F492250

General Info

Members Datasets Scaffolds Average Seq Length
1255 418 1246 324

Family's Representative Sequence

Representative Sequence 3300049765|Ga0501268_017905|Ga0501268_017905_10_1167
Length 385
Sequence VDFGAGQPLSGQQGERQARRARADDGEFQHAGILRAARDWRPAGISCALCVTAPQDFAMQYRRLGRAGLQVSELSLGSWVTYHNQVDTKTATEMLAAAFDAGINFFDNAEVYAQGESEVVMGQAFKALGWNRLDYIVSSKFFWGLTRDGVTTTNRKDTLNRKYLMQAVDGSLKRLQLEHIDLIYCHRPDPHTPIEETVWAMSDIIRQGKALYWGTSEWSAADIRAAWDIAERHHLHKPVVEQPQYHLFHRRRVEQEYARLYDDIGLGLTTWSPLASGLLTGKYAAGIPAGSRASLDSMAWLREHLQDRAKNEAVGQLGDIAAELGCNTAQLAIAWINRNPRVSSVILGASRIEQLRDNLGALAVTPKLTPDVVERIDAIAKPLAG

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221585 Pelomonas sp. Root662 Isolate Unclassified
4 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
5 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
6 2643221656 Pelomonas sp. Root405 Isolate Unclassified
7 2643221660 Methylibium sp. Root1272 Isolate Unclassified
8 2738541337 Pelomonas sp. BT06 Isolate Unclassified
9 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
112 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
219 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
220 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
231 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
232 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
233 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
234 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
235 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
241 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
244 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
247 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
248 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
249 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
250 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
251 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
252 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
253 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
254 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
259 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
260 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
261 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
262 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
265 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
266 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
267 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
268 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
273 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
275 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
276 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
277 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
278 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
279 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
280 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
283 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
284 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
287 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
288 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
289 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
290 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
293 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
294 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
295 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
296 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
297 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
298 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
299 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
300 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
301 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
302 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
303 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
304 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
305 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
306 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
307 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
308 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
313 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
314 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
315 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
316 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
317 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
318 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
321 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
322 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
325 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
326 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
327 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
328 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
329 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
330 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
331 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
334 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
335 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
336 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
337 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
338 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
347 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
348 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
349 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
350 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
351 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
352 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
353 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
356 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
357 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
365 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
377 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
378 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
379 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
380 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
381 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
382 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
383 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
384 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
385 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
389 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
390 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
391 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
392 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
393 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
394 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
395 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
396 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
397 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
398 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
399 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
400 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
401 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
408 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
409 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
410 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
411 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
412 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
413 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
414 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
415 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
416 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
417 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
418 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.82
Nodule 0.32
Rhizoplane 3.35
Rhizosphere 88.29
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1002080 3300002076 Bacteria 2822
2 JGI24034J26672_10002936 3300002239 Bacteria 2362
3 rootH1_10043368 3300003316 Bacteria 6592
4 rootL2_10002418 3300003322 Bacteria 24582
5 rootL2_10012665 3300003322 Bacteria 5554
6 rootL2_10027947 3300003322 Bacteria 28083
7 Ga0055525_1000100 3300003759 Bacteria 136467
8 Ga0055526_1013302 3300003771 Bacteria 3493
9 Ga0055524_1001523 3300003775 Bacteria 13107
10 Ga0055530_10001128 3300003791 Bacteria 20838
11 Ga0055540_1000110 3300003792 Bacteria 88766
12 Ga0055540_1025877 3300003792 Bacteria 1429
13 Ga0055531_10000042 3300003794 Bacteria 134368
14 Ga0055531_10004790 3300003794 Bacteria 8086
15 Ga0055531_10009863 3300003794 Bacteria 4833
16 Ga0065165_1000063 3300005262 Bacteria 176477
17 Ga0065165_1001135 3300005262 Bacteria 31247
18 Ga0065712_10120426 3300005290 Bacteria 1678
19 Ga0065712_10123062 3300005290 Bacteria 1643
20 Ga0065715_10021485 3300005293 Bacteria 1658
21 Ga0065715_10117495 3300005293 Bacteria 2346
22 Ga0065715_10180442 3300005293 Bacteria 1480
23 Ga0065715_10215931 3300005293 Bacteria 1293
24 Ga0070658_10004627 3300005327 Bacteria 11186
25 Ga0070658_10016650 3300005327 Bacteria 5883
26 Ga0070658_10021183 3300005327 Bacteria 5208
27 Ga0070658_10028225 3300005327 Bacteria 4505
28 Ga0070658_10146558 3300005327 Bacteria 1974
29 Ga0070658_10252075 3300005327 Bacteria 1498
30 Ga0070658_10297209 3300005327 Bacteria 1376
31 Ga0070658_10325533 3300005327 Bacteria 1313
32 Ga0070676_10002080 3300005328 Bacteria 10184
33 Ga0070676_10008552 3300005328 Bacteria 5518
34 Ga0070676_10009207 3300005328 Bacteria 5338
35 Ga0070676_10009874 3300005328 Bacteria 5166
36 Ga0070683_100006919 3300005329 Bacteria 9532
37 Ga0070683_100012189 3300005329 Bacteria 7462
38 Ga0070683_100015781 3300005329 Bacteria 6640
39 Ga0070683_100032256 3300005329 Bacteria 4770
40 Ga0070683_100142843 3300005329 Bacteria 2267
41 Ga0070683_100151045 3300005329 Bacteria 2202
42 Ga0070690_100012720 3300005330 Bacteria 4955
43 Ga0070690_100042902 3300005330 Bacteria 2866
44 Ga0070690_100134126 3300005330 Bacteria 1675
45 Ga0070670_100001353 3300005331 Bacteria 19634
46 Ga0070670_100008746 3300005331 Bacteria 8646
47 Ga0070670_100032189 3300005331 Bacteria 4517
48 Ga0070670_100038102 3300005331 Bacteria 4134
49 Ga0070670_100105606 3300005331 Bacteria 2426
50 Ga0070670_100131201 3300005331 Bacteria 2164
51 Ga0070670_100220130 3300005331 Bacteria 1651
52 Ga0070670_100232103 3300005331 Bacteria 1606
53 Ga0070677_10000110 3300005333 Bacteria 26795
54 Ga0068869_100012867 3300005334 Bacteria 5540
55 Ga0068869_100015623 3300005334 Bacteria 5099
56 Ga0068869_100064331 3300005334 Bacteria 2697
57 Ga0068869_100078582 3300005334 Bacteria 2457
58 Ga0068869_100234090 3300005334 Bacteria 1461
59 Ga0068869_100270925 3300005334 Bacteria 1362
60 Ga0070666_10001273 3300005335 Bacteria 15250
61 Ga0070666_10040552 3300005335 Bacteria 3107
62 Ga0070666_10070705 3300005335 Bacteria 2374
63 Ga0070666_10187410 3300005335 Bacteria 1453
64 Ga0070666_10340621 3300005335 Bacteria 1072
65 Ga0070680_100028583 3300005336 Bacteria 4473
66 Ga0070680_100082259 3300005336 Bacteria 2657
67 Ga0070680_100129783 3300005336 Bacteria 2108
68 Ga0068868_100002706 3300005338 Bacteria 12298
69 Ga0068868_100080400 3300005338 Bacteria 2612
70 Ga0068868_100177232 3300005338 Bacteria 1767
71 Ga0068868_100246410 3300005338 Bacteria 1503
72 Ga0070660_100003196 3300005339 Bacteria 11261
73 Ga0070660_100015363 3300005339 Bacteria 5525
74 Ga0070660_100038166 3300005339 Bacteria 3645
75 Ga0070660_100041670 3300005339 Bacteria 3500
76 Ga0070660_100068544 3300005339 Bacteria 2765
77 Ga0070660_100160746 3300005339 Bacteria 1810
78 Ga0070660_100253827 3300005339 Bacteria 1435
79 Ga0070660_100316268 3300005339 Bacteria 1282
80 Ga0070689_100003000 3300005340 Bacteria 11102
81 Ga0070689_100030747 3300005340 Bacteria 4076
82 Ga0070689_100079246 3300005340 Bacteria 2576
83 Ga0070687_100019948 3300005343 Bacteria 3127
84 Ga0070687_100042290 3300005343 Bacteria 2308
85 Ga0070661_100002328 3300005344 Bacteria 13044
86 Ga0070661_100002858 3300005344 Bacteria 11869
87 Ga0070661_100007616 3300005344 Bacteria 7468
88 Ga0070661_100009841 3300005344 Bacteria 6632
89 Ga0070661_100013147 3300005344 Bacteria 5809
90 Ga0070661_100020626 3300005344 Bacteria 4701
91 Ga0070661_100093097 3300005344 Bacteria 2233
92 Ga0070661_100103772 3300005344 Bacteria 2117
93 Ga0070661_100127160 3300005344 Bacteria 1912
94 Ga0070661_100127416 3300005344 Bacteria 1910
95 Ga0070661_100198627 3300005344 Bacteria 1531
96 Ga0070692_10023349 3300005345 Bacteria 3030
97 Ga0070692_10049852 3300005345 Bacteria 2173
98 Ga0070668_100001262 3300005347 Bacteria 18067
99 Ga0070668_100003150 3300005347 Bacteria 12166
100 Ga0070668_100005925 3300005347 Bacteria 9059
101 Ga0070668_100006020 3300005347 Bacteria 8996
102 Ga0070668_100107682 3300005347 Bacteria 2215
103 Ga0070668_100117466 3300005347 Bacteria 2122
104 Ga0070669_100007697 3300005353 Bacteria 7701
105 Ga0070669_100012475 3300005353 Bacteria 6029
106 Ga0070669_100020170 3300005353 Bacteria 4760
107 Ga0070669_100087040 3300005353 Bacteria 2335
108 Ga0070675_100001224 3300005354 Bacteria 18668
109 Ga0070675_100001731 3300005354 Bacteria 16099
110 Ga0070675_100020955 3300005354 Bacteria 5220
111 Ga0070675_100035986 3300005354 Bacteria 4026
112 Ga0070675_100080009 3300005354 Bacteria 2724
113 Ga0070675_100214793 3300005354 Bacteria 1673
114 Ga0070671_100008129 3300005355 Bacteria 8398
115 Ga0070671_100010339 3300005355 Bacteria 7486
116 Ga0070671_100025515 3300005355 Bacteria 4850
117 Ga0070671_100033147 3300005355 Bacteria 4271
118 Ga0070671_100033312 3300005355 Bacteria 4259
119 Ga0070671_100034014 3300005355 Bacteria 4218
120 Ga0070671_100041370 3300005355 Bacteria 3830
121 Ga0070674_100000281 3300005356 Bacteria 24879
122 Ga0070674_100002429 3300005356 Bacteria 10301
123 Ga0070674_100003681 3300005356 Bacteria 8640
124 Ga0070674_100014235 3300005356 Bacteria 4941
125 Ga0070674_100016440 3300005356 Bacteria 4637
126 Ga0070674_100097692 3300005356 Bacteria 2133
127 Ga0070674_100402220 3300005356 Bacteria 1119
128 Ga0070673_100001293 3300005364 Bacteria 14580
129 Ga0070673_100014449 3300005364 Bacteria 5501
130 Ga0070673_100021463 3300005364 Bacteria 4683
131 Ga0070673_100046063 3300005364 Bacteria 3385
132 Ga0070673_100070687 3300005364 Bacteria 2802
133 Ga0070673_100128158 3300005364 Bacteria 2126
134 Ga0070673_100144417 3300005364 Bacteria 2010
135 Ga0070673_100198799 3300005364 Bacteria 1726
136 Ga0070688_100001354 3300005365 Bacteria 12169
137 Ga0070688_100002366 3300005365 Bacteria 9518
138 Ga0070659_100009750 3300005366 Bacteria 7058
139 Ga0070659_100014617 3300005366 Bacteria 5869
140 Ga0070659_100021722 3300005366 Bacteria 4893
141 Ga0070659_100024523 3300005366 Bacteria 4623
142 Ga0070659_100029139 3300005366 Bacteria 4265
143 Ga0070659_100148008 3300005366 Bacteria 1914
144 Ga0070659_100213888 3300005366 Bacteria 1589
145 Ga0070667_100002647 3300005367 Bacteria 15512
146 Ga0070667_100007248 3300005367 Bacteria 9212
147 Ga0070667_100019486 3300005367 Bacteria 5629
148 Ga0070667_100119394 3300005367 Bacteria 2293
149 Ga0070667_100134744 3300005367 Bacteria 2159
150 Ga0070667_100172614 3300005367 Bacteria 1909
151 Ga0070709_10016041 3300005434 Bacteria 4269
152 Ga0070709_10028498 3300005434 Bacteria 3331
153 Ga0070709_10048878 3300005434 Bacteria 2641
154 Ga0070714_100004236 3300005435 Bacteria 10802
155 Ga0070714_100085883 3300005435 Bacteria 2749
156 Ga0070714_100126120 3300005435 Bacteria 2282
157 Ga0070713_100056141 3300005436 Bacteria 3275
158 Ga0070710_10010524 3300005437 Bacteria 4546
159 Ga0070701_10005635 3300005438 Bacteria 5195
160 Ga0070711_100002733 3300005439 Bacteria 10119
161 Ga0070711_100050733 3300005439 Bacteria 2846
162 Ga0070711_100089823 3300005439 Bacteria 2211
163 Ga0070700_100017255 3300005441 Bacteria 4123
164 Ga0070708_100033437 3300005445 Bacteria 4467
165 Ga0070708_100235573 3300005445 Bacteria 1718
166 Ga0070663_100004048 3300005455 Bacteria 8557
167 Ga0070663_100006933 3300005455 Bacteria 6862
168 Ga0070663_100014606 3300005455 Bacteria 5045
169 Ga0070663_100116301 3300005455 Bacteria 2015
170 Ga0070663_100233320 3300005455 Bacteria 1450
171 Ga0070663_100263997 3300005455 Bacteria 1366
172 Ga0070663_100394314 3300005455 Bacteria 1130
173 Ga0070678_100001716 3300005456 Bacteria 11769
174 Ga0070678_100003910 3300005456 Bacteria 8375
175 Ga0070678_100005336 3300005456 Bacteria 7417
176 Ga0070678_100013613 3300005456 Bacteria 5109
177 Ga0070678_100018511 3300005456 Bacteria 4515
178 Ga0070678_100100101 3300005456 Bacteria 2244
179 Ga0070678_100153837 3300005456 Bacteria 1856
180 Ga0070678_100212692 3300005456 Bacteria 1603
181 Ga0070662_100000721 3300005457 Bacteria 20263
182 Ga0070662_100004835 3300005457 Bacteria 8537
183 Ga0070662_100068874 3300005457 Bacteria 2603
184 Ga0070662_100130333 3300005457 Bacteria 1938
185 Ga0070681_10000413 3300005458 Bacteria 34680
186 Ga0070681_10112882 3300005458 Bacteria 2657
187 Ga0070681_10187435 3300005458 Bacteria 1989
188 Ga0070681_10324597 3300005458 Bacteria 1449
189 Ga0068867_100000076 3300005459 Bacteria 59983
190 Ga0068867_100002927 3300005459 Bacteria 12032
191 Ga0068867_100010338 3300005459 Bacteria 6584
192 Ga0068867_100010405 3300005459 Bacteria 6563
193 Ga0068867_100030407 3300005459 Bacteria 3896
194 Ga0068867_100057073 3300005459 Bacteria 2891
195 Ga0068867_100063871 3300005459 Bacteria 2737
196 Ga0068867_100091242 3300005459 Bacteria 2312
197 Ga0068867_100091748 3300005459 Bacteria 2306
198 Ga0070685_10001322 3300005466 Bacteria 13022
199 Ga0070685_10001523 3300005466 Bacteria 12225
200 Ga0070685_10140690 3300005466 Bacteria 1519
201 Ga0070706_100007656 3300005467 Bacteria 10105
202 Ga0070706_100032233 3300005467 Bacteria 4833
203 Ga0070706_100102357 3300005467 Bacteria 2662
204 Ga0070707_100097289 3300005468 Bacteria 2851
205 Ga0070707_100099250 3300005468 Bacteria 2821
206 Ga0070707_100155510 3300005468 Bacteria 2227
207 Ga0070707_100221463 3300005468 Bacteria 1843
208 Ga0070698_100091533 3300005471 Bacteria 3024
209 Ga0070699_100004993 3300005518 Bacteria 11696
210 Ga0070699_100024281 3300005518 Bacteria 5223
211 Ga0070699_100084335 3300005518 Bacteria 2772
212 Ga0070699_100162481 3300005518 Bacteria 1977
213 Ga0070679_100001227 3300005530 Bacteria 22510
214 Ga0070679_100032042 3300005530 Bacteria 5197
215 Ga0070679_100058921 3300005530 Bacteria 3827
216 Ga0070679_100091089 3300005530 Bacteria 3037
217 Ga0070679_100124627 3300005530 Bacteria 2559
218 Ga0070684_100006324 3300005535 Bacteria 9152
219 Ga0070684_100007308 3300005535 Bacteria 8583
220 Ga0070684_100019383 3300005535 Bacteria 5626
221 Ga0070684_100034421 3300005535 Bacteria 4331
222 Ga0070684_100305629 3300005535 Bacteria 1460
223 Ga0070697_100255099 3300005536 Bacteria 1500
224 Ga0068853_100001754 3300005539 Bacteria 15915
225 Ga0068853_100006320 3300005539 Bacteria 9402
226 Ga0068853_100012996 3300005539 Bacteria 6788
227 Ga0068853_100017300 3300005539 Bacteria 5952
228 Ga0068853_100019057 3300005539 Bacteria 5685
229 Ga0068853_100030917 3300005539 Bacteria 4525
230 Ga0068853_100129921 3300005539 Bacteria 2254
231 Ga0068853_100182743 3300005539 Bacteria 1902
232 Ga0068853_100278580 3300005539 Bacteria 1541
233 Ga0070672_100000121 3300005543 Bacteria 40117
234 Ga0070672_100000724 3300005543 Bacteria 19541
235 Ga0070672_100006701 3300005543 Bacteria 7763
236 Ga0070672_100007386 3300005543 Bacteria 7452
237 Ga0070672_100023411 3300005543 Bacteria 4553
238 Ga0070672_100044854 3300005543 Bacteria 3416
239 Ga0070672_100049179 3300005543 Bacteria 3279
240 Ga0070672_100127203 3300005543 Bacteria 2091
241 Ga0070672_100135358 3300005543 Bacteria 2029
242 Ga0070686_100015482 3300005544 Bacteria 4419
243 Ga0070695_100061764 3300005545 Bacteria 2431
244 Ga0070695_100128804 3300005545 Bacteria 1742
245 Ga0070696_100017248 3300005546 Bacteria 4872
246 Ga0070696_100038720 3300005546 Bacteria 3291
247 Ga0070696_100118507 3300005546 Bacteria 1914
248 Ga0070693_100001243 3300005547 Bacteria 11519
249 Ga0070665_100002011 3300005548 Bacteria 22862
250 Ga0070665_100003069 3300005548 Bacteria 17984
251 Ga0070665_100008870 3300005548 Bacteria 10182
252 Ga0070665_100104125 3300005548 Bacteria 2840
253 Ga0070665_100112883 3300005548 Bacteria 2720
254 Ga0070665_100305700 3300005548 Bacteria 1593
255 Ga0070704_100012540 3300005549 Bacteria 5236
256 Ga0068855_100000453 3300005563 Bacteria 50677
257 Ga0068855_100015192 3300005563 Bacteria 9272
258 Ga0068855_100030735 3300005563 Bacteria 6421
259 Ga0068855_100069746 3300005563 Bacteria 4090
260 Ga0068855_100102570 3300005563 Bacteria 3293
261 Ga0068855_100214938 3300005563 Bacteria 2159
262 Ga0070664_100000225 3300005564 Bacteria 40336
263 Ga0070664_100001099 3300005564 Bacteria 21380
264 Ga0070664_100003164 3300005564 Bacteria 13302
265 Ga0070664_100025828 3300005564 Bacteria 4870
266 Ga0070664_100042812 3300005564 Bacteria 3821
267 Ga0070664_100052164 3300005564 Bacteria 3463
268 Ga0070664_100069951 3300005564 Bacteria 3004
269 Ga0070664_100140517 3300005564 Bacteria 2126
270 Ga0070664_100183684 3300005564 Bacteria 1860
271 Ga0070664_100216952 3300005564 Bacteria 1711
272 Ga0068857_100019014 3300005577 Bacteria 6027
273 Ga0068857_100039154 3300005577 Bacteria 4199
274 Ga0068857_100046513 3300005577 Bacteria 3851
275 Ga0068854_100001711 3300005578 Bacteria 13371
276 Ga0068854_100002211 3300005578 Bacteria 11975
277 Ga0068854_100008998 3300005578 Bacteria 6434
278 Ga0068854_100012434 3300005578 Bacteria 5574
279 Ga0068854_100029754 3300005578 Bacteria 3783
280 Ga0068854_100165657 3300005578 Bacteria 1716
281 Ga0068856_100000980 3300005614 Bacteria 30458
282 Ga0068856_100007412 3300005614 Bacteria 10706
283 Ga0068856_100007820 3300005614 Bacteria 10439
284 Ga0068856_100010154 3300005614 Bacteria 9150
285 Ga0068856_100018411 3300005614 Bacteria 6769
286 Ga0068856_100024027 3300005614 Bacteria 5930
287 Ga0068856_100082117 3300005614 Bacteria 3198
288 Ga0068856_100631791 3300005614 Bacteria 1091
289 Ga0070702_100017945 3300005615 Bacteria 3660
290 Ga0068852_100005521 3300005616 Bacteria 9065
291 Ga0068852_100005781 3300005616 Bacteria 8881
292 Ga0068852_100011366 3300005616 Bacteria 6698
293 Ga0068852_100048531 3300005616 Bacteria 3628
294 Ga0068852_100052531 3300005616 Bacteria 3503
295 Ga0068852_100053251 3300005616 Bacteria 3482
296 Ga0068852_100059604 3300005616 Bacteria 3311
297 Ga0068852_100087899 3300005616 Bacteria 2774
298 Ga0068852_100094816 3300005616 Bacteria 2678
299 Ga0068852_100102441 3300005616 Bacteria 2587
300 Ga0068852_100128372 3300005616 Bacteria 2332
301 Ga0068852_100144730 3300005616 Bacteria 2203
302 Ga0068852_100153040 3300005616 Bacteria 2147
303 Ga0068852_100183434 3300005616 Bacteria 1969
304 Ga0068859_100008179 3300005617 Bacteria 10608
305 Ga0068859_100019260 3300005617 Bacteria 6857
306 Ga0068859_100120357 3300005617 Bacteria 2692
307 Ga0068859_100138766 3300005617 Bacteria 2505
308 Ga0068859_100224881 3300005617 Bacteria 1965
309 Ga0068864_100003021 3300005618 Bacteria 13903
310 Ga0068864_100003215 3300005618 Bacteria 13492
311 Ga0068864_100003388 3300005618 Bacteria 13175
312 Ga0068864_100004994 3300005618 Bacteria 10869
313 Ga0068864_100006896 3300005618 Bacteria 9311
314 Ga0068864_100012967 3300005618 Bacteria 6897
315 Ga0068864_100012983 3300005618 Bacteria 6894
316 Ga0068864_100017103 3300005618 Bacteria 6046
317 Ga0068864_100043933 3300005618 Bacteria 3827
318 Ga0068864_100051250 3300005618 Bacteria 3555
319 Ga0068864_100186145 3300005618 Bacteria 1901
320 Ga0068866_10001300 3300005718 Bacteria 10812
321 Ga0068866_10003042 3300005718 Bacteria 6920
322 Ga0068866_10056168 3300005718 Bacteria 2024
323 Ga0068861_100003681 3300005719 Bacteria 10226
324 Ga0068861_100019950 3300005719 Bacteria 4793
325 Ga0068861_100074947 3300005719 Bacteria 2633
326 Ga0068861_100252661 3300005719 Bacteria 1505
327 Ga0068851_10001504 3300005834 Bacteria 10227
328 Ga0068851_10001952 3300005834 Bacteria 9062
329 Ga0068851_10005110 3300005834 Bacteria 5947
330 Ga0068870_10004649 3300005840 Bacteria 5921
331 Ga0068870_10011360 3300005840 Bacteria 4127
332 Ga0068863_100002944 3300005841 Bacteria 16823
333 Ga0068863_100006136 3300005841 Bacteria 11785
334 Ga0068863_100012415 3300005841 Bacteria 8226
335 Ga0068863_100078939 3300005841 Bacteria 3117
336 Ga0068863_100106689 3300005841 Bacteria 2665
337 Ga0068863_100211302 3300005841 Bacteria 1869
338 Ga0068863_100265844 3300005841 Bacteria 1659
339 Ga0068863_100359834 3300005841 Bacteria 1418
340 Ga0068858_100001489 3300005842 Bacteria 24134
341 Ga0068858_100001809 3300005842 Bacteria 21766
342 Ga0068858_100009131 3300005842 Bacteria 9478
343 Ga0068858_100012375 3300005842 Bacteria 8044
344 Ga0068858_100014246 3300005842 Bacteria 7497
345 Ga0068858_100073212 3300005842 Bacteria 3181
346 Ga0068860_100030385 3300005843 Bacteria 5196
347 Ga0068860_100036536 3300005843 Bacteria 4706
348 Ga0068860_100070370 3300005843 Bacteria 3326
349 Ga0068860_100109777 3300005843 Bacteria 2636
350 Ga0068860_100225374 3300005843 Bacteria 1821
351 Ga0068862_100032352 3300005844 Bacteria 4419
352 Ga0068862_100036091 3300005844 Bacteria 4188
353 Ga0068862_100501604 3300005844 Bacteria 1152
354 Ga0075365_10107573 3300006038 Bacteria 1915
355 Ga0075365_10160636 3300006038 Bacteria 1565
356 Ga0075368_10015453 3300006042 Bacteria 2833
357 Ga0075363_100018085 3300006048 Bacteria 3505
358 Ga0075364_10053083 3300006051 Bacteria 2649
359 Ga0075364_10069798 3300006051 Bacteria 2312
360 Ga0070716_100011574 3300006173 Bacteria 4445
361 Ga0075367_10071027 3300006178 Bacteria 2094
362 Ga0075369_10011589 3300006186 Bacteria 3471
363 Ga0075366_10073654 3300006195 Bacteria 2036
364 Ga0075366_10111179 3300006195 Bacteria 1648
365 Ga0075366_10145124 3300006195 Bacteria 1436
366 Ga0097621_100013385 3300006237 Bacteria 6115
367 Ga0097621_100014480 3300006237 Bacteria 5902
368 Ga0097621_100015566 3300006237 Bacteria 5728
369 Ga0097621_100024903 3300006237 Bacteria 4678
370 Ga0097621_100038425 3300006237 Bacteria 3841
371 Ga0097621_100223620 3300006237 Bacteria 1641
372 Ga0097621_100363334 3300006237 Bacteria 1290
373 Ga0075370_10000588 3300006353 Bacteria 14049
374 Ga0075370_10007627 3300006353 Bacteria 5521
375 Ga0075370_10015758 3300006353 Bacteria 4054
376 Ga0075370_10016857 3300006353 Bacteria 3938
377 Ga0075370_10026463 3300006353 Bacteria 3214
378 Ga0075370_10096251 3300006353 Bacteria 1710
379 Ga0068871_100007455 3300006358 Bacteria 7820
380 Ga0068871_100007492 3300006358 Bacteria 7807
381 Ga0068871_100023997 3300006358 Bacteria 4726
382 Ga0068871_100047622 3300006358 Bacteria 3458
383 Ga0068871_100064259 3300006358 Bacteria 3005
384 Ga0068871_100503920 3300006358 Bacteria 1091
385 Ga0075431_100125652 3300006847 Bacteria 2646
386 Ga0075433_10051025 3300006852 Bacteria 3601
387 Ga0075434_100005141 3300006871 Bacteria 11879
388 Ga0075434_100316150 3300006871 Bacteria 1582
389 Ga0075429_100012528 3300006880 Bacteria 7357
390 Ga0068865_100002377 3300006881 Bacteria 11089
391 Ga0068865_100036709 3300006881 Bacteria 3305
392 Ga0068865_100110781 3300006881 Bacteria 2025
393 Ga0068865_100124275 3300006881 Bacteria 1924
394 Ga0075436_100000450 3300006914 Bacteria 26442
395 Ga0075436_100040453 3300006914 Bacteria 3217
396 Ga0075436_100049197 3300006914 Bacteria 2909
397 Ga0075436_100097161 3300006914 Bacteria 2049
398 Ga0097620_100008179 3300006931 Bacteria 10608
399 Ga0097620_100019260 3300006931 Bacteria 6857
400 Ga0097620_100120356 3300006931 Bacteria 2692
401 Ga0097620_100138763 3300006931 Bacteria 2505
402 Ga0097620_100224901 3300006931 Bacteria 1965
403 Ga0099823_1000028 3300006944 Bacteria 69723
404 Ga0079104_1000233 3300006946 Bacteria 75184
405 Ga0075435_100015802 3300007076 Bacteria 5681
406 Ga0105240_10008957 3300009093 Bacteria 14229
407 Ga0105240_10024631 3300009093 Bacteria 7928
408 Ga0105240_10046164 3300009093 Bacteria 5522
409 Ga0111539_10037540 3300009094 Bacteria 5848
410 Ga0105245_10023867 3300009098 Bacteria 5367
411 Ga0105245_10132843 3300009098 Bacteria 2336
412 Ga0105245_10136895 3300009098 Bacteria 2302
413 Ga0105245_10332858 3300009098 Bacteria 1499
414 Ga0105245_10378274 3300009098 Bacteria 1409
415 Ga0105247_10028923 3300009101 Bacteria 3355
416 Ga0105247_10145471 3300009101 Bacteria 1557
417 Ga0105247_10148766 3300009101 Bacteria 1541
418 Ga0114129_10161325 3300009147 Bacteria 3062
419 Ga0114129_10294619 3300009147 Bacteria 2164
420 Ga0114129_10600994 3300009147 Bacteria 1425
421 Ga0105243_10005306 3300009148 Bacteria 10073
422 Ga0105243_10022010 3300009148 Bacteria 4842
423 Ga0105243_10038828 3300009148 Bacteria 3709
424 Ga0105243_10043773 3300009148 Bacteria 3509
425 Ga0105243_10272335 3300009148 Bacteria 1521
426 Ga0105241_10001246 3300009174 Bacteria 19419
427 Ga0105241_10018060 3300009174 Bacteria 5185
428 Ga0105241_10431362 3300009174 Bacteria 1162
429 Ga0105242_10064186 3300009176 Bacteria 3026
430 Ga0105242_10066151 3300009176 Bacteria 2984
431 Ga0105242_10099391 3300009176 Bacteria 2463
432 Ga0105242_10140587 3300009176 Bacteria 2094
433 Ga0105242_10374105 3300009176 Bacteria 1322
434 Ga0105242_10594179 3300009176 Bacteria 1068
435 Ga0105248_10002109 3300009177 Bacteria 22030
436 Ga0105248_10003500 3300009177 Bacteria 17423
437 Ga0105248_10041720 3300009177 Bacteria 5145
438 Ga0105248_10103598 3300009177 Bacteria 3208
439 Ga0105248_10108637 3300009177 Bacteria 3128
440 Ga0105248_10197642 3300009177 Bacteria 2266
441 Ga0105248_10262360 3300009177 Bacteria 1945
442 Ga0105237_10002827 3300009545 Bacteria 21113
443 Ga0105237_10036249 3300009545 Bacteria 4989
444 Ga0105237_10051155 3300009545 Bacteria 4150
445 Ga0105238_10000931 3300009551 Bacteria 29986
446 Ga0105238_10011759 3300009551 Bacteria 8822
447 Ga0105238_10021461 3300009551 Bacteria 6577
448 Ga0105238_10121296 3300009551 Bacteria 2594
449 Ga0105238_10317688 3300009551 Bacteria 1543
450 Ga0105238_10320999 3300009551 Bacteria 1535
451 Ga0105238_10344764 3300009551 Bacteria 1478
452 Ga0105249_10053561 3300009553 Bacteria 3688
453 Ga0105249_10131014 3300009553 Bacteria 2394
454 Ga0105249_10231327 3300009553 Bacteria 1823
455 Ga0105239_10003016 3300010375 Bacteria 20980
456 Ga0105239_10047674 3300010375 Bacteria 4695
457 Ga0105239_10152516 3300010375 Bacteria 2579
458 Ga0105239_10168187 3300010375 Bacteria 2451
459 Ga0105239_10278259 3300010375 Bacteria 1883
460 Ga0105239_10338345 3300010375 Bacteria 1698
461 Ga0105239_10738454 3300010375 Bacteria 1126
462 Ga0105246_10051067 3300011119 Bacteria 2838
463 Ga0105246_10107836 3300011119 Bacteria 2040
464 Ga0157319_1000018 3300012497 Bacteria 98831
465 Ga0157373_10000649 3300013100 Bacteria 27382
466 Ga0157373_10001504 3300013100 Bacteria 17780
467 Ga0157373_10008726 3300013100 Bacteria 7515
468 Ga0157373_10038750 3300013100 Bacteria 3415
469 Ga0157373_10093769 3300013100 Bacteria 2114
470 Ga0157371_10000638 3300013102 Bacteria 41588
471 Ga0157371_10032114 3300013102 Bacteria 3779
472 Ga0157371_10038122 3300013102 Bacteria 3439
473 Ga0157371_10064586 3300013102 Bacteria 2593
474 Ga0157371_10155259 3300013102 Bacteria 1633
475 Ga0157370_10002443 3300013104 Bacteria 22408
476 Ga0157370_10005978 3300013104 Bacteria 13542
477 Ga0157370_10011477 3300013104 Bacteria 9261
478 Ga0157370_10012817 3300013104 Bacteria 8667
479 Ga0157370_10029242 3300013104 Bacteria 5412
480 Ga0157370_10050818 3300013104 Bacteria 3961
481 Ga0157370_10073452 3300013104 Bacteria 3227
482 Ga0157370_10117936 3300013104 Bacteria 2480
483 Ga0157370_10275977 3300013104 Bacteria 1553
484 Ga0157370_10293931 3300013104 Bacteria 1500
485 Ga0157369_10003589 3300013105 Bacteria 18428
486 Ga0157369_10084966 3300013105 Bacteria 3382
487 Ga0157369_10088888 3300013105 Bacteria 3298
488 Ga0157369_10215608 3300013105 Bacteria 2011
489 Ga0157369_10478974 3300013105 Bacteria 1288
490 Ga0157374_10013256 3300013296 Bacteria 7191
491 Ga0157374_10014532 3300013296 Bacteria 6890
492 Ga0157374_10025251 3300013296 Bacteria 5331
493 Ga0157374_10025342 3300013296 Bacteria 5324
494 Ga0157374_10046648 3300013296 Bacteria 4014
495 Ga0157374_10049943 3300013296 Bacteria 3886
496 Ga0157374_10254048 3300013296 Bacteria 1730
497 Ga0157374_10460869 3300013296 Bacteria 1273
498 Ga0157374_10586127 3300013296 Bacteria 1124
499 Ga0157378_10015438 3300013297 Bacteria 6690
500 Ga0157378_10019789 3300013297 Bacteria 5920
501 Ga0157378_10108058 3300013297 Bacteria 2547
502 Ga0157378_10376176 3300013297 Bacteria 1394
503 Ga0163162_10010226 3300013306 Bacteria 9115
504 Ga0163162_10030008 3300013306 Bacteria 5384
505 Ga0163162_10219859 3300013306 Bacteria 2029
506 Ga0157372_10039758 3300013307 Bacteria 5192
507 Ga0157372_10045419 3300013307 Bacteria 4873
508 Ga0157372_10084764 3300013307 Bacteria 3593
509 Ga0157372_10097486 3300013307 Bacteria 3353
510 Ga0157372_10098850 3300013307 Bacteria 3329
511 Ga0157372_10136264 3300013307 Bacteria 2827
512 Ga0157375_10000552 3300013308 Bacteria 33621
513 Ga0157375_10104651 3300013308 Bacteria 2919
514 Ga0157375_10105087 3300013308 Bacteria 2913
515 Ga0157375_10201464 3300013308 Bacteria 2146
516 Ga0157375_10342380 3300013308 Bacteria 1661
517 Ga0157375_10765066 3300013308 Bacteria 1116
518 Ga0163163_10014450 3300014325 Bacteria 7256
519 Ga0163163_10033485 3300014325 Bacteria 4971
520 Ga0163163_10072501 3300014325 Bacteria 3433
521 Ga0163163_10101651 3300014325 Bacteria 2897
522 Ga0157380_10010386 3300014326 Bacteria 6697
523 Ga0157380_10038888 3300014326 Bacteria 3696
524 Ga0157380_10110771 3300014326 Bacteria 2306
525 Ga0157377_10000006 3300014745 Bacteria 419853
526 Ga0157377_10017024 3300014745 Bacteria 3754
527 Ga0157377_10177573 3300014745 Bacteria 1336
528 Ga0157379_10008664 3300014968 Bacteria 8859
529 Ga0157379_10014570 3300014968 Bacteria 6896
530 Ga0157379_10019963 3300014968 Bacteria 5921
531 Ga0157379_10055126 3300014968 Bacteria 3552
532 Ga0157379_10101584 3300014968 Bacteria 2581
533 Ga0157379_10119953 3300014968 Bacteria 2365
534 Ga0157379_10413034 3300014968 Bacteria 1242
535 Ga0157376_10002032 3300014969 Bacteria 13573
536 Ga0157376_10016427 3300014969 Bacteria 5619
537 Ga0157376_10275772 3300014969 Bacteria 1581
538 Ga0163161_10011419 3300017792 Bacteria 6160
539 Ga0163161_10022976 3300017792 Bacteria 4394
540 Ga0163161_10031806 3300017792 Bacteria 3763
541 Ga0163161_10081871 3300017792 Bacteria 2378
542 Ga0163161_10088263 3300017792 Bacteria 2292
543 Ga0163161_10185645 3300017792 Bacteria 1596
544 Ga0163161_10350400 3300017792 Bacteria 1173
545 Ga0213872_10000299 3300021361 Bacteria 42359
546 Ga0213872_10001215 3300021361 Bacteria 17431
547 Ga0213872_10005774 3300021361 Bacteria 6293
548 Ga0213872_10011797 3300021361 Bacteria 4129
549 Ga0209563_100112 3300025230 Bacteria 136524
550 Ga0209258_106994 3300025242 Bacteria 1710
551 Ga0209759_1001653 3300025256 Bacteria 11725
552 Ga0209673_1002680 3300025273 Bacteria 11863
553 Ga0209564_1000131 3300025295 Bacteria 192177
554 Ga0209758_1000367 3300025297 Bacteria 80207
555 Ga0209050_1000596 3300025298 Bacteria 57689
556 Ga0209050_1001057 3300025298 Bacteria 33847
557 Ga0209050_1002537 3300025298 Bacteria 15264
558 Ga0209256_1001842 3300025299 Bacteria 19699
559 Ga0209256_1001867 3300025299 Bacteria 19447
560 Ga0209051_1000148 3300025303 Bacteria 132600
561 Ga0209051_1000953 3300025303 Bacteria 28382
562 Ga0209051_1001133 3300025303 Bacteria 24392
563 Ga0209051_1017641 3300025303 Bacteria 3184
564 Ga0209257_1000016 3300025304 Bacteria 908015
565 Ga0209257_1000380 3300025304 Bacteria 88824
566 Ga0209257_1001173 3300025304 Bacteria 33131
567 Ga0209257_1001971 3300025304 Bacteria 22101
568 Ga0209257_1010980 3300025304 Bacteria 4452
569 Ga0209257_1011952 3300025304 Bacteria 4091
570 Ga0207697_10000014 3300025315 Bacteria 59917
571 Ga0207656_10004561 3300025321 Bacteria 4848
572 Ga0207656_10011011 3300025321 Bacteria 3405
573 Ga0207656_10017951 3300025321 Bacteria 2778
574 Ga0207656_10049367 3300025321 Bacteria 1814
575 Ga0207682_10000063 3300025893 Bacteria 46817
576 Ga0207682_10000095 3300025893 Bacteria 41132
577 Ga0207682_10008608 3300025893 Bacteria 4034
578 Ga0207682_10008799 3300025893 Bacteria 3992
579 Ga0207682_10035747 3300025893 Bacteria 2008
580 Ga0207642_10001503 3300025899 Bacteria 7183
581 Ga0207642_10010704 3300025899 Bacteria 3245
582 Ga0207688_10003995 3300025901 Bacteria 8034
583 Ga0207680_10015227 3300025903 Bacteria 4008
584 Ga0207680_10052613 3300025903 Bacteria 2441
585 Ga0207680_10053699 3300025903 Bacteria 2420
586 Ga0207680_10071438 3300025903 Bacteria 2152
587 Ga0207680_10115127 3300025903 Bacteria 1751
588 Ga0207699_10057676 3300025906 Bacteria 2320
589 Ga0207645_10000195 3300025907 Bacteria 49424
590 Ga0207645_10000272 3300025907 Bacteria 42718
591 Ga0207645_10007040 3300025907 Bacteria 8006
592 Ga0207645_10043389 3300025907 Bacteria 2878
593 Ga0207645_10046857 3300025907 Bacteria 2761
594 Ga0207645_10188371 3300025907 Bacteria 1355
595 Ga0207645_10245835 3300025907 Bacteria 1183
596 Ga0207643_10001264 3300025908 Bacteria 14806
597 Ga0207643_10015155 3300025908 Bacteria 4193
598 Ga0207643_10087762 3300025908 Bacteria 1809
599 Ga0207705_10019028 3300025909 Bacteria 4912
600 Ga0207705_10068271 3300025909 Bacteria 2574
601 Ga0207705_10109288 3300025909 Bacteria 2041
602 Ga0207705_10130123 3300025909 Bacteria 1873
603 Ga0207684_10010783 3300025910 Bacteria 8021
604 Ga0207684_10017161 3300025910 Bacteria 6213
605 Ga0207654_10040018 3300025911 Bacteria 2640
606 Ga0207707_10003509 3300025912 Bacteria 13888
607 Ga0207707_10013024 3300025912 Bacteria 7241
608 Ga0207707_10038346 3300025912 Bacteria 4187
609 Ga0207707_10161743 3300025912 Bacteria 1957
610 Ga0207695_10004581 3300025913 Bacteria 18783
611 Ga0207695_10005581 3300025913 Bacteria 16617
612 Ga0207671_10002906 3300025914 Bacteria 17691
613 Ga0207671_10113162 3300025914 Bacteria 2067
614 Ga0207671_10445060 3300025914 Bacteria 1032
615 Ga0207693_10000153 3300025915 Bacteria 63886
616 Ga0207693_10014403 3300025915 Bacteria 6359
617 Ga0207693_10050525 3300025915 Bacteria 3265
618 Ga0207663_10036617 3300025916 Bacteria 2953
619 Ga0207660_10005727 3300025917 Bacteria 8062
620 Ga0207660_10102503 3300025917 Bacteria 2139
621 Ga0207660_10266821 3300025917 Bacteria 1355
622 Ga0207662_10008788 3300025918 Bacteria 5541
623 Ga0207662_10112987 3300025918 Bacteria 1695
624 Ga0207657_10000409 3300025919 Bacteria 45340
625 Ga0207657_10004564 3300025919 Bacteria 14645
626 Ga0207657_10006048 3300025919 Bacteria 12581
627 Ga0207657_10035422 3300025919 Bacteria 4476
628 Ga0207657_10037570 3300025919 Bacteria 4322
629 Ga0207657_10043449 3300025919 Bacteria 3958
630 Ga0207657_10043737 3300025919 Bacteria 3942
631 Ga0207657_10114852 3300025919 Bacteria 2219
632 Ga0207657_10151935 3300025919 Bacteria 1885
633 Ga0207657_10162359 3300025919 Bacteria 1814
634 Ga0207657_10222252 3300025919 Bacteria 1513
635 Ga0207649_10003601 3300025920 Bacteria 8464
636 Ga0207649_10007126 3300025920 Bacteria 6079
637 Ga0207649_10007390 3300025920 Bacteria 5977
638 Ga0207649_10019187 3300025920 Bacteria 3905
639 Ga0207649_10056447 3300025920 Bacteria 2452
640 Ga0207652_10002018 3300025921 Bacteria 17506
641 Ga0207652_10030735 3300025921 Bacteria 4501
642 Ga0207652_10239563 3300025921 Bacteria 1635
643 Ga0207646_10021842 3300025922 Bacteria 5906
644 Ga0207646_10072499 3300025922 Bacteria 3076
645 Ga0207646_10160640 3300025922 Bacteria 2027
646 Ga0207681_10113098 3300025923 Bacteria 1978
647 Ga0207694_10012399 3300025924 Bacteria 6423
648 Ga0207694_10051392 3300025924 Bacteria 3195
649 Ga0207694_10123967 3300025924 Bacteria 2065
650 Ga0207694_10246142 3300025924 Bacteria 1462
651 Ga0207694_10247391 3300025924 Bacteria 1458
652 Ga0207694_10296665 3300025924 Bacteria 1330
653 Ga0207650_10000846 3300025925 Bacteria 23178
654 Ga0207650_10001899 3300025925 Bacteria 14741
655 Ga0207650_10004762 3300025925 Bacteria 9269
656 Ga0207650_10006005 3300025925 Bacteria 8284
657 Ga0207650_10009384 3300025925 Bacteria 6687
658 Ga0207650_10013079 3300025925 Bacteria 5740
659 Ga0207650_10036806 3300025925 Bacteria 3562
660 Ga0207650_10067924 3300025925 Bacteria 2676
661 Ga0207650_10161341 3300025925 Bacteria 1776
662 Ga0207659_10002575 3300025926 Bacteria 10800
663 Ga0207659_10004373 3300025926 Bacteria 8539
664 Ga0207659_10006715 3300025926 Bacteria 7069
665 Ga0207659_10010964 3300025926 Bacteria 5710
666 Ga0207659_10057886 3300025926 Bacteria 2781
667 Ga0207659_10083027 3300025926 Bacteria 2374
668 Ga0207659_10088744 3300025926 Bacteria 2304
669 Ga0207659_10241261 3300025926 Bacteria 1462
670 Ga0207687_10006544 3300025927 Bacteria 7694
671 Ga0207687_10153484 3300025927 Bacteria 1760
672 Ga0207700_10036066 3300025928 Bacteria 3568
673 Ga0207700_10059555 3300025928 Bacteria 2888
674 Ga0207664_10008735 3300025929 Bacteria 7083
675 Ga0207664_10030560 3300025929 Bacteria 4114
676 Ga0207644_10004197 3300025931 Bacteria 9351
677 Ga0207644_10006681 3300025931 Bacteria 7515
678 Ga0207644_10011530 3300025931 Bacteria 5851
679 Ga0207644_10012979 3300025931 Bacteria 5543
680 Ga0207644_10017416 3300025931 Bacteria 4850
681 Ga0207644_10025283 3300025931 Bacteria 4083
682 Ga0207644_10053412 3300025931 Bacteria 2907
683 Ga0207644_10059361 3300025931 Bacteria 2766
684 Ga0207644_10068055 3300025931 Bacteria 2597
685 Ga0207644_10093222 3300025931 Bacteria 2248
686 Ga0207644_10191165 3300025931 Bacteria 1609
687 Ga0207690_10011683 3300025932 Bacteria 5251
688 Ga0207690_10019689 3300025932 Bacteria 4160
689 Ga0207690_10284496 3300025932 Bacteria 1289
690 Ga0207690_10288491 3300025932 Bacteria 1280
691 Ga0207690_10433819 3300025932 Bacteria 1053
692 Ga0207706_10000232 3300025933 Bacteria 60892
693 Ga0207706_10009312 3300025933 Bacteria 9017
694 Ga0207706_10014346 3300025933 Bacteria 7181
695 Ga0207706_10017282 3300025933 Bacteria 6500
696 Ga0207706_10064159 3300025933 Bacteria 3233
697 Ga0207706_10085827 3300025933 Bacteria 2767
698 Ga0207686_10008700 3300025934 Bacteria 5484
699 Ga0207709_10010741 3300025935 Bacteria 5044
700 Ga0207709_10038651 3300025935 Bacteria 2844
701 Ga0207709_10096773 3300025935 Bacteria 1942
702 Ga0207670_10037114 3300025936 Bacteria 3174
703 Ga0207670_10062133 3300025936 Bacteria 2552
704 Ga0207670_10128255 3300025936 Bacteria 1854
705 Ga0207669_10000968 3300025937 Bacteria 12162
706 Ga0207669_10008441 3300025937 Bacteria 4837
707 Ga0207669_10015132 3300025937 Bacteria 3882
708 Ga0207669_10023946 3300025937 Bacteria 3272
709 Ga0207669_10065278 3300025937 Bacteria 2257
710 Ga0207669_10151151 3300025937 Bacteria 1626
711 Ga0207704_10033559 3300025938 Bacteria 2920
712 Ga0207704_10098281 3300025938 Bacteria 1944
713 Ga0207704_10273462 3300025938 Bacteria 1280
714 Ga0207665_10003325 3300025939 Bacteria 10770
715 Ga0207665_10048457 3300025939 Bacteria 2852
716 Ga0207665_10050819 3300025939 Bacteria 2789
717 Ga0207691_10000175 3300025940 Bacteria 60250
718 Ga0207691_10000370 3300025940 Bacteria 45317
719 Ga0207691_10000406 3300025940 Bacteria 43071
720 Ga0207691_10004936 3300025940 Bacteria 12872
721 Ga0207691_10006303 3300025940 Bacteria 11451
722 Ga0207691_10006393 3300025940 Bacteria 11380
723 Ga0207691_10014981 3300025940 Bacteria 7382
724 Ga0207691_10043866 3300025940 Bacteria 4119
725 Ga0207691_10078079 3300025940 Bacteria 2981
726 Ga0207691_10081812 3300025940 Bacteria 2902
727 Ga0207691_10125516 3300025940 Bacteria 2271
728 Ga0207691_10143884 3300025940 Bacteria 2100
729 Ga0207711_10000677 3300025941 Bacteria 33809
730 Ga0207711_10011337 3300025941 Bacteria 7404
731 Ga0207711_10048113 3300025941 Bacteria 3648
732 Ga0207711_10059114 3300025941 Bacteria 3300
733 Ga0207711_10064515 3300025941 Bacteria 3164
734 Ga0207711_10075441 3300025941 Bacteria 2935
735 Ga0207711_10091407 3300025941 Bacteria 2677
736 Ga0207711_10141991 3300025941 Bacteria 2161
737 Ga0207711_10257234 3300025941 Bacteria 1604
738 Ga0207711_10371780 3300025941 Bacteria 1326
739 Ga0207689_10002874 3300025942 Bacteria 15876
740 Ga0207689_10003356 3300025942 Bacteria 14651
741 Ga0207689_10006514 3300025942 Bacteria 10309
742 Ga0207689_10017634 3300025942 Bacteria 6035
743 Ga0207689_10030246 3300025942 Bacteria 4513
744 Ga0207689_10260367 3300025942 Bacteria 1435
745 Ga0207661_10005335 3300025944 Bacteria 9047
746 Ga0207661_10045320 3300025944 Bacteria 3480
747 Ga0207661_10082591 3300025944 Bacteria 2656
748 Ga0207661_10115910 3300025944 Bacteria 2274
749 Ga0207661_10128142 3300025944 Bacteria 2170
750 Ga0207661_10236884 3300025944 Bacteria 1618
751 Ga0207679_10007974 3300025945 Bacteria 6734
752 Ga0207679_10012424 3300025945 Bacteria 5553
753 Ga0207679_10016751 3300025945 Bacteria 4870
754 Ga0207679_10030704 3300025945 Bacteria 3754
755 Ga0207679_10133208 3300025945 Bacteria 1997
756 Ga0207679_10209639 3300025945 Bacteria 1633
757 Ga0207667_10000860 3300025949 Bacteria 39081
758 Ga0207667_10001380 3300025949 Bacteria 30442
759 Ga0207667_10003655 3300025949 Bacteria 18970
760 Ga0207667_10008779 3300025949 Bacteria 11969
761 Ga0207667_10030332 3300025949 Bacteria 5851
762 Ga0207667_10128814 3300025949 Bacteria 2606
763 Ga0207667_10199460 3300025949 Bacteria 2053
764 Ga0207667_10319761 3300025949 Bacteria 1585
765 Ga0207667_10380813 3300025949 Bacteria 1437
766 Ga0207651_10002106 3300025960 Bacteria 9396
767 Ga0207651_10012926 3300025960 Bacteria 4750
768 Ga0207651_10021398 3300025960 Bacteria 3930
769 Ga0207651_10021533 3300025960 Bacteria 3921
770 Ga0207651_10029248 3300025960 Bacteria 3488
771 Ga0207651_10039799 3300025960 Bacteria 3103
772 Ga0207651_10282087 3300025960 Bacteria 1373
773 Ga0207651_10331527 3300025960 Bacteria 1275
774 Ga0207712_10210107 3300025961 Bacteria 1549
775 Ga0207668_10000588 3300025972 Bacteria 22596
776 Ga0207668_10066180 3300025972 Bacteria 2560
777 Ga0207668_10115860 3300025972 Bacteria 2019
778 Ga0207668_10359237 3300025972 Bacteria 1220
779 Ga0207640_10007254 3300025981 Bacteria 6114
780 Ga0207640_10019268 3300025981 Bacteria 4028
781 Ga0207640_10025022 3300025981 Bacteria 3609
782 Ga0207640_10046560 3300025981 Bacteria 2791
783 Ga0207640_10109120 3300025981 Bacteria 1957
784 Ga0207640_10128890 3300025981 Bacteria 1825
785 Ga0207658_10004294 3300025986 Bacteria 9925
786 Ga0207658_10012167 3300025986 Bacteria 5869
787 Ga0207658_10029131 3300025986 Bacteria 3895
788 Ga0207658_10073100 3300025986 Bacteria 2602
789 Ga0207658_10118225 3300025986 Bacteria 2108
790 Ga0207658_10221610 3300025986 Bacteria 1592
791 Ga0207658_10278265 3300025986 Bacteria 1433
792 Ga0207677_10000568 3300026023 Bacteria 23256
793 Ga0207677_10005073 3300026023 Bacteria 7117
794 Ga0207677_10019960 3300026023 Bacteria 4058
795 Ga0207677_10077614 3300026023 Bacteria 2369
796 Ga0207677_10116070 3300026023 Bacteria 2004
797 Ga0207677_10174372 3300026023 Bacteria 1685
798 Ga0207677_10317897 3300026023 Bacteria 1293
799 Ga0207703_10003052 3300026035 Bacteria 14164
800 Ga0207703_10015842 3300026035 Bacteria 5882
801 Ga0207703_10133865 3300026035 Bacteria 2144
802 Ga0207639_10023753 3300026041 Bacteria 4428
803 Ga0207639_10028265 3300026041 Bacteria 4092
804 Ga0207639_10044448 3300026041 Bacteria 3341
805 Ga0207639_10060210 3300026041 Bacteria 2929
806 Ga0207639_10077914 3300026041 Bacteria 2614
807 Ga0207639_10280504 3300026041 Bacteria 1465
808 Ga0207678_10000060 3300026067 Bacteria 85708
809 Ga0207678_10001630 3300026067 Bacteria 20581
810 Ga0207678_10004372 3300026067 Bacteria 12704
811 Ga0207678_10004440 3300026067 Bacteria 12618
812 Ga0207678_10009412 3300026067 Bacteria 8598
813 Ga0207678_10025143 3300026067 Bacteria 5199
814 Ga0207678_10152589 3300026067 Bacteria 1973
815 Ga0207678_10166047 3300026067 Bacteria 1885
816 Ga0207708_10000766 3300026075 Bacteria 24175
817 Ga0207708_10334594 3300026075 Bacteria 1239
818 Ga0207702_10003001 3300026078 Bacteria 15691
819 Ga0207702_10004735 3300026078 Bacteria 12021
820 Ga0207702_10017663 3300026078 Bacteria 5903
821 Ga0207702_10098884 3300026078 Bacteria 2571
822 Ga0207702_10240838 3300026078 Unclassified 1695
823 Ga0207702_10252410 3300026078 Bacteria 1657
824 Ga0207702_10487553 3300026078 Bacteria 1200
825 Ga0207641_10005500 3300026088 Bacteria 10803
826 Ga0207641_10027119 3300026088 Bacteria 4730
827 Ga0207641_10027318 3300026088 Bacteria 4713
828 Ga0207641_10058733 3300026088 Bacteria 3274
829 Ga0207641_10090534 3300026088 Bacteria 2675
830 Ga0207641_10111602 3300026088 Bacteria 2425
831 Ga0207641_10186108 3300026088 Bacteria 1905
832 Ga0207641_10364665 3300026088 Bacteria 1380
833 Ga0207648_10000023 3300026089 Bacteria 134519
834 Ga0207648_10000885 3300026089 Bacteria 33754
835 Ga0207648_10001587 3300026089 Bacteria 24915
836 Ga0207648_10003000 3300026089 Bacteria 17836
837 Ga0207648_10005713 3300026089 Bacteria 12464
838 Ga0207648_10006509 3300026089 Bacteria 11599
839 Ga0207648_10067742 3300026089 Bacteria 3111
840 Ga0207648_10077572 3300026089 Bacteria 2896
841 Ga0207676_10000487 3300026095 Bacteria 33269
842 Ga0207676_10005256 3300026095 Bacteria 9163
843 Ga0207676_10007017 3300026095 Bacteria 7979
844 Ga0207676_10024837 3300026095 Bacteria 4439
845 Ga0207676_10036016 3300026095 Bacteria 3761
846 Ga0207676_10054047 3300026095 Bacteria 3145
847 Ga0207676_10084458 3300026095 Bacteria 2588
848 Ga0207676_10119767 3300026095 Bacteria 2217
849 Ga0207676_10466973 3300026095 Bacteria 1193
850 Ga0207674_10000045 3300026116 Bacteria 122251
851 Ga0207674_10000380 3300026116 Bacteria 57884
852 Ga0207674_10008292 3300026116 Bacteria 12034
853 Ga0207674_10011058 3300026116 Bacteria 10149
854 Ga0207674_10031960 3300026116 Bacteria 5524
855 Ga0207674_10288182 3300026116 Bacteria 1591
856 Ga0207675_100000982 3300026118 Bacteria 28316
857 Ga0207675_100006003 3300026118 Bacteria 11559
858 Ga0207675_100010997 3300026118 Bacteria 8479
859 Ga0207675_100034419 3300026118 Bacteria 4724
860 Ga0207675_100100927 3300026118 Bacteria 2719
861 Ga0207683_10000009 3300026121 Bacteria 150281
862 Ga0207683_10001803 3300026121 Bacteria 18967
863 Ga0207683_10002654 3300026121 Bacteria 15624
864 Ga0207683_10002918 3300026121 Bacteria 14907
865 Ga0207683_10007175 3300026121 Bacteria 9553
866 Ga0207683_10009314 3300026121 Bacteria 8368
867 Ga0207683_10016707 3300026121 Bacteria 6245
868 Ga0207683_10019254 3300026121 Bacteria 5828
869 Ga0207683_10033501 3300026121 Bacteria 4462
870 Ga0207683_10050124 3300026121 Bacteria 3656
871 Ga0207683_10092890 3300026121 Bacteria 2689
872 Ga0207698_10001195 3300026142 Bacteria 15126
873 Ga0207698_10004886 3300026142 Bacteria 8219
874 Ga0207698_10016132 3300026142 Bacteria 5026
875 Ga0207698_10019585 3300026142 Bacteria 4636
876 Ga0207698_10050176 3300026142 Bacteria 3181
877 Ga0207698_10106664 3300026142 Bacteria 2337
878 Ga0207698_10162162 3300026142 Bacteria 1957
879 Ga0207698_10168457 3300026142 Bacteria 1926
880 Ga0207698_10186360 3300026142 Bacteria 1844
881 Ga0209281_1000076 3300027111 Bacteria 263350
882 Ga0209389_1007702 3300027296 Bacteria 9514
883 Ga0209981_1007750 3300027378 Bacteria 1452
884 Ga0209968_1005124 3300027526 Bacteria 1965
885 Ga0209970_1018051 3300027614 Bacteria 1183
886 Ga0209966_1000360 3300027695 Bacteria 13904
887 Ga0209966_1006848 3300027695 Bacteria 1988
888 Ga0209974_10009106 3300027876 Bacteria 3373
889 Ga0209974_10017653 3300027876 Bacteria 2365
890 Ga0207428_10057082 3300027907 Bacteria 3100
891 Ga0268266_10002814 3300028379 Bacteria 18146
892 Ga0268266_10028922 3300028379 Bacteria 4710
893 Ga0268266_10035048 3300028379 Bacteria 4268
894 Ga0268266_10083838 3300028379 Bacteria 2782
895 Ga0268266_10181860 3300028379 Bacteria 1915
896 Ga0268265_10027125 3300028380 Bacteria 4084
897 Ga0268265_10115987 3300028380 Bacteria 2196
898 Ga0268265_10216209 3300028380 Bacteria 1674
899 Ga0268265_10375890 3300028380 Bacteria 1305
900 Ga0268264_10016423 3300028381 Bacteria 6060
901 Ga0268264_10103061 3300028381 Bacteria 2484
902 Ga0268264_10464604 3300028381 Bacteria 1228
903 Ga0307515_10000109 3300028794 Bacteria 195895
904 Ga0307515_10004774 3300028794 Bacteria 27760
905 Ga0307515_10024496 3300028794 Bacteria 10513
906 Ga0307515_10122066 3300028794 Bacteria 2942
907 Ga0265330_10002031 3300031235 Bacteria 11231
908 Ga0265332_10001320 3300031238 Bacteria 14074
909 Ga0265328_10014756 3300031239 Bacteria 3071
910 Ga0265325_10020658 3300031241 Bacteria 3628
911 Ga0265329_10002673 3300031242 Bacteria 8024
912 Ga0265339_10043404 3300031249 Bacteria 2487
913 Ga0265331_10000782 3300031250 Bacteria 26477
914 Ga0265331_10007011 3300031250 Bacteria 6576
915 Ga0265327_10000149 3300031251 Bacteria 150385
916 Ga0265327_10001316 3300031251 Bacteria 32359
917 Ga0265327_10002079 3300031251 Bacteria 22367
918 Ga0265327_10008910 3300031251 Bacteria 7364
919 Ga0265327_10100592 3300031251 Unclassified 1395
920 Ga0265327_10110845 3300031251 Bacteria 1311
921 Ga0265316_10001831 3300031344 Bacteria 22378
922 Ga0265316_10015971 3300031344 Bacteria 6534
923 Ga0307513_10006129 3300031456 Bacteria 15780
924 Ga0307509_10033425 3300031507 Bacteria 5661
925 Ga0307408_100000006 3300031548 Bacteria 472824
926 Ga0307408_100022760 3300031548 Bacteria 4262
927 Ga0307408_100024311 3300031548 Bacteria 4135
928 Ga0307508_10000237 3300031616 Bacteria 67014
929 Ga0307514_10000200 3300031649 Bacteria 167194
930 Ga0316579_10017242 3300031691 Bacteria 3165
931 Ga0265314_10024215 3300031711 Bacteria 4606
932 Ga0316576_10019850 3300031727 Bacteria 4610
933 Ga0316576_10126795 3300031727 Bacteria 1918
934 Ga0316578_10036520 3300031728 Bacteria 2827
935 Ga0316578_10075217 3300031728 Bacteria 2003
936 Ga0307516_10000476 3300031730 Bacteria 53151
937 Ga0307516_10004137 3300031730 Bacteria 18093
938 Ga0307405_10000531 3300031731 Bacteria 14441
939 Ga0307405_10005429 3300031731 Bacteria 6147
940 Ga0307405_10006086 3300031731 Bacteria 5902
941 Ga0316577_10072871 3300031733 Bacteria 1917
942 Ga0307413_10002488 3300031824 Bacteria 7506
943 Ga0307413_10007240 3300031824 Bacteria 5135
944 Ga0307413_10028776 3300031824 Bacteria 3100
945 Ga0307410_10002348 3300031852 Bacteria 9114
946 Ga0307410_10002777 3300031852 Bacteria 8565
947 Ga0307406_10005190 3300031901 Bacteria 7114
948 Ga0307407_10006878 3300031903 Bacteria 5104
949 Ga0307407_10011931 3300031903 Bacteria 4158
950 Ga0307407_10102592 3300031903 Bacteria 1779
951 Ga0307412_10011462 3300031911 Bacteria 5138
952 Ga0307412_10017944 3300031911 Bacteria 4245
953 Ga0307412_10313904 3300031911 Bacteria 1244
954 Ga0307409_100000296 3300031995 Bacteria 20197
955 Ga0307409_100008896 3300031995 Bacteria 6130
956 Ga0307409_100283352 3300031995 Bacteria 1533
957 Ga0307416_100004316 3300032002 Bacteria 8540
958 Ga0307416_100019849 3300032002 Bacteria 4776
959 Ga0307416_100065620 3300032002 Bacteria 2984
960 Ga0307416_100564011 3300032002 Bacteria 1214
961 Ga0307416_100613769 3300032002 Bacteria 1169
962 Ga0307414_10018807 3300032004 Bacteria 4265
963 Ga0307414_10020468 3300032004 Bacteria 4125
964 Ga0307411_10000157 3300032005 Bacteria 21587
965 Ga0307411_10001828 3300032005 Bacteria 9028
966 Ga0307411_10023364 3300032005 Bacteria 3660
967 Ga0307411_10027937 3300032005 Bacteria 3422
968 Ga0307411_10135527 3300032005 Bacteria 1807
969 Ga0307415_100030255 3300032126 Bacteria 3472
970 Ga0307415_100041448 3300032126 Bacteria 3057
971 Ga0316585_10043512 3300032137 Bacteria 1434
972 Ga0316580_10026199 3300032139 Bacteria 1802
973 Ga0307510_10225780 3300033180 Bacteria 1380
974 Ga0373944_0021853 3300035089 Bacteria 1856
975 Ga0373949_0036540 3300035090 Bacteria 1192
976 Ga0373939_0000172 3300035114 Bacteria 17838
977 Ga0373939_0078301 3300035114 Bacteria 1092
978 Ga0373954_0002732 3300035118 Bacteria 7426
979 Ga0373956_0045582 3300035119 Bacteria 1957
980 Ga0373957_0002773 3300035120 Bacteria 5043
981 Ga0373960_0000838 3300035121 Bacteria 6489
982 Ga0373943_0058774 3300035170 Bacteria 1915
983 Ga0373946_0020385 3300035171 Bacteria 2562
984 Ga0373924_0011368 3300035410 Bacteria 3305
985 Ga0373931_0000138 3300035691 Bacteria 33181
986 Ga0373931_0008388 3300035691 Bacteria 4899
987 Ga0373931_0143868 3300035691 Bacteria 1384
988 Ga0373931_0259984 3300035691 Bacteria 1059
989 Ga0373927_0020224 3300035695 Bacteria 4365
990 Ga0373927_0149886 3300035695 Bacteria 1527
991 Ga0373927_0249703 3300035695 Bacteria 1166
992 Ga0373933_0033639 3300035724 Bacteria 2983
993 Ga0373933_0063845 3300035724 Bacteria 2227
994 Ga0373933_0173888 3300035724 Bacteria 1371
995 Ga0373947_0006647 3300035725 Bacteria 6711
996 Ga0373947_0018891 3300035725 Bacteria 3971
997 Ga0373937_0000885 3300036401 Bacteria 25664
998 Ga0373937_0012826 3300036401 Bacteria 7381
999 Ga0373937_0068780 3300036401 Bacteria 3264
1000 Ga0373937_0089311 3300036401 Bacteria 2853
1001 Ga0373937_0094166 3300036401 Bacteria 2777
1002 Ga0316582_0066241 3300036647 Bacteria 2328
1003 Ga0316582_0194431 3300036647 Bacteria 1382
1004 Ga0316584_0238463 3300036712 Bacteria 1331
1005 Ga0373925_0006042 3300037068 Bacteria 8956
1006 Ga0373925_0111719 3300037068 Bacteria 2112
1007 Ga0395899_0200723 3300037312 Bacteria 1391
1008 Ga0395905_0000642 3300037471 Bacteria 46676
1009 Ga0395905_0014790 3300037471 Bacteria 7441
1010 Ga0395905_0332159 3300037471 Bacteria 1411
1011 Ga0316581_0007165 3300037588 Bacteria 2983
1012 Ga0395901_0016261 3300038443 Bacteria 7579
1013 Ga0242420_007333 3300038996 Bacteria 1767
1014 Ga0436365_0314337 3300039437 Bacteria 3805
1015 Ga0436361_0041271 3300039447 Bacteria 10750
1016 Ga0436361_0313405 3300039447 Bacteria 87904
1017 Ga0436361_0427460 3300039447 Bacteria 107545
1018 Ga0436361_0587522 3300039447 Bacteria 5273
1019 Ga0436361_0813019 3300039447 Bacteria 1758
1020 Ga0436361_0919876 3300039447 Bacteria 112731
1021 Ga0436361_1046311 3300039447 Bacteria 5131
1022 Ga0451787_337636 3300041441 Bacteria 1906
1023 Ga0451851_0324073 3300041507 Bacteria 1254
1024 Ga0451853_3266585 3300041512 Bacteria 1911
1025 Ga0451853_3309104 3300041512 Bacteria 1176
1026 Ga0439431_0020814 3300041997 Bacteria 1570
1027 Ga0450917_000104 3300042120 Bacteria 5203
1028 Ga0450888_000032 3300042126 Bacteria 9836
1029 Ga0450890_001624 3300042127 Bacteria 3225
1030 Ga0450890_002449 3300042127 Bacteria 2557
1031 Ga0439434_0003833 3300042435 Bacteria 4395
1032 Ga0439434_0039862 3300042435 Bacteria 1442
1033 Ga0439459_0001155 3300042438 Bacteria 3832
1034 Ga0451577_0005058 3300042876 Bacteria 13616
1035 Ga0451577_0008299 3300042876 Bacteria 10107
1036 Ga0451577_0055602 3300042876 Bacteria 3531
1037 Ga0466969_0000123 3300044656 Bacteria 41546
1038 Ga0466969_0011706 3300044656 Bacteria 4640
1039 Ga0466969_0053525 3300044656 Bacteria 1979
1040 Ga0453683_0002257 3300044673 Bacteria 15226
1041 Ga0453683_0047332 3300044673 Bacteria 2696
1042 Ga0453683_0092397 3300044673 Bacteria 1897
1043 Ga0466965_0000144 3300044683 Bacteria 20908
1044 Ga0466965_0014529 3300044683 Bacteria 3729
1045 Ga0466966_0001180 3300044684 Bacteria 16743
1046 Ga0466966_0002933 3300044684 Bacteria 11238
1047 Ga0466966_0016277 3300044684 Bacteria 4917
1048 Ga0466961_0002198 3300044693 Bacteria 12138
1049 Ga0466961_0017217 3300044693 Bacteria 4642
1050 Ga0466963_0024519 3300044694 Bacteria 3840
1051 Ga0466963_0071821 3300044694 Bacteria 2330
1052 Ga0466964_0023294 3300044706 Bacteria 2407
1053 Ga0466964_0041491 3300044706 Bacteria 1861
1054 Ga0453684_0016947 3300044712 Bacteria 11328
1055 Ga0453684_0019353 3300044712 Bacteria 10370
1056 Ga0453684_0054309 3300044712 Bacteria 5219
1057 Ga0453684_0057170 3300044712 Bacteria 5052
1058 Ga0453684_0210842 3300044712 Bacteria 2258
1059 Ga0453684_0235626 3300044712 Bacteria 2110
1060 Ga0453684_0384656 3300044712 Bacteria 1575
1061 Ga0453684_0586369 3300044712 Bacteria 1224
1062 Ga0466971_0003216 3300044719 Bacteria 6968
1063 Ga0466971_0011365 3300044719 Bacteria 3899
1064 Ga0466971_0017330 3300044719 Bacteria 3185
1065 Ga0466968_0006730 3300044735 Bacteria 4344
1066 Ga0466970_0003580 3300044765 Bacteria 7571
1067 Ga0466970_0018148 3300044765 Bacteria 3640
1068 Ga0466970_0021220 3300044765 Bacteria 3382
1069 Ga0466957_0003922 3300044842 Bacteria 8225
1070 Ga0466957_0005762 3300044842 Bacteria 6959
1071 Ga0466959_0000054 3300045049 Bacteria 79861
1072 Ga0466959_0021344 3300045049 Bacteria 4775
1073 Ga0466959_0076780 3300045049 Bacteria 2411
1074 Ga0451576_0000001 3300045051 Bacteria 1802108
1075 Ga0451576_0051380 3300045051 Bacteria 4322
1076 Ga0451576_0123825 3300045051 Bacteria 2693
1077 Ga0451576_0256130 3300045051 Bacteria 1829
1078 Ga0451576_0589834 3300045051 Bacteria 1168
1079 Ga0466958_0174932 3300045836 Bacteria 1360
1080 Ga0495590_0014854 3300046457 Bacteria 2838
1081 Ga0495629_0033378 3300046459 Bacteria 3640
1082 Ga0495651_0131591 3300046462 Bacteria 1826
1083 Ga0495653_0099806 3300046463 Bacteria 2106
1084 Ga0495580_0124571 3300046472 Bacteria 1789
1085 Ga0495580_0210435 3300046472 Bacteria 1338
1086 Ga0495639_0016287 3300046475 Bacteria 3226
1087 Ga0495639_0140454 3300046475 Bacteria 1161
1088 Ga0495662_0020205 3300046476 Bacteria 3221
1089 Ga0495664_0037911 3300046477 Bacteria 2845
1090 Ga0495585_0031454 3300046492 Bacteria 3012
1091 Ga0495618_0141184 3300046514 Bacteria 1541
1092 Ga0495630_0152593 3300046517 Bacteria 1758
1093 Ga0495630_0248054 3300046517 Bacteria 1360
1094 Ga0495632_0055816 3300046519 Bacteria 1932
1095 Ga0495632_0073119 3300046519 Bacteria 1644
1096 Ga0495643_0017219 3300046522 Bacteria 4228
1097 Ga0495586_0097404 3300046535 Bacteria 1630
1098 Ga0495621_0009828 3300046539 Bacteria 2918
1099 Ga0495621_0022302 3300046539 Bacteria 2097
1100 Ga0495621_0032286 3300046539 Bacteria 1799
1101 Ga0495597_0011120 3300046542 Bacteria 4369
1102 Ga0495645_0030864 3300046543 Bacteria 3904
1103 Ga0495645_0033343 3300046543 Bacteria 3757
1104 Ga0495645_0236527 3300046543 Bacteria 1221
1105 Ga0495625_0032909 3300046660 Bacteria 3838
1106 Ga0495659_0005751 3300046664 Bacteria 3911
1107 Ga0495657_0197629 3300046675 Bacteria 1227
1108 Ga0495623_0084968 3300046679 Bacteria 1952
1109 Ga0495647_0045978 3300046681 Bacteria 1679
1110 Ga0495658_0023095 3300046683 Bacteria 3299
1111 Ga0495658_0192097 3300046683 Bacteria 1270
1112 Ga0495613_0015093 3300046689 Bacteria 5736
1113 Ga0495613_0111604 3300046689 Bacteria 1970
1114 Ga0495670_0087790 3300046691 Bacteria 1589
1115 Ga0495649_0006739 3300046694 Bacteria 7116
1116 Ga0495600_0019071 3300046809 Bacteria 4377
1117 Ga0495581_0040029 3300047315 Bacteria 2713
1118 Ga0495636_0050144 3300047318 Bacteria 1747
1119 Ga0495680_0058280 3300047322 Bacteria 2985
1120 Ga0495687_000863 3300047443 Bacteria 32127
1121 Ga0495675_0138740 3300047444 Bacteria 1508
1122 Ga0495684_0010031 3300047471 Bacteria 7323
1123 Ga0495684_0102509 3300047471 Bacteria 2163
1124 Ga0495614_0082581 3300048089 Bacteria 1393
1125 Ga0495626_0067502 3300048091 Bacteria 1615
1126 Ga0496100_0471867 3300048903 Bacteria 964
1127 Ga0496101_0032221 3300048904 Bacteria 3687
1128 Ga0496101_0157020 3300048904 Bacteria 1743
1129 Ga0496101_0238712 3300048904 Bacteria 1414
1130 Ga0496102_0004391 3300048905 Bacteria 11912
1131 Ga0496102_0123790 3300048905 Bacteria 2416
1132 Ga0496102_0205793 3300048905 Bacteria 1855
1133 Ga0496102_0352409 3300048905 Bacteria 1386
1134 Ga0496102_0565404 3300048905 Bacteria 1060
1135 Ga0496103_0010291 3300048906 Bacteria 5532
1136 Ga0496103_0043052 3300048906 Bacteria 2779
1137 Ga0496104_0025445 3300048907 Bacteria 5456
1138 Ga0496104_0044281 3300048907 Bacteria 4182
1139 Ga0496104_0046798 3300048907 Bacteria 4075
1140 Ga0496105_0007858 3300048908 Bacteria 8281
1141 Ga0496106_0016578 3300048909 Bacteria 5452
1142 Ga0496106_0035206 3300048909 Bacteria 3744
1143 Ga0496107_0004959 3300048910 Bacteria 9059
1144 Ga0496107_0136223 3300048910 Bacteria 1814
1145 Ga0496107_0158474 3300048910 Bacteria 1677
1146 Ga0496108_0003315 3300048911 Bacteria 12939
1147 Ga0496108_0137943 3300048911 Bacteria 2100
1148 Ga0496108_0149187 3300048911 Bacteria 2017
1149 Ga0496108_0475932 3300048911 Bacteria 1091
1150 Ga0496109_0004780 3300048912 Bacteria 11306
1151 Ga0496109_0028429 3300048912 Bacteria 5000
1152 Ga0496109_0184211 3300048912 Bacteria 1962
1153 Ga0496109_0205998 3300048912 Bacteria 1849
1154 Ga0496109_0266685 3300048912 Bacteria 1613
1155 Ga0496110_0006092 3300048913 Bacteria 9502
1156 Ga0496110_0204183 3300048913 Bacteria 1796
1157 Ga0496110_0219614 3300048913 Bacteria 1728
1158 Ga0496110_0396062 3300048913 Bacteria 1259
1159 Ga0496112_0000710 3300048915 Bacteria 23117
1160 Ga0496112_0053740 3300048915 Bacteria 3956
1161 Ga0496114_0017071 3300048917 Bacteria 5855
1162 Ga0496114_0043990 3300048917 Bacteria 3703
1163 Ga0496114_0400635 3300048917 Bacteria 1215
1164 Ga0496115_0010832 3300048918 Bacteria 6820
1165 Ga0496115_0072150 3300048918 Bacteria 2801
1166 Ga0496115_0455891 3300048918 Bacteria 1032
1167 Ga0496124_0053200 3300048927 Bacteria 3434
1168 Ga0501291_013785 3300049514 Bacteria 1201
1169 Ga0501300_002056 3300049523 Bacteria 3003
1170 Ga0501034_0015916 3300049571 Bacteria 7718
1171 Ga0501043_0000018 3300049579 Bacteria 161101
1172 Ga0501046_0000042 3300049580 Bacteria 151850
1173 Ga0501047_0000052 3300049581 Bacteria 153448
1174 Ga0501047_0101856 3300049581 Bacteria 2751
1175 Ga0501048_0010225 3300049582 Bacteria 7017
1176 Ga0501067_0012644 3300049583 Bacteria 4682
1177 Ga0501070_0006503 3300049586 Bacteria 9938
1178 Ga0501073_0086176 3300049589 Bacteria 2184
1179 Ga0501074_0053822 3300049590 Bacteria 2903
1180 Ga0501077_0240070 3300049593 Bacteria 1152
1181 Ga0501198_000042 3300049649 Bacteria 45595
1182 Ga0501201_002787 3300049651 Bacteria 1597
1183 Ga0501206_002112 3300049653 Bacteria 2511
1184 Ga0501206_006650 3300049653 Bacteria 1504
1185 Ga0501211_003040 3300049658 Bacteria 1745
1186 Ga0501222_000016 3300049662 Bacteria 80046
1187 Ga0501222_002427 3300049662 Bacteria 2587
1188 Ga0501223_005309 3300049663 Bacteria 2714
1189 Ga0501235_009142 3300049669 Bacteria 2164
1190 Ga0501249_012855 3300049679 Bacteria 1773
1191 Ga0501255_003581 3300049684 Bacteria 1452
1192 Ga0501221_002963 3300049704 Bacteria 2797
1193 Ga0501080_0009862 3300049742 Bacteria 8726
1194 Ga0501083_0000703 3300049744 Bacteria 21776
1195 Ga0501083_0063016 3300049744 Bacteria 2473
1196 Ga0501232_006067 3300049757 Bacteria 1226
1197 Ga0501263_004038 3300049760 Bacteria 1598
1198 Ga0501265_005461 3300049762 Bacteria 1466
1199 Ga0501267_000881 3300049764 Bacteria 2456
1200 Ga0501268_017905 3300049765 Bacteria 1185
1201 Ga0501269_003052 3300049766 Bacteria 2035
1202 Ga0501045_0006468 3300049824 Bacteria 8116
1203 nmdc:mga03683_12266_c1 3300050489 Bacteria 3126
1204 nmdc:mga00v17_201376_c1 3300050491 Bacteria 1287
1205 nmdc:mga0k408_135126_c1 3300050493 Bacteria 1465
1206 nmdc:mga0k408_20287_c1 3300050493 Bacteria 3722
1207 nmdc:mga0k408_20982_c1 3300050493 Bacteria 3666
1208 nmdc:mga0k408_47063_c1 3300050493 Bacteria 2492
1209 nmdc:mga0k408_5366_c1 3300050493 Bacteria 6814
1210 nmdc:mga06z11_90412_c1 3300050494 Bacteria 1661
1211 nmdc:mga07m45_121459_c1 3300050496 Bacteria 1509
1212 nmdc:mga07m45_151709_c1 3300050496 Bacteria 1344
1213 nmdc:mga07m45_26147_c1 3300050496 Bacteria 3206
1214 nmdc:mga07m45_39198_c1 3300050496 Bacteria 2647
1215 nmdc:mga07m45_40957_c1 3300050496 Bacteria 2594
1216 nmdc:mga07m45_470_c1 3300050496 Bacteria 16988
1217 nmdc:mga07m45_51695_c1 3300050496 Bacteria 2318
1218 nmdc:mga07m45_771_c1 3300050496 Bacteria 13760
1219 nmdc:mga05p37_242853_c1 3300050507 Bacteria 2164
1220 nmdc:mga05p37_27957_c1 3300050507 Bacteria 6870
1221 nmdc:mga05p37_597279_c1 3300050507 Bacteria 1247
1222 nmdc:mga09592_23891_c1 3300050508 Bacteria 5051
1223 nmdc:mga08y16_10845_c1 3300050511 Bacteria 9568
1224 nmdc:mga08y16_584128_c1 3300050511 Bacteria 1128
1225 nmdc:mga0n895_296823_c1 3300050512 Bacteria 1638
1226 nmdc:mga0n895_69615_c1 3300050512 Bacteria 3486
1227 nmdc:mga0rr50_303739_c1 3300050513 Bacteria 1335
1228 nmdc:mga08x19_224871_c1 3300050514 Bacteria 1290
1229 nmdc:mga08x19_5335_c1 3300050514 Bacteria 7597
1230 nmdc:mga0sz30_42922_c1 3300050516 Bacteria 1903
1231 Ga0495601_0000784 3300053077 Bacteria 17179
1232 Ga0500635_0000018 3300053080 Bacteria 112805
1233 Ga0495595_0073599 3300053084 Bacteria 1618
1234 Ga0495619_0015430 3300053085 Bacteria 4833
1235 Ga0495619_0032076 3300053085 Bacteria 3407
1236 Ga0495619_0126157 3300053085 Bacteria 1756
1237 Ga0500578_0015993 3300053086 Bacteria 4818
1238 Ga0500641_0112612 3300053096 Bacteria 1171
1239 Ga0500658_0022649 3300053134 Bacteria 2392
1240 Ga0500616_0000820 3300053153 Bacteria 35228
1241 Ga0500616_0003173 3300053153 Bacteria 12802
1242 Ga0500622_0005578 3300053156 Bacteria 7510
1243 Ga0500645_043393 3300053730 Bacteria 1324
1244 Ga0501084_0028961 3300054114 Bacteria 4630
1245 Ga0501084_0065152 3300054114 Bacteria 3048
1246 Ga0590071_006731 3300059421 Bacteria 2726

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10048457 Ga0207665_100484572 249
2 3300035695 Ga0373927_0249703 Ga0373927_0249703_13_795 257
3 3300009176 Ga0105242_10594179 Ga0105242_105941791 283
4 3300035724 Ga0373933_0033639 Ga0373933_0033639_23_883 283
5 3300046683 Ga0495658_0192097 Ga0495658_0192097_397_1260 283
6 3300048903 Ga0496100_0471867 Ga0496100_0471867_83_952 283
7 3300036647 Ga0316582_0066241 Ga0316582_0066241_32_907 284
8 3300037588 Ga0316581_0007165 Ga0316581_0007165_88_963 284
9 3300044673 Ga0453683_0092397 Ga0453683_0092397_243_1133 292
10 3300050507 nmdc:mga05p37_597279_c1 nmdc:mga05p37_597279_c1_15_905 292
11 3300035695 Ga0373927_0149886 Ga0373927_0149886_591_1496 298
12 3300046514 Ga0495618_0141184 Ga0495618_0141184_622_1527 298
13 3300048904 Ga0496101_0238712 Ga0496101_0238712_11_907 298
14 3300048905 Ga0496102_0565404 Ga0496102_0565404_140_1039 298
15 3300048910 Ga0496107_0136223 Ga0496107_0136223_860_1765 298
16 3300048913 Ga0496110_0396062 Ga0496110_0396062_304_1200 298
17 3300053084 Ga0495595_0073599 Ga0495595_0073599_26_931 298
18 3300035724 Ga0373933_0173888 Ga0373933_0173888_16_996 305
19 3300036401 Ga0373937_0000885 Ga0373937_0000885_22085_23065 305
20 3300014745 Ga0157377_10177573 Ga0157377_101775732 306
21 3300025931 Ga0207644_10191165 Ga0207644_101911651 306
22 3300046522 Ga0495643_0017219 Ga0495643_0017219_2219_3163 306
23 3300003792 Ga0055540_1025877 Ga0055540_10258772 307
24 3300025303 Ga0209051_1000953 Ga0209051_100095320 307
25 3300031507 Ga0307509_10033425 Ga0307509_100334253 307
26 3300053077 Ga0495601_0000784 Ga0495601_0000784_6064_7056 308
27 3300050493 nmdc:mga0k408_20287_c1 nmdc:mga0k408_20287_c1_2490_3473 310
28 3300005616 Ga0068852_100183434 Ga0068852_1001834342 311
29 3300044684 Ga0466966_0002933 Ga0466966_0002933_1293_2276 311
30 3300044693 Ga0466961_0017217 Ga0466961_0017217_15_998 311
31 3300044706 Ga0466964_0041491 Ga0466964_0041491_476_1459 311
32 3300044719 Ga0466971_0003216 Ga0466971_0003216_4494_5477 311
33 3300044735 Ga0466968_0006730 Ga0466968_0006730_1119_2102 311
34 3300044765 Ga0466970_0018148 Ga0466970_0018148_346_1329 311
35 3300044842 Ga0466957_0005762 Ga0466957_0005762_1306_2289 311
36 3300045049 Ga0466959_0021344 Ga0466959_0021344_3296_4279 311
37 3300045836 Ga0466958_0174932 Ga0466958_0174932_345_1328 311
38 3300044683 Ga0466965_0000144 Ga0466965_0000144_6927_7946 313
39 3300041512 Ga0451853_3309104 Ga0451853_3309104_147_1094 314
40 iso_pu_bacteria 2585428062 2587757116 314
41 iso_pu_bacteria 2643221544 2643741832 314
42 iso_pu_bacteria 2643221585 2643935098 314
43 iso_pu_bacteria 2643221639 2644220240 314
44 iso_pu_bacteria 2643221646 2644259104 314
45 iso_pu_bacteria 2643221656 2644316585 314
46 iso_pu_bacteria 2643221660 2644339776 314
47 iso_pu_bacteria 2738541337 2739053442 314
48 iso_pu_bacteria 2886848708 2886850993 314
49 3300045051 Ga0451576_0256130 Ga0451576_0256130_705_1664 315
50 3300003316 rootH1_10043368 rootH1_100433686 318
51 3300003322 rootL2_10002418 rootL2_100024185 318
52 3300003322 rootL2_10012665 rootL2_100126653 318
53 3300003322 rootL2_10027947 rootL2_100279476 318
54 3300003759 Ga0055525_1000100 Ga0055525_100010061 318
55 3300003771 Ga0055526_1013302 Ga0055526_10133022 318
56 3300003775 Ga0055524_1001523 Ga0055524_10015236 318
57 3300003791 Ga0055530_10001128 Ga0055530_1000112818 318
58 3300003792 Ga0055540_1000110 Ga0055540_100011043 318
59 3300003794 Ga0055531_10000042 Ga0055531_10000042100 318
60 3300003794 Ga0055531_10004790 Ga0055531_100047905 318
61 3300003794 Ga0055531_10009863 Ga0055531_100098632 318
62 3300005262 Ga0065165_1000063 Ga0065165_1000063114 318
63 3300005262 Ga0065165_1001135 Ga0065165_10011351 318
64 3300005290 Ga0065712_10120426 Ga0065712_101204262 318
65 3300005293 Ga0065715_10215931 Ga0065715_102159312 318
66 3300005327 Ga0070658_10016650 Ga0070658_100166503 318
67 3300005327 Ga0070658_10146558 Ga0070658_101465582 318
68 3300005327 Ga0070658_10297209 Ga0070658_102972092 318
69 3300005328 Ga0070676_10009207 Ga0070676_100092073 318
70 3300005331 Ga0070670_100008746 Ga0070670_1000087467 318
71 3300005334 Ga0068869_100078582 Ga0068869_1000785821 318
72 3300005338 Ga0068868_100080400 Ga0068868_1000804002 318
73 3300005338 Ga0068868_100246410 Ga0068868_1002464102 318
74 3300005339 Ga0070660_100068544 Ga0070660_1000685443 318
75 3300005339 Ga0070660_100316268 Ga0070660_1003162681 318
76 3300005344 Ga0070661_100127160 Ga0070661_1001271602 318
77 3300005353 Ga0070669_100012475 Ga0070669_1000124755 318
78 3300005354 Ga0070675_100001224 Ga0070675_10000122417 318
79 3300005355 Ga0070671_100008129 Ga0070671_1000081294 318
80 3300005355 Ga0070671_100033147 Ga0070671_1000331472 318
81 3300005356 Ga0070674_100003681 Ga0070674_1000036817 318
82 3300005356 Ga0070674_100016440 Ga0070674_1000164403 318
83 3300005364 Ga0070673_100021463 Ga0070673_1000214634 318
84 3300005364 Ga0070673_100046063 Ga0070673_1000460632 318
85 3300005364 Ga0070673_100128158 Ga0070673_1001281582 318
86 3300005364 Ga0070673_100144417 Ga0070673_1001444172 318
87 3300005364 Ga0070673_100198799 Ga0070673_1001987991 318
88 3300005366 Ga0070659_100009750 Ga0070659_1000097506 318
89 3300005366 Ga0070659_100029139 Ga0070659_1000291394 318
90 3300005367 Ga0070667_100019486 Ga0070667_1000194864 318
91 3300005445 Ga0070708_100235573 Ga0070708_1002355732 318
92 3300005455 Ga0070663_100004048 Ga0070663_1000040483 318
93 3300005455 Ga0070663_100116301 Ga0070663_1001163011 318
94 3300005456 Ga0070678_100013613 Ga0070678_1000136132 318
95 3300005456 Ga0070678_100018511 Ga0070678_1000185114 318
96 3300005456 Ga0070678_100153837 Ga0070678_1001538372 318
97 3300005457 Ga0070662_100004835 Ga0070662_1000048352 318
98 3300005457 Ga0070662_100130333 Ga0070662_1001303331 318
99 3300005459 Ga0068867_100000076 Ga0068867_10000007622 318
100 3300005459 Ga0068867_100010405 Ga0068867_1000104052 318
101 3300005459 Ga0068867_100057073 Ga0068867_1000570733 318
102 3300005467 Ga0070706_100007656 Ga0070706_1000076567 318
103 3300005468 Ga0070707_100099250 Ga0070707_1000992502 318
104 3300005535 Ga0070684_100019383 Ga0070684_1000193832 318
105 3300005539 Ga0068853_100006320 Ga0068853_1000063204 318
106 3300005539 Ga0068853_100012996 Ga0068853_1000129965 318
107 3300005543 Ga0070672_100000121 Ga0070672_10000012113 318
108 3300005543 Ga0070672_100006701 Ga0070672_1000067017 318
109 3300005545 Ga0070695_100128804 Ga0070695_1001288041 318
110 3300005548 Ga0070665_100104125 Ga0070665_1001041253 318
111 3300005564 Ga0070664_100025828 Ga0070664_1000258283 318
112 3300005564 Ga0070664_100052164 Ga0070664_1000521644 318
113 3300005614 Ga0068856_100007820 Ga0068856_1000078205 318
114 3300005616 Ga0068852_100048531 Ga0068852_1000485312 318
115 3300005616 Ga0068852_100102441 Ga0068852_1001024412 318
116 3300005616 Ga0068852_100128372 Ga0068852_1001283722 318
117 3300005616 Ga0068852_100153040 Ga0068852_1001530403 318
118 3300005617 Ga0068859_100138766 Ga0068859_1001387664 318
119 3300005618 Ga0068864_100003215 Ga0068864_1000032156 318
120 3300005618 Ga0068864_100012983 Ga0068864_1000129834 318
121 3300005618 Ga0068864_100017103 Ga0068864_1000171033 318
122 3300005841 Ga0068863_100106689 Ga0068863_1001066892 318
123 3300005841 Ga0068863_100211302 Ga0068863_1002113022 318
124 3300006038 Ga0075365_10107573 Ga0075365_101075732 318
125 3300006042 Ga0075368_10015453 Ga0075368_100154532 318
126 3300006048 Ga0075363_100018085 Ga0075363_1000180852 318
127 3300006051 Ga0075364_10053083 Ga0075364_100530831 318
128 3300006051 Ga0075364_10069798 Ga0075364_100697985 318
129 3300006178 Ga0075367_10071027 Ga0075367_100710272 318
130 3300006186 Ga0075369_10011589 Ga0075369_100115892 318
131 3300006195 Ga0075366_10073654 Ga0075366_100736542 318
132 3300006195 Ga0075366_10111179 Ga0075366_101111792 318
133 3300006195 Ga0075366_10145124 Ga0075366_101451242 318
134 3300006237 Ga0097621_100013385 Ga0097621_1000133853 318
135 3300006237 Ga0097621_100015566 Ga0097621_1000155665 318
136 3300006353 Ga0075370_10000588 Ga0075370_100005887 318
137 3300006353 Ga0075370_10007627 Ga0075370_100076272 318
138 3300006353 Ga0075370_10015758 Ga0075370_100157582 318
139 3300006353 Ga0075370_10016857 Ga0075370_100168572 318
140 3300006353 Ga0075370_10026463 Ga0075370_100264632 318
141 3300006353 Ga0075370_10096251 Ga0075370_100962512 318
142 3300006358 Ga0068871_100023997 Ga0068871_1000239972 318
143 3300006931 Ga0097620_100138763 Ga0097620_1001387634 318
144 3300006944 Ga0099823_1000028 Ga0099823_100002817 318
145 3300006946 Ga0079104_1000233 Ga0079104_100023330 318
146 3300009098 Ga0105245_10136895 Ga0105245_101368952 318
147 3300009098 Ga0105245_10378274 Ga0105245_103782742 318
148 3300009101 Ga0105247_10148766 Ga0105247_101487662 318
149 3300009147 Ga0114129_10161325 Ga0114129_101613252 318
150 3300009147 Ga0114129_10600994 Ga0114129_106009942 318
151 3300009148 Ga0105243_10005306 Ga0105243_100053067 318
152 3300009148 Ga0105243_10038828 Ga0105243_100388284 318
153 3300009176 Ga0105242_10140587 Ga0105242_101405872 318
154 3300009177 Ga0105248_10003500 Ga0105248_100035008 318
155 3300009177 Ga0105248_10041720 Ga0105248_100417203 318
156 3300009177 Ga0105248_10262360 Ga0105248_102623603 318
157 3300009545 Ga0105237_10002827 Ga0105237_100028272 318
158 3300009545 Ga0105237_10051155 Ga0105237_100511556 318
159 3300009551 Ga0105238_10011759 Ga0105238_100117594 318
160 3300009551 Ga0105238_10121296 Ga0105238_101212962 318
161 3300009551 Ga0105238_10320999 Ga0105238_103209992 318
162 3300010375 Ga0105239_10003016 Ga0105239_100030162 318
163 3300012497 Ga0157319_1000018 Ga0157319_10000185 318
164 3300013100 Ga0157373_10093769 Ga0157373_100937692 318
165 3300013102 Ga0157371_10155259 Ga0157371_101552592 318
166 3300013104 Ga0157370_10293931 Ga0157370_102939312 318
167 3300013105 Ga0157369_10088888 Ga0157369_100888882 318
168 3300013296 Ga0157374_10025251 Ga0157374_100252514 318
169 3300013296 Ga0157374_10049943 Ga0157374_100499434 318
170 3300013297 Ga0157378_10376176 Ga0157378_103761762 318
171 3300013306 Ga0163162_10219859 Ga0163162_102198592 318
172 3300013307 Ga0157372_10084764 Ga0157372_100847642 318
173 3300013307 Ga0157372_10098850 Ga0157372_100988504 318
174 3300013308 Ga0157375_10105087 Ga0157375_101050871 318
175 3300014326 Ga0157380_10110771 Ga0157380_101107712 318
176 3300014745 Ga0157377_10000006 Ga0157377_10000006149 318
177 3300014745 Ga0157377_10017024 Ga0157377_100170244 318
178 3300014968 Ga0157379_10014570 Ga0157379_100145704 318
179 3300014968 Ga0157379_10055126 Ga0157379_100551264 318
180 3300014968 Ga0157379_10101584 Ga0157379_101015841 318
181 3300014969 Ga0157376_10002032 Ga0157376_1000203213 318
182 3300014969 Ga0157376_10016427 Ga0157376_100164272 318
183 3300014969 Ga0157376_10275772 Ga0157376_102757722 318
184 3300017792 Ga0163161_10011419 Ga0163161_100114195 318
185 3300021361 Ga0213872_10000299 Ga0213872_1000029935 318
186 3300021361 Ga0213872_10001215 Ga0213872_1000121514 318
187 3300021361 Ga0213872_10005774 Ga0213872_100057743 318
188 3300021361 Ga0213872_10011797 Ga0213872_100117972 318
189 3300025230 Ga0209563_100112 Ga0209563_10011262 318
190 3300025242 Ga0209258_106994 Ga0209258_1069942 318
191 3300025256 Ga0209759_1001653 Ga0209759_10016533 318
192 3300025273 Ga0209673_1002680 Ga0209673_10026807 318
193 3300025295 Ga0209564_1000131 Ga0209564_1000131111 318
194 3300025297 Ga0209758_1000367 Ga0209758_100036710 318
195 3300025298 Ga0209050_1000596 Ga0209050_100059655 318
196 3300025298 Ga0209050_1001057 Ga0209050_100105729 318
197 3300025298 Ga0209050_1002537 Ga0209050_10025377 318
198 3300025299 Ga0209256_1001842 Ga0209256_10018426 318
199 3300025299 Ga0209256_1001867 Ga0209256_10018678 318
200 3300025303 Ga0209051_1000148 Ga0209051_100014896 318
201 3300025303 Ga0209051_1001133 Ga0209051_10011338 318
202 3300025303 Ga0209051_1017641 Ga0209051_10176412 318
203 3300025304 Ga0209257_1000016 Ga0209257_1000016332 318
204 3300025304 Ga0209257_1000380 Ga0209257_100038043 318
205 3300025304 Ga0209257_1001173 Ga0209257_100117315 318
206 3300025304 Ga0209257_1001971 Ga0209257_10019718 318
207 3300025304 Ga0209257_1010980 Ga0209257_10109802 318
208 3300025304 Ga0209257_1011952 Ga0209257_10119522 318
209 3300025321 Ga0207656_10049367 Ga0207656_100493672 318
210 3300025893 Ga0207682_10008608 Ga0207682_100086082 318
211 3300025893 Ga0207682_10008799 Ga0207682_100087992 318
212 3300025907 Ga0207645_10188371 Ga0207645_101883712 318
213 3300025909 Ga0207705_10019028 Ga0207705_100190283 318
214 3300025909 Ga0207705_10130123 Ga0207705_101301231 318
215 3300025910 Ga0207684_10010783 Ga0207684_100107834 318
216 3300025910 Ga0207684_10017161 Ga0207684_100171615 318
217 3300025913 Ga0207695_10004581 Ga0207695_1000458112 318
218 3300025914 Ga0207671_10002906 Ga0207671_100029062 318
219 3300025914 Ga0207671_10113162 Ga0207671_101131622 318
220 3300025919 Ga0207657_10043449 Ga0207657_100434491 318
221 3300025922 Ga0207646_10021842 Ga0207646_100218427 318
222 3300025924 Ga0207694_10051392 Ga0207694_100513922 318
223 3300025925 Ga0207650_10000846 Ga0207650_100008469 318
224 3300025925 Ga0207650_10006005 Ga0207650_100060056 318
225 3300025926 Ga0207659_10057886 Ga0207659_100578862 318
226 3300025926 Ga0207659_10241261 Ga0207659_102412611 318
227 3300025931 Ga0207644_10006681 Ga0207644_100066813 318
228 3300025931 Ga0207644_10025283 Ga0207644_100252833 318
229 3300025931 Ga0207644_10053412 Ga0207644_100534122 318
230 3300025931 Ga0207644_10068055 Ga0207644_100680552 318
231 3300025933 Ga0207706_10014346 Ga0207706_100143462 318
232 3300025935 Ga0207709_10010741 Ga0207709_100107414 318
233 3300025937 Ga0207669_10015132 Ga0207669_100151324 318
234 3300025937 Ga0207669_10023946 Ga0207669_100239464 318
235 3300025940 Ga0207691_10000175 Ga0207691_1000017531 318
236 3300025940 Ga0207691_10014981 Ga0207691_100149813 318
237 3300025941 Ga0207711_10141991 Ga0207711_101419912 318
238 3300025941 Ga0207711_10257234 Ga0207711_102572342 318
239 3300025944 Ga0207661_10128142 Ga0207661_101281422 318
240 3300025945 Ga0207679_10030704 Ga0207679_100307044 318
241 3300025960 Ga0207651_10021398 Ga0207651_100213983 318
242 3300025960 Ga0207651_10039799 Ga0207651_100397993 318
243 3300025960 Ga0207651_10282087 Ga0207651_102820872 318
244 3300025961 Ga0207712_10210107 Ga0207712_102101072 318
245 3300026023 Ga0207677_10116070 Ga0207677_101160702 318
246 3300026067 Ga0207678_10000060 Ga0207678_1000006055 318
247 3300026078 Ga0207702_10252410 Ga0207702_102524101 318
248 3300026088 Ga0207641_10027119 Ga0207641_100271192 318
249 3300026088 Ga0207641_10186108 Ga0207641_101861082 318
250 3300026089 Ga0207648_10000023 Ga0207648_1000002310 318
251 3300026089 Ga0207648_10005713 Ga0207648_100057136 318
252 3300026095 Ga0207676_10005256 Ga0207676_100052567 318
253 3300026095 Ga0207676_10084458 Ga0207676_100844583 318
254 3300026095 Ga0207676_10119767 Ga0207676_101197672 318
255 3300026095 Ga0207676_10466973 Ga0207676_104669732 318
256 3300026116 Ga0207674_10288182 Ga0207674_102881822 318
257 3300026121 Ga0207683_10002654 Ga0207683_100026549 318
258 3300026121 Ga0207683_10033501 Ga0207683_100335015 318
259 3300026121 Ga0207683_10050124 Ga0207683_100501243 318
260 3300026142 Ga0207698_10106664 Ga0207698_101066641 318
261 3300026142 Ga0207698_10162162 Ga0207698_101621622 318
262 3300026142 Ga0207698_10186360 Ga0207698_101863602 318
263 3300027111 Ga0209281_1000076 Ga0209281_1000076231 318
264 3300027296 Ga0209389_1007702 Ga0209389_10077023 318
265 3300027378 Ga0209981_1007750 Ga0209981_10077501 318
266 3300027526 Ga0209968_1005124 Ga0209968_10051242 318
267 3300027695 Ga0209966_1000360 Ga0209966_10003606 318
268 3300028379 Ga0268266_10028922 Ga0268266_100289224 318
269 3300028379 Ga0268266_10181860 Ga0268266_101818602 318
270 3300028794 Ga0307515_10000109 Ga0307515_10000109150 318
271 3300028794 Ga0307515_10004774 Ga0307515_1000477411 318
272 3300028794 Ga0307515_10024496 Ga0307515_100244965 318
273 3300028794 Ga0307515_10122066 Ga0307515_101220665 318
274 3300031250 Ga0265331_10007011 Ga0265331_100070116 318
275 3300031251 Ga0265327_10000149 Ga0265327_1000014985 318
276 3300031251 Ga0265327_10002079 Ga0265327_100020795 318
277 3300031251 Ga0265327_10008910 Ga0265327_100089106 318
278 3300031251 Ga0265327_10100592 Ga0265327_101005921 318
279 3300031344 Ga0265316_10001831 Ga0265316_1000183114 318
280 3300031456 Ga0307513_10006129 Ga0307513_100061296 318
281 3300031548 Ga0307408_100000006 Ga0307408_100000006310 318
282 3300031548 Ga0307408_100022760 Ga0307408_1000227602 318
283 3300031616 Ga0307508_10000237 Ga0307508_1000023713 318
284 3300031649 Ga0307514_10000200 Ga0307514_1000020018 318
285 3300031730 Ga0307516_10000476 Ga0307516_1000047629 318
286 3300031730 Ga0307516_10004137 Ga0307516_100041379 318
287 3300031731 Ga0307405_10005429 Ga0307405_100054293 318
288 3300031824 Ga0307413_10007240 Ga0307413_100072406 318
289 3300031911 Ga0307412_10313904 Ga0307412_103139042 318
290 3300031995 Ga0307409_100283352 Ga0307409_1002833522 318
291 3300032002 Ga0307416_100065620 Ga0307416_1000656202 318
292 3300032002 Ga0307416_100564011 Ga0307416_1005640112 318
293 3300032002 Ga0307416_100613769 Ga0307416_1006137691 318
294 3300032005 Ga0307411_10001828 Ga0307411_100018286 318
295 3300032005 Ga0307411_10023364 Ga0307411_100233642 318
296 3300032005 Ga0307411_10135527 Ga0307411_101355272 318
297 3300033180 Ga0307510_10225780 Ga0307510_102257802 318
298 3300035089 Ga0373944_0021853 Ga0373944_0021853_116_1096 318
299 3300035090 Ga0373949_0036540 Ga0373949_0036540_172_1155 318
300 3300035114 Ga0373939_0078301 Ga0373939_0078301_95_1075 318
301 3300035691 Ga0373931_0008388 Ga0373931_0008388_495_1478 318
302 3300035691 Ga0373931_0143868 Ga0373931_0143868_333_1316 318
303 3300037471 Ga0395905_0000642 Ga0395905_0000642_24304_25287 318
304 3300037471 Ga0395905_0332159 Ga0395905_0332159_257_1240 318
305 3300039447 Ga0436361_0041271 Ga0436361_0041271_7253_8233 318
306 3300039447 Ga0436361_0313405 Ga0436361_0313405_48456_49436 318
307 3300039447 Ga0436361_0427460 Ga0436361_0427460_49877_50857 318
308 3300039447 Ga0436361_0587522 Ga0436361_0587522_113_1093 318
309 3300039447 Ga0436361_0813019 Ga0436361_0813019_107_1087 318
310 3300039447 Ga0436361_0919876 Ga0436361_0919876_37349_38338 318
311 3300039447 Ga0436361_1046311 Ga0436361_1046311_1677_2657 318
312 3300041441 Ga0451787_337636 Ga0451787_337636_297_1277 318
313 3300041512 Ga0451853_3266585 Ga0451853_3266585_197_1177 318
314 3300041997 Ga0439431_0020814 Ga0439431_0020814_204_1187 318
315 3300042120 Ga0450917_000104 Ga0450917_000104_3285_4268 318
316 3300042126 Ga0450888_000032 Ga0450888_000032_1068_2051 318
317 3300042127 Ga0450890_001624 Ga0450890_001624_2165_3148 318
318 3300042127 Ga0450890_002449 Ga0450890_002449_1540_2520 318
319 3300042435 Ga0439434_0039862 Ga0439434_0039862_33_1016 318
320 3300042438 Ga0439459_0001155 Ga0439459_0001155_2287_3267 318
321 3300042876 Ga0451577_0005058 Ga0451577_0005058_8171_9151 318
322 3300042876 Ga0451577_0008299 Ga0451577_0008299_7261_8241 318
323 3300044656 Ga0466969_0000123 Ga0466969_0000123_13780_14760 318
324 3300044656 Ga0466969_0011706 Ga0466969_0011706_1006_1986 318
325 3300044656 Ga0466969_0053525 Ga0466969_0053525_165_1145 318
326 3300044683 Ga0466965_0014529 Ga0466965_0014529_49_1029 318
327 3300044684 Ga0466966_0001180 Ga0466966_0001180_9697_10677 318
328 3300044684 Ga0466966_0016277 Ga0466966_0016277_1757_2737 318
329 3300044693 Ga0466961_0002198 Ga0466961_0002198_162_1142 318
330 3300044694 Ga0466963_0024519 Ga0466963_0024519_1114_2094 318
331 3300044694 Ga0466963_0071821 Ga0466963_0071821_1064_2044 318
332 3300044706 Ga0466964_0023294 Ga0466964_0023294_1242_2222 318
333 3300044712 Ga0453684_0019353 Ga0453684_0019353_1666_2646 318
334 3300044712 Ga0453684_0210842 Ga0453684_0210842_333_1313 318
335 3300044712 Ga0453684_0235626 Ga0453684_0235626_905_1891 318
336 3300044712 Ga0453684_0384656 Ga0453684_0384656_431_1411 318
337 3300044719 Ga0466971_0011365 Ga0466971_0011365_2432_3412 318
338 3300044719 Ga0466971_0017330 Ga0466971_0017330_1705_2685 318
339 3300044765 Ga0466970_0003580 Ga0466970_0003580_3077_4057 318
340 3300044765 Ga0466970_0021220 Ga0466970_0021220_2120_3100 318
341 3300044842 Ga0466957_0003922 Ga0466957_0003922_3808_4788 318
342 3300045049 Ga0466959_0000054 Ga0466959_0000054_30893_31873 318
343 3300045049 Ga0466959_0076780 Ga0466959_0076780_879_1859 318
344 3300045051 Ga0451576_0123825 Ga0451576_0123825_976_1956 318
345 3300045051 Ga0451576_0589834 Ga0451576_0589834_116_1096 318
346 3300046457 Ga0495590_0014854 Ga0495590_0014854_1546_2529 318
347 3300046475 Ga0495639_0140454 Ga0495639_0140454_57_1037 318
348 3300046492 Ga0495585_0031454 Ga0495585_0031454_1359_2342 318
349 3300046519 Ga0495632_0055816 Ga0495632_0055816_403_1386 318
350 3300046519 Ga0495632_0073119 Ga0495632_0073119_653_1633 318
351 3300046535 Ga0495586_0097404 Ga0495586_0097404_103_1083 318
352 3300046539 Ga0495621_0009828 Ga0495621_0009828_1493_2485 318
353 3300046542 Ga0495597_0011120 Ga0495597_0011120_2700_3683 318
354 3300046543 Ga0495645_0033343 Ga0495645_0033343_2289_3269 318
355 3300046543 Ga0495645_0236527 Ga0495645_0236527_138_1118 318
356 3300046660 Ga0495625_0032909 Ga0495625_0032909_1301_2281 318
357 3300046675 Ga0495657_0197629 Ga0495657_0197629_230_1210 318
358 3300046689 Ga0495613_0111604 Ga0495613_0111604_115_1095 318
359 3300046691 Ga0495670_0087790 Ga0495670_0087790_326_1318 318
360 3300046694 Ga0495649_0006739 Ga0495649_0006739_4654_5637 318
361 3300047443 Ga0495687_000863 Ga0495687_000863_26292_27275 318
362 3300047444 Ga0495675_0138740 Ga0495675_0138740_287_1267 318
363 3300047471 Ga0495684_0102509 Ga0495684_0102509_731_1711 318
364 3300048091 Ga0495626_0067502 Ga0495626_0067502_370_1353 318
365 3300048905 Ga0496102_0352409 Ga0496102_0352409_190_1182 318
366 3300048907 Ga0496104_0044281 Ga0496104_0044281_119_1102 318
367 3300048911 Ga0496108_0137943 Ga0496108_0137943_162_1154 318
368 3300048911 Ga0496108_0149187 Ga0496108_0149187_136_1119 318
369 3300048912 Ga0496109_0205998 Ga0496109_0205998_308_1291 318
370 3300048913 Ga0496110_0219614 Ga0496110_0219614_185_1177 318
371 3300048918 Ga0496115_0072150 Ga0496115_0072150_1307_2290 318
372 3300048927 Ga0496124_0053200 Ga0496124_0053200_1045_2025 318
373 3300049514 Ga0501291_013785 Ga0501291_013785_173_1156 318
374 3300049523 Ga0501300_002056 Ga0501300_002056_1420_2403 318
375 3300049571 Ga0501034_0015916 Ga0501034_0015916_5961_6938 318
376 3300049579 Ga0501043_0000018 Ga0501043_0000018_65907_66887 318
377 3300049580 Ga0501046_0000042 Ga0501046_0000042_65907_66887 318
378 3300049581 Ga0501047_0000052 Ga0501047_0000052_86562_87542 318
379 3300049582 Ga0501048_0010225 Ga0501048_0010225_169_1149 318
380 3300049649 Ga0501198_000042 Ga0501198_000042_34244_35224 318
381 3300049651 Ga0501201_002787 Ga0501201_002787_499_1482 318
382 3300049653 Ga0501206_002112 Ga0501206_002112_941_1921 318
383 3300049653 Ga0501206_006650 Ga0501206_006650_188_1171 318
384 3300049658 Ga0501211_003040 Ga0501211_003040_511_1494 318
385 3300049662 Ga0501222_000016 Ga0501222_000016_12168_13148 318
386 3300049662 Ga0501222_002427 Ga0501222_002427_808_1791 318
387 3300049663 Ga0501223_005309 Ga0501223_005309_925_1908 318
388 3300049669 Ga0501235_009142 Ga0501235_009142_572_1555 318
389 3300049679 Ga0501249_012855 Ga0501249_012855_312_1295 318
390 3300049684 Ga0501255_003581 Ga0501255_003581_307_1290 318
391 3300049704 Ga0501221_002963 Ga0501221_002963_75_1058 318
392 3300049757 Ga0501232_006067 Ga0501232_006067_97_1080 318
393 3300049762 Ga0501265_005461 Ga0501265_005461_124_1107 318
394 3300049764 Ga0501267_000881 Ga0501267_000881_1071_2054 318
395 3300049766 Ga0501269_003052 Ga0501269_003052_948_1931 318
396 3300049824 Ga0501045_0006468 Ga0501045_0006468_5768_6748 318
397 3300050489 nmdc:mga03683_12266_c1 nmdc:mga03683_12266_c1_1373_2356 318
398 3300050491 nmdc:mga00v17_201376_c1 nmdc:mga00v17_201376_c1_156_1139 318
399 3300050493 nmdc:mga0k408_135126_c1 nmdc:mga0k408_135126_c1_292_1275 318
400 3300050493 nmdc:mga0k408_20982_c1 nmdc:mga0k408_20982_c1_773_1756 318
401 3300050493 nmdc:mga0k408_47063_c1 nmdc:mga0k408_47063_c1_888_1868 318
402 3300050493 nmdc:mga0k408_5366_c1 nmdc:mga0k408_5366_c1_1283_2266 318
403 3300050494 nmdc:mga06z11_90412_c1 nmdc:mga06z11_90412_c1_10_993 318
404 3300050496 nmdc:mga07m45_121459_c1 nmdc:mga07m45_121459_c1_435_1418 318
405 3300050496 nmdc:mga07m45_151709_c1 nmdc:mga07m45_151709_c1_135_1118 318
406 3300050496 nmdc:mga07m45_26147_c1 nmdc:mga07m45_26147_c1_546_1526 318
407 3300050496 nmdc:mga07m45_39198_c1 nmdc:mga07m45_39198_c1_1362_2342 318
408 3300050496 nmdc:mga07m45_40957_c1 nmdc:mga07m45_40957_c1_1509_2492 318
409 3300050496 nmdc:mga07m45_470_c1 nmdc:mga07m45_470_c1_11626_12609 318
410 3300050496 nmdc:mga07m45_51695_c1 nmdc:mga07m45_51695_c1_648_1631 318
411 3300050496 nmdc:mga07m45_771_c1 nmdc:mga07m45_771_c1_6263_7243 318
412 3300050507 nmdc:mga05p37_27957_c1 nmdc:mga05p37_27957_c1_783_1766 318
413 3300050516 nmdc:mga0sz30_42922_c1 nmdc:mga0sz30_42922_c1_834_1817 318
414 3300053080 Ga0500635_0000018 Ga0500635_0000018_94369_95352 318
415 3300053085 Ga0495619_0032076 Ga0495619_0032076_1221_2201 318
416 3300053086 Ga0500578_0015993 Ga0500578_0015993_3212_4192 318
417 3300053134 Ga0500658_0022649 Ga0500658_0022649_118_1098 318
418 3300053153 Ga0500616_0000820 Ga0500616_0000820_14116_15078 318
419 3300053156 Ga0500622_0005578 Ga0500622_0005578_6432_7424 318
420 3300053730 Ga0500645_043393 Ga0500645_043393_207_1187 318
421 3300059421 Ga0590071_006731 Ga0590071_006731_129_1118 318
422 3300005293 Ga0065715_10021485 Ga0065715_100214852 319
423 3300005327 Ga0070658_10004627 Ga0070658_100046272 319
424 3300005327 Ga0070658_10028225 Ga0070658_100282253 319
425 3300005327 Ga0070658_10252075 Ga0070658_102520752 319
426 3300005327 Ga0070658_10325533 Ga0070658_103255332 319
427 3300005329 Ga0070683_100006919 Ga0070683_10000691910 319
428 3300005329 Ga0070683_100015781 Ga0070683_1000157813 319
429 3300005329 Ga0070683_100032256 Ga0070683_1000322563 319
430 3300005331 Ga0070670_100032189 Ga0070670_1000321892 319
431 3300005334 Ga0068869_100234090 Ga0068869_1002340901 319
432 3300005335 Ga0070666_10070705 Ga0070666_100707051 319
433 3300005335 Ga0070666_10340621 Ga0070666_103406211 319
434 3300005336 Ga0070680_100082259 Ga0070680_1000822592 319
435 3300005338 Ga0068868_100177232 Ga0068868_1001772322 319
436 3300005339 Ga0070660_100003196 Ga0070660_1000031966 319
437 3300005339 Ga0070660_100038166 Ga0070660_1000381662 319
438 3300005339 Ga0070660_100160746 Ga0070660_1001607462 319
439 3300005339 Ga0070660_100253827 Ga0070660_1002538271 319
440 3300005340 Ga0070689_100003000 Ga0070689_1000030002 319
441 3300005340 Ga0070689_100079246 Ga0070689_1000792462 319
442 3300005343 Ga0070687_100042290 Ga0070687_1000422902 319
443 3300005344 Ga0070661_100002858 Ga0070661_1000028585 319
444 3300005344 Ga0070661_100013147 Ga0070661_1000131472 319
445 3300005344 Ga0070661_100103772 Ga0070661_1001037722 319
446 3300005344 Ga0070661_100198627 Ga0070661_1001986271 319
447 3300005345 Ga0070692_10049852 Ga0070692_100498522 319
448 3300005347 Ga0070668_100107682 Ga0070668_1001076821 319
449 3300005355 Ga0070671_100010339 Ga0070671_1000103392 319
450 3300005356 Ga0070674_100002429 Ga0070674_10000242910 319
451 3300005356 Ga0070674_100014235 Ga0070674_1000142355 319
452 3300005364 Ga0070673_100070687 Ga0070673_1000706873 319
453 3300005365 Ga0070688_100001354 Ga0070688_10000135413 319
454 3300005366 Ga0070659_100014617 Ga0070659_1000146172 319
455 3300005366 Ga0070659_100021722 Ga0070659_1000217223 319
456 3300005367 Ga0070667_100119394 Ga0070667_1001193941 319
457 3300005367 Ga0070667_100172614 Ga0070667_1001726141 319
458 3300005434 Ga0070709_10016041 Ga0070709_100160412 319
459 3300005434 Ga0070709_10048878 Ga0070709_100488782 319
460 3300005435 Ga0070714_100004236 Ga0070714_1000042362 319
461 3300005435 Ga0070714_100085883 Ga0070714_1000858833 319
462 3300005435 Ga0070714_100126120 Ga0070714_1001261202 319
463 3300005436 Ga0070713_100056141 Ga0070713_1000561412 319
464 3300005437 Ga0070710_10010524 Ga0070710_100105242 319
465 3300005439 Ga0070711_100002733 Ga0070711_1000027337 319
466 3300005439 Ga0070711_100050733 Ga0070711_1000507332 319
467 3300005439 Ga0070711_100089823 Ga0070711_1000898232 319
468 3300005445 Ga0070708_100033437 Ga0070708_1000334373 319
469 3300005455 Ga0070663_100006933 Ga0070663_1000069336 319
470 3300005455 Ga0070663_100233320 Ga0070663_1002333202 319
471 3300005456 Ga0070678_100001716 Ga0070678_10000171612 319
472 3300005458 Ga0070681_10112882 Ga0070681_101128822 319
473 3300005458 Ga0070681_10324597 Ga0070681_103245972 319
474 3300005459 Ga0068867_100063871 Ga0068867_1000638712 319
475 3300005466 Ga0070685_10001322 Ga0070685_100013228 319
476 3300005467 Ga0070706_100032233 Ga0070706_1000322333 319
477 3300005467 Ga0070706_100102357 Ga0070706_1001023572 319
478 3300005468 Ga0070707_100155510 Ga0070707_1001555101 319
479 3300005468 Ga0070707_100221463 Ga0070707_1002214632 319
480 3300005471 Ga0070698_100091533 Ga0070698_1000915333 319
481 3300005518 Ga0070699_100004993 Ga0070699_1000049937 319
482 3300005518 Ga0070699_100024281 Ga0070699_1000242815 319
483 3300005518 Ga0070699_100084335 Ga0070699_1000843353 319
484 3300005518 Ga0070699_100162481 Ga0070699_1001624812 319
485 3300005530 Ga0070679_100058921 Ga0070679_1000589212 319
486 3300005530 Ga0070679_100091089 Ga0070679_1000910893 319
487 3300005530 Ga0070679_100124627 Ga0070679_1001246272 319
488 3300005535 Ga0070684_100007308 Ga0070684_1000073086 319
489 3300005535 Ga0070684_100034421 Ga0070684_1000344212 319
490 3300005536 Ga0070697_100255099 Ga0070697_1002550992 319
491 3300005539 Ga0068853_100017300 Ga0068853_1000173005 319
492 3300005539 Ga0068853_100278580 Ga0068853_1002785802 319
493 3300005543 Ga0070672_100044854 Ga0070672_1000448542 319
494 3300005543 Ga0070672_100135358 Ga0070672_1001353582 319
495 3300005545 Ga0070695_100061764 Ga0070695_1000617642 319
496 3300005546 Ga0070696_100017248 Ga0070696_1000172485 319
497 3300005546 Ga0070696_100038720 Ga0070696_1000387202 319
498 3300005546 Ga0070696_100118507 Ga0070696_1001185072 319
499 3300005547 Ga0070693_100001243 Ga0070693_1000012438 319
500 3300005548 Ga0070665_100002011 Ga0070665_10000201123 319
501 3300005548 Ga0070665_100112883 Ga0070665_1001128833 319
502 3300005549 Ga0070704_100012540 Ga0070704_1000125405 319
503 3300005563 Ga0068855_100015192 Ga0068855_1000151926 319
504 3300005563 Ga0068855_100030735 Ga0068855_1000307357 319
505 3300005563 Ga0068855_100214938 Ga0068855_1002149382 319
506 3300005564 Ga0070664_100000225 Ga0070664_10000022539 319
507 3300005564 Ga0070664_100042812 Ga0070664_1000428122 319
508 3300005564 Ga0070664_100183684 Ga0070664_1001836842 319
509 3300005577 Ga0068857_100046513 Ga0068857_1000465134 319
510 3300005578 Ga0068854_100001711 Ga0068854_1000017116 319
511 3300005578 Ga0068854_100002211 Ga0068854_1000022119 319
512 3300005614 Ga0068856_100007412 Ga0068856_1000074123 319
513 3300005614 Ga0068856_100010154 Ga0068856_1000101547 319
514 3300005614 Ga0068856_100018411 Ga0068856_1000184114 319
515 3300005614 Ga0068856_100024027 Ga0068856_1000240272 319
516 3300005614 Ga0068856_100631791 Ga0068856_1006317911 319
517 3300005616 Ga0068852_100059604 Ga0068852_1000596044 319
518 3300005616 Ga0068852_100087899 Ga0068852_1000878992 319
519 3300005616 Ga0068852_100144730 Ga0068852_1001447302 319
520 3300005617 Ga0068859_100008179 Ga0068859_1000081794 319
521 3300005618 Ga0068864_100003021 Ga0068864_1000030214 319
522 3300005618 Ga0068864_100012967 Ga0068864_1000129673 319
523 3300005718 Ga0068866_10003042 Ga0068866_100030427 319
524 3300005719 Ga0068861_100252661 Ga0068861_1002526612 319
525 3300005834 Ga0068851_10001952 Ga0068851_100019522 319
526 3300005834 Ga0068851_10005110 Ga0068851_100051103 319
527 3300005840 Ga0068870_10004649 Ga0068870_100046493 319
528 3300005841 Ga0068863_100078939 Ga0068863_1000789393 319
529 3300005841 Ga0068863_100265844 Ga0068863_1002658442 319
530 3300005841 Ga0068863_100359834 Ga0068863_1003598342 319
531 3300005842 Ga0068858_100001809 Ga0068858_10000180922 319
532 3300005842 Ga0068858_100014246 Ga0068858_1000142466 319
533 3300005843 Ga0068860_100036536 Ga0068860_1000365362 319
534 3300005843 Ga0068860_100225374 Ga0068860_1002253741 319
535 3300005844 Ga0068862_100036091 Ga0068862_1000360912 319
536 3300005844 Ga0068862_100501604 Ga0068862_1005016041 319
537 3300006173 Ga0070716_100011574 Ga0070716_1000115742 319
538 3300006237 Ga0097621_100363334 Ga0097621_1003633342 319
539 3300006358 Ga0068871_100503920 Ga0068871_1005039202 319
540 3300006847 Ga0075431_100125652 Ga0075431_1001256523 319
541 3300006852 Ga0075433_10051025 Ga0075433_100510252 319
542 3300006871 Ga0075434_100005141 Ga0075434_10000514111 319
543 3300006871 Ga0075434_100316150 Ga0075434_1003161501 319
544 3300006880 Ga0075429_100012528 Ga0075429_1000125281 319
545 3300006881 Ga0068865_100002377 Ga0068865_1000023773 319
546 3300006914 Ga0075436_100000450 Ga0075436_10000045021 319
547 3300006914 Ga0075436_100040453 Ga0075436_1000404532 319
548 3300006914 Ga0075436_100049197 Ga0075436_1000491972 319
549 3300006914 Ga0075436_100097161 Ga0075436_1000971612 319
550 3300006931 Ga0097620_100008179 Ga0097620_1000081798 319
551 3300007076 Ga0075435_100015802 Ga0075435_1000158024 319
552 3300009093 Ga0105240_10008957 Ga0105240_100089575 319
553 3300009093 Ga0105240_10024631 Ga0105240_100246318 319
554 3300009093 Ga0105240_10046164 Ga0105240_100461642 319
555 3300009098 Ga0105245_10023867 Ga0105245_100238676 319
556 3300009098 Ga0105245_10132843 Ga0105245_101328432 319
557 3300009098 Ga0105245_10332858 Ga0105245_103328582 319
558 3300009101 Ga0105247_10028923 Ga0105247_100289232 319
559 3300009147 Ga0114129_10294619 Ga0114129_102946192 319
560 3300009148 Ga0105243_10272335 Ga0105243_102723352 319
561 3300009174 Ga0105241_10001246 Ga0105241_1000124615 319
562 3300009174 Ga0105241_10018060 Ga0105241_100180604 319
563 3300009174 Ga0105241_10431362 Ga0105241_104313621 319
564 3300009176 Ga0105242_10099391 Ga0105242_100993913 319
565 3300009176 Ga0105242_10374105 Ga0105242_103741052 319
566 3300009177 Ga0105248_10103598 Ga0105248_101035982 319
567 3300009177 Ga0105248_10197642 Ga0105248_101976422 319
568 3300009545 Ga0105237_10036249 Ga0105237_100362496 319
569 3300009551 Ga0105238_10000931 Ga0105238_1000093110 319
570 3300009551 Ga0105238_10021461 Ga0105238_100214612 319
571 3300009551 Ga0105238_10317688 Ga0105238_103176882 319
572 3300009551 Ga0105238_10344764 Ga0105238_103447642 319
573 3300009553 Ga0105249_10231327 Ga0105249_102313272 319
574 3300010375 Ga0105239_10047674 Ga0105239_100476742 319
575 3300010375 Ga0105239_10168187 Ga0105239_101681872 319
576 3300010375 Ga0105239_10738454 Ga0105239_107384541 319
577 3300011119 Ga0105246_10107836 Ga0105246_101078362 319
578 3300013100 Ga0157373_10001504 Ga0157373_100015046 319
579 3300013100 Ga0157373_10008726 Ga0157373_100087265 319
580 3300013100 Ga0157373_10038750 Ga0157373_100387502 319
581 3300013102 Ga0157371_10038122 Ga0157371_100381223 319
582 3300013102 Ga0157371_10064586 Ga0157371_100645862 319
583 3300013104 Ga0157370_10005978 Ga0157370_100059784 319
584 3300013104 Ga0157370_10011477 Ga0157370_100114774 319
585 3300013104 Ga0157370_10012817 Ga0157370_100128176 319
586 3300013104 Ga0157370_10029242 Ga0157370_100292424 319
587 3300013104 Ga0157370_10050818 Ga0157370_100508182 319
588 3300013104 Ga0157370_10117936 Ga0157370_101179362 319
589 3300013105 Ga0157369_10003589 Ga0157369_1000358910 319
590 3300013105 Ga0157369_10084966 Ga0157369_100849662 319
591 3300013296 Ga0157374_10013256 Ga0157374_100132565 319
592 3300013296 Ga0157374_10014532 Ga0157374_100145322 319
593 3300013296 Ga0157374_10046648 Ga0157374_100466482 319
594 3300013296 Ga0157374_10460869 Ga0157374_104608691 319
595 3300013296 Ga0157374_10586127 Ga0157374_105861271 319
596 3300013297 Ga0157378_10015438 Ga0157378_100154384 319
597 3300013297 Ga0157378_10108058 Ga0157378_101080583 319
598 3300013306 Ga0163162_10010226 Ga0163162_100102266 319
599 3300013307 Ga0157372_10039758 Ga0157372_100397582 319
600 3300013307 Ga0157372_10045419 Ga0157372_100454195 319
601 3300013307 Ga0157372_10097486 Ga0157372_100974861 319
602 3300013308 Ga0157375_10000552 Ga0157375_1000055227 319
603 3300013308 Ga0157375_10201464 Ga0157375_102014642 319
604 3300013308 Ga0157375_10765066 Ga0157375_107650661 319
605 3300014325 Ga0163163_10033485 Ga0163163_100334852 319
606 3300014325 Ga0163163_10072501 Ga0163163_100725013 319
607 3300014325 Ga0163163_10101651 Ga0163163_101016513 319
608 3300014326 Ga0157380_10010386 Ga0157380_100103863 319
609 3300014326 Ga0157380_10038888 Ga0157380_100388882 319
610 3300014968 Ga0157379_10008664 Ga0157379_100086645 319
611 3300014968 Ga0157379_10119953 Ga0157379_101199532 319
612 3300025315 Ga0207697_10000014 Ga0207697_1000001431 319
613 3300025321 Ga0207656_10011011 Ga0207656_100110112 319
614 3300025899 Ga0207642_10010704 Ga0207642_100107042 319
615 3300025901 Ga0207688_10003995 Ga0207688_100039957 319
616 3300025903 Ga0207680_10052613 Ga0207680_100526132 319
617 3300025903 Ga0207680_10071438 Ga0207680_100714382 319
618 3300025907 Ga0207645_10000272 Ga0207645_1000027233 319
619 3300025907 Ga0207645_10245835 Ga0207645_102458352 319
620 3300025908 Ga0207643_10001264 Ga0207643_100012643 319
621 3300025908 Ga0207643_10087762 Ga0207643_100877622 319
622 3300025909 Ga0207705_10109288 Ga0207705_101092882 319
623 3300025911 Ga0207654_10040018 Ga0207654_100400182 319
624 3300025912 Ga0207707_10003509 Ga0207707_100035095 319
625 3300025912 Ga0207707_10013024 Ga0207707_100130242 319
626 3300025913 Ga0207695_10005581 Ga0207695_100055813 319
627 3300025914 Ga0207671_10445060 Ga0207671_104450601 319
628 3300025915 Ga0207693_10000153 Ga0207693_1000015345 319
629 3300025915 Ga0207693_10014403 Ga0207693_100144036 319
630 3300025916 Ga0207663_10036617 Ga0207663_100366173 319
631 3300025917 Ga0207660_10005727 Ga0207660_100057276 319
632 3300025918 Ga0207662_10008788 Ga0207662_100087882 319
633 3300025919 Ga0207657_10004564 Ga0207657_100045649 319
634 3300025919 Ga0207657_10006048 Ga0207657_100060483 319
635 3300025919 Ga0207657_10035422 Ga0207657_100354223 319
636 3300025919 Ga0207657_10043737 Ga0207657_100437372 319
637 3300025919 Ga0207657_10162359 Ga0207657_101623592 319
638 3300025919 Ga0207657_10222252 Ga0207657_102222521 319
639 3300025920 Ga0207649_10003601 Ga0207649_100036014 319
640 3300025920 Ga0207649_10056447 Ga0207649_100564472 319
641 3300025921 Ga0207652_10002018 Ga0207652_100020184 319
642 3300025921 Ga0207652_10239563 Ga0207652_102395632 319
643 3300025922 Ga0207646_10072499 Ga0207646_100724992 319
644 3300025922 Ga0207646_10160640 Ga0207646_101606402 319
645 3300025924 Ga0207694_10012399 Ga0207694_100123994 319
646 3300025924 Ga0207694_10123967 Ga0207694_101239672 319
647 3300025924 Ga0207694_10246142 Ga0207694_102461422 319
648 3300025925 Ga0207650_10004762 Ga0207650_100047622 319
649 3300025925 Ga0207650_10036806 Ga0207650_100368063 319
650 3300025926 Ga0207659_10004373 Ga0207659_100043737 319
651 3300025927 Ga0207687_10006544 Ga0207687_100065444 319
652 3300025928 Ga0207700_10036066 Ga0207700_100360663 319
653 3300025928 Ga0207700_10059555 Ga0207700_100595552 319
654 3300025929 Ga0207664_10008735 Ga0207664_100087352 319
655 3300025929 Ga0207664_10030560 Ga0207664_100305602 319
656 3300025932 Ga0207690_10019689 Ga0207690_100196892 319
657 3300025932 Ga0207690_10288491 Ga0207690_102884912 319
658 3300025932 Ga0207690_10433819 Ga0207690_104338191 319
659 3300025933 Ga0207706_10085827 Ga0207706_100858272 319
660 3300025934 Ga0207686_10008700 Ga0207686_100087003 319
661 3300025936 Ga0207670_10128255 Ga0207670_101282552 319
662 3300025937 Ga0207669_10151151 Ga0207669_101511512 319
663 3300025938 Ga0207704_10273462 Ga0207704_102734622 319
664 3300025939 Ga0207665_10003325 Ga0207665_100033259 319
665 3300025939 Ga0207665_10050819 Ga0207665_100508193 319
666 3300025940 Ga0207691_10078079 Ga0207691_100780793 319
667 3300025940 Ga0207691_10081812 Ga0207691_100818122 319
668 3300025940 Ga0207691_10125516 Ga0207691_101255162 319
669 3300025941 Ga0207711_10000677 Ga0207711_1000067719 319
670 3300025941 Ga0207711_10059114 Ga0207711_100591142 319
671 3300025941 Ga0207711_10075441 Ga0207711_100754412 319
672 3300025942 Ga0207689_10002874 Ga0207689_100028749 319
673 3300025942 Ga0207689_10030246 Ga0207689_100302465 319
674 3300025944 Ga0207661_10005335 Ga0207661_100053353 319
675 3300025944 Ga0207661_10045320 Ga0207661_100453203 319
676 3300025944 Ga0207661_10082591 Ga0207661_100825912 319
677 3300025944 Ga0207661_10115910 Ga0207661_101159102 319
678 3300025944 Ga0207661_10236884 Ga0207661_102368842 319
679 3300025945 Ga0207679_10012424 Ga0207679_100124242 319
680 3300025945 Ga0207679_10016751 Ga0207679_100167512 319
681 3300025949 Ga0207667_10000860 Ga0207667_1000086026 319
682 3300025949 Ga0207667_10003655 Ga0207667_1000365517 319
683 3300025949 Ga0207667_10008779 Ga0207667_100087795 319
684 3300025949 Ga0207667_10030332 Ga0207667_100303322 319
685 3300025949 Ga0207667_10319761 Ga0207667_103197612 319
686 3300025949 Ga0207667_10380813 Ga0207667_103808131 319
687 3300025960 Ga0207651_10002106 Ga0207651_100021069 319
688 3300025960 Ga0207651_10029248 Ga0207651_100292482 319
689 3300025981 Ga0207640_10007254 Ga0207640_100072543 319
690 3300025981 Ga0207640_10109120 Ga0207640_101091202 319
691 3300025986 Ga0207658_10029131 Ga0207658_100291313 319
692 3300025986 Ga0207658_10221610 Ga0207658_102216102 319
693 3300025986 Ga0207658_10278265 Ga0207658_102782651 319
694 3300026023 Ga0207677_10000568 Ga0207677_100005682 319
695 3300026023 Ga0207677_10077614 Ga0207677_100776142 319
696 3300026035 Ga0207703_10003052 Ga0207703_100030528 319
697 3300026035 Ga0207703_10015842 Ga0207703_100158424 319
698 3300026041 Ga0207639_10023753 Ga0207639_100237533 319
699 3300026067 Ga0207678_10009412 Ga0207678_100094124 319
700 3300026075 Ga0207708_10334594 Ga0207708_103345942 319
701 3300026078 Ga0207702_10004735 Ga0207702_100047355 319
702 3300026078 Ga0207702_10017663 Ga0207702_100176635 319
703 3300026078 Ga0207702_10240838 Ga0207702_102408382 319
704 3300026078 Ga0207702_10487553 Ga0207702_104875532 319
705 3300026088 Ga0207641_10090534 Ga0207641_100905342 319
706 3300026088 Ga0207641_10364665 Ga0207641_103646652 319
707 3300026089 Ga0207648_10077572 Ga0207648_100775722 319
708 3300026095 Ga0207676_10000487 Ga0207676_1000048722 319
709 3300026116 Ga0207674_10000045 Ga0207674_10000045103 319
710 3300026116 Ga0207674_10000380 Ga0207674_1000038010 319
711 3300026116 Ga0207674_10011058 Ga0207674_100110583 319
712 3300026118 Ga0207675_100034419 Ga0207675_1000344193 319
713 3300026121 Ga0207683_10001803 Ga0207683_1000180319 319
714 3300026121 Ga0207683_10007175 Ga0207683_100071758 319
715 3300026121 Ga0207683_10009314 Ga0207683_100093148 319
716 3300026142 Ga0207698_10001195 Ga0207698_100011952 319
717 3300026142 Ga0207698_10050176 Ga0207698_100501762 319
718 3300026142 Ga0207698_10168457 Ga0207698_101684571 319
719 3300027614 Ga0209970_1018051 Ga0209970_10180511 319
720 3300027876 Ga0209974_10009106 Ga0209974_100091062 319
721 3300028379 Ga0268266_10035048 Ga0268266_100350484 319
722 3300028379 Ga0268266_10083838 Ga0268266_100838382 319
723 3300028380 Ga0268265_10216209 Ga0268265_102162092 319
724 3300028380 Ga0268265_10375890 Ga0268265_103758901 319
725 3300028381 Ga0268264_10103061 Ga0268264_101030612 319
726 3300028381 Ga0268264_10464604 Ga0268264_104646041 319
727 3300031548 Ga0307408_100024311 Ga0307408_1000243114 319
728 3300031691 Ga0316579_10017242 Ga0316579_100172423 319
729 3300031727 Ga0316576_10019850 Ga0316576_100198503 319
730 3300031727 Ga0316576_10126795 Ga0316576_101267952 319
731 3300031728 Ga0316578_10036520 Ga0316578_100365203 319
732 3300031728 Ga0316578_10075217 Ga0316578_100752172 319
733 3300031731 Ga0307405_10000531 Ga0307405_100005316 319
734 3300031731 Ga0307405_10006086 Ga0307405_100060862 319
735 3300031733 Ga0316577_10072871 Ga0316577_100728712 319
736 3300031824 Ga0307413_10002488 Ga0307413_100024888 319
737 3300031824 Ga0307413_10028776 Ga0307413_100287762 319
738 3300031852 Ga0307410_10002348 Ga0307410_100023484 319
739 3300031852 Ga0307410_10002777 Ga0307410_100027775 319
740 3300031901 Ga0307406_10005190 Ga0307406_100051904 319
741 3300031903 Ga0307407_10006878 Ga0307407_100068781 319
742 3300031903 Ga0307407_10011931 Ga0307407_100119312 319
743 3300031911 Ga0307412_10011462 Ga0307412_100114622 319
744 3300031911 Ga0307412_10017944 Ga0307412_100179442 319
745 3300031995 Ga0307409_100000296 Ga0307409_10000029617 319
746 3300031995 Ga0307409_100008896 Ga0307409_1000088964 319
747 3300032002 Ga0307416_100004316 Ga0307416_1000043163 319
748 3300032002 Ga0307416_100019849 Ga0307416_1000198494 319
749 3300032004 Ga0307414_10018807 Ga0307414_100188073 319
750 3300032004 Ga0307414_10020468 Ga0307414_100204684 319
751 3300032005 Ga0307411_10000157 Ga0307411_1000015713 319
752 3300032005 Ga0307411_10027937 Ga0307411_100279372 319
753 3300032126 Ga0307415_100030255 Ga0307415_1000302553 319
754 3300032126 Ga0307415_100041448 Ga0307415_1000414482 319
755 3300032137 Ga0316585_10043512 Ga0316585_100435122 319
756 3300032139 Ga0316580_10026199 Ga0316580_100261992 319
757 3300035114 Ga0373939_0000172 Ga0373939_0000172_1748_2743 319
758 3300035118 Ga0373954_0002732 Ga0373954_0002732_293_1261 319
759 3300035120 Ga0373957_0002773 Ga0373957_0002773_2948_3916 319
760 3300035121 Ga0373960_0000838 Ga0373960_0000838_4077_5072 319
761 3300035170 Ga0373943_0058774 Ga0373943_0058774_127_1095 319
762 3300035171 Ga0373946_0020385 Ga0373946_0020385_607_1575 319
763 3300035410 Ga0373924_0011368 Ga0373924_0011368_1815_2783 319
764 3300035691 Ga0373931_0000138 Ga0373931_0000138_20300_21295 319
765 3300035691 Ga0373931_0259984 Ga0373931_0259984_37_1032 319
766 3300035695 Ga0373927_0020224 Ga0373927_0020224_248_1225 319
767 3300035725 Ga0373947_0006647 Ga0373947_0006647_5603_6571 319
768 3300035725 Ga0373947_0018891 Ga0373947_0018891_188_1156 319
769 3300036401 Ga0373937_0012826 Ga0373937_0012826_3974_4942 319
770 3300036401 Ga0373937_0068780 Ga0373937_0068780_1519_2487 319
771 3300036401 Ga0373937_0094166 Ga0373937_0094166_816_1784 319
772 3300036647 Ga0316582_0194431 Ga0316582_0194431_189_1148 319
773 3300036712 Ga0316584_0238463 Ga0316584_0238463_152_1111 319
774 3300037068 Ga0373925_0006042 Ga0373925_0006042_3919_4887 319
775 3300037068 Ga0373925_0111719 Ga0373925_0111719_937_1896 319
776 3300037312 Ga0395899_0200723 Ga0395899_0200723_227_1189 319
777 3300037471 Ga0395905_0014790 Ga0395905_0014790_4976_5938 319
778 3300038443 Ga0395901_0016261 Ga0395901_0016261_5130_6092 319
779 3300038996 Ga0242420_007333 Ga0242420_007333_707_1666 319
780 3300039437 Ga0436365_0314337 Ga0436365_0314337_548_1519 319
781 3300042876 Ga0451577_0055602 Ga0451577_0055602_712_1671 319
782 3300044673 Ga0453683_0002257 Ga0453683_0002257_627_1598 319
783 3300044673 Ga0453683_0047332 Ga0453683_0047332_355_1338 319
784 3300044712 Ga0453684_0016947 Ga0453684_0016947_614_1585 319
785 3300044712 Ga0453684_0054309 Ga0453684_0054309_2680_3663 319
786 3300044712 Ga0453684_0057170 Ga0453684_0057170_3496_4473 319
787 3300044712 Ga0453684_0586369 Ga0453684_0586369_28_1011 319
788 3300045051 Ga0451576_0000001 Ga0451576_0000001_978970_979941 319
789 3300045051 Ga0451576_0051380 Ga0451576_0051380_1126_2112 319
790 3300046459 Ga0495629_0033378 Ga0495629_0033378_224_1192 319
791 3300046462 Ga0495651_0131591 Ga0495651_0131591_258_1226 319
792 3300046463 Ga0495653_0099806 Ga0495653_0099806_60_1028 319
793 3300046472 Ga0495580_0210435 Ga0495580_0210435_34_993 319
794 3300046475 Ga0495639_0016287 Ga0495639_0016287_2145_3113 319
795 3300046476 Ga0495662_0020205 Ga0495662_0020205_738_1706 319
796 3300046477 Ga0495664_0037911 Ga0495664_0037911_1183_2151 319
797 3300046517 Ga0495630_0152593 Ga0495630_0152593_776_1744 319
798 3300046517 Ga0495630_0248054 Ga0495630_0248054_354_1313 319
799 3300046539 Ga0495621_0022302 Ga0495621_0022302_71_1048 319
800 3300046543 Ga0495645_0030864 Ga0495645_0030864_2840_3808 319
801 3300046664 Ga0495659_0005751 Ga0495659_0005751_1140_2108 319
802 3300046679 Ga0495623_0084968 Ga0495623_0084968_956_1924 319
803 3300046681 Ga0495647_0045978 Ga0495647_0045978_266_1234 319
804 3300046683 Ga0495658_0023095 Ga0495658_0023095_1040_2008 319
805 3300046689 Ga0495613_0015093 Ga0495613_0015093_3860_4828 319
806 3300046809 Ga0495600_0019071 Ga0495600_0019071_2694_3662 319
807 3300047315 Ga0495581_0040029 Ga0495581_0040029_420_1388 319
808 3300047318 Ga0495636_0050144 Ga0495636_0050144_407_1375 319
809 3300047322 Ga0495680_0058280 Ga0495680_0058280_1312_2280 319
810 3300047471 Ga0495684_0010031 Ga0495684_0010031_2876_3844 319
811 3300048089 Ga0495614_0082581 Ga0495614_0082581_42_1010 319
812 3300048904 Ga0496101_0032221 Ga0496101_0032221_2459_3418 319
813 3300048904 Ga0496101_0157020 Ga0496101_0157020_308_1285 319
814 3300048905 Ga0496102_0123790 Ga0496102_0123790_1416_2384 319
815 3300048905 Ga0496102_0205793 Ga0496102_0205793_757_1716 319
816 3300048906 Ga0496103_0043052 Ga0496103_0043052_989_1957 319
817 3300048907 Ga0496104_0025445 Ga0496104_0025445_1138_2097 319
818 3300048907 Ga0496104_0046798 Ga0496104_0046798_169_1137 319
819 3300048908 Ga0496105_0007858 Ga0496105_0007858_3772_4731 319
820 3300048909 Ga0496106_0016578 Ga0496106_0016578_1848_2807 319
821 3300048910 Ga0496107_0158474 Ga0496107_0158474_45_1013 319
822 3300048911 Ga0496108_0003315 Ga0496108_0003315_2161_3120 319
823 3300048911 Ga0496108_0475932 Ga0496108_0475932_30_992 319
824 3300048912 Ga0496109_0004780 Ga0496109_0004780_8016_8975 319
825 3300048912 Ga0496109_0028429 Ga0496109_0028429_163_1131 319
826 3300048912 Ga0496109_0266685 Ga0496109_0266685_573_1550 319
827 3300048913 Ga0496110_0006092 Ga0496110_0006092_6230_7189 319
828 3300048915 Ga0496112_0000710 Ga0496112_0000710_7101_8069 319
829 3300048915 Ga0496112_0053740 Ga0496112_0053740_1273_2235 319
830 3300048917 Ga0496114_0017071 Ga0496114_0017071_3349_4317 319
831 3300048918 Ga0496115_0010832 Ga0496115_0010832_5250_6218 319
832 3300048918 Ga0496115_0455891 Ga0496115_0455891_13_981 319
833 3300049581 Ga0501047_0101856 Ga0501047_0101856_1377_2348 319
834 3300049583 Ga0501067_0012644 Ga0501067_0012644_2175_3146 319
835 3300049586 Ga0501070_0006503 Ga0501070_0006503_8850_9821 319
836 3300049589 Ga0501073_0086176 Ga0501073_0086176_978_1949 319
837 3300049590 Ga0501074_0053822 Ga0501074_0053822_1004_1975 319
838 3300049593 Ga0501077_0240070 Ga0501077_0240070_54_1025 319
839 3300049742 Ga0501080_0009862 Ga0501080_0009862_5552_6523 319
840 3300049744 Ga0501083_0000703 Ga0501083_0000703_12136_13116 319
841 3300049744 Ga0501083_0063016 Ga0501083_0063016_1471_2442 319
842 3300049760 Ga0501263_004038 Ga0501263_004038_400_1380 319
843 3300050507 nmdc:mga05p37_242853_c1 nmdc:mga05p37_242853_c1_611_1579 319
844 3300050511 nmdc:mga08y16_10845_c1 nmdc:mga08y16_10845_c1_1563_2534 319
845 3300050512 nmdc:mga0n895_296823_c1 nmdc:mga0n895_296823_c1_144_1121 319
846 3300050513 nmdc:mga0rr50_303739_c1 nmdc:mga0rr50_303739_c1_72_1034 319
847 3300050514 nmdc:mga08x19_224871_c1 nmdc:mga08x19_224871_c1_102_1067 319
848 3300053085 Ga0495619_0015430 Ga0495619_0015430_3101_4069 319
849 3300053096 Ga0500641_0112612 Ga0500641_0112612_86_1060 319
850 3300054114 Ga0501084_0028961 Ga0501084_0028961_2260_3240 319
851 3300054114 Ga0501084_0065152 Ga0501084_0065152_1600_2571 319
852 3300005329 Ga0070683_100142843 Ga0070683_1001428431 320
853 3300005329 Ga0070683_100151045 Ga0070683_1001510452 320
854 3300005331 Ga0070670_100220130 Ga0070670_1002201302 320
855 3300005336 Ga0070680_100028583 Ga0070680_1000285834 320
856 3300005344 Ga0070661_100093097 Ga0070661_1000930972 320
857 3300005344 Ga0070661_100127416 Ga0070661_1001274162 320
858 3300005354 Ga0070675_100214793 Ga0070675_1002147932 320
859 3300005355 Ga0070671_100025515 Ga0070671_1000255152 320
860 3300005459 Ga0068867_100091748 Ga0068867_1000917482 320
861 3300005530 Ga0070679_100032042 Ga0070679_1000320422 320
862 3300005539 Ga0068853_100129921 Ga0068853_1001299212 320
863 3300005548 Ga0070665_100305700 Ga0070665_1003057001 320
864 3300005564 Ga0070664_100003164 Ga0070664_10000316412 320
865 3300005564 Ga0070664_100140517 Ga0070664_1001405172 320
866 3300005577 Ga0068857_100019014 Ga0068857_1000190144 320
867 3300005578 Ga0068854_100029754 Ga0068854_1000297542 320
868 3300005614 Ga0068856_100082117 Ga0068856_1000821173 320
869 3300005616 Ga0068852_100011366 Ga0068852_1000113664 320
870 3300005616 Ga0068852_100053251 Ga0068852_1000532513 320
871 3300005616 Ga0068852_100094816 Ga0068852_1000948162 320
872 3300005617 Ga0068859_100224881 Ga0068859_1002248812 320
873 3300005618 Ga0068864_100004994 Ga0068864_1000049945 320
874 3300005718 Ga0068866_10056168 Ga0068866_100561682 320
875 3300005719 Ga0068861_100003681 Ga0068861_1000036811 320
876 3300005842 Ga0068858_100012375 Ga0068858_1000123752 320
877 3300005842 Ga0068858_100073212 Ga0068858_1000732124 320
878 3300005843 Ga0068860_100109777 Ga0068860_1001097773 320
879 3300006237 Ga0097621_100223620 Ga0097621_1002236201 320
880 3300006881 Ga0068865_100124275 Ga0068865_1001242751 320
881 3300006931 Ga0097620_100224901 Ga0097620_1002249012 320
882 3300013102 Ga0157371_10032114 Ga0157371_100321143 320
883 3300017792 Ga0163161_10350400 Ga0163161_103504001 320
884 3300025321 Ga0207656_10017951 Ga0207656_100179513 320
885 3300025893 Ga0207682_10035747 Ga0207682_100357472 320
886 3300025907 Ga0207645_10043389 Ga0207645_100433892 320
887 3300025917 Ga0207660_10266821 Ga0207660_102668211 320
888 3300025918 Ga0207662_10112987 Ga0207662_101129872 320
889 3300025919 Ga0207657_10114852 Ga0207657_101148522 320
890 3300025919 Ga0207657_10151935 Ga0207657_101519351 320
891 3300025924 Ga0207694_10247391 Ga0207694_102473912 320
892 3300025924 Ga0207694_10296665 Ga0207694_102966651 320
893 3300025925 Ga0207650_10001899 Ga0207650_100018993 320
894 3300025926 Ga0207659_10088744 Ga0207659_100887441 320
895 3300025927 Ga0207687_10153484 Ga0207687_101534842 320
896 3300025933 Ga0207706_10009312 Ga0207706_100093126 320
897 3300025941 Ga0207711_10048113 Ga0207711_100481132 320
898 3300025941 Ga0207711_10091407 Ga0207711_100914072 320
899 3300025941 Ga0207711_10371780 Ga0207711_103717801 320
900 3300025942 Ga0207689_10003356 Ga0207689_1000335614 320
901 3300025945 Ga0207679_10209639 Ga0207679_102096392 320
902 3300025949 Ga0207667_10199460 Ga0207667_101994602 320
903 3300026023 Ga0207677_10174372 Ga0207677_101743722 320
904 3300026035 Ga0207703_10133865 Ga0207703_101338652 320
905 3300026041 Ga0207639_10044448 Ga0207639_100444481 320
906 3300026041 Ga0207639_10060210 Ga0207639_100602102 320
907 3300026067 Ga0207678_10025143 Ga0207678_100251432 320
908 3300026067 Ga0207678_10152589 Ga0207678_101525892 320
909 3300026078 Ga0207702_10098884 Ga0207702_100988842 320
910 3300026095 Ga0207676_10036016 Ga0207676_100360162 320
911 3300026116 Ga0207674_10031960 Ga0207674_100319604 320
912 3300026118 Ga0207675_100000982 Ga0207675_1000009825 320
913 3300026121 Ga0207683_10092890 Ga0207683_100928902 320
914 3300026142 Ga0207698_10016132 Ga0207698_100161322 320
915 3300005327 Ga0070658_10021183 Ga0070658_100211834 321
916 3300005328 Ga0070676_10008552 Ga0070676_100085525 321
917 3300005331 Ga0070670_100232103 Ga0070670_1002321032 321
918 3300005333 Ga0070677_10000110 Ga0070677_1000011013 321
919 3300005334 Ga0068869_100270925 Ga0068869_1002709252 321
920 3300005335 Ga0070666_10001273 Ga0070666_100012739 321
921 3300005338 Ga0068868_100002706 Ga0068868_1000027069 321
922 3300005347 Ga0070668_100001262 Ga0070668_10000126215 321
923 3300005354 Ga0070675_100001731 Ga0070675_1000017316 321
924 3300005355 Ga0070671_100033312 Ga0070671_1000333124 321
925 3300005355 Ga0070671_100041370 Ga0070671_1000413703 321
926 3300005356 Ga0070674_100000281 Ga0070674_10000028111 321
927 3300005364 Ga0070673_100001293 Ga0070673_1000012932 321
928 3300005367 Ga0070667_100007248 Ga0070667_1000072487 321
929 3300005367 Ga0070667_100134744 Ga0070667_1001347443 321
930 3300005456 Ga0070678_100003910 Ga0070678_1000039105 321
931 3300005459 Ga0068867_100010338 Ga0068867_1000103386 321
932 3300005539 Ga0068853_100030917 Ga0068853_1000309174 321
933 3300005543 Ga0070672_100023411 Ga0070672_1000234112 321
934 3300005548 Ga0070665_100003069 Ga0070665_10000306915 321
935 3300005616 Ga0068852_100005521 Ga0068852_1000055216 321
936 3300005618 Ga0068864_100006896 Ga0068864_1000068967 321
937 3300005840 Ga0068870_10011360 Ga0068870_100113602 321
938 3300005841 Ga0068863_100006136 Ga0068863_1000061367 321
939 3300005842 Ga0068858_100001489 Ga0068858_1000014892 321
940 3300006237 Ga0097621_100024903 Ga0097621_1000249033 321
941 3300006358 Ga0068871_100007492 Ga0068871_1000074923 321
942 3300006881 Ga0068865_100036709 Ga0068865_1000367092 321
943 3300009177 Ga0105248_10108637 Ga0105248_101086372 321
944 3300010375 Ga0105239_10338345 Ga0105239_103383452 321
945 3300014325 Ga0163163_10014450 Ga0163163_100144507 321
946 3300014968 Ga0157379_10413034 Ga0157379_104130342 321
947 3300017792 Ga0163161_10185645 Ga0163161_101856452 321
948 3300025893 Ga0207682_10000063 Ga0207682_1000006315 321
949 3300025903 Ga0207680_10053699 Ga0207680_100536992 321
950 3300025907 Ga0207645_10000195 Ga0207645_1000019526 321
951 3300025908 Ga0207643_10015155 Ga0207643_100151552 321
952 3300025909 Ga0207705_10068271 Ga0207705_100682713 321
953 3300025926 Ga0207659_10006715 Ga0207659_100067154 321
954 3300025931 Ga0207644_10012979 Ga0207644_100129792 321
955 3300025931 Ga0207644_10017416 Ga0207644_100174164 321
956 3300025937 Ga0207669_10000968 Ga0207669_100009688 321
957 3300025940 Ga0207691_10000370 Ga0207691_100003707 321
958 3300025941 Ga0207711_10064515 Ga0207711_100645152 321
959 3300025942 Ga0207689_10260367 Ga0207689_102603671 321
960 3300025960 Ga0207651_10012926 Ga0207651_100129264 321
961 3300025972 Ga0207668_10066180 Ga0207668_100661803 321
962 3300025972 Ga0207668_10359237 Ga0207668_103592372 321
963 3300025986 Ga0207658_10004294 Ga0207658_100042942 321
964 3300025986 Ga0207658_10118225 Ga0207658_101182252 321
965 3300026023 Ga0207677_10005073 Ga0207677_100050733 321
966 3300026041 Ga0207639_10077914 Ga0207639_100779142 321
967 3300026067 Ga0207678_10001630 Ga0207678_1000163021 321
968 3300026088 Ga0207641_10027318 Ga0207641_100273185 321
969 3300026089 Ga0207648_10006509 Ga0207648_100065092 321
970 3300026095 Ga0207676_10024837 Ga0207676_100248372 321
971 3300026121 Ga0207683_10000009 Ga0207683_1000000921 321
972 3300028379 Ga0268266_10002814 Ga0268266_1000281415 321
973 3300031251 Ga0265327_10001316 Ga0265327_100013167 321
974 3300041507 Ga0451851_0324073 Ga0451851_0324073_118_1122 321
975 3300048909 Ga0496106_0035206 Ga0496106_0035206_99_1109 321
976 3300048917 Ga0496114_0400635 Ga0496114_0400635_89_1069 321
977 3300049765 Ga0501268_017905 Ga0501268_017905_10_1167 321
978 3300002076 JGI24749J21850_1002080 JGI24749J21850_10020802 322
979 3300002239 JGI24034J26672_10002936 JGI24034J26672_100029362 322
980 3300005290 Ga0065712_10123062 Ga0065712_101230622 322
981 3300005293 Ga0065715_10117495 Ga0065715_101174952 322
982 3300005293 Ga0065715_10180442 Ga0065715_101804422 322
983 3300005328 Ga0070676_10002080 Ga0070676_100020807 322
984 3300005328 Ga0070676_10009874 Ga0070676_100098743 322
985 3300005329 Ga0070683_100012189 Ga0070683_1000121894 322
986 3300005330 Ga0070690_100012720 Ga0070690_1000127203 322
987 3300005330 Ga0070690_100042902 Ga0070690_1000429021 322
988 3300005330 Ga0070690_100134126 Ga0070690_1001341262 322
989 3300005331 Ga0070670_100001353 Ga0070670_1000013533 322
990 3300005331 Ga0070670_100038102 Ga0070670_1000381022 322
991 3300005331 Ga0070670_100105606 Ga0070670_1001056061 322
992 3300005331 Ga0070670_100131201 Ga0070670_1001312012 322
993 3300005334 Ga0068869_100012867 Ga0068869_1000128672 322
994 3300005334 Ga0068869_100015623 Ga0068869_1000156233 322
995 3300005334 Ga0068869_100064331 Ga0068869_1000643312 322
996 3300005335 Ga0070666_10040552 Ga0070666_100405522 322
997 3300005335 Ga0070666_10187410 Ga0070666_101874102 322
998 3300005336 Ga0070680_100129783 Ga0070680_1001297832 322
999 3300005339 Ga0070660_100015363 Ga0070660_1000153636 322
1000 3300005339 Ga0070660_100041670 Ga0070660_1000416702 322
1001 3300005340 Ga0070689_100030747 Ga0070689_1000307472 322
1002 3300005343 Ga0070687_100019948 Ga0070687_1000199483 322
1003 3300005344 Ga0070661_100002328 Ga0070661_1000023283 322
1004 3300005344 Ga0070661_100007616 Ga0070661_1000076167 322
1005 3300005344 Ga0070661_100009841 Ga0070661_1000098415 322
1006 3300005344 Ga0070661_100020626 Ga0070661_1000206265 322
1007 3300005345 Ga0070692_10023349 Ga0070692_100233492 322
1008 3300005347 Ga0070668_100003150 Ga0070668_1000031502 322
1009 3300005347 Ga0070668_100005925 Ga0070668_1000059256 322
1010 3300005347 Ga0070668_100006020 Ga0070668_1000060205 322
1011 3300005347 Ga0070668_100117466 Ga0070668_1001174662 322
1012 3300005353 Ga0070669_100007697 Ga0070669_1000076972 322
1013 3300005353 Ga0070669_100020170 Ga0070669_1000201702 322
1014 3300005353 Ga0070669_100087040 Ga0070669_1000870402 322
1015 3300005354 Ga0070675_100020955 Ga0070675_1000209556 322
1016 3300005354 Ga0070675_100035986 Ga0070675_1000359863 322
1017 3300005354 Ga0070675_100080009 Ga0070675_1000800091 322
1018 3300005355 Ga0070671_100034014 Ga0070671_1000340143 322
1019 3300005356 Ga0070674_100097692 Ga0070674_1000976922 322
1020 3300005356 Ga0070674_100402220 Ga0070674_1004022201 322
1021 3300005364 Ga0070673_100014449 Ga0070673_1000144492 322
1022 3300005365 Ga0070688_100002366 Ga0070688_1000023667 322
1023 3300005366 Ga0070659_100024523 Ga0070659_1000245233 322
1024 3300005366 Ga0070659_100148008 Ga0070659_1001480082 322
1025 3300005366 Ga0070659_100213888 Ga0070659_1002138881 322
1026 3300005367 Ga0070667_100002647 Ga0070667_10000264714 322
1027 3300005434 Ga0070709_10028498 Ga0070709_100284983 322
1028 3300005438 Ga0070701_10005635 Ga0070701_100056353 322
1029 3300005441 Ga0070700_100017255 Ga0070700_1000172552 322
1030 3300005455 Ga0070663_100014606 Ga0070663_1000146065 322
1031 3300005455 Ga0070663_100263997 Ga0070663_1002639972 322
1032 3300005455 Ga0070663_100394314 Ga0070663_1003943141 322
1033 3300005456 Ga0070678_100005336 Ga0070678_1000053364 322
1034 3300005456 Ga0070678_100100101 Ga0070678_1001001012 322
1035 3300005456 Ga0070678_100212692 Ga0070678_1002126921 322
1036 3300005457 Ga0070662_100000721 Ga0070662_1000007219 322
1037 3300005457 Ga0070662_100068874 Ga0070662_1000688742 322
1038 3300005458 Ga0070681_10000413 Ga0070681_1000041333 322
1039 3300005458 Ga0070681_10187435 Ga0070681_101874352 322
1040 3300005459 Ga0068867_100002927 Ga0068867_1000029274 322
1041 3300005459 Ga0068867_100030407 Ga0068867_1000304072 322
1042 3300005459 Ga0068867_100091242 Ga0068867_1000912422 322
1043 3300005466 Ga0070685_10001523 Ga0070685_1000152310 322
1044 3300005466 Ga0070685_10140690 Ga0070685_101406902 322
1045 3300005468 Ga0070707_100097289 Ga0070707_1000972891 322
1046 3300005530 Ga0070679_100001227 Ga0070679_10000122720 322
1047 3300005535 Ga0070684_100006324 Ga0070684_1000063243 322
1048 3300005535 Ga0070684_100305629 Ga0070684_1003056292 322
1049 3300005539 Ga0068853_100001754 Ga0068853_1000017544 322
1050 3300005539 Ga0068853_100019057 Ga0068853_1000190576 322
1051 3300005539 Ga0068853_100182743 Ga0068853_1001827432 322
1052 3300005543 Ga0070672_100000724 Ga0070672_10000072420 322
1053 3300005543 Ga0070672_100007386 Ga0070672_1000073866 322
1054 3300005543 Ga0070672_100049179 Ga0070672_1000491793 322
1055 3300005543 Ga0070672_100127203 Ga0070672_1001272032 322
1056 3300005544 Ga0070686_100015482 Ga0070686_1000154822 322
1057 3300005548 Ga0070665_100008870 Ga0070665_1000088706 322
1058 3300005563 Ga0068855_100000453 Ga0068855_10000045332 322
1059 3300005563 Ga0068855_100069746 Ga0068855_1000697463 322
1060 3300005563 Ga0068855_100102570 Ga0068855_1001025702 322
1061 3300005564 Ga0070664_100001099 Ga0070664_10000109910 322
1062 3300005564 Ga0070664_100069951 Ga0070664_1000699512 322
1063 3300005564 Ga0070664_100216952 Ga0070664_1002169522 322
1064 3300005577 Ga0068857_100039154 Ga0068857_1000391542 322
1065 3300005578 Ga0068854_100008998 Ga0068854_1000089983 322
1066 3300005578 Ga0068854_100012434 Ga0068854_1000124343 322
1067 3300005578 Ga0068854_100165657 Ga0068854_1001656572 322
1068 3300005614 Ga0068856_100000980 Ga0068856_1000009809 322
1069 3300005615 Ga0070702_100017945 Ga0070702_1000179452 322
1070 3300005616 Ga0068852_100005781 Ga0068852_1000057816 322
1071 3300005616 Ga0068852_100052531 Ga0068852_1000525311 322
1072 3300005617 Ga0068859_100019260 Ga0068859_1000192602 322
1073 3300005617 Ga0068859_100120357 Ga0068859_1001203572 322
1074 3300005618 Ga0068864_100003388 Ga0068864_1000033889 322
1075 3300005618 Ga0068864_100043933 Ga0068864_1000439332 322
1076 3300005618 Ga0068864_100051250 Ga0068864_1000512503 322
1077 3300005618 Ga0068864_100186145 Ga0068864_1001861452 322
1078 3300005718 Ga0068866_10001300 Ga0068866_1000130010 322
1079 3300005719 Ga0068861_100019950 Ga0068861_1000199501 322
1080 3300005719 Ga0068861_100074947 Ga0068861_1000749472 322
1081 3300005834 Ga0068851_10001504 Ga0068851_100015046 322
1082 3300005841 Ga0068863_100002944 Ga0068863_1000029446 322
1083 3300005841 Ga0068863_100012415 Ga0068863_1000124155 322
1084 3300005842 Ga0068858_100009131 Ga0068858_1000091315 322
1085 3300005843 Ga0068860_100030385 Ga0068860_1000303856 322
1086 3300005843 Ga0068860_100070370 Ga0068860_1000703701 322
1087 3300005844 Ga0068862_100032352 Ga0068862_1000323522 322
1088 3300006038 Ga0075365_10160636 Ga0075365_101606361 322
1089 3300006237 Ga0097621_100014480 Ga0097621_1000144802 322
1090 3300006237 Ga0097621_100038425 Ga0097621_1000384253 322
1091 3300006358 Ga0068871_100007455 Ga0068871_1000074555 322
1092 3300006358 Ga0068871_100047622 Ga0068871_1000476223 322
1093 3300006358 Ga0068871_100064259 Ga0068871_1000642592 322
1094 3300006881 Ga0068865_100110781 Ga0068865_1001107812 322
1095 3300006931 Ga0097620_100019260 Ga0097620_1000192602 322
1096 3300006931 Ga0097620_100120356 Ga0097620_1001203562 322
1097 3300009094 Ga0111539_10037540 Ga0111539_100375402 322
1098 3300009101 Ga0105247_10145471 Ga0105247_101454712 322
1099 3300009148 Ga0105243_10022010 Ga0105243_100220103 322
1100 3300009148 Ga0105243_10043773 Ga0105243_100437732 322
1101 3300009176 Ga0105242_10064186 Ga0105242_100641862 322
1102 3300009176 Ga0105242_10066151 Ga0105242_100661513 322
1103 3300009177 Ga0105248_10002109 Ga0105248_1000210910 322
1104 3300009553 Ga0105249_10053561 Ga0105249_100535613 322
1105 3300009553 Ga0105249_10131014 Ga0105249_101310143 322
1106 3300010375 Ga0105239_10152516 Ga0105239_101525162 322
1107 3300010375 Ga0105239_10278259 Ga0105239_102782592 322
1108 3300011119 Ga0105246_10051067 Ga0105246_100510673 322
1109 3300013100 Ga0157373_10000649 Ga0157373_100006497 322
1110 3300013102 Ga0157371_10000638 Ga0157371_1000063813 322
1111 3300013104 Ga0157370_10002443 Ga0157370_1000244310 322
1112 3300013104 Ga0157370_10073452 Ga0157370_100734522 322
1113 3300013104 Ga0157370_10275977 Ga0157370_102759771 322
1114 3300013105 Ga0157369_10215608 Ga0157369_102156082 322
1115 3300013105 Ga0157369_10478974 Ga0157369_104789741 322
1116 3300013296 Ga0157374_10025342 Ga0157374_100253422 322
1117 3300013296 Ga0157374_10254048 Ga0157374_102540482 322
1118 3300013297 Ga0157378_10019789 Ga0157378_100197895 322
1119 3300013306 Ga0163162_10030008 Ga0163162_100300082 322
1120 3300013307 Ga0157372_10136264 Ga0157372_101362642 322
1121 3300013308 Ga0157375_10104651 Ga0157375_101046512 322
1122 3300013308 Ga0157375_10342380 Ga0157375_103423802 322
1123 3300014968 Ga0157379_10019963 Ga0157379_100199632 322
1124 3300017792 Ga0163161_10022976 Ga0163161_100229763 322
1125 3300017792 Ga0163161_10031806 Ga0163161_100318062 322
1126 3300017792 Ga0163161_10081871 Ga0163161_100818712 322
1127 3300017792 Ga0163161_10088263 Ga0163161_100882632 322
1128 3300025321 Ga0207656_10004561 Ga0207656_100045615 322
1129 3300025893 Ga0207682_10000095 Ga0207682_1000009533 322
1130 3300025899 Ga0207642_10001503 Ga0207642_100015036 322
1131 3300025903 Ga0207680_10015227 Ga0207680_100152272 322
1132 3300025903 Ga0207680_10115127 Ga0207680_101151272 322
1133 3300025906 Ga0207699_10057676 Ga0207699_100576761 322
1134 3300025907 Ga0207645_10007040 Ga0207645_100070402 322
1135 3300025907 Ga0207645_10046857 Ga0207645_100468572 322
1136 3300025912 Ga0207707_10038346 Ga0207707_100383462 322
1137 3300025912 Ga0207707_10161743 Ga0207707_101617432 322
1138 3300025915 Ga0207693_10050525 Ga0207693_100505252 322
1139 3300025917 Ga0207660_10102503 Ga0207660_101025032 322
1140 3300025919 Ga0207657_10000409 Ga0207657_1000040931 322
1141 3300025919 Ga0207657_10037570 Ga0207657_100375702 322
1142 3300025920 Ga0207649_10007126 Ga0207649_100071265 322
1143 3300025920 Ga0207649_10007390 Ga0207649_100073902 322
1144 3300025920 Ga0207649_10019187 Ga0207649_100191872 322
1145 3300025921 Ga0207652_10030735 Ga0207652_100307352 322
1146 3300025923 Ga0207681_10113098 Ga0207681_101130982 322
1147 3300025925 Ga0207650_10009384 Ga0207650_100093846 322
1148 3300025925 Ga0207650_10013079 Ga0207650_100130792 322
1149 3300025925 Ga0207650_10067924 Ga0207650_100679242 322
1150 3300025925 Ga0207650_10161341 Ga0207650_101613412 322
1151 3300025926 Ga0207659_10002575 Ga0207659_100025753 322
1152 3300025926 Ga0207659_10010964 Ga0207659_100109642 322
1153 3300025926 Ga0207659_10083027 Ga0207659_100830273 322
1154 3300025931 Ga0207644_10004197 Ga0207644_100041977 322
1155 3300025931 Ga0207644_10011530 Ga0207644_100115302 322
1156 3300025931 Ga0207644_10059361 Ga0207644_100593613 322
1157 3300025931 Ga0207644_10093222 Ga0207644_100932222 322
1158 3300025932 Ga0207690_10011683 Ga0207690_100116833 322
1159 3300025932 Ga0207690_10284496 Ga0207690_102844961 322
1160 3300025933 Ga0207706_10000232 Ga0207706_1000023231 322
1161 3300025933 Ga0207706_10017282 Ga0207706_100172824 322
1162 3300025933 Ga0207706_10064159 Ga0207706_100641592 322
1163 3300025935 Ga0207709_10038651 Ga0207709_100386512 322
1164 3300025935 Ga0207709_10096773 Ga0207709_100967732 322
1165 3300025936 Ga0207670_10037114 Ga0207670_100371142 322
1166 3300025936 Ga0207670_10062133 Ga0207670_100621332 322
1167 3300025937 Ga0207669_10008441 Ga0207669_100084413 322
1168 3300025937 Ga0207669_10065278 Ga0207669_100652781 322
1169 3300025938 Ga0207704_10033559 Ga0207704_100335592 322
1170 3300025938 Ga0207704_10098281 Ga0207704_100982812 322
1171 3300025940 Ga0207691_10000406 Ga0207691_100004062 322
1172 3300025940 Ga0207691_10004936 Ga0207691_100049363 322
1173 3300025940 Ga0207691_10006303 Ga0207691_100063037 322
1174 3300025940 Ga0207691_10006393 Ga0207691_100063933 322
1175 3300025940 Ga0207691_10043866 Ga0207691_100438661 322
1176 3300025940 Ga0207691_10143884 Ga0207691_101438842 322
1177 3300025941 Ga0207711_10011337 Ga0207711_100113373 322
1178 3300025942 Ga0207689_10006514 Ga0207689_100065145 322
1179 3300025942 Ga0207689_10017634 Ga0207689_100176345 322
1180 3300025945 Ga0207679_10007974 Ga0207679_100079746 322
1181 3300025945 Ga0207679_10133208 Ga0207679_101332082 322
1182 3300025949 Ga0207667_10001380 Ga0207667_1000138026 322
1183 3300025949 Ga0207667_10128814 Ga0207667_101288142 322
1184 3300025960 Ga0207651_10021533 Ga0207651_100215332 322
1185 3300025960 Ga0207651_10331527 Ga0207651_103315272 322
1186 3300025972 Ga0207668_10000588 Ga0207668_100005882 322
1187 3300025972 Ga0207668_10115860 Ga0207668_101158602 322
1188 3300025981 Ga0207640_10019268 Ga0207640_100192681 322
1189 3300025981 Ga0207640_10025022 Ga0207640_100250222 322
1190 3300025981 Ga0207640_10046560 Ga0207640_100465602 322
1191 3300025981 Ga0207640_10128890 Ga0207640_101288902 322
1192 3300025986 Ga0207658_10012167 Ga0207658_100121676 322
1193 3300025986 Ga0207658_10073100 Ga0207658_100731002 322
1194 3300026023 Ga0207677_10019960 Ga0207677_100199602 322
1195 3300026023 Ga0207677_10317897 Ga0207677_103178971 322
1196 3300026041 Ga0207639_10028265 Ga0207639_100282654 322
1197 3300026041 Ga0207639_10280504 Ga0207639_102805042 322
1198 3300026067 Ga0207678_10004372 Ga0207678_100043725 322
1199 3300026067 Ga0207678_10004440 Ga0207678_100044404 322
1200 3300026067 Ga0207678_10166047 Ga0207678_101660472 322
1201 3300026075 Ga0207708_10000766 Ga0207708_1000076624 322
1202 3300026078 Ga0207702_10003001 Ga0207702_100030011 322
1203 3300026088 Ga0207641_10005500 Ga0207641_100055006 322
1204 3300026088 Ga0207641_10058733 Ga0207641_100587332 322
1205 3300026088 Ga0207641_10111602 Ga0207641_101116022 322
1206 3300026089 Ga0207648_10000885 Ga0207648_1000088513 322
1207 3300026089 Ga0207648_10001587 Ga0207648_1000158726 322
1208 3300026089 Ga0207648_10003000 Ga0207648_100030007 322
1209 3300026089 Ga0207648_10067742 Ga0207648_100677423 322
1210 3300026095 Ga0207676_10007017 Ga0207676_100070172 322
1211 3300026095 Ga0207676_10054047 Ga0207676_100540472 322
1212 3300026116 Ga0207674_10008292 Ga0207674_100082927 322
1213 3300026118 Ga0207675_100006003 Ga0207675_1000060035 322
1214 3300026118 Ga0207675_100010997 Ga0207675_1000109976 322
1215 3300026118 Ga0207675_100100927 Ga0207675_1001009272 322
1216 3300026121 Ga0207683_10002918 Ga0207683_100029187 322
1217 3300026121 Ga0207683_10016707 Ga0207683_100167075 322
1218 3300026121 Ga0207683_10019254 Ga0207683_100192543 322
1219 3300026142 Ga0207698_10004886 Ga0207698_100048863 322
1220 3300026142 Ga0207698_10019585 Ga0207698_100195852 322
1221 3300027695 Ga0209966_1006848 Ga0209966_10068482 322
1222 3300027876 Ga0209974_10017653 Ga0209974_100176532 322
1223 3300027907 Ga0207428_10057082 Ga0207428_100570822 322
1224 3300028380 Ga0268265_10027125 Ga0268265_100271253 322
1225 3300028380 Ga0268265_10115987 Ga0268265_101159872 322
1226 3300028381 Ga0268264_10016423 Ga0268264_100164236 322
1227 3300031235 Ga0265330_10002031 Ga0265330_100020318 322
1228 3300031238 Ga0265332_10001320 Ga0265332_1000132010 322
1229 3300031239 Ga0265328_10014756 Ga0265328_100147562 322
1230 3300031241 Ga0265325_10020658 Ga0265325_100206582 322
1231 3300031242 Ga0265329_10002673 Ga0265329_100026736 322
1232 3300031249 Ga0265339_10043404 Ga0265339_100434042 322
1233 3300031250 Ga0265331_10000782 Ga0265331_1000078222 322
1234 3300031251 Ga0265327_10110845 Ga0265327_101108451 322
1235 3300031344 Ga0265316_10015971 Ga0265316_100159716 322
1236 3300031711 Ga0265314_10024215 Ga0265314_100242153 322
1237 3300031903 Ga0307407_10102592 Ga0307407_101025922 322
1238 3300035119 Ga0373956_0045582 Ga0373956_0045582_150_1118 322
1239 3300035724 Ga0373933_0063845 Ga0373933_0063845_443_1411 322
1240 3300036401 Ga0373937_0089311 Ga0373937_0089311_15_983 322
1241 3300042435 Ga0439434_0003833 Ga0439434_0003833_2266_3234 322
1242 3300046472 Ga0495580_0124571 Ga0495580_0124571_668_1645 322
1243 3300046539 Ga0495621_0032286 Ga0495621_0032286_451_1419 322
1244 3300048905 Ga0496102_0004391 Ga0496102_0004391_130_1098 322
1245 3300048906 Ga0496103_0010291 Ga0496103_0010291_3014_3982 322
1246 3300048910 Ga0496107_0004959 Ga0496107_0004959_6824_7792 322
1247 3300048912 Ga0496109_0184211 Ga0496109_0184211_623_1615 322
1248 3300048913 Ga0496110_0204183 Ga0496110_0204183_742_1758 322
1249 3300048917 Ga0496114_0043990 Ga0496114_0043990_1580_2548 322
1250 3300050508 nmdc:mga09592_23891_c1 nmdc:mga09592_23891_c1_45_1070 322
1251 3300050511 nmdc:mga08y16_584128_c1 nmdc:mga08y16_584128_c1_25_993 322
1252 3300050512 nmdc:mga0n895_69615_c1 nmdc:mga0n895_69615_c1_183_1163 322
1253 3300050514 nmdc:mga08x19_5335_c1 nmdc:mga08x19_5335_c1_2153_3133 322
1254 3300053085 Ga0495619_0126157 Ga0495619_0126157_726_1694 322
1255 3300053153 Ga0500616_0003173 Ga0500616_0003173_3661_4629 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

73

381

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eb3-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone 0.9783 6 321
3eb4-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone 0.9781 6 321
7wf3-assembly1.cif.gz_C composite map of human kv1.3 channel in apo state with beta subunits 0.9654 6 321
6ci1-assembly1.cif.gz_H the structure of full-length kv beta 2.1 determined by cryogenic electron microscopy 0.9614 6 319
3eb3-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone 0.9573 6 321
ID Description Score Start End Superfamily
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9866 4 321 3.20.20.100
af_P97382_23_247_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9777 109 321 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9768 4 321 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9684 4 321 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9655 5 321 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2U2SJ32-F1-model_v4 Aldo/keto reductase 0.9941 4 321 GO:0016491
AF-A0A7C7GQV1-F1-model_v4 deleted 0.9924 4 180
AF-A0A382BNH0-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9924 4 173 GO:0016491
AF-A0A7J6WMD8-F1-model_v4 Voltage-gated potassium channel subunit beta-1 0.9906 4 197 GO:0016491
GO:0034220
AF-A0A3M2GM87-F1-model_v4 Aldo/keto reductase 0.9875 143 322 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.69 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map