 319 |
| 708 | 3300026095 | Ga0207676_10000487 | Ga0207676_1000048722 | 319 |
| 709 | 3300026116 | Ga0207674_10000045 | Ga0207674_10000045103 | 319 |
| 710 | 3300026116 | Ga0207674_10000380 | Ga0207674_1000038010 | 319 |
| 711 | 3300026116 | Ga0207674_10011058 | Ga0207674_100110583 | 319 |
| 712 | 3300026118 | Ga0207675_100034419 | Ga0207675_1000344193 | 319 |
| 713 | 3300026121 | Ga0207683_10001803 | Ga0207683_1000180319 | 319 |
| 714 | 3300026121 | Ga0207683_10007175 | Ga0207683_100071758 | 319 |
| 715 | 3300026121 | Ga0207683_10009314 | Ga0207683_100093148 | 319 |
| 716 | 3300026142 | Ga0207698_10001195 | Ga0207698_100011952 | 319 |
| 717 | 3300026142 | Ga0207698_10050176 | Ga0207698_100501762 | 319 |
| 718 | 3300026142 | Ga0207698_10168457 | Ga0207698_101684571 | 319 |
| 719 | 3300027614 | Ga0209970_1018051 | Ga0209970_10180511 | 319 |
| 720 | 3300027876 | Ga0209974_10009106 | Ga0209974_100091062 | 319 |
| 721 | 3300028379 | Ga0268266_10035048 | Ga0268266_100350484 | 319 |
| 722 | 3300028379 | Ga0268266_10083838 | Ga0268266_100838382 | 319 |
| 723 | 3300028380 | Ga0268265_10216209 | Ga0268265_102162092 | 319 |
| 724 | 3300028380 | Ga0268265_10375890 | Ga0268265_103758901 | 319 |
| 725 | 3300028381 | Ga0268264_10103061 | Ga0268264_101030612 | 319 |
| 726 | 3300028381 | Ga0268264_10464604 | Ga0268264_104646041 | 319 |
| 727 | 3300031548 | Ga0307408_100024311 | Ga0307408_1000243114 | 319 |
| 728 | 3300031691 | Ga0316579_10017242 | Ga0316579_100172423 | 319 |
| 729 | 3300031727 | Ga0316576_10019850 | Ga0316576_100198503 | 319 |
| 730 | 3300031727 | Ga0316576_10126795 | Ga0316576_101267952 | 319 |
| 731 | 3300031728 | Ga0316578_10036520 | Ga0316578_100365203 | 319 |
| 732 | 3300031728 | Ga0316578_10075217 | Ga0316578_100752172 | 319 |
| 733 | 3300031731 | Ga0307405_10000531 | Ga0307405_100005316 | 319 |
| 734 | 3300031731 | Ga0307405_10006086 | Ga0307405_100060862 | 319 |
| 735 | 3300031733 | Ga0316577_10072871 | Ga0316577_100728712 | 319 |
| 736 | 3300031824 | Ga0307413_10002488 | Ga0307413_100024888 | 319 |
| 737 | 3300031824 | Ga0307413_10028776 | Ga0307413_100287762 | 319 |
| 738 | 3300031852 | Ga0307410_10002348 | Ga0307410_100023484 | 319 |
| 739 | 3300031852 | Ga0307410_10002777 | Ga0307410_100027775 | 319 |
| 740 | 3300031901 | Ga0307406_10005190 | Ga0307406_100051904 | 319 |
| 741 | 3300031903 | Ga0307407_10006878 | Ga0307407_100068781 | 319 |
| 742 | 3300031903 | Ga0307407_10011931 | Ga0307407_100119312 | 319 |
| 743 | 3300031911 | Ga0307412_10011462 | Ga0307412_100114622 | 319 |
| 744 | 3300031911 | Ga0307412_10017944 | Ga0307412_100179442 | 319 |
| 745 | 3300031995 | Ga0307409_100000296 | Ga0307409_10000029617 | 319 |
| 746 | 3300031995 | Ga0307409_100008896 | Ga0307409_1000088964 | 319 |
| 747 | 3300032002 | Ga0307416_100004316 | Ga0307416_1000043163 | 319 |
| 748 | 3300032002 | Ga0307416_100019849 | Ga0307416_1000198494 | 319 |
| 749 | 3300032004 | Ga0307414_10018807 | Ga0307414_100188073 | 319 |
| 750 | 3300032004 | Ga0307414_10020468 | Ga0307414_100204684 | 319 |
| 751 | 3300032005 | Ga0307411_10000157 | Ga0307411_1000015713 | 319 |
| 752 | 3300032005 | Ga0307411_10027937 | Ga0307411_100279372 | 319 |
| 753 | 3300032126 | Ga0307415_100030255 | Ga0307415_1000302553 | 319 |
| 754 | 3300032126 | Ga0307415_100041448 | Ga0307415_1000414482 | 319 |
| 755 | 3300032137 | Ga0316585_10043512 | Ga0316585_100435122 | 319 |
| 756 | 3300032139 | Ga0316580_10026199 | Ga0316580_100261992 | 319 |
| 757 | 3300035114 | Ga0373939_0000172 | Ga0373939_0000172_1748_2743 | 319 |
| 758 | 3300035118 | Ga0373954_0002732 | Ga0373954_0002732_293_1261 | 319 |
| 759 | 3300035120 | Ga0373957_0002773 | Ga0373957_0002773_2948_3916 | 319 |
| 760 | 3300035121 | Ga0373960_0000838 | Ga0373960_0000838_4077_5072 | 319 |
| 761 | 3300035170 | Ga0373943_0058774 | Ga0373943_0058774_127_1095 | 319 |
| 762 | 3300035171 | Ga0373946_0020385 | Ga0373946_0020385_607_1575 | 319 |
| 763 | 3300035410 | Ga0373924_0011368 | Ga0373924_0011368_1815_2783 | 319 |
| 764 | 3300035691 | Ga0373931_0000138 | Ga0373931_0000138_20300_21295 | 319 |
| 765 | 3300035691 | Ga0373931_0259984 | Ga0373931_0259984_37_1032 | 319 |
| 766 | 3300035695 | Ga0373927_0020224 | Ga0373927_0020224_248_1225 | 319 |
| 767 | 3300035725 | Ga0373947_0006647 | Ga0373947_0006647_5603_6571 | 319 |
| 768 | 3300035725 | Ga0373947_0018891 | Ga0373947_0018891_188_1156 | 319 |
| 769 | 3300036401 | Ga0373937_0012826 | Ga0373937_0012826_3974_4942 | 319 |
| 770 | 3300036401 | Ga0373937_0068780 | Ga0373937_0068780_1519_2487 | 319 |
| 771 | 3300036401 | Ga0373937_0094166 | Ga0373937_0094166_816_1784 | 319 |
| 772 | 3300036647 | Ga0316582_0194431 | Ga0316582_0194431_189_1148 | 319 |
| 773 | 3300036712 | Ga0316584_0238463 | Ga0316584_0238463_152_1111 | 319 |
| 774 | 3300037068 | Ga0373925_0006042 | Ga0373925_0006042_3919_4887 | 319 |
| 775 | 3300037068 | Ga0373925_0111719 | Ga0373925_0111719_937_1896 | 319 |
| 776 | 3300037312 | Ga0395899_0200723 | Ga0395899_0200723_227_1189 | 319 |
| 777 | 3300037471 | Ga0395905_0014790 | Ga0395905_0014790_4976_5938 | 319 |
| 778 | 3300038443 | Ga0395901_0016261 | Ga0395901_0016261_5130_6092 | 319 |
| 779 | 3300038996 | Ga0242420_007333 | Ga0242420_007333_707_1666 | 319 |
| 780 | 3300039437 | Ga0436365_0314337 | Ga0436365_0314337_548_1519 | 319 |
| 781 | 3300042876 | Ga0451577_0055602 | Ga0451577_0055602_712_1671 | 319 |
| 782 | 3300044673 | Ga0453683_0002257 | Ga0453683_0002257_627_1598 | 319 |
| 783 | 3300044673 | Ga0453683_0047332 | Ga0453683_0047332_355_1338 | 319 |
| 784 | 3300044712 | Ga0453684_0016947 | Ga0453684_0016947_614_1585 | 319 |
| 785 | 3300044712 | Ga0453684_0054309 | Ga0453684_0054309_2680_3663 | 319 |
| 786 | 3300044712 | Ga0453684_0057170 | Ga0453684_0057170_3496_4473 | 319 |
| 787 | 3300044712 | Ga0453684_0586369 | Ga0453684_0586369_28_1011 | 319 |
| 788 | 3300045051 | Ga0451576_0000001 | Ga0451576_0000001_978970_979941 | 319 |
| 789 | 3300045051 | Ga0451576_0051380 | Ga0451576_0051380_1126_2112 | 319 |
| 790 | 3300046459 | Ga0495629_0033378 | Ga0495629_0033378_224_1192 | 319 |
| 791 | 3300046462 | Ga0495651_0131591 | Ga0495651_0131591_258_1226 | 319 |
| 792 | 3300046463 | Ga0495653_0099806 | Ga0495653_0099806_60_1028 | 319 |
| 793 | 3300046472 | Ga0495580_0210435 | Ga0495580_0210435_34_993 | 319 |
| 794 | 3300046475 | Ga0495639_0016287 | Ga0495639_0016287_2145_3113 | 319 |
| 795 | 3300046476 | Ga0495662_0020205 | Ga0495662_0020205_738_1706 | 319 |
| 796 | 3300046477 | Ga0495664_0037911 | Ga0495664_0037911_1183_2151 | 319 |
| 797 | 3300046517 | Ga0495630_0152593 | Ga0495630_0152593_776_1744 | 319 |
| 798 | 3300046517 | Ga0495630_0248054 | Ga0495630_0248054_354_1313 | 319 |
| 799 | 3300046539 | Ga0495621_0022302 | Ga0495621_0022302_71_1048 | 319 |
| 800 | 3300046543 | Ga0495645_0030864 | Ga0495645_0030864_2840_3808 | 319 |
| 801 | 3300046664 | Ga0495659_0005751 | Ga0495659_0005751_1140_2108 | 319 |
| 802 | 3300046679 | Ga0495623_0084968 | Ga0495623_0084968_956_1924 | 319 |
| 803 | 3300046681 | Ga0495647_0045978 | Ga0495647_0045978_266_1234 | 319 |
| 804 | 3300046683 | Ga0495658_0023095 | Ga0495658_0023095_1040_2008 | 319 |
| 805 | 3300046689 | Ga0495613_0015093 | Ga0495613_0015093_3860_4828 | 319 |
| 806 | 3300046809 | Ga0495600_0019071 | Ga0495600_0019071_2694_3662 | 319 |
| 807 | 3300047315 | Ga0495581_0040029 | Ga0495581_0040029_420_1388 | 319 |
| 808 | 3300047318 | Ga0495636_0050144 | Ga0495636_0050144_407_1375 | 319 |
| 809 | 3300047322 | Ga0495680_0058280 | Ga0495680_0058280_1312_2280 | 319 |
| 810 | 3300047471 | Ga0495684_0010031 | Ga0495684_0010031_2876_3844 | 319 |
| 811 | 3300048089 | Ga0495614_0082581 | Ga0495614_0082581_42_1010 | 319 |
| 812 | 3300048904 | Ga0496101_0032221 | Ga0496101_0032221_2459_3418 | 319 |
| 813 | 3300048904 | Ga0496101_0157020 | Ga0496101_0157020_308_1285 | 319 |
| 814 | 3300048905 | Ga0496102_0123790 | Ga0496102_0123790_1416_2384 | 319 |
| 815 | 3300048905 | Ga0496102_0205793 | Ga0496102_0205793_757_1716 | 319 |
| 816 | 3300048906 | Ga0496103_0043052 | Ga0496103_0043052_989_1957 | 319 |
| 817 | 3300048907 | Ga0496104_0025445 | Ga0496104_0025445_1138_2097 | 319 |
| 818 | 3300048907 | Ga0496104_0046798 | Ga0496104_0046798_169_1137 | 319 |
| 819 | 3300048908 | Ga0496105_0007858 | Ga0496105_0007858_3772_4731 | 319 |
| 820 | 3300048909 | Ga0496106_0016578 | Ga0496106_0016578_1848_2807 | 319 |
| 821 | 3300048910 | Ga0496107_0158474 | Ga0496107_0158474_45_1013 | 319 |
| 822 | 3300048911 | Ga0496108_0003315 | Ga0496108_0003315_2161_3120 | 319 |
| 823 | 3300048911 | Ga0496108_0475932 | Ga0496108_0475932_30_992 | 319 |
| 824 | 3300048912 | Ga0496109_0004780 | Ga0496109_0004780_8016_8975 | 319 |
| 825 | 3300048912 | Ga0496109_0028429 | Ga0496109_0028429_163_1131 | 319 |
| 826 | 3300048912 | Ga0496109_0266685 | Ga0496109_0266685_573_1550 | 319 |
| 827 | 3300048913 | Ga0496110_0006092 | Ga0496110_0006092_6230_7189 | 319 |
| 828 | 3300048915 | Ga0496112_0000710 | Ga0496112_0000710_7101_8069 | 319 |
| 829 | 3300048915 | Ga0496112_0053740 | Ga0496112_0053740_1273_2235 | 319 |
| 830 | 3300048917 | Ga0496114_0017071 | Ga0496114_0017071_3349_4317 | 319 |
| 831 | 3300048918 | Ga0496115_0010832 | Ga0496115_0010832_5250_6218 | 319 |
| 832 | 3300048918 | Ga0496115_0455891 | Ga0496115_0455891_13_981 | 319 |
| 833 | 3300049581 | Ga0501047_0101856 | Ga0501047_0101856_1377_2348 | 319 |
| 834 | 3300049583 | Ga0501067_0012644 | Ga0501067_0012644_2175_3146 | 319 |
| 835 | 3300049586 | Ga0501070_0006503 | Ga0501070_0006503_8850_9821 | 319 |
| 836 | 3300049589 | Ga0501073_0086176 | Ga0501073_0086176_978_1949 | 319 |
| 837 | 3300049590 | Ga0501074_0053822 | Ga0501074_0053822_1004_1975 | 319 |
| 838 | 3300049593 | Ga0501077_0240070 | Ga0501077_0240070_54_1025 | 319 |
| 839 | 3300049742 | Ga0501080_0009862 | Ga0501080_0009862_5552_6523 | 319 |
| 840 | 3300049744 | Ga0501083_0000703 | Ga0501083_0000703_12136_13116 | 319 |
| 841 | 3300049744 | Ga0501083_0063016 | Ga0501083_0063016_1471_2442 | 319 |
| 842 | 3300049760 | Ga0501263_004038 | Ga0501263_004038_400_1380 | 319 |
| 843 | 3300050507 | nmdc:mga05p37_242853_c1 | nmdc:mga05p37_242853_c1_611_1579 | 319 |
| 844 | 3300050511 | nmdc:mga08y16_10845_c1 | nmdc:mga08y16_10845_c1_1563_2534 | 319 |
| 845 | 3300050512 | nmdc:mga0n895_296823_c1 | nmdc:mga0n895_296823_c1_144_1121 | 319 |
| 846 | 3300050513 | nmdc:mga0rr50_303739_c1 | nmdc:mga0rr50_303739_c1_72_1034 | 319 |
| 847 | 3300050514 | nmdc:mga08x19_224871_c1 | nmdc:mga08x19_224871_c1_102_1067 | 319 |
| 848 | 3300053085 | Ga0495619_0015430 | Ga0495619_0015430_3101_4069 | 319 |
| 849 | 3300053096 | Ga0500641_0112612 | Ga0500641_0112612_86_1060 | 319 |
| 850 | 3300054114 | Ga0501084_0028961 | Ga0501084_0028961_2260_3240 | 319 |
| 851 | 3300054114 | Ga0501084_0065152 | Ga0501084_0065152_1600_2571 | 319 |
| 852 | 3300005329 | Ga0070683_100142843 | Ga0070683_1001428431 | 320 |
| 853 | 3300005329 | Ga0070683_100151045 | Ga0070683_1001510452 | 320 |
| 854 | 3300005331 | Ga0070670_100220130 | Ga0070670_1002201302 | 320 |
| 855 | 3300005336 | Ga0070680_100028583 | Ga0070680_1000285834 | 320 |
| 856 | 3300005344 | Ga0070661_100093097 | Ga0070661_1000930972 | 320 |
| 857 | 3300005344 | Ga0070661_100127416 | Ga0070661_1001274162 | 320 |
| 858 | 3300005354 | Ga0070675_100214793 | Ga0070675_1002147932 | 320 |
| 859 | 3300005355 | Ga0070671_100025515 | Ga0070671_1000255152 | 320 |
| 860 | 3300005459 | Ga0068867_100091748 | Ga0068867_1000917482 | 320 |
| 861 | 3300005530 | Ga0070679_100032042 | Ga0070679_1000320422 | 320 |
| 862 | 3300005539 | Ga0068853_100129921 | Ga0068853_1001299212 | 320 |
| 863 | 3300005548 | Ga0070665_100305700 | Ga0070665_1003057001 | 320 |
| 864 | 3300005564 | Ga0070664_100003164 | Ga0070664_10000316412 | 320 |
| 865 | 3300005564 | Ga0070664_100140517 | Ga0070664_1001405172 | 320 |
| 866 | 3300005577 | Ga0068857_100019014 | Ga0068857_1000190144 | 320 |
| 867 | 3300005578 | Ga0068854_100029754 | Ga0068854_1000297542 | 320 |
| 868 | 3300005614 | Ga0068856_100082117 | Ga0068856_1000821173 | 320 |
| 869 | 3300005616 | Ga0068852_100011366 | Ga0068852_1000113664 | 320 |
| 870 | 3300005616 | Ga0068852_100053251 | Ga0068852_1000532513 | 320 |
| 871 | 3300005616 | Ga0068852_100094816 | Ga0068852_1000948162 | 320 |
| 872 | 3300005617 | Ga0068859_100224881 | Ga0068859_1002248812 | 320 |
| 873 | 3300005618 | Ga0068864_100004994 | Ga0068864_1000049945 | 320 |
| 874 | 3300005718 | Ga0068866_10056168 | Ga0068866_100561682 | 320 |
| 875 | 3300005719 | Ga0068861_100003681 | Ga0068861_1000036811 | 320 |
| 876 | 3300005842 | Ga0068858_100012375 | Ga0068858_1000123752 | 320 |
| 877 | 3300005842 | Ga0068858_100073212 | Ga0068858_1000732124 | 320 |
| 878 | 3300005843 | Ga0068860_100109777 | Ga0068860_1001097773 | 320 |
| 879 | 3300006237 | Ga0097621_100223620 | Ga0097621_1002236201 | 320 |
| 880 | 3300006881 | Ga0068865_100124275 | Ga0068865_1001242751 | 320 |
| 881 | 3300006931 | Ga0097620_100224901 | Ga0097620_1002249012 | 320 |
| 882 | 3300013102 | Ga0157371_10032114 | Ga0157371_100321143 | 320 |
| 883 | 3300017792 | Ga0163161_10350400 | Ga0163161_103504001 | 320 |
| 884 | 3300025321 | Ga0207656_10017951 | Ga0207656_100179513 | 320 |
| 885 | 3300025893 | Ga0207682_10035747 | Ga0207682_100357472 | 320 |
| 886 | 3300025907 | Ga0207645_10043389 | Ga0207645_100433892 | 320 |
| 887 | 3300025917 | Ga0207660_10266821 | Ga0207660_102668211 | 320 |
| 888 | 3300025918 | Ga0207662_10112987 | Ga0207662_101129872 | 320 |
| 889 | 3300025919 | Ga0207657_10114852 | Ga0207657_101148522 | 320 |
| 890 | 3300025919 | Ga0207657_10151935 | Ga0207657_101519351 | 320 |
| 891 | 3300025924 | Ga0207694_10247391 | Ga0207694_102473912 | 320 |
| 892 | 3300025924 | Ga0207694_10296665 | Ga0207694_102966651 | 320 |
| 893 | 3300025925 | Ga0207650_10001899 | Ga0207650_100018993 | 320 |
| 894 | 3300025926 | Ga0207659_10088744 | Ga0207659_100887441 | 320 |
| 895 | 3300025927 | Ga0207687_10153484 | Ga0207687_101534842 | 320 |
| 896 | 3300025933 | Ga0207706_10009312 | Ga0207706_100093126 | 320 |
| 897 | 3300025941 | Ga0207711_10048113 | Ga0207711_100481132 | 320 |
| 898 | 3300025941 | Ga0207711_10091407 | Ga0207711_100914072 | 320 |
| 899 | 3300025941 | Ga0207711_10371780 | Ga0207711_103717801 | 320 |
| 900 | 3300025942 | Ga0207689_10003356 | Ga0207689_1000335614 | 320 |
| 901 | 3300025945 | Ga0207679_10209639 | Ga0207679_102096392 | 320 |
| 902 | 3300025949 | Ga0207667_10199460 | Ga0207667_101994602 | 320 |
| 903 | 3300026023 | Ga0207677_10174372 | Ga0207677_101743722 | 320 |
| 904 | 3300026035 | Ga0207703_10133865 | Ga0207703_101338652 | 320 |
| 905 | 3300026041 | Ga0207639_10044448 | Ga0207639_100444481 | 320 |
| 906 | 3300026041 | Ga0207639_10060210 | Ga0207639_100602102 | 320 |
| 907 | 3300026067 | Ga0207678_10025143 | Ga0207678_100251432 | 320 |
| 908 | 3300026067 | Ga0207678_10152589 | Ga0207678_101525892 | 320 |
| 909 | 3300026078 | Ga0207702_10098884 | Ga0207702_100988842 | 320 |
| 910 | 3300026095 | Ga0207676_10036016 | Ga0207676_100360162 | 320 |
| 911 | 3300026116 | Ga0207674_10031960 | Ga0207674_100319604 | 320 |
| 912 | 3300026118 | Ga0207675_100000982 | Ga0207675_1000009825 | 320 |
| 913 | 3300026121 | Ga0207683_10092890 | Ga0207683_100928902 | 320 |
| 914 | 3300026142 | Ga0207698_10016132 | Ga0207698_100161322 | 320 |
| 915 | 3300005327 | Ga0070658_10021183 | Ga0070658_100211834 | 321 |
| 916 | 3300005328 | Ga0070676_10008552 | Ga0070676_100085525 | 321 |
| 917 | 3300005331 | Ga0070670_100232103 | Ga0070670_1002321032 | 321 |
| 918 | 3300005333 | Ga0070677_10000110 | Ga0070677_1000011013 | 321 |
| 919 | 3300005334 | Ga0068869_100270925 | Ga0068869_1002709252 | 321 |
| 920 | 3300005335 | Ga0070666_10001273 | Ga0070666_100012739 | 321 |
| 921 | 3300005338 | Ga0068868_100002706 | Ga0068868_1000027069 | 321 |
| 922 | 3300005347 | Ga0070668_100001262 | Ga0070668_10000126215 | 321 |
| 923 | 3300005354 | Ga0070675_100001731 | Ga0070675_1000017316 | 321 |
| 924 | 3300005355 | Ga0070671_100033312 | Ga0070671_1000333124 | 321 |
| 925 | 3300005355 | Ga0070671_100041370 | Ga0070671_1000413703 | 321 |
| 926 | 3300005356 | Ga0070674_100000281 | Ga0070674_10000028111 | 321 |
| 927 | 3300005364 | Ga0070673_100001293 | Ga0070673_1000012932 | 321 |
| 928 | 3300005367 | Ga0070667_100007248 | Ga0070667_1000072487 | 321 |
| 929 | 3300005367 | Ga0070667_100134744 | Ga0070667_1001347443 | 321 |
| 930 | 3300005456 | Ga0070678_100003910 | Ga0070678_1000039105 | 321 |
| 931 | 3300005459 | Ga0068867_100010338 | Ga0068867_1000103386 | 321 |
| 932 | 3300005539 | Ga0068853_100030917 | Ga0068853_1000309174 | 321 |
| 933 | 3300005543 | Ga0070672_100023411 | Ga0070672_1000234112 | 321 |
| 934 | 3300005548 | Ga0070665_100003069 | Ga0070665_10000306915 | 321 |
| 935 | 3300005616 | Ga0068852_100005521 | Ga0068852_1000055216 | 321 |
| 936 | 3300005618 | Ga0068864_100006896 | Ga0068864_1000068967 | 321 |
| 937 | 3300005840 | Ga0068870_10011360 | Ga0068870_100113602 | 321 |
| 938 | 3300005841 | Ga0068863_100006136 | Ga0068863_1000061367 | 321 |
| 939 | 3300005842 | Ga0068858_100001489 | Ga0068858_1000014892 | 321 |
| 940 | 3300006237 | Ga0097621_100024903 | Ga0097621_1000249033 | 321 |
| 941 | 3300006358 | Ga0068871_100007492 | Ga0068871_1000074923 | 321 |
| 942 | 3300006881 | Ga0068865_100036709 | Ga0068865_1000367092 | 321 |
| 943 | 3300009177 | Ga0105248_10108637 | Ga0105248_101086372 | 321 |
| 944 | 3300010375 | Ga0105239_10338345 | Ga0105239_103383452 | 321 |
| 945 | 3300014325 | Ga0163163_10014450 | Ga0163163_100144507 | 321 |
| 946 | 3300014968 | Ga0157379_10413034 | Ga0157379_104130342 | 321 |
| 947 | 3300017792 | Ga0163161_10185645 | Ga0163161_101856452 | 321 |
| 948 | 3300025893 | Ga0207682_10000063 | Ga0207682_1000006315 | 321 |
| 949 | 3300025903 | Ga0207680_10053699 | Ga0207680_100536992 | 321 |
| 950 | 3300025907 | Ga0207645_10000195 | Ga0207645_1000019526 | 321 |
| 951 | 3300025908 | Ga0207643_10015155 | Ga0207643_100151552 | 321 |
| 952 | 3300025909 | Ga0207705_10068271 | Ga0207705_100682713 | 321 |
| 953 | 3300025926 | Ga0207659_10006715 | Ga0207659_100067154 | 321 |
| 954 | 3300025931 | Ga0207644_10012979 | Ga0207644_100129792 | 321 |
| 955 | 3300025931 | Ga0207644_10017416 | Ga0207644_100174164 | 321 |
| 956 | 3300025937 | Ga0207669_10000968 | Ga0207669_100009688 | 321 |
| 957 | 3300025940 | Ga0207691_10000370 | Ga0207691_100003707 | 321 |
| 958 | 3300025941 | Ga0207711_10064515 | Ga0207711_100645152 | 321 |
| 959 | 3300025942 | Ga0207689_10260367 | Ga0207689_102603671 | 321 |
| 960 | 3300025960 | Ga0207651_10012926 | Ga0207651_100129264 | 321 |
| 961 | 3300025972 | Ga0207668_10066180 | Ga0207668_100661803 | 321 |
| 962 | 3300025972 | Ga0207668_10359237 | Ga0207668_103592372 | 321 |
| 963 | 3300025986 | Ga0207658_10004294 | Ga0207658_100042942 | 321 |
| 964 | 3300025986 | Ga0207658_10118225 | Ga0207658_101182252 | 321 |
| 965 | 3300026023 | Ga0207677_10005073 | Ga0207677_100050733 | 321 |
| 966 | 3300026041 | Ga0207639_10077914 | Ga0207639_100779142 | 321 |
| 967 | 3300026067 | Ga0207678_10001630 | Ga0207678_1000163021 | 321 |
| 968 | 3300026088 | Ga0207641_10027318 | Ga0207641_100273185 | 321 |
| 969 | 3300026089 | Ga0207648_10006509 | Ga0207648_100065092 | 321 |
| 970 | 3300026095 | Ga0207676_10024837 | Ga0207676_100248372 | 321 |
| 971 | 3300026121 | Ga0207683_10000009 | Ga0207683_1000000921 | 321 |
| 972 | 3300028379 | Ga0268266_10002814 | Ga0268266_1000281415 | 321 |
| 973 | 3300031251 | Ga0265327_10001316 | Ga0265327_100013167 | 321 |
| 974 | 3300041507 | Ga0451851_0324073 | Ga0451851_0324073_118_1122 | 321 |
| 975 | 3300048909 | Ga0496106_0035206 | Ga0496106_0035206_99_1109 | 321 |
| 976 | 3300048917 | Ga0496114_0400635 | Ga0496114_0400635_89_1069 | 321 |
| 977 | 3300049765 | Ga0501268_017905 | Ga0501268_017905_10_1167 | 321 |
| 978 | 3300002076 | JGI24749J21850_1002080 | JGI24749J21850_10020802 | 322 |
| 979 | 3300002239 | JGI24034J26672_10002936 | JGI24034J26672_100029362 | 322 |
| 980 | 3300005290 | Ga0065712_10123062 | Ga0065712_101230622 | 322 |
| 981 | 3300005293 | Ga0065715_10117495 | Ga0065715_101174952 | 322 |
| 982 | 3300005293 | Ga0065715_10180442 | Ga0065715_101804422 | 322 |
| 983 | 3300005328 | Ga0070676_10002080 | Ga0070676_100020807 | 322 |
| 984 | 3300005328 | Ga0070676_10009874 | Ga0070676_100098743 | 322 |
| 985 | 3300005329 | Ga0070683_100012189 | Ga0070683_1000121894 | 322 |
| 986 | 3300005330 | Ga0070690_100012720 | Ga0070690_1000127203 | 322 |
| 987 | 3300005330 | Ga0070690_100042902 | Ga0070690_1000429021 | 322 |
| 988 | 3300005330 | Ga0070690_100134126 | Ga0070690_1001341262 | 322 |
| 989 | 3300005331 | Ga0070670_100001353 | Ga0070670_1000013533 | 322 |
| 990 | 3300005331 | Ga0070670_100038102 | Ga0070670_1000381022 | 322 |
| 991 | 3300005331 | Ga0070670_100105606 | Ga0070670_1001056061 | 322 |
| 992 | 3300005331 | Ga0070670_100131201 | Ga0070670_1001312012 | 322 |
| 993 | 3300005334 | Ga0068869_100012867 | Ga0068869_1000128672 | 322 |
| 994 | 3300005334 | Ga0068869_100015623 | Ga0068869_1000156233 | 322 |
| 995 | 3300005334 | Ga0068869_100064331 | Ga0068869_1000643312 | 322 |
| 996 | 3300005335 | Ga0070666_10040552 | Ga0070666_100405522 | 322 |
| 997 | 3300005335 | Ga0070666_10187410 | Ga0070666_101874102 | 322 |
| 998 | 3300005336 | Ga0070680_100129783 | Ga0070680_1001297832 | 322 |
| 999 | 3300005339 | Ga0070660_100015363 | Ga0070660_1000153636 | 322 |
| 1000 | 3300005339 | Ga0070660_100041670 | Ga0070660_1000416702 | 322 |
| 1001 | 3300005340 | Ga0070689_100030747 | Ga0070689_1000307472 | 322 |
| 1002 | 3300005343 | Ga0070687_100019948 | Ga0070687_1000199483 | 322 |
| 1003 | 3300005344 | Ga0070661_100002328 | Ga0070661_1000023283 | 322 |
| 1004 | 3300005344 | Ga0070661_100007616 | Ga0070661_1000076167 | 322 |
| 1005 | 3300005344 | Ga0070661_100009841 | Ga0070661_1000098415 | 322 |
| 1006 | 3300005344 | Ga0070661_100020626 | Ga0070661_1000206265 | 322 |
| 1007 | 3300005345 | Ga0070692_10023349 | Ga0070692_100233492 | 322 |
| 1008 | 3300005347 | Ga0070668_100003150 | Ga0070668_1000031502 | 322 |
| 1009 | 3300005347 | Ga0070668_100005925 | Ga0070668_1000059256 | 322 |
| 1010 | 3300005347 | Ga0070668_100006020 | Ga0070668_1000060205 | 322 |
| 1011 | 3300005347 | Ga0070668_100117466 | Ga0070668_1001174662 | 322 |
| 1012 | 3300005353 | Ga0070669_100007697 | Ga0070669_1000076972 | 322 |
| 1013 | 3300005353 | Ga0070669_100020170 | Ga0070669_1000201702 | 322 |
| 1014 | 3300005353 | Ga0070669_100087040 | Ga0070669_1000870402 | 322 |
| 1015 | 3300005354 | Ga0070675_100020955 | Ga0070675_1000209556 | 322 |
| 1016 | 3300005354 | Ga0070675_100035986 | Ga0070675_1000359863 | 322 |
| 1017 | 3300005354 | Ga0070675_100080009 | Ga0070675_1000800091 | 322 |
| 1018 | 3300005355 | Ga0070671_100034014 | Ga0070671_1000340143 | 322 |
| 1019 | 3300005356 | Ga0070674_100097692 | Ga0070674_1000976922 | 322 |
| 1020 | 3300005356 | Ga0070674_100402220 | Ga0070674_1004022201 | 322 |
| 1021 | 3300005364 | Ga0070673_100014449 | Ga0070673_1000144492 | 322 |
| 1022 | 3300005365 | Ga0070688_100002366 | Ga0070688_1000023667 | 322 |
| 1023 | 3300005366 | Ga0070659_100024523 | Ga0070659_1000245233 | 322 |
| 1024 | 3300005366 | Ga0070659_100148008 | Ga0070659_1001480082 | 322 |
| 1025 | 3300005366 | Ga0070659_100213888 | Ga0070659_1002138881 | 322 |
| 1026 | 3300005367 | Ga0070667_100002647 | Ga0070667_10000264714 | 322 |
| 1027 | 3300005434 | Ga0070709_10028498 | Ga0070709_100284983 | 322 |
| 1028 | 3300005438 | Ga0070701_10005635 | Ga0070701_100056353 | 322 |
| 1029 | 3300005441 | Ga0070700_100017255 | Ga0070700_1000172552 | 322 |
| 1030 | 3300005455 | Ga0070663_100014606 | Ga0070663_1000146065 | 322 |
| 1031 | 3300005455 | Ga0070663_100263997 | Ga0070663_1002639972 | 322 |
| 1032 | 3300005455 | Ga0070663_100394314 | Ga0070663_1003943141 | 322 |
| 1033 | 3300005456 | Ga0070678_100005336 | Ga0070678_1000053364 | 322 |
| 1034 | 3300005456 | Ga0070678_100100101 | Ga0070678_1001001012 | 322 |
| 1035 | 3300005456 | Ga0070678_100212692 | Ga0070678_1002126921 | 322 |
| 1036 | 3300005457 | Ga0070662_100000721 | Ga0070662_1000007219 | 322 |
| 1037 | 3300005457 | Ga0070662_100068874 | Ga0070662_1000688742 | 322 |
| 1038 | 3300005458 | Ga0070681_10000413 | Ga0070681_1000041333 | 322 |
| 1039 | 3300005458 | Ga0070681_10187435 | Ga0070681_101874352 | 322 |
| 1040 | 3300005459 | Ga0068867_100002927 | Ga0068867_1000029274 | 322 |
| 1041 | 3300005459 | Ga0068867_100030407 | Ga0068867_1000304072 | 322 |
| 1042 | 3300005459 | Ga0068867_100091242 | Ga0068867_1000912422 | 322 |
| 1043 | 3300005466 | Ga0070685_10001523 | Ga0070685_1000152310 | 322 |
| 1044 | 3300005466 | Ga0070685_10140690 | Ga0070685_101406902 | 322 |
| 1045 | 3300005468 | Ga0070707_100097289 | Ga0070707_1000972891 | 322 |
| 1046 | 3300005530 | Ga0070679_100001227 | Ga0070679_10000122720 | 322 |
| 1047 | 3300005535 | Ga0070684_100006324 | Ga0070684_1000063243 | 322 |
| 1048 | 3300005535 | Ga0070684_100305629 | Ga0070684_1003056292 | 322 |
| 1049 | 3300005539 | Ga0068853_100001754 | Ga0068853_1000017544 | 322 |
| 1050 | 3300005539 | Ga0068853_100019057 | Ga0068853_1000190576 | 322 |
| 1051 | 3300005539 | Ga0068853_100182743 | Ga0068853_1001827432 | 322 |
| 1052 | 3300005543 | Ga0070672_100000724 | Ga0070672_10000072420 | 322 |
| 1053 | 3300005543 | Ga0070672_100007386 | Ga0070672_1000073866 | 322 |
| 1054 | 3300005543 | Ga0070672_100049179 | Ga0070672_1000491793 | 322 |
| 1055 | 3300005543 | Ga0070672_100127203 | Ga0070672_1001272032 | 322 |
| 1056 | 3300005544 | Ga0070686_100015482 | Ga0070686_1000154822 | 322 |
| 1057 | 3300005548 | Ga0070665_100008870 | Ga0070665_1000088706 | 322 |
| 1058 | 3300005563 | Ga0068855_100000453 | Ga0068855_10000045332 | 322 |
| 1059 | 3300005563 | Ga0068855_100069746 | Ga0068855_1000697463 | 322 |
| 1060 | 3300005563 | Ga0068855_100102570 | Ga0068855_1001025702 | 322 |
| 1061 | 3300005564 | Ga0070664_100001099 | Ga0070664_10000109910 | 322 |
| 1062 | 3300005564 | Ga0070664_100069951 | Ga0070664_1000699512 | 322 |
| 1063 | 3300005564 | Ga0070664_100216952 | Ga0070664_1002169522 | 322 |
| 1064 | 3300005577 | Ga0068857_100039154 | Ga0068857_1000391542 | 322 |
| 1065 | 3300005578 | Ga0068854_100008998 | Ga0068854_1000089983 | 322 |
| 1066 | 3300005578 | Ga0068854_100012434 | Ga0068854_1000124343 | 322 |
| 1067 | 3300005578 | Ga0068854_100165657 | Ga0068854_1001656572 | 322 |
| 1068 | 3300005614 | Ga0068856_100000980 | Ga0068856_1000009809 | 322 |
| 1069 | 3300005615 | Ga0070702_100017945 | Ga0070702_1000179452 | 322 |
| 1070 | 3300005616 | Ga0068852_100005781 | Ga0068852_1000057816 | 322 |
| 1071 | 3300005616 | Ga0068852_100052531 | Ga0068852_1000525311 | 322 |
| 1072 | 3300005617 | Ga0068859_100019260 | Ga0068859_1000192602 | 322 |
| 1073 | 3300005617 | Ga0068859_100120357 | Ga0068859_1001203572 | 322 |
| 1074 | 3300005618 | Ga0068864_100003388 | Ga0068864_1000033889 | 322 |
| 1075 | 3300005618 | Ga0068864_100043933 | Ga0068864_1000439332 | 322 |
| 1076 | 3300005618 | Ga0068864_100051250 | Ga0068864_1000512503 | 322 |
| 1077 | 3300005618 | Ga0068864_100186145 | Ga0068864_1001861452 | 322 |
| 1078 | 3300005718 | Ga0068866_10001300 | Ga0068866_1000130010 | 322 |
| 1079 | 3300005719 | Ga0068861_100019950 | Ga0068861_1000199501 | 322 |
| 1080 | 3300005719 | Ga0068861_100074947 | Ga0068861_1000749472 | 322 |
| 1081 | 3300005834 | Ga0068851_10001504 | Ga0068851_100015046 | 322 |
| 1082 | 3300005841 | Ga0068863_100002944 | Ga0068863_1000029446 | 322 |
| 1083 | 3300005841 | Ga0068863_100012415 | Ga0068863_1000124155 | 322 |
| 1084 | 3300005842 | Ga0068858_100009131 | Ga0068858_1000091315 | 322 |
| 1085 | 3300005843 | Ga0068860_100030385 | Ga0068860_1000303856 | 322 |
| 1086 | 3300005843 | Ga0068860_100070370 | Ga0068860_1000703701 | 322 |
| 1087 | 3300005844 | Ga0068862_100032352 | Ga0068862_1000323522 | 322 |
| 1088 | 3300006038 | Ga0075365_10160636 | Ga0075365_101606361 | 322 |
| 1089 | 3300006237 | Ga0097621_100014480 | Ga0097621_1000144802 | 322 |
| 1090 | 3300006237 | Ga0097621_100038425 | Ga0097621_1000384253 | 322 |
| 1091 | 3300006358 | Ga0068871_100007455 | Ga0068871_1000074555 | 322 |
| 1092 | 3300006358 | Ga0068871_100047622 | Ga0068871_1000476223 | 322 |
| 1093 | 3300006358 | Ga0068871_100064259 | Ga0068871_1000642592 | 322 |
| 1094 | 3300006881 | Ga0068865_100110781 | Ga0068865_1001107812 | 322 |
| 1095 | 3300006931 | Ga0097620_100019260 | Ga0097620_1000192602 | 322 |
| 1096 | 3300006931 | Ga0097620_100120356 | Ga0097620_1001203562 | 322 |
| 1097 | 3300009094 | Ga0111539_10037540 | Ga0111539_100375402 | 322 |
| 1098 | 3300009101 | Ga0105247_10145471 | Ga0105247_101454712 | 322 |
| 1099 | 3300009148 | Ga0105243_10022010 | Ga0105243_100220103 | 322 |
| 1100 | 3300009148 | Ga0105243_10043773 | Ga0105243_100437732 | 322 |
| 1101 | 3300009176 | Ga0105242_10064186 | Ga0105242_100641862 | 322 |
| 1102 | 3300009176 | Ga0105242_10066151 | Ga0105242_100661513 | 322 |
| 1103 | 3300009177 | Ga0105248_10002109 | Ga0105248_1000210910 | 322 |
| 1104 | 3300009553 | Ga0105249_10053561 | Ga0105249_100535613 | 322 |
| 1105 | 3300009553 | Ga0105249_10131014 | Ga0105249_101310143 | 322 |
| 1106 | 3300010375 | Ga0105239_10152516 | Ga0105239_101525162 | 322 |
| 1107 | 3300010375 | Ga0105239_10278259 | Ga0105239_102782592 | 322 |
| 1108 | 3300011119 | Ga0105246_10051067 | Ga0105246_100510673 | 322 |
| 1109 | 3300013100 | Ga0157373_10000649 | Ga0157373_100006497 | 322 |
| 1110 | 3300013102 | Ga0157371_10000638 | Ga0157371_1000063813 | 322 |
| 1111 | 3300013104 | Ga0157370_10002443 | Ga0157370_1000244310 | 322 |
| 1112 | 3300013104 | Ga0157370_10073452 | Ga0157370_100734522 | 322 |
| 1113 | 3300013104 | Ga0157370_10275977 | Ga0157370_102759771 | 322 |
| 1114 | 3300013105 | Ga0157369_10215608 | Ga0157369_102156082 | 322 |
| 1115 | 3300013105 | Ga0157369_10478974 | Ga0157369_104789741 | 322 |
| 1116 | 3300013296 | Ga0157374_10025342 | Ga0157374_100253422 | 322 |
| 1117 | 3300013296 | Ga0157374_10254048 | Ga0157374_102540482 | 322 |
| 1118 | 3300013297 | Ga0157378_10019789 | Ga0157378_100197895 | 322 |
| 1119 | 3300013306 | Ga0163162_10030008 | Ga0163162_100300082 | 322 |
| 1120 | 3300013307 | Ga0157372_10136264 | Ga0157372_101362642 | 322 |
| 1121 | 3300013308 | Ga0157375_10104651 | Ga0157375_101046512 | 322 |
| 1122 | 3300013308 | Ga0157375_10342380 | Ga0157375_103423802 | 322 |
| 1123 | 3300014968 | Ga0157379_10019963 | Ga0157379_100199632 | 322 |
| 1124 | 3300017792 | Ga0163161_10022976 | Ga0163161_100229763 | 322 |
| 1125 | 3300017792 | Ga0163161_10031806 | Ga0163161_100318062 | 322 |
| 1126 | 3300017792 | Ga0163161_10081871 | Ga0163161_100818712 | 322 |
| 1127 | 3300017792 | Ga0163161_10088263 | Ga0163161_100882632 | 322 |
| 1128 | 3300025321 | Ga0207656_10004561 | Ga0207656_100045615 | 322 |
| 1129 | 3300025893 | Ga0207682_10000095 | Ga0207682_1000009533 | 322 |
| 1130 | 3300025899 | Ga0207642_10001503 | Ga0207642_100015036 | 322 |
| 1131 | 3300025903 | Ga0207680_10015227 | Ga0207680_100152272 | 322 |
| 1132 | 3300025903 | Ga0207680_10115127 | Ga0207680_101151272 | 322 |
| 1133 | 3300025906 | Ga0207699_10057676 | Ga0207699_100576761 | 322 |
| 1134 | 3300025907 | Ga0207645_10007040 | Ga0207645_100070402 | 322 |
| 1135 | 3300025907 | Ga0207645_10046857 | Ga0207645_100468572 | 322 |
| 1136 | 3300025912 | Ga0207707_10038346 | Ga0207707_100383462 | 322 |
| 1137 | 3300025912 | Ga0207707_10161743 | Ga0207707_101617432 | 322 |
| 1138 | 3300025915 | Ga0207693_10050525 | Ga0207693_100505252 | 322 |
| 1139 | 3300025917 | Ga0207660_10102503 | Ga0207660_101025032 | 322 |
| 1140 | 3300025919 | Ga0207657_10000409 | Ga0207657_1000040931 | 322 |
| 1141 | 3300025919 | Ga0207657_10037570 | Ga0207657_100375702 | 322 |
| 1142 | 3300025920 | Ga0207649_10007126 | Ga0207649_100071265 | 322 |
| 1143 | 3300025920 | Ga0207649_10007390 | Ga0207649_100073902 | 322 |
| 1144 | 3300025920 | Ga0207649_10019187 | Ga0207649_100191872 | 322 |
| 1145 | 3300025921 | Ga0207652_10030735 | Ga0207652_100307352 | 322 |
| 1146 | 3300025923 | Ga0207681_10113098 | Ga0207681_101130982 | 322 |
| 1147 | 3300025925 | Ga0207650_10009384 | Ga0207650_100093846 | 322 |
| 1148 | 3300025925 | Ga0207650_10013079 | Ga0207650_100130792 | 322 |
| 1149 | 3300025925 | Ga0207650_10067924 | Ga0207650_100679242 | 322 |
| 1150 | 3300025925 | Ga0207650_10161341 | Ga0207650_101613412 | 322 |
| 1151 | 3300025926 | Ga0207659_10002575 | Ga0207659_100025753 | 322 |
| 1152 | 3300025926 | Ga0207659_10010964 | Ga0207659_100109642 | 322 |
| 1153 | 3300025926 | Ga0207659_10083027 | Ga0207659_100830273 | 322 |
| 1154 | 3300025931 | Ga0207644_10004197 | Ga0207644_100041977 | 322 |
| 1155 | 3300025931 | Ga0207644_10011530 | Ga0207644_100115302 | 322 |
| 1156 | 3300025931 | Ga0207644_10059361 | Ga0207644_100593613 | 322 |
| 1157 | 3300025931 | Ga0207644_10093222 | Ga0207644_100932222 | 322 |
| 1158 | 3300025932 | Ga0207690_10011683 | Ga0207690_100116833 | 322 |
| 1159 | 3300025932 | Ga0207690_10284496 | Ga0207690_102844961 | 322 |
| 1160 | 3300025933 | Ga0207706_10000232 | Ga0207706_1000023231 | 322 |
| 1161 | 3300025933 | Ga0207706_10017282 | Ga0207706_100172824 | 322 |
| 1162 | 3300025933 | Ga0207706_10064159 | Ga0207706_100641592 | 322 |
| 1163 | 3300025935 | Ga0207709_10038651 | Ga0207709_100386512 | 322 |
| 1164 | 3300025935 | Ga0207709_10096773 | Ga0207709_100967732 | 322 |
| 1165 | 3300025936 | Ga0207670_10037114 | Ga0207670_100371142 | 322 |
| 1166 | 3300025936 | Ga0207670_10062133 | Ga0207670_100621332 | 322 |
| 1167 | 3300025937 | Ga0207669_10008441 | Ga0207669_100084413 | 322 |
| 1168 | 3300025937 | Ga0207669_10065278 | Ga0207669_100652781 | 322 |
| 1169 | 3300025938 | Ga0207704_10033559 | Ga0207704_100335592 | 322 |
| 1170 | 3300025938 | Ga0207704_10098281 | Ga0207704_100982812 | 322 |
| 1171 | 3300025940 | Ga0207691_10000406 | Ga0207691_100004062 | 322 |
| 1172 | 3300025940 | Ga0207691_10004936 | Ga0207691_100049363 | 322 |
| 1173 | 3300025940 | Ga0207691_10006303 | Ga0207691_100063037 | 322 |
| 1174 | 3300025940 | Ga0207691_10006393 | Ga0207691_100063933 | 322 |
| 1175 | 3300025940 | Ga0207691_10043866 | Ga0207691_100438661 | 322 |
| 1176 | 3300025940 | Ga0207691_10143884 | Ga0207691_101438842 | 322 |
| 1177 | 3300025941 | Ga0207711_10011337 | Ga0207711_100113373 | 322 |
| 1178 | 3300025942 | Ga0207689_10006514 | Ga0207689_100065145 | 322 |
| 1179 | 3300025942 | Ga0207689_10017634 | Ga0207689_100176345 | 322 |
| 1180 | 3300025945 | Ga0207679_10007974 | Ga0207679_100079746 | 322 |
| 1181 | 3300025945 | Ga0207679_10133208 | Ga0207679_101332082 | 322 |
| 1182 | 3300025949 | Ga0207667_10001380 | Ga0207667_1000138026 | 322 |
| 1183 | 3300025949 | Ga0207667_10128814 | Ga0207667_101288142 | 322 |
| 1184 | 3300025960 | Ga0207651_10021533 | Ga0207651_100215332 | 322 |
| 1185 | 3300025960 | Ga0207651_10331527 | Ga0207651_103315272 | 322 |
| 1186 | 3300025972 | Ga0207668_10000588 | Ga0207668_100005882 | 322 |
| 1187 | 3300025972 | Ga0207668_10115860 | Ga0207668_101158602 | 322 |
| 1188 | 3300025981 | Ga0207640_10019268 | Ga0207640_100192681 | 322 |
| 1189 | 3300025981 | Ga0207640_10025022 | Ga0207640_100250222 | 322 |
| 1190 | 3300025981 | Ga0207640_10046560 | Ga0207640_100465602 | 322 |
| 1191 | 3300025981 | Ga0207640_10128890 | Ga0207640_101288902 | 322 |
| 1192 | 3300025986 | Ga0207658_10012167 | Ga0207658_100121676 | 322 |
| 1193 | 3300025986 | Ga0207658_10073100 | Ga0207658_100731002 | 322 |
| 1194 | 3300026023 | Ga0207677_10019960 | Ga0207677_100199602 | 322 |
| 1195 | 3300026023 | Ga0207677_10317897 | Ga0207677_103178971 | 322 |
| 1196 | 3300026041 | Ga0207639_10028265 | Ga0207639_100282654 | 322 |
| 1197 | 3300026041 | Ga0207639_10280504 | Ga0207639_102805042 | 322 |
| 1198 | 3300026067 | Ga0207678_10004372 | Ga0207678_100043725 | 322 |
| 1199 | 3300026067 | Ga0207678_10004440 | Ga0207678_100044404 | 322 |
| 1200 | 3300026067 | Ga0207678_10166047 | Ga0207678_101660472 | 322 |
| 1201 | 3300026075 | Ga0207708_10000766 | Ga0207708_1000076624 | 322 |
| 1202 | 3300026078 | Ga0207702_10003001 | Ga0207702_100030011 | 322 |
| 1203 | 3300026088 | Ga0207641_10005500 | Ga0207641_100055006 | 322 |
| 1204 | 3300026088 | Ga0207641_10058733 | Ga0207641_100587332 | 322 |
| 1205 | 3300026088 | Ga0207641_10111602 | Ga0207641_101116022 | 322 |
| 1206 | 3300026089 | Ga0207648_10000885 | Ga0207648_1000088513 | 322 |
| 1207 | 3300026089 | Ga0207648_10001587 | Ga0207648_1000158726 | 322 |
| 1208 | 3300026089 | Ga0207648_10003000 | Ga0207648_100030007 | 322 |
| 1209 | 3300026089 | Ga0207648_10067742 | Ga0207648_100677423 | 322 |
| 1210 | 3300026095 | Ga0207676_10007017 | Ga0207676_100070172 | 322 |
| 1211 | 3300026095 | Ga0207676_10054047 | Ga0207676_100540472 | 322 |
| 1212 | 3300026116 | Ga0207674_10008292 | Ga0207674_100082927 | 322 |
| 1213 | 3300026118 | Ga0207675_100006003 | Ga0207675_1000060035 | 322 |
| 1214 | 3300026118 | Ga0207675_100010997 | Ga0207675_1000109976 | 322 |
| 1215 | 3300026118 | Ga0207675_100100927 | Ga0207675_1001009272 | 322 |
| 1216 | 3300026121 | Ga0207683_10002918 | Ga0207683_100029187 | 322 |
| 1217 | 3300026121 | Ga0207683_10016707 | Ga0207683_100167075 | 322 |
| 1218 | 3300026121 | Ga0207683_10019254 | Ga0207683_100192543 | 322 |
| 1219 | 3300026142 | Ga0207698_10004886 | Ga0207698_100048863 | 322 |
| 1220 | 3300026142 | Ga0207698_10019585 | Ga0207698_100195852 | 322 |
| 1221 | 3300027695 | Ga0209966_1006848 | Ga0209966_10068482 | 322 |
| 1222 | 3300027876 | Ga0209974_10017653 | Ga0209974_100176532 | 322 |
| 1223 | 3300027907 | Ga0207428_10057082 | Ga0207428_100570822 | 322 |
| 1224 | 3300028380 | Ga0268265_10027125 | Ga0268265_100271253 | 322 |
| 1225 | 3300028380 | Ga0268265_10115987 | Ga0268265_101159872 | 322 |
| 1226 | 3300028381 | Ga0268264_10016423 | Ga0268264_100164236 | 322 |
| 1227 | 3300031235 | Ga0265330_10002031 | Ga0265330_100020318 | 322 |
| 1228 | 3300031238 | Ga0265332_10001320 | Ga0265332_1000132010 | 322 |
| 1229 | 3300031239 | Ga0265328_10014756 | Ga0265328_100147562 | 322 |
| 1230 | 3300031241 | Ga0265325_10020658 | Ga0265325_100206582 | 322 |
| 1231 | 3300031242 | Ga0265329_10002673 | Ga0265329_100026736 | 322 |
| 1232 | 3300031249 | Ga0265339_10043404 | Ga0265339_100434042 | 322 |
| 1233 | 3300031250 | Ga0265331_10000782 | Ga0265331_1000078222 | 322 |
| 1234 | 3300031251 | Ga0265327_10110845 | Ga0265327_101108451 | 322 |
| 1235 | 3300031344 | Ga0265316_10015971 | Ga0265316_100159716 | 322 |
| 1236 | 3300031711 | Ga0265314_10024215 | Ga0265314_100242153 | 322 |
| 1237 | 3300031903 | Ga0307407_10102592 | Ga0307407_101025922 | 322 |
| 1238 | 3300035119 | Ga0373956_0045582 | Ga0373956_0045582_150_1118 | 322 |
| 1239 | 3300035724 | Ga0373933_0063845 | Ga0373933_0063845_443_1411 | 322 |
| 1240 | 3300036401 | Ga0373937_0089311 | Ga0373937_0089311_15_983 | 322 |
| 1241 | 3300042435 | Ga0439434_0003833 | Ga0439434_0003833_2266_3234 | 322 |
| 1242 | 3300046472 | Ga0495580_0124571 | Ga0495580_0124571_668_1645 | 322 |
| 1243 | 3300046539 | Ga0495621_0032286 | Ga0495621_0032286_451_1419 | 322 |
| 1244 | 3300048905 | Ga0496102_0004391 | Ga0496102_0004391_130_1098 | 322 |
| 1245 | 3300048906 | Ga0496103_0010291 | Ga0496103_0010291_3014_3982 | 322 |
| 1246 | 3300048910 | Ga0496107_0004959 | Ga0496107_0004959_6824_7792 | 322 |
| 1247 | 3300048912 | Ga0496109_0184211 | Ga0496109_0184211_623_1615 | 322 |
| 1248 | 3300048913 | Ga0496110_0204183 | Ga0496110_0204183_742_1758 | 322 |
| 1249 | 3300048917 | Ga0496114_0043990 | Ga0496114_0043990_1580_2548 | 322 |
| 1250 | 3300050508 | nmdc:mga09592_23891_c1 | nmdc:mga09592_23891_c1_45_1070 | 322 |
| 1251 | 3300050511 | nmdc:mga08y16_584128_c1 | nmdc:mga08y16_584128_c1_25_993 | 322 |
| 1252 | 3300050512 | nmdc:mga0n895_69615_c1 | nmdc:mga0n895_69615_c1_183_1163 | 322 |
| 1253 | 3300050514 | nmdc:mga08x19_5335_c1 | nmdc:mga08x19_5335_c1_2153_3133 | 322 |
| 1254 | 3300053085 | Ga0495619_0126157 | Ga0495619_0126157_726_1694 | 322 |
| 1255 | 3300053153 | Ga0500616_0003173 | Ga0500616_0003173_3661_4629 | 322 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3eb3-assembly1.cif.gz_A | voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone | 0.9783 | 6 | 321 |
| 3eb4-assembly1.cif.gz_A | voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone | 0.9781 | 6 | 321 |
| 7wf3-assembly1.cif.gz_C | composite map of human kv1.3 channel in apo state with beta subunits | 0.9654 | 6 | 321 |
| 6ci1-assembly1.cif.gz_H | the structure of full-length kv beta 2.1 determined by cryogenic electron microscopy | 0.9614 | 6 | 319 |
| 3eb3-assembly1.cif.gz_A | voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone | 0.9573 | 6 | 321 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C4J2K0_1_323_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9866 | 4 | 321 | 3.20.20.100 |
| af_P97382_23_247_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9777 | 109 | 321 | 3.20.20.100 |
| af_E9QGU5_66_406_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9768 | 4 | 321 | 3.20.20.100 |
| af_C4J2K0_1_323_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9684 | 4 | 321 | 3.20.20.100 |
| af_O59826_13_339_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9655 | 5 | 321 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U2SJ32-F1-model_v4 | Aldo/keto reductase | 0.9941 | 4 | 321 |
GO:0016491
|
| AF-A0A7C7GQV1-F1-model_v4 | deleted | 0.9924 | 4 | 180 |
|
| AF-A0A382BNH0-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9924 | 4 | 173 |
GO:0016491
|
| AF-A0A7J6WMD8-F1-model_v4 | Voltage-gated potassium channel subunit beta-1 | 0.9906 | 4 | 197 |
GO:0016491
GO:0034220 |
| AF-A0A3M2GM87-F1-model_v4 | Aldo/keto reductase | 0.9875 | 143 | 322 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar