F492252

General Info

Members Datasets Scaffolds Average Seq Length
1255 1001 2508 455

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2922386360|2922387161
Length 533
Sequence IGALAESCAKRRFEFERQWRASLKAGIRCRGDRQRKAKLPPSICCLGATAVFDILFWTRKHRDDRISVGVDLEDDMLSNSLIELDRAHLIHPVSSYRSHEAQGVRVLKSAKGATLTDVSGRQLLDGFAGLWCVNAGYGQDSIVEAAARQLRELPYATGYFGLGSDPAIRLAARLAELAPGDLNHVYFTLGGSDAVDSTIRFIRYYYHAKGRPQKDQFISVEYGYHGSSTAGSGLTALPAFHTGFGVPYSWQHKIPSHYAYRNPVGTHPQAIIAASVAALQAKISELGADRVAAFYVEPIQGSGGVLVPPPSWLKEMQAVCKEHDILFVADEVITGFGRVGPLFACEEDDVVPDLMTTAKGLTSGYVPMGAILMSDRVYNTIADGAGKTAVGHGYTYSAHPVSAAVGLACLDLYENGLLENGRKAGHRLMEGLRALADHPLVGDVRGRGMLAAIELVTDKKRKTPLPTEADAARRIFDRAWDNGLVIRAFAQGVLGFAPPLCCTDADIDGIIERTRSTLDQTLEDKDVRAAMKG

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
78 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
79 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
80 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
93 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
108 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
109 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
110 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
111 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
112 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
113 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
114 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
122 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
123 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
179 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
180 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
182 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
183 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
184 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
202 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
203 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
216 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
217 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
222 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
223 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
241 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
257 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
305 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
306 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
307 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
308 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
309 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
310 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
311 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
312 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
315 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
316 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
317 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
318 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
319 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
320 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
322 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
323 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
324 2508501050 Microvirga lupini Lut6 Isolate Nodule
325 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
326 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
327 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
328 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
329 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
330 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
331 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
332 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
333 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
334 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
335 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
336 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
337 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
338 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
339 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
340 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
341 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
342 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
343 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
344 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
345 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
346 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
347 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
348 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
349 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
350 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
351 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
352 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
353 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
354 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
355 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
356 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
357 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
358 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
359 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
360 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
361 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
362 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
363 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
364 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
365 2516143018 Ensifer sp. BR816 Isolate Nodule
366 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
367 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
368 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
369 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
370 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
371 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
372 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
373 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
374 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
375 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
376 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
377 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
378 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
379 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
380 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
381 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
382 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
383 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
384 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
385 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
386 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
387 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
388 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
389 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
390 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
391 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
392 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
393 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
394 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
395 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
396 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
397 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
398 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
399 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
400 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
401 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
402 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
403 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
404 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
405 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
406 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
407 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
408 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
409 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
410 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
411 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
412 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
413 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
414 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
415 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
416 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
417 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
418 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
419 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
420 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
421 2643221582 Rhizobium sp. Root651 Isolate Unclassified
422 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
423 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
424 2643221693 Rhizobium sp. Root491 Isolate Unclassified
425 2643221723 Ensifer sp. Root278 Isolate Unclassified
426 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
427 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
428 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
429 2718217882 Rhizobium sp. N741 Isolate Nodule
430 2718217927 Rhizobium sp. N324 Isolate Nodule
431 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
432 2718218009 Rhizobium sp. N561 Isolate Nodule
433 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
434 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
435 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
436 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
437 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
438 2718218363 Rhizobium sp. N113 Isolate Nodule
439 2718218365 Rhizobium sp. N731 Isolate Nodule
440 2718218366 Rhizobium sp. N621 Isolate Nodule
441 2718218423 Rhizobium sp. N941 Isolate Nodule
442 2721755514 Rhizobium sp. N6212 Isolate Nodule
443 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
444 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
445 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
446 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
447 2721755809 Rhizobium sp. N541 Isolate Nodule
448 2721755810 Rhizobium sp. N871 Isolate Nodule
449 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
450 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
451 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
452 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
453 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
454 2728369365 Rhizobium sp. N1341 Isolate Nodule
455 2728369397 Rhizobium sp. N1314 Isolate Nodule
456 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
457 2751185800 Brucella pituitosa AA2 Isolate Unclassified
458 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
459 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
460 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
461 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
462 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
463 2773857925 Microvirga vignae BR3299 Isolate Unclassified
464 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
465 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
466 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
467 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
468 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
469 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
470 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
471 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
472 2791355256 Rhizobium sp. M10 Isolate Nodule
473 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
474 2791355260 Rhizobium sp. L9 Isolate Nodule
475 2791355261 Rhizobium sp. J15 Isolate Nodule
476 2791355262 Rhizobium sp. M1 Isolate Nodule
477 2791355263 Rhizobium chutanense C5 Isolate Nodule
478 2791355264 Rhizobium sp. S9 Isolate Nodule
479 2791355266 Rhizobium sp. L43 Isolate Nodule
480 2791355267 Rhizobium sp. L18 Isolate Nodule
481 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
482 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
483 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
484 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
485 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
486 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
487 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
488 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
489 2802429633 Rhizobium anhuiense J3 Isolate Nodule
490 2802429634 Rhizobium anhuiense S10 Isolate Nodule
491 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
492 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
493 2802429637 Rhizobium anhuiense C15 Isolate Nodule
494 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
495 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
496 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
497 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
498 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
499 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
500 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
501 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
502 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
503 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
504 2838048938 Rhizobium pisi 27/80 Isolate Nodule
505 2838061910 Rhizobium phaseoli L15 Isolate Nodule
506 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
507 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
508 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
509 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
510 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
511 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
512 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
513 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
514 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
515 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
516 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
517 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
518 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
519 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
520 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
521 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
522 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
523 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
524 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
525 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
526 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
527 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
528 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
529 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
530 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
531 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
532 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
533 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
534 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
535 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
536 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
537 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
538 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
539 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
540 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
541 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
542 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
543 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
544 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
545 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
546 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
547 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
548 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
549 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
550 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
551 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
552 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
553 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
554 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
555 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
556 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
557 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
558 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
559 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
560 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
561 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
562 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
563 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
564 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
565 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
566 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
567 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
568 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
569 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
570 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
571 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
572 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
573 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
574 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
575 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
576 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
577 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
578 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
579 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
580 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
581 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
582 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
583 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
584 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
585 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
586 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
587 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
588 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
589 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
590 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
591 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
592 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
593 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
594 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
595 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
596 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
597 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
598 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
599 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
600 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
601 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
602 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
603 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
604 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
605 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
606 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
607 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
608 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
609 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
610 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
611 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
612 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
613 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
614 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
615 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
616 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
617 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
618 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
619 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
620 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
621 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
622 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
623 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
624 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
625 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
626 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
627 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
628 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
629 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
630 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
631 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
632 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
633 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
634 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
635 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
636 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
637 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
638 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
639 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
640 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
641 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
642 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
643 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
644 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
645 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
646 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
647 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
648 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
649 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
650 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
651 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
652 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
653 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
654 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
655 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
656 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
657 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
658 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
659 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
660 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
661 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
662 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
663 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
664 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
665 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
666 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
667 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
668 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
669 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
670 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
671 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
672 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
673 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
674 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
675 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
676 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
677 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
678 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
679 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
680 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
681 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
682 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
683 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
684 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
685 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
686 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
687 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
688 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
689 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
690 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
691 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
692 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
693 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
694 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
695 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
696 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
697 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
698 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
699 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
700 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
701 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
702 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
703 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
704 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
705 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
706 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
707 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
708 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
709 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
710 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
711 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
712 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
713 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
714 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
715 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
716 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
717 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
718 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
719 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
720 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
721 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
722 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
723 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
724 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
725 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
726 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
727 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
728 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
729 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
730 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
731 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
732 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
733 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
734 2933599457 Rhizobium phaseoli M3 Isolate Nodule
735 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
736 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
737 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
738 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
739 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
740 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
741 2936381700 Rhizobium chutanense C16 Isolate Unclassified
742 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
743 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
744 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
745 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
746 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
747 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
748 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
749 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
750 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
751 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
752 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
753 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
754 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
755 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
756 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
757 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
758 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
759 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
760 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
761 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
762 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
763 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
764 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
765 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
766 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
767 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
768 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
769 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
770 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
771 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
772 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
773 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
774 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
775 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
776 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
777 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
778 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
779 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
780 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
781 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
782 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
783 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
784 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
785 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
786 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
787 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
788 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
789 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
790 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
791 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
792 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
793 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
794 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
795 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
796 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
797 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
798 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
799 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
800 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
801 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
802 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
803 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
804 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
805 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
806 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
807 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
808 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
809 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
810 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
811 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
812 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
813 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
814 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
815 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
816 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
817 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
818 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
819 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
820 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
821 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
822 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
823 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
824 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
825 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
826 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
827 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
828 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
829 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
830 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
831 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
832 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
833 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
834 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
835 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
836 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
837 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
838 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
839 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
840 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
841 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
842 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
843 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
844 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
845 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
846 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
847 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
848 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
849 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
850 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
851 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
852 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
853 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
854 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
855 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
856 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
857 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
858 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
859 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
860 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
861 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
862 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
863 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
864 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
865 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
866 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
867 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
868 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
869 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
870 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
871 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
872 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
873 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
874 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
875 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
876 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
877 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
878 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
879 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
880 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
881 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
882 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
883 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
884 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
885 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
886 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
887 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
888 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
889 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
890 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
891 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
892 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
893 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
894 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
895 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
896 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
897 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
898 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
899 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
900 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
901 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
902 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
903 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
904 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
905 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
906 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
907 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
908 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
909 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
910 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
911 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
912 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
913 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
914 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
915 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
916 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
917 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
918 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
919 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
920 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
921 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
922 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
923 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
924 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
925 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
926 2996887358 Rhizobium sp. R711 Isolate Nodule
927 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
928 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
929 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
930 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
931 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
932 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
933 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
934 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
935 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
936 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
937 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
938 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
939 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
940 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
941 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
942 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
943 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
944 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
945 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
946 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
947 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
948 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
949 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
950 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
951 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
952 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
953 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
954 8005275841 Rhizobium sp. N4311 Isolate Nodule
955 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
956 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
957 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
958 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
959 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
960 8005321885 Rhizobium sp. R72 Isolate Nodule
961 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
962 8005382845 Rhizobium sp. R634 Isolate Nodule
963 8005395548 Rhizobium sp. R339 Isolate Nodule
964 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
965 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
966 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
967 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
968 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
969 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
970 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
971 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
972 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
973 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
974 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
975 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
976 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
977 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
978 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
979 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
980 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
981 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
982 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
983 8018176218 Rhizobium sp. N122 Isolate Nodule
984 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
985 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
986 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
987 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
988 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
989 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
990 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
991 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
992 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
993 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
994 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
995 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
996 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
997 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
998 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
999 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
1000 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1001 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.34
Metatranscriptomes 0
Isolates 54.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 14.18
Nodule 44.7
Rhizoplane 1.91
Rhizosphere 25.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000196 3300001904 Bacteria 10841
2 JGI24741J21665_1000024 3300001915 Bacteria 36239
3 JGI24740J21852_10001594 3300001979 Bacteria 10423
4 JGI24740J21852_10006396 3300001979 Bacteria 4883
5 JGI24739J22299_10001518 3300001989 Bacteria 8763
6 JGI24738J21930_10003743 3300002075 Bacteria 3801
7 JGI25155J39150_1000003 3300002704 Bacteria 279666
8 JGI25155J39150_1000729 3300002704 Bacteria 5708
9 JGI25156J39149_1000004 3300002705 Bacteria 273027
10 JGI25162J39368_1000069 3300002737 Bacteria 125244
11 JGI25154J39366_1000013 3300002738 Bacteria 268260
12 JGI25154J39366_1000772 3300002738 Bacteria 14196
13 JGI25157J39369_1000004 3300002741 Bacteria 273009
14 JGI25152J39213_1000186 3300002773 Bacteria 41823
15 JGI25159J45721_1000019 3300002987 Bacteria 127304
16 JGI25151J46595_10000867 3300003187 Bacteria 23973
17 JGI25165J46597_1000018 3300003214 Bacteria 374701
18 JGI25165J46597_1000020 3300003214 Bacteria 370477
19 JGI25165J46597_1000372 3300003214 Bacteria 50057
20 JGI25165J46597_1005415 3300003214 Bacteria 2462
21 JGI25153J46596_10000200 3300003215 Bacteria 55694
22 JGI25153J46596_10000829 3300003215 Bacteria 18882
23 JGI25153J46596_10020305 3300003215 Bacteria 2515
24 rootH1_10018479 3300003316 Bacteria 3044
25 rootH1_10010878 3300003323 Bacteria 5360
26 rootH1_10084286 3300003323 Bacteria 6026
27 JGI25160J50197_1000054 3300003354 Bacteria 127304
28 JGI25160J50197_1000203 3300003354 Bacteria 49418
29 JGI25160J50197_1002223 3300003354 Bacteria 9111
30 JGI25161J50226_1000570 3300003374 Bacteria 15614
31 JGI25161J50226_1002643 3300003374 Bacteria 4485
32 JGI25161J50226_1003970 3300003374 Bacteria 3214
33 Ga0055538_1000008 3300003751 Bacteria 398547
34 Ga0055538_1000302 3300003751 Bacteria 24606
35 Ga0055539_1000012 3300003752 Bacteria 398547
36 Ga0055533_1000015 3300003756 Bacteria 398547
37 Ga0055525_1000017 3300003759 Bacteria 398547
38 Ga0055542_1000068 3300003762 Bacteria 152353
39 Ga0055526_1000308 3300003771 Bacteria 40807
40 Ga0055526_1002146 3300003771 Bacteria 13527
41 Ga0055524_1002400 3300003775 Bacteria 9714
42 Ga0055524_1017598 3300003775 Bacteria 2517
43 Ga0055536_1000640 3300003781 Bacteria 23814
44 Ga0055536_1001374 3300003781 Bacteria 14794
45 Ga0055536_1004941 3300003781 Bacteria 6642
46 Ga0055528_1000054 3300003790 Bacteria 90334
47 Ga0055528_1000611 3300003790 Bacteria 26673
48 Ga0055540_1000131 3300003792 Bacteria 75615
49 Ga0055531_10000207 3300003794 Bacteria 64818
50 Ga0055531_10003719 3300003794 Bacteria 9591
51 Ga0055531_10020782 3300003794 Bacteria 2579
52 Ga0055541_1000009 3300003841 Bacteria 398547
53 Ga0058692_1004401 3300003856 Bacteria 4182
54 Ga0055543_1000150 3300004625 Bacteria 58353
55 Ga0055543_1000349 3300004625 Bacteria 31437
56 Ga0055543_1001165 3300004625 Bacteria 11186
57 Ga0065165_1000136 3300005262 Bacteria 127754
58 Ga0065165_1000672 3300005262 Bacteria 49172
59 Ga0070670_100025939 3300005331 Bacteria 5043
60 Ga0070666_10002707 3300005335 Bacteria 10698
61 Ga0068868_100011890 3300005338 Bacteria 6347
62 Ga0070660_100012565 3300005339 Bacteria 6048
63 Ga0070661_100062021 3300005344 Bacteria 2745
64 Ga0070668_100046856 3300005347 Bacteria 3322
65 Ga0070671_100017186 3300005355 Bacteria 5855
66 Ga0070674_100034053 3300005356 Bacteria 3398
67 Ga0070667_100009753 3300005367 Bacteria 7961
68 Ga0070709_10004117 3300005434 Bacteria 7841
69 Ga0070713_100020550 3300005436 Bacteria 5065
70 Ga0070710_10001455 3300005437 Bacteria 11172
71 Ga0070663_100006884 3300005455 Bacteria 6881
72 Ga0070663_100008174 3300005455 Bacteria 6420
73 Ga0070681_10053293 3300005458 Bacteria 4031
74 Ga0070685_10001923 3300005466 Bacteria 10778
75 Ga0070699_100068180 3300005518 Bacteria 3089
76 Ga0070665_100000227 3300005548 Bacteria 93439
77 Ga0070665_100040698 3300005548 Bacteria 4671
78 Ga0070665_100059322 3300005548 Bacteria 3836
79 Ga0070665_100153116 3300005548 Bacteria 2308
80 Ga0068855_100001019 3300005563 Bacteria 34917
81 Ga0068855_100153664 3300005563 Bacteria 2615
82 Ga0068855_100186637 3300005563 Bacteria 2341
83 Ga0068857_100120684 3300005577 Bacteria 2360
84 Ga0068857_100279867 3300005577 Bacteria 1534
85 Ga0068854_100010398 3300005578 Bacteria 6033
86 Ga0068854_100031331 3300005578 Bacteria 3694
87 Ga0068854_100063002 3300005578 Bacteria 2691
88 Ga0068856_100009010 3300005614 Bacteria 9709
89 Ga0068856_100009837 3300005614 Bacteria 9287
90 Ga0068856_100017742 3300005614 Bacteria 6902
91 Ga0068856_100154918 3300005614 Bacteria 2301
92 Ga0068852_100000915 3300005616 Bacteria 19555
93 Ga0068852_100201722 3300005616 Bacteria 1882
94 Ga0068852_100206905 3300005616 Bacteria 1859
95 Ga0068864_100187555 3300005618 Bacteria 1894
96 Ga0068851_10001399 3300005834 Bacteria 10544
97 Ga0068863_100051283 3300005841 Bacteria 3911
98 Ga0068863_100106350 3300005841 Bacteria 2670
99 Ga0068858_100004031 3300005842 Bacteria 14495
100 Ga0068862_100176133 3300005844 Bacteria 1917
101 Ga0081540_1003849 3300005983 Bacteria 11723
102 Ga0070717_10064195 3300006028 Bacteria 3049
103 Ga0075365_10000531 3300006038 Bacteria 14672
104 Ga0075365_10009053 3300006038 Bacteria 5695
105 Ga0075365_10010720 3300006038 Bacteria 5353
106 Ga0075365_10017374 3300006038 Bacteria 4400
107 Ga0075365_10019715 3300006038 Bacteria 4169
108 Ga0075365_10022527 3300006038 Bacteria 3948
109 Ga0075365_10030791 3300006038 Bacteria 3440
110 Ga0075365_10081484 3300006038 Bacteria 2193
111 Ga0075368_10034284 3300006042 Bacteria 1977
112 Ga0075363_100000058 3300006048 Bacteria 22322
113 Ga0075364_10014932 3300006051 Bacteria 4808
114 Ga0070712_100016628 3300006175 Bacteria 4752
115 Ga0075362_10010898 3300006177 Bacteria 3567
116 Ga0075362_10015935 3300006177 Bacteria 3068
117 Ga0075362_10040411 3300006177 Bacteria 2053
118 Ga0075367_10000241 3300006178 Bacteria 18607
119 Ga0075367_10049377 3300006178 Bacteria 2480
120 Ga0075367_10094119 3300006178 Bacteria 1826
121 Ga0075369_10002765 3300006186 Bacteria 6298
122 Ga0075369_10004181 3300006186 Bacteria 5319
123 Ga0075369_10006567 3300006186 Bacteria 4402
124 Ga0075369_10009584 3300006186 Bacteria 3766
125 Ga0075366_10006620 3300006195 Bacteria 6359
126 Ga0075370_10008090 3300006353 Bacteria 5396
127 Ga0075428_100005444 3300006844 Bacteria 14149
128 Ga0075428_100117841 3300006844 Bacteria 2892
129 Ga0075430_100010143 3300006846 Bacteria 7973
130 Ga0075430_100012612 3300006846 Bacteria 7197
131 Ga0075431_100000183 3300006847 Bacteria 45154
132 Ga0099825_1029359 3300006941 Bacteria 2561
133 Ga0099824_1023232 3300006942 Bacteria 3891
134 Ga0099822_1023504 3300006943 Bacteria 5663
135 Ga0099826_10000665 3300006948 Bacteria 17773
136 Ga0105251_10031549 3300009011 Bacteria 2650
137 Ga0105244_10048482 3300009036 Bacteria 2174
138 Ga0105240_10000217 3300009093 Bacteria 115649
139 Ga0105240_10001044 3300009093 Bacteria 49217
140 Ga0105240_10136724 3300009093 Bacteria 2934
141 Ga0105240_10176549 3300009093 Bacteria 2525
142 Ga0114129_10032402 3300009147 Bacteria 7386
143 Ga0105243_10007647 3300009148 Bacteria 8304
144 Ga0105243_10018759 3300009148 Bacteria 5240
145 Ga0105241_10001102 3300009174 Bacteria 20563
146 Ga0105242_10210522 3300009176 Bacteria 1732
147 Ga0105248_10029402 3300009177 Bacteria 6129
148 Ga0105237_10000978 3300009545 Bacteria 38384
149 Ga0105237_10003836 3300009545 Bacteria 17674
150 Ga0105237_10010892 3300009545 Bacteria 9648
151 Ga0105237_10016626 3300009545 Bacteria 7642
152 Ga0105237_10045493 3300009545 Bacteria 4416
153 Ga0105237_10116983 3300009545 Bacteria 2659
154 Ga0105238_10000111 3300009551 Bacteria 89931
155 Ga0105238_10006969 3300009551 Bacteria 11292
156 Ga0105238_10073563 3300009551 Bacteria 3412
157 Ga0105238_10148003 3300009551 Bacteria 2324
158 Ga0105238_10209138 3300009551 Bacteria 1927
159 Ga0105249_10007119 3300009553 Bacteria 9765
160 Ga0105249_10085551 3300009553 Bacteria 2939
161 Ga0123341_1000093 3300009765 Bacteria 37635
162 Ga0123342_1019635 3300009766 Bacteria 5107
163 Ga0123342_1024823 3300009766 Bacteria 3698
164 Ga0105239_10008101 3300010375 Bacteria 11995
165 Ga0105239_10027600 3300010375 Bacteria 6247
166 Ga0105239_10164192 3300010375 Bacteria 2483
167 Ga0157373_10004938 3300013100 Bacteria 10032
168 Ga0157373_10010185 3300013100 Bacteria 6925
169 Ga0157371_10000002 3300013102 Bacteria 665040
170 Ga0157370_10003627 3300013104 Bacteria 18062
171 Ga0157370_10005183 3300013104 Bacteria 14691
172 Ga0157369_10104600 3300013105 Bacteria 3014
173 Ga0157369_10177423 3300013105 Bacteria 2243
174 Ga0171463_1002 3300013249 Bacteria 1274851
175 Ga0157374_10035329 3300013296 Bacteria 4573
176 Ga0157372_10234891 3300013307 Bacteria 2126
177 Ga0163163_10000004 3300014325 Bacteria 416569
178 Ga0163163_10013631 3300014325 Bacteria 7444
179 Ga0182007_10004509 3300015262 Bacteria 6295
180 Ga0182005_1014944 3300015265 Bacteria 2168
181 Ga0183363_1041 3300015690 Bacteria 42461
182 Ga0163161_10043176 3300017792 Bacteria 3246
183 Ga0214544_1000018 3300021320 Bacteria 187095
184 Ga0214544_1009587 3300021320 Bacteria 15037
185 Ga0214542_1000307 3300021321 Bacteria 83288
186 Ga0214542_1001549 3300021321 Bacteria 47303
187 Ga0214542_1018955 3300021321 Bacteria 5622
188 Ga0214545_1005475 3300021324 Bacteria 22886
189 Ga0214543_1000195 3300021327 Bacteria 89886
190 Ga0214543_1007141 3300021327 Bacteria 19391
191 Ga0214543_1011326 3300021327 Bacteria 12581
192 Ga0228711_1004587 3300022739 Bacteria 21197
193 Ga0228710_1004744 3300022740 Bacteria 21386
194 Ga0209435_100006 3300025206 Bacteria 542459
195 Ga0209436_100404 3300025208 Bacteria 19502
196 Ga0209436_102987 3300025208 Bacteria 4703
197 Ga0209784_100005 3300025224 Bacteria 1040422
198 Ga0209784_100312 3300025224 Bacteria 25509
199 Ga0209566_100005 3300025225 Bacteria 1040422
200 Ga0209674_100009 3300025226 Bacteria 1040422
201 Ga0209672_105623 3300025228 Bacteria 2126
202 Ga0209563_100012 3300025230 Bacteria 1040422
203 Ga0209437_100022 3300025233 Bacteria 625694
204 Ga0207425_1002753 3300025245 Bacteria 5977
205 Ga0207425_1003951 3300025245 Bacteria 4572
206 Ga0209646_1000015 3300025246 Bacteria 542459
207 Ga0209646_1000108 3300025246 Bacteria 158853
208 Ga0209026_1000039 3300025250 Bacteria 280608
209 Ga0209677_100006 3300025253 Bacteria 1040422
210 Ga0209677_100826 3300025253 Bacteria 15447
211 Ga0209148_1000078 3300025254 Bacteria 296101
212 Ga0209148_1000790 3300025254 Bacteria 23555
213 Ga0209148_1006123 3300025254 Bacteria 2643
214 Ga0209148_1010791 3300025254 Bacteria 1721
215 Ga0209759_1000005 3300025256 Bacteria 542459
216 Ga0209759_1001092 3300025256 Bacteria 17633
217 Ga0209759_1019371 3300025256 Bacteria 1615
218 Ga0209129_1000255 3300025258 Bacteria 55335
219 Ga0209129_1000669 3300025258 Bacteria 22694
220 Ga0209233_1000031 3300025261 Bacteria 624646
221 Ga0209233_1000047 3300025261 Bacteria 459614
222 Ga0209233_1000324 3300025261 Bacteria 51086
223 Ga0209233_1000330 3300025261 Bacteria 48662
224 Ga0209233_1011262 3300025261 Bacteria 2640
225 Ga0209455_1000193 3300025272 Bacteria 90413
226 Ga0209455_1000641 3300025272 Bacteria 21437
227 Ga0209455_1005792 3300025272 Bacteria 3755
228 Ga0209455_1009389 3300025272 Bacteria 2573
229 Ga0209673_1000067 3300025273 Bacteria 249077
230 Ga0209673_1000291 3300025273 Bacteria 93803
231 Ga0209673_1000473 3300025273 Bacteria 67570
232 Ga0209673_1000642 3300025273 Bacteria 52672
233 Ga0209673_1013619 3300025273 Bacteria 3198
234 Ga0209130_1000120 3300025284 Bacteria 127890
235 Ga0209130_1000242 3300025284 Bacteria 69580
236 Ga0209675_1014646 3300025291 Bacteria 2375
237 Ga0209676_1000470 3300025292 Bacteria 67541
238 Ga0209676_1001059 3300025292 Bacteria 31510
239 Ga0209676_1001988 3300025292 Bacteria 16222
240 Ga0209676_1002891 3300025292 Bacteria 11278
241 Ga0209676_1022144 3300025292 Bacteria 2113
242 Ga0209025_1000240 3300025294 Bacteria 128397
243 Ga0209025_1000430 3300025294 Bacteria 83230
244 Ga0209025_1000708 3300025294 Bacteria 56788
245 Ga0209025_1001534 3300025294 Bacteria 29500
246 Ga0209025_1006332 3300025294 Bacteria 9231
247 Ga0209564_1000092 3300025295 Bacteria 249018
248 Ga0209564_1000338 3300025295 Bacteria 90246
249 Ga0209564_1000876 3300025295 Bacteria 40029
250 Ga0209564_1018490 3300025295 Bacteria 2652
251 Ga0209758_1000131 3300025297 Bacteria 184259
252 Ga0209758_1000490 3300025297 Bacteria 64714
253 Ga0209758_1000508 3300025297 Bacteria 62735
254 Ga0209758_1000610 3300025297 Bacteria 55335
255 Ga0209758_1008376 3300025297 Bacteria 6719
256 Ga0209050_1001238 3300025298 Bacteria 29567
257 Ga0209050_1006857 3300025298 Bacteria 6611
258 Ga0209050_1009556 3300025298 Bacteria 4944
259 Ga0209050_1013160 3300025298 Bacteria 3706
260 Ga0209256_1000788 3300025299 Bacteria 40932
261 Ga0209256_1001230 3300025299 Bacteria 28470
262 Ga0209256_1001843 3300025299 Bacteria 19673
263 Ga0209256_1002067 3300025299 Bacteria 17689
264 Ga0207426_1000075 3300025302 Bacteria 321337
265 Ga0207426_1000206 3300025302 Bacteria 140737
266 Ga0207426_1000483 3300025302 Bacteria 60265
267 Ga0209051_1000038 3300025303 Bacteria 320926
268 Ga0209051_1002802 3300025303 Bacteria 12031
269 Ga0209051_1002894 3300025303 Bacteria 11792
270 Ga0209051_1016836 3300025303 Bacteria 3285
271 Ga0209257_1000545 3300025304 Bacteria 64769
272 Ga0209257_1001781 3300025304 Bacteria 23741
273 Ga0209257_1003568 3300025304 Bacteria 13193
274 Ga0209257_1003646 3300025304 Bacteria 12935
275 Ga0207656_10025224 3300025321 Bacteria 2411
276 Ga0207655_1051164 3300025728 Bacteria 1672
277 Ga0207713_1036400 3300025735 Bacteria 2111
278 Ga0207692_10012086 3300025898 Bacteria 3697
279 Ga0207680_10001300 3300025903 Bacteria 11819
280 Ga0207647_10000500 3300025904 Bacteria 31386
281 Ga0207647_10001555 3300025904 Bacteria 17635
282 Ga0207647_10003982 3300025904 Bacteria 11020
283 Ga0207699_10001044 3300025906 Bacteria 13060
284 Ga0207654_10008998 3300025911 Bacteria 5067
285 Ga0207654_10058718 3300025911 Bacteria 2241
286 Ga0207695_10000007 3300025913 Bacteria 1092551
287 Ga0207695_10001205 3300025913 Bacteria 44411
288 Ga0207695_10022351 3300025913 Bacteria 7182
289 Ga0207695_10031196 3300025913 Bacteria 5851
290 Ga0207695_10036514 3300025913 Bacteria 5312
291 Ga0207695_10130548 3300025913 Bacteria 2471
292 Ga0207671_10000793 3300025914 Bacteria 40024
293 Ga0207671_10003510 3300025914 Bacteria 15568
294 Ga0207671_10008685 3300025914 Bacteria 8577
295 Ga0207671_10209851 3300025914 Bacteria 1523
296 Ga0207693_10025190 3300025915 Bacteria 4717
297 Ga0207657_10062390 3300025919 Bacteria 3191
298 Ga0207694_10000199 3300025924 Bacteria 60220
299 Ga0207694_10005080 3300025924 Bacteria 10170
300 Ga0207694_10007856 3300025924 Bacteria 8077
301 Ga0207694_10009453 3300025924 Bacteria 7349
302 Ga0207694_10011666 3300025924 Bacteria 6628
303 Ga0207694_10039024 3300025924 Bacteria 3653
304 Ga0207650_10010601 3300025925 Bacteria 6329
305 Ga0207644_10021404 3300025931 Bacteria 4404
306 Ga0207706_10020155 3300025933 Bacteria 5992
307 Ga0207706_10046067 3300025933 Bacteria 3862
308 Ga0207706_10107587 3300025933 Bacteria 2454
309 Ga0207706_10120797 3300025933 Bacteria 2304
310 Ga0207669_10066859 3300025937 Bacteria 2237
311 Ga0207704_10053054 3300025938 Bacteria 2462
312 Ga0207665_10001859 3300025939 Bacteria 14230
313 Ga0207691_10078053 3300025940 Bacteria 2981
314 Ga0207711_10040250 3300025941 Bacteria 3976
315 Ga0207667_10000028 3300025949 Bacteria 334510
316 Ga0207667_10090804 3300025949 Bacteria 3156
317 Ga0207712_10000169 3300025961 Bacteria 67461
318 Ga0207712_10024258 3300025961 Bacteria 4014
319 Ga0207668_10033246 3300025972 Bacteria 3414
320 Ga0207668_10047884 3300025972 Bacteria 2930
321 Ga0207640_10001595 3300025981 Bacteria 12185
322 Ga0207640_10017441 3300025981 Bacteria 4200
323 Ga0207658_10013181 3300025986 Bacteria 5645
324 Ga0207703_10001066 3300026035 Bacteria 26163
325 Ga0207639_10000560 3300026041 Bacteria 25545
326 Ga0207678_10002324 3300026067 Bacteria 17232
327 Ga0207678_10033763 3300026067 Bacteria 4456
328 Ga0207678_10035730 3300026067 Bacteria 4327
329 Ga0207702_10004405 3300026078 Bacteria 12541
330 Ga0207702_10013019 3300026078 Bacteria 6918
331 Ga0207702_10034297 3300026078 Bacteria 4242
332 Ga0207641_10094135 3300026088 Bacteria 2627
333 Ga0207648_10084397 3300026089 Bacteria 2770
334 Ga0207674_10124592 3300026116 Bacteria 2543
335 Ga0207674_10141337 3300026116 Bacteria 2366
336 Ga0207675_100107710 3300026118 Bacteria 2628
337 Ga0207683_10091692 3300026121 Bacteria 2707
338 Ga0207683_10181519 3300026121 Bacteria 1908
339 Ga0207698_10140736 3300026142 Bacteria 2078
340 Ga0209281_1000491 3300027111 Bacteria 54084
341 Ga0209281_1000981 3300027111 Bacteria 22781
342 Ga0209389_1004138 3300027296 Bacteria 11968
343 Ga0209371_1000003 3300027312 Bacteria 1122971
344 Ga0209371_1000324 3300027312 Bacteria 52237
345 Ga0209589_1002342 3300027357 Bacteria 32707
346 Ga0209589_1007145 3300027357 Bacteria 18101
347 Ga0209489_106154 3300027361 Bacteria 19664
348 Ga0209489_106733 3300027361 Bacteria 18101
349 Ga0209700_100005 3300027363 Bacteria 573969
350 Ga0209282_1000108 3300027666 Bacteria 54085
351 Ga0209282_1000604 3300027666 Bacteria 17667
352 Ga0209813_10001351 3300027866 Bacteria 5499
353 Ga0268266_10000006 3300028379 Bacteria 1410021
354 Ga0268266_10029411 3300028379 Bacteria 4671
355 Ga0268266_10033739 3300028379 Bacteria 4351
356 Ga0268266_10096000 3300028379 Bacteria 2604
357 Ga0268264_10127213 3300028381 Bacteria 2254
358 Ga0307515_10001625 3300028794 Bacteria 50019
359 Ga0307515_10001999 3300028794 Bacteria 45141
360 Ga0307515_10051586 3300028794 Bacteria 6128
361 Ga0307515_10233095 3300028794 Bacteria 1629
362 Ga0265338_10189785 3300028800 Bacteria 1559
363 Ga0268256_1000004 3300030500 Bacteria 1122967
364 Ga0268256_1001615 3300030500 Bacteria 13064
365 Ga0307513_10095186 3300031456 Bacteria 3020
366 Ga0307408_100000948 3300031548 Bacteria 22509
367 Ga0307514_10000850 3300031649 Bacteria 49169
368 Ga0307405_10019055 3300031731 Bacteria 3801
369 Ga0307406_10064691 3300031901 Bacteria 2374
370 Ga0307412_10007012 3300031911 Bacteria 6395
371 Ga0315914_1000427 3300031967 Bacteria 51660
372 Ga0307416_100082647 3300032002 Bacteria 2721
373 Ga0307414_10128900 3300032004 Bacteria 1960
374 Ga0307411_10099176 3300032005 Bacteria 2055
375 Ga0315913_1001358 3300033430 Bacteria 26703
376 Ga0315915_1000032 3300033464 Bacteria 87024
377 Ga0316574_0008040 3300035398 Bacteria 5830
378 Ga0316574_0032447 3300035398 Bacteria 3174
379 Ga0373927_0000581 3300035695 Bacteria 27838
380 Ga0316584_0142313 3300036712 Bacteria 1788
381 Ga0373925_0003311 3300037068 Bacteria 12517
382 Ga0395900_0170554 3300037418 Bacteria 2216
383 Ga0395905_0001624 3300037471 Bacteria 26721
384 Ga0395905_0018526 3300037471 Bacteria 6608
385 Ga0395905_0168297 3300037471 Bacteria 2059
386 Ga0395901_0037069 3300038443 Bacteria 5043
387 Ga0395901_0099665 3300038443 Bacteria 3047
388 Ga0400487_39107 3300039110 Bacteria 2418
389 Ga0436365_1690000 3300039437 Bacteria 1545
390 Ga0436361_0082211 3300039447 Bacteria 2449
391 Ga0436361_1160430 3300039447 Bacteria 8197
392 Ga0439436_0032326 3300041404 Bacteria 1518
393 Ga0439465_0001210 3300041413 Bacteria 8327
394 Ga0439465_0008515 3300041413 Bacteria 3236
395 Ga0451849_0513859 3300041505 Bacteria 2226
396 Ga0451851_0276965 3300041507 Bacteria 1852
397 Ga0451843_1077282 3300041509 Bacteria 2036
398 Ga0451853_1283853 3300041512 Bacteria 2226
399 Ga0439432_003974 3300042006 Bacteria 5431
400 Ga0439449_0019041 3300042007 Bacteria 2574
401 Ga0450906_003989 3300042145 Bacteria 3124
402 Ga0450907_007441 3300042146 Bacteria 1828
403 Ga0439446_0009399 3300042156 Bacteria 2617
404 Ga0439434_0010852 3300042435 Bacteria 2690
405 Ga0439434_0015659 3300042435 Bacteria 2261
406 Ga0450918_000330 3300042531 Bacteria 10599
407 Ga0466963_0008944 3300044694 Bacteria 6011
408 Ga0466968_0006460 3300044735 Bacteria 4420
409 Ga0466970_0000136 3300044765 Bacteria 33881
410 Ga0466959_0056743 3300045049 Bacteria 2857
411 Ga0451576_0121180 3300045051 Bacteria 2723
412 Ga0466958_0004964 3300045836 Bacteria 7096
413 Ga0495617_006379 3300046452 Bacteria 4139
414 Ga0495629_0009432 3300046459 Bacteria 7137
415 Ga0495638_0001519 3300046460 Bacteria 20885
416 Ga0495650_0060858 3300046471 Bacteria 1515
417 Ga0495605_0020476 3300046474 Bacteria 3514
418 Ga0495585_0033722 3300046492 Bacteria 2897
419 Ga0495585_0099629 3300046492 Bacteria 1555
420 Ga0495606_0006572 3300046507 Bacteria 10689
421 Ga0495606_0021433 3300046507 Bacteria 4733
422 Ga0495606_0079141 3300046507 Bacteria 2048
423 Ga0495610_0016880 3300046512 Bacteria 4183
424 Ga0495620_0001877 3300046515 Bacteria 12353
425 Ga0495637_0014296 3300046520 Bacteria 3744
426 Ga0495643_0001015 3300046522 Bacteria 28687
427 Ga0495643_0038695 3300046522 Bacteria 2611
428 Ga0495648_0043713 3300046524 Bacteria 2805
429 Ga0495654_0000920 3300046530 Bacteria 21891
430 Ga0495597_0007987 3300046542 Bacteria 5324
431 Ga0495622_0001480 3300046557 Bacteria 11803
432 Ga0495633_0044363 3300046558 Bacteria 2107
433 Ga0495633_0063020 3300046558 Bacteria 1735
434 Ga0495668_0027729 3300046616 Bacteria 3209
435 Ga0495625_0014937 3300046660 Bacteria 6173
436 Ga0495625_0028129 3300046660 Bacteria 4219
437 Ga0495625_0169879 3300046660 Bacteria 1456
438 Ga0495635_0069085 3300046663 Bacteria 2422
439 Ga0495661_0038541 3300046665 Bacteria 2976
440 Ga0495588_0000630 3300046674 Bacteria 16434
441 Ga0495600_0091745 3300046809 Bacteria 1981
442 Ga0495604_0000886 3300047317 Bacteria 24880
443 Ga0495672_0017946 3300047320 Bacteria 4716
444 Ga0495672_0037928 3300047320 Bacteria 2945
445 Ga0495687_008305 3300047443 Bacteria 5965
446 Ga0495681_0002578 3300047470 Bacteria 12873
447 Ga0495681_0009025 3300047470 Bacteria 6184
448 Ga0496101_0015346 3300048904 Bacteria 5161
449 Ga0496102_0003274 3300048905 Bacteria 13725
450 Ga0496103_0005911 3300048906 Bacteria 7315
451 Ga0496104_0012545 3300048907 Bacteria 7624
452 Ga0496105_0003825 3300048908 Bacteria 11230
453 Ga0496106_0006011 3300048909 Bacteria 8977
454 Ga0496108_0026952 3300048911 Bacteria 4742
455 Ga0496109_0018060 3300048912 Bacteria 6192
456 Ga0496110_0010594 3300048913 Bacteria 7505
457 Ga0496110_0020290 3300048913 Bacteria 5611
458 Ga0496110_0031938 3300048913 Bacteria 4545
459 Ga0496112_0010380 3300048915 Bacteria 8445
460 Ga0496112_0084625 3300048915 Bacteria 3137
461 Ga0496112_0090216 3300048915 Bacteria 3034
462 Ga0496116_0031320 3300048919 Bacteria 3810
463 Ga0496116_0144165 3300048919 Bacteria 1334
464 Ga0496117_0000016 3300048920 Bacteria 523642
465 Ga0496117_0041396 3300048920 Bacteria 3376
466 Ga0496117_0077648 3300048920 Bacteria 2196
467 Ga0496118_0000153 3300048921 Bacteria 122419
468 Ga0496118_0001953 3300048921 Bacteria 29213
469 Ga0496118_0023476 3300048921 Bacteria 5355
470 Ga0496118_0060873 3300048921 Bacteria 2800
471 Ga0496119_0007331 3300048922 Bacteria 9975
472 Ga0496119_0021185 3300048922 Bacteria 4708
473 Ga0496119_0026665 3300048922 Bacteria 3998
474 Ga0496119_0045015 3300048922 Bacteria 2771
475 Ga0496119_0053504 3300048922 Bacteria 2465
476 Ga0496120_0000660 3300048923 Bacteria 50656
477 Ga0496120_0004196 3300048923 Bacteria 12311
478 Ga0496120_0006449 3300048923 Bacteria 9012
479 Ga0496121_0000191 3300048924 Bacteria 136529
480 Ga0496121_0001476 3300048924 Bacteria 39569
481 Ga0496121_0016949 3300048924 Bacteria 7484
482 Ga0496121_0023957 3300048924 Bacteria 5854
483 Ga0496121_0077608 3300048924 Bacteria 2644
484 Ga0496121_0159878 3300048924 Bacteria 1649
485 Ga0496122_0000002 3300048925 Bacteria 905834
486 Ga0496122_0002358 3300048925 Bacteria 27165
487 Ga0496122_0002550 3300048925 Bacteria 25608
488 Ga0496122_0003859 3300048925 Bacteria 19238
489 Ga0496123_0000002 3300048926 Bacteria 1811682
490 Ga0496123_0021716 3300048926 Bacteria 4977
491 Ga0496124_0000006 3300048927 Bacteria 904259
492 Ga0496124_0004712 3300048927 Bacteria 15746
493 Ga0496124_0008231 3300048927 Bacteria 10935
494 Ga0496124_0011294 3300048927 Bacteria 8940
495 Ga0496124_0029218 3300048927 Bacteria 4917
496 Ga0496125_0000428 3300048928 Bacteria 77638
497 Ga0496125_0001524 3300048928 Bacteria 33228
498 Ga0496125_0014527 3300048928 Bacteria 7665
499 Ga0496125_0014609 3300048928 Bacteria 7637
500 Ga0496125_0023312 3300048928 Bacteria 5715
501 Ga0496125_0050628 3300048928 Bacteria 3437
502 Ga0496125_0065695 3300048928 Bacteria 2872
503 Ga0496125_0120723 3300048928 Bacteria 1870
504 Ga0496126_0001278 3300048929 Bacteria 40439
505 Ga0496126_0109555 3300048929 Bacteria 2407
506 Ga0501031_0139909 3300049568 Bacteria 1582
507 Ga0501032_0008522 3300049569 Bacteria 7476
508 Ga0501032_0041410 3300049569 Bacteria 3128
509 Ga0501033_0002403 3300049570 Bacteria 15941
510 Ga0501034_0000003 3300049571 Bacteria 471748
511 Ga0501034_0267192 3300049571 Bacteria 1652
512 Ga0501037_0000028 3300049573 Bacteria 139838
513 Ga0501039_0073800 3300049575 Bacteria 2651
514 Ga0501043_0000028 3300049579 Bacteria 144125
515 Ga0501069_0000014 3300049585 Bacteria 146321
516 Ga0501070_0000121 3300049586 Bacteria 69910
517 Ga0501073_0021852 3300049589 Bacteria 4609
518 Ga0501074_0000004 3300049590 Bacteria 114255
519 Ga0501080_0000027 3300049742 Bacteria 89243
520 Ga0501083_0000025 3300049744 Bacteria 121349
521 Ga0501035_0000129 3300049822 Bacteria 92221
522 Ga0501044_0000052 3300049823 Bacteria 143626
523 nmdc:mga03683_12598_c1 3300050489 Bacteria 3094
524 nmdc:mga03683_14537_c1 3300050489 Bacteria 2915
525 nmdc:mga00v17_11453_c1 3300050491 Bacteria 4873
526 nmdc:mga00v17_11939_c1 3300050491 Bacteria 4782
527 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
528 nmdc:mga0yw44_10540_c1 3300050492 Bacteria 2385
529 nmdc:mga0yw44_31834_c1 3300050492 Bacteria 3070
530 nmdc:mga0yw44_6443_c1 3300050492 Bacteria 5675
531 nmdc:mga0yw44_9013_c1 3300050492 Bacteria 5014
532 nmdc:mga0k408_1643_c1 3300050493 Bacteria 12092
533 nmdc:mga0k408_28205_c1 3300050493 Bacteria 3192
534 nmdc:mga06z11_19394_c1 3300050494 Bacteria 3126
535 nmdc:mga06z11_42757_c1 3300050494 Bacteria 2275
536 nmdc:mga06z11_98357_c1 3300050494 Bacteria 1601
537 nmdc:mga07m45_40126_c1 3300050496 Bacteria 2619
538 nmdc:mga07m45_7997_c1 3300050496 Bacteria 5420
539 nmdc:mga05p37_114737_c1 3300050507 Bacteria 2377
540 nmdc:mga05p37_602_c1 3300050507 Bacteria 39665
541 nmdc:mga09592_1214_c1 3300050508 Bacteria 20659
542 nmdc:mga0qj67_30261_c1 3300050509 Bacteria 4212
543 nmdc:mga0qj67_41540_c1 3300050509 Bacteria 3618
544 nmdc:mga06r32_2662_c1 3300050510 Bacteria 15970
545 nmdc:mga0sz30_17402_c1 3300050516 Bacteria 2866
546 nmdc:mga0sz30_28733_c1 3300050516 Bacteria 2290
547 nmdc:mga0sz30_514_c1 3300050516 Bacteria 14418
548 nmdc:mga0sz30_5788_c1 3300050516 Bacteria 4554
549 Ga0500610_0019641 3300053079 Bacteria 3287
550 Ga0495655_0007607 3300053083 Bacteria 2022
551 Ga0500643_019909 3300053087 Bacteria 2203
552 Ga0500560_001318 3300053107 Bacteria 4230
553 Ga0500569_006377 3300053109 Bacteria 2588
554 Ga0500618_006461 3300053125 Bacteria 3437
555 Ga0500618_012616 3300053125 Bacteria 2207
556 Ga0500658_0001866 3300053134 Bacteria 8273
557 Ga0500561_0000133 3300053137 Bacteria 14162
558 Ga0500568_0012171 3300053139 Bacteria 3963
559 Ga0500573_0014457 3300053140 Bacteria 4468
560 Ga0500590_002599 3300053148 Bacteria 8085
561 Ga0500616_0005939 3300053153 Bacteria 8150
562 Ga0500616_0038875 3300053153 Bacteria 2568
563 Ga0500624_000016 3300053157 Bacteria 134804
564 Ga0500624_000337 3300053157 Bacteria 15781
565 Ga0500636_0000001 3300053177 Bacteria 324086
566 Ga0500636_0056283 3300053177 Bacteria 2304
567 Ga0500637_0000007 3300053178 Bacteria 93788
568 Ga0590075_012034 3300059424 Bacteria 2098
569 2922387161 2922386360 Bacteria 7017218
570 2503200940 2503198000 Bacteria 6884444
571 2508697127 2508501042 Bacteria 8719808
572 2508731299 2508501050 Bacteria 9633614
573 2509110597 2508501122 Bacteria 6292184
574 2509390882 2509276021 Bacteria 7634384
575 2509441942 2509276033 Bacteria 7180565
576 2510136131 2510065019 Bacteria 6903379
577 2510306054 2510065057 Bacteria 6649661
578 2510892866 2510461076 Bacteria 8618824
579 2511135584 2510917022 Bacteria 6504556
580 2511184947 2510917028 Bacteria 6185411
581 2511195131 2510917030 Bacteria 7460662
582 2511500084 2511231052 Bacteria 6974333
583 2512036700 2511231221 Bacteria 6846400
584 2512530307 2512047086 Bacteria 6850303
585 2512531411 2512047086 Bacteria 6850303
586 2512929141 2512875016 Bacteria 6529530
587 2512975259 2512875026 Bacteria 6861065
588 2513568432 2513237084 Bacteria 7231967
589 2513579469 2513237085 Bacteria 7695351
590 2513584457 2513237086 Bacteria 7265287
591 2513606794 2513237089 Bacteria 6553624
592 2513611562 2513237090 Bacteria 7096802
593 2513619603 2513237091 Bacteria 6900273
594 2513624778 2513237092 Bacteria 8341956
595 2513630711 2513237093 Bacteria 7545552
596 2513711937 2513237103 Bacteria 7647401
597 2513876258 2513237139 Bacteria 8737671
598 2513883181 2513237140 Bacteria 7076289
599 2513904255 2513237143 Bacteria 6664116
600 2514001812 2513237159 Bacteria 6810126
601 2514006996 2513237160 Bacteria 6650282
602 2514017071 2513237161 Bacteria 8871253
603 2514018266 2513237162 Bacteria 7468464
604 2514035816 2513237164 Bacteria 7563725
605 2514423386 2513237305 Bacteria 7293571
606 2514592343 2513237351 Bacteria 6968952
607 2515108942 2515075009 Bacteria 7288508
608 2515613292 2515154107 Bacteria 6795637
609 2515624310 2515154112 Bacteria 8294334
610 2515633053 2515154113 Bacteria 7807172
611 2515640258 2515154114 Bacteria 7848616
612 2515656339 2515154116 Bacteria 7552979
613 2515738477 2515154134 Bacteria 7220242
614 2516207161 2516143018 Bacteria 6951533
615 2516897615 2516653046 Bacteria 6989037
616 2517040883 2516653077 Bacteria 7555578
617 2517080514 2516653085 Bacteria 7346596
618 2517098483 2517093000 Bacteria 7412387
619 2517409967 2517287029 Bacteria 6905599
620 2517566663 2517487022 Bacteria 7227575
621 2521557009 2521172590 Bacteria 5047645
622 2524453369 2524023207 Bacteria 6813453
623 2524459173 2524023209 Bacteria 6679728
624 2530648702 2529292951 Bacteria 6916614
625 2537877487 2537561587 Bacteria 5425293
626 2551674840 2551306084 Bacteria 8942552
627 2551687092 2551306085 Bacteria 7347181
628 2551697280 2551306087 Bacteria 7351905
629 2551714289 2551306089 Bacteria 7162724
630 2551737641 2551306092 Bacteria 6992595
631 2553004808 2551306416 Bacteria 6152985
632 2554245480 2554235003 Bacteria 5877155
633 2554817817 2554235132 Bacteria 6772433
634 2558864946 2558860100 Bacteria 8458965
635 2559296690 2558860242 Bacteria 5568029
636 2585232684 2582581299 Bacteria 6518058
637 2585268269 2582581306 Bacteria 6450535
638 2585272659 2582581307 Bacteria 6597605
639 2585281209 2582581308 Bacteria 7413247
640 2585327295 2582581315 Bacteria 7318924
641 2585334519 2582581316 Bacteria 7774528
642 2585391165 2582581865 Bacteria 6644329
643 2585396262 2582581866 Bacteria 6859583
644 2585526838 2585427526 Bacteria 7258840
645 2585536131 2585427527 Bacteria 7273426
646 2585542400 2585427528 Bacteria 6842387
647 2585557616 2585427530 Bacteria 7383882
648 2585562327 2585427531 Bacteria 6992870
649 2585841872 2585427593 Bacteria 7141551
650 2585896767 2585427608 Bacteria 6544331
651 2585906506 2585427609 Bacteria 6667127
652 2585993365 2585427633 Bacteria 6413184
653 2586004005 2585427634 Bacteria 6455027
654 2587981928 2585428125 Bacteria 6662905
655 2588514384 2588253730 Bacteria 6881675
656 2597813921 2597489875 Bacteria 7010078
657 2599602806 2599185210 Bacteria 5624189
658 2599940080 2599185301 Bacteria 6161860
659 2600197381 2599185352 Bacteria 7228948
660 2600362990 2600254931 Bacteria 6734225
661 2601610439 2600255279 Bacteria 5605316
662 2601747231 2600255308 Bacteria 5611129
663 2608380858 2606217733 Bacteria 6360972
664 2616298025 2615840624 Bacteria 6557588
665 2616310989 2615840626 Bacteria 7921970
666 2616555589 2615840698 Bacteria 7319877
667 2617353962 2617270735 Bacteria 9163226
668 2617378920 2617270741 Bacteria 8201522
669 2617385521 2617270742 Bacteria 6808054
670 2643917329 2643221582 Bacteria 5804683
671 2643984692 2643221595 Bacteria 6565519
672 2644153017 2643221627 Bacteria 6761570
673 2644520818 2643221693 Bacteria 5513853
674 2644673434 2643221723 Bacteria 7095460
675 2657685739 2657244999 Bacteria 5946535
676 2671113169 2667528174 Bacteria 6435400
677 2692318306 2690316117 Bacteria 6800650
678 2719184850 2718217882 Bacteria 6556348
679 2719389825 2718217927 Bacteria 6972593
680 2719668850 2718217997 Bacteria 6740740
681 2719728870 2718218009 Bacteria 6478651
682 2720489543 2718218199 Bacteria 6740745
683 2720610218 2718218232 Bacteria 6720332
684 2720617642 2718218233 Bacteria 6662049
685 2720628784 2718218235 Bacteria 6630699
686 2720772733 2718218269 Bacteria 6906114
687 2721144561 2718218363 Bacteria 6524337
688 2721156053 2718218365 Bacteria 6274507
689 2721161931 2718218366 Bacteria 6425255
690 2721403468 2718218423 Bacteria 6438183
691 2722843076 2721755514 Bacteria 6424414
692 2723030173 2721755556 Bacteria 6745503
693 2723564578 2721755684 Bacteria 6859907
694 2723569780 2721755685 Bacteria 6704835
695 2723575019 2721755686 Bacteria 7343952
696 2724035044 2721755809 Bacteria 6438790
697 2724041895 2721755810 Bacteria 6479005
698 2724092762 2721755819 Bacteria 6906405
699 2724101327 2721755822 Bacteria 6726041
700 2724113149 2721755823 Bacteria 6752556
701 2725949400 2724679232 Bacteria 7646494
702 2730110706 2728369352 Bacteria 6745171
703 2730160965 2728369365 Bacteria 6555560
704 2730295586 2728369397 Bacteria 6274511
705 2739038466 2738541333 Bacteria 7106503
706 2753357764 2751185800 Bacteria 5467370
707 2753462802 2751185821 Bacteria 6189929
708 2758638030 2758568016 Bacteria 5645291
709 2765468807 2765235802 Bacteria 5618596
710 2766068870 2765235942 Bacteria 7445910
711 2770198471 2767802442 Bacteria 5747986
712 2774873147 2773857925 Bacteria 6472445
713 2776265227 2775506901 Bacteria 9631051
714 2776910705 2775507049 Bacteria 6284736
715 2778174844 2775507266 Bacteria 7392367
716 2792583722 2791355082 Bacteria 5973319
717 2792619363 2791355091 Bacteria 6135441
718 2792627135 2791355092 Bacteria 6248105
719 2792640931 2791355094 Bacteria 7011481
720 2792752212 2791355123 Bacteria 8049106
721 2793299129 2791355256 Bacteria 6798008
722 2793312722 2791355259 Bacteria 7254731
723 2793324244 2791355260 Bacteria 6598818
724 2793329904 2791355261 Bacteria 6661293
725 2793333871 2791355262 Bacteria 6774204
726 2793340789 2791355263 Bacteria 6872478
727 2793345739 2791355264 Bacteria 6429314
728 2793361865 2791355266 Bacteria 7116587
729 2793367418 2791355267 Bacteria 7222458
730 2802720137 2802428858 Bacteria 6636079
731 2802723824 2802428859 Bacteria 6667919
732 2802734149 2802428860 Bacteria 6525526
733 2802739611 2802428861 Bacteria 6534206
734 2802746003 2802428862 Bacteria 6633353
735 2802753402 2802428863 Bacteria 6410669
736 2804754997 2802429268 Bacteria 6094027
737 2805935169 2802429606 Bacteria 6346811
738 2806048809 2802429633 Bacteria 7341974
739 2806056012 2802429634 Bacteria 7083200
740 2806062841 2802429635 Bacteria 7650140
741 2806070263 2802429636 Bacteria 7597525
742 2806077249 2802429637 Bacteria 7067217
743 2808987143 2808606387 Bacteria 5697198
744 2812370262 2811994881 Bacteria 6298475
745 2819557519 2818991439 Bacteria 6907412
746 2819613183 2818991448 Bacteria 6772224
747 2819616808 2818991449 Bacteria 5518009
748 2819641745 2818991453 Bacteria 7181617
749 2819683579 2818991461 Bacteria 7026071
750 2824681602 2824679649 Bacteria 8248951
751 2838020495 2838016132 Bacteria 6577831
752 2838031685 2838029111 Bacteria 6603031
753 2838049936 2838048938 Bacteria 6044578
754 2838062204 2838061910 Bacteria 6794874
755 2838069438 2838068647 Bacteria 6208656
756 2838078636 2838074704 Bacteria 6785777
757 2838129598 2838122688 Bacteria 8803140
758 2838677968 2838675328 Bacteria 4909118
759 2838686166 2838680041 Bacteria 6545511
760 2838690474 2838686498 Bacteria 7807632
761 2838700463 2838694306 Bacteria 6853137
762 2838713742 2838707686 Bacteria 6619912
763 2838717126 2838714209 Bacteria 5525906
764 2838722263 2838719591 Bacteria 5523910
765 2838727875 2838724970 Bacteria 4908691
766 2838733169 2838729681 Bacteria 7400765
767 2838747242 2838742623 Bacteria 7396178
768 2840770218 2840764183 Bacteria 6358399
769 2840881958 2840878972 Bacteria 5483153
770 2840882554 2840878972 Bacteria 5483153
771 2841849533 2841846520 Bacteria 5345850
772 2841855395 2841851746 Bacteria 7532261
773 2841861427 2841859092 Bacteria 5436171
774 2841865785 2841864319 Bacteria 6742987
775 2841946245 2841941048 Bacteria 8688029
776 2841952271 2841949485 Bacteria 8680857
777 2841967914 2841966195 Bacteria 8673214
778 2841982754 2841974524 Bacteria 8931498
779 2842083105 2842077413 Bacteria 6508645
780 2842116975 2842110456 Bacteria 7656360
781 2842124087 2842118031 Bacteria 7033875
782 2842127719 2842124991 Bacteria 5346824
783 2842132861 2842130223 Bacteria 4909145
784 2842154854 2842152218 Bacteria 4908957
785 2842160898 2842156927 Bacteria 6894975
786 2842164427 2842163707 Bacteria 6916235
787 2842173353 2842170452 Bacteria 5525737
788 2842178475 2842175837 Bacteria 4908771
789 2842184514 2842180545 Bacteria 6888678
790 2842190234 2842187318 Bacteria 5524014
791 2842214548 2842211629 Bacteria 5523832
792 2842219660 2842217011 Bacteria 7497767
793 2842227267 2842224351 Bacteria 5524473
794 2842232097 2842229732 Bacteria 7475766
795 2842243155 2842237096 Bacteria 6620661
796 2842248501 2842243621 Bacteria 7421798
797 2842262691 2842257432 Bacteria 7401195
798 2842264815 2842264693 Bacteria 6472963
799 2842275212 2842271015 Bacteria 7807131
800 2842297364 2842291075 Bacteria 7076806
801 2842300960 2842298080 Bacteria 6123127
802 2842307352 2842304105 Bacteria 7023636
803 2842345763 2842341865 Bacteria 7003929
804 2842360024 2842357229 Bacteria 6485165
805 2842364031 2842363717 Bacteria 6844742
806 2842376215 2842370503 Bacteria 7038661
807 2842383758 2842377471 Bacteria 7140707
808 2842390897 2842384541 Bacteria 7057858
809 2842405945 2842402390 Bacteria 6681310
810 2842412529 2842409023 Bacteria 6687331
811 2842419173 2842415677 Bacteria 6596907
812 2842422629 2842422224 Bacteria 6239196
813 2842429132 2842428310 Bacteria 6767288
814 2842435745 2842434925 Bacteria 6502746
815 2842441393 2842441272 Bacteria 6769273
816 2842449790 2842447887 Bacteria 6754142
817 2842463558 2842462802 Bacteria 6588055
818 2842470075 2842469257 Bacteria 6752936
819 2842478417 2842475841 Bacteria 6603183
820 2842505637 2842502639 Bacteria 6604161
821 2842513861 2842509118 Bacteria 6850950
822 2842518306 2842515876 Bacteria 5436280
823 2842527322 2842521101 Bacteria 6569494
824 2844004716 2844002411 Bacteria 7168230
825 2844460130 2844454524 Bacteria 7952546
826 2847423190 2847417321 Bacteria 6913799
827 2847674871 2847670302 Bacteria 6165597
828 2848997414 2848992105 Bacteria 6810864
829 2850084669 2850079185 Bacteria 6848280
830 2852394165 2852387548 Bacteria 8025568
831 2854922459 2854916844 Bacteria 5725939
832 2855830471 2855825444 Bacteria 6785811
833 2855845757 2855839649 Bacteria 7135830
834 2855874179 2855872281 Bacteria 6964271
835 2856317245 2856314179 Bacteria 6477897
836 2856344135 2856342000 Bacteria 7176905
837 2856353638 2856349417 Bacteria 6230045
838 2856366199 2856364286 Bacteria 6939991
839 2856745978 2856741275 Bacteria 8096094
840 2857350039 2857349434 Bacteria 7926032
841 2857354406 2857349434 Bacteria 7926032
842 2857517696 2857516855 Bacteria 7787325
843 2858805149 2858800743 Bacteria 6603254
844 2869163894 2869162929 Bacteria 6399702
845 2869257483 2869256925 Bacteria 6981691
846 2869287233 2869285874 Bacteria 6901219
847 2871430533 2871429161 Bacteria 6547891
848 2871489473 2871488783 Bacteria 6929816
849 2871496301 2871495908 Bacteria 6935695
850 2874103466 2874102143 Bacteria 6342645
851 2874128221 2874123672 Bacteria 7238285
852 2874149190 2874146452 Bacteria 7533118
853 2874156025 2874155637 Bacteria 6724144
854 2874170187 2874168670 Bacteria 8062617
855 2874595402 2874590934 Bacteria 8299676
856 2874634384 2874628541 Bacteria 8630250
857 2874651828 2874645413 Bacteria 8214782
858 2876367301 2876363079 Bacteria 6544991
859 2876373607 2876369609 Bacteria 6807521
860 2876393653 2876392853 Bacteria 6660880
861 2876415387 2876413966 Bacteria 6831344
862 2876775596 2876771140 Bacteria 8287509
863 2876823588 2876818435 Bacteria 8274608
864 2878038283 2878035449 Bacteria 6555736
865 2878742314 2878738818 Bacteria 7136951
866 2878746965 2878745973 Bacteria 6867388
867 2878754122 2878753008 Bacteria 6922523
868 2878760530 2878760144 Bacteria 6823465
869 2878767493 2878767105 Bacteria 6898628
870 2879079687 2879074833 Bacteria 8279565
871 2879133909 2879127579 Bacteria 8294491
872 2879145042 2879142872 Bacteria 8267021
873 2881151121 2881147464 Bacteria 7779814
874 2881161511 2881155292 Bacteria 6461656
875 2881163414 2881161766 Bacteria 7127907
876 2881668843 2881665667 Bacteria 8175609
877 2881849006 2881845957 Bacteria 6611900
878 2881868083 2881861095 Bacteria 7128710
879 2882463174 2882456835 Bacteria 6863978
880 2882637520 2882632389 Bacteria 8154593
881 2882919046 2882912400 Bacteria 6801539
882 2885305845 2885305155 Bacteria 7348390
883 2885324123 2885318864 Bacteria 6729568
884 2885327741 2885326080 Bacteria 7134805
885 2885340061 2885334103 Bacteria 7216818
886 2885350136 2885342637 Bacteria 7011821
887 2885353215 2885350715 Bacteria 6787678
888 2885367994 2885366525 Bacteria 8326213
889 2885416464 2885409591 Bacteria 9235467
890 2888338835 2888337043 Bacteria 6629336
891 2888347647 2888343758 Bacteria 6611049
892 2888352437 2888350351 Bacteria 7372807
893 2889020772 2889016732 Bacteria 6700763
894 2889034635 2889033259 Bacteria 9099371
895 2891398135 2891395885 Bacteria 9251614
896 2891556478 2891554331 Bacteria 8812224
897 2896387521 2896384573 Bacteria 7700774
898 2899796470 2899792073 Bacteria 4926588
899 2899849998 2899845264 Bacteria 5672268
900 2903453229 2903448605 Bacteria 7357801
901 2903494575 2903492973 Bacteria 13473544
902 2903500518 2903492973 Bacteria 13473544
903 2903526792 2903521522 Bacteria 6525694
904 2903530589 2903528002 Bacteria 6586099
905 2903541095 2903540706 Bacteria 7062119
906 2904440286 2904439833 Bacteria 5931679
907 2904530801 2904530477 Bacteria 5876334
908 2904585784 2904584206 Bacteria 6028872
909 2904592403 2904589729 Bacteria 6113573
910 2904601464 2904601388 Bacteria 5884906
911 2904660161 2904659560 Bacteria 6685615
912 2906309779 2906308376 Bacteria 6841989
913 2906322414 2906321335 Bacteria 6579571
914 2906331868 2906328253 Bacteria 6585166
915 2906355017 2906354277 Bacteria 6991324
916 2906417307 2906414383 Bacteria 6580790
917 2906629032 2906626472 Bacteria 8826946
918 2906646436 2906643746 Bacteria 8722424
919 2913297014 2913295892 Bacteria 6333755
920 2915984318 2915980308 Bacteria 6624279
921 2915987020 2915986958 Bacteria 6739310
922 2915999437 2915993759 Bacteria 7016183
923 2916004071 2916000859 Bacteria 6865702
924 2916012468 2916007675 Bacteria 6898660
925 2916014704 2916014648 Bacteria 6946486
926 2916026929 2916021584 Bacteria 6854472
927 2916034040 2916028427 Bacteria 6748433
928 2916038597 2916035215 Bacteria 6755766
929 2916046326 2916041962 Bacteria 6820487
930 2916050825 2916048683 Bacteria 6543552
931 2916060592 2916055098 Bacteria 6758838
932 2916066637 2916061851 Bacteria 6737736
933 2916071650 2916068649 Bacteria 6943657
934 2916079557 2916076590 Bacteria 6596108
935 2919049819 2919046199 Bacteria 5567169
936 2919082886 2919079590 Bacteria 5946433
937 2919117384 2919114240 Bacteria 5700270
938 2919176256 2919171160 Bacteria 6499771
939 2919412937 2919408235 Bacteria 6149349
940 2919682597 2919679072 Bacteria 4629602
941 2920763331 2920760137 Bacteria 7427611
942 2920827226 2920822456 Bacteria 6897201
943 2921205387 2921201388 Bacteria 6926299
944 2921210709 2921208531 Bacteria 6745326
945 2921240627 2921237296 Bacteria 6876710
946 2921249603 2921244191 Bacteria 6568419
947 2921254274 2921250672 Bacteria 6677771
948 2921261697 2921257292 Bacteria 6808382
949 2921269608 2921263974 Bacteria 6864552
950 2921285052 2921282425 Bacteria 6826397
951 2921294220 2921289301 Bacteria 7316391
952 2921299008 2921296804 Bacteria 7176999
953 2922138177 2922130491 Bacteria 7173936
954 2922163056 2922158528 Bacteria 6573167
955 2922189176 2922185730 Bacteria 7113964
956 2922400154 2922393267 Bacteria 8285685
957 2923515641 2923510766 Bacteria 5926163
958 2923524350 2923519811 Bacteria 6298479
959 2924144379 2924144063 Bacteria 6883928
960 2924151613 2924150972 Bacteria 7169444
961 2924159489 2924158325 Bacteria 7188855
962 2924172618 2924165586 Bacteria 7260590
963 2924178730 2924172951 Bacteria 6749356
964 2924185771 2924179722 Bacteria 6843264
965 2924196070 2924193448 Bacteria 6955718
966 2924201328 2924200457 Bacteria 6757188
967 2924210160 2924207177 Bacteria 6917007
968 2924218921 2924214083 Bacteria 7080103
969 2924227617 2924221636 Bacteria 7113495
970 2924230877 2924228884 Bacteria 6633132
971 2924712830 2924710171 Bacteria 6752351
972 2924729552 2924726620 Bacteria 6271473
973 2924737401 2924733363 Bacteria 7574837
974 2924761777 2924754689 Bacteria 6774424
975 2924769108 2924762789 Bacteria 6561353
976 2924780114 2924776078 Bacteria 7492003
977 2924788800 2924784321 Bacteria 7416538
978 2926758831 2926754445 Bacteria 5964435
979 2926763644 2926760298 Bacteria 5505990
980 2928134541 2928130867 Bacteria 5467269
981 2933009764 2933006813 Bacteria 4912075
982 2933013935 2933011516 Bacteria 5439334
983 2933573992 2933570622 Bacteria 7023390
984 2933593275 2933586486 Bacteria 7667493
985 2933595745 2933594066 Bacteria 5594265
986 2933600101 2933599457 Bacteria 5858799
987 2935900780 2935894831 Bacteria 6620579
988 2935906112 2935901341 Bacteria 7341747
989 2935983010 2935975950 Bacteria 8347125
990 2935988092 2935984226 Bacteria 8302647
991 2936374683 2936367885 Bacteria 7324495
992 2936375883 2936375103 Bacteria 6652732
993 2936382415 2936381700 Bacteria 7006523
994 2937005415 2937002841 Bacteria 6934057
995 2937013000 2937009748 Bacteria 6746052
996 2937018022 2937016420 Bacteria 6782579
997 2937029536 2937023124 Bacteria 6815156
998 2937033952 2937029754 Bacteria 6424026
999 2937037251 2937036028 Bacteria 6846469
1000 2937043398 2937042894 Bacteria 6741576
1001 2937051951 2937049772 Bacteria 6757901
1002 2937066249 2937063883 Bacteria 7199456
1003 2937077054 2937071275 Bacteria 6984483
1004 2937080488 2937078374 Bacteria 6610289
1005 2937091509 2937084907 Bacteria 6618516
1006 2937096443 2937091812 Bacteria 6979387
1007 2937105700 2937098957 Bacteria 7249374
1008 2937110939 2937106411 Bacteria 6947143
1009 2937116806 2937113482 Bacteria 6505872
1010 2937125029 2937119839 Bacteria 6597547
1011 2937132860 2937126314 Bacteria 6771275
1012 2937814924 2937813078 Bacteria 7783518
1013 2937848802 2937848649 Bacteria 6983481
1014 2937882634 2937877337 Bacteria 7246526
1015 2937891539 2937891427 Bacteria 6357007
1016 2937994948 2937994558 Bacteria 7036190
1017 2941505433 2941499720 Bacteria 7599444
1018 2957379797 2957375807 Bacteria 6425588
1019 2957385597 2957382221 Bacteria 6737050
1020 2957390216 2957388812 Bacteria 6778072
1021 2957398852 2957395598 Bacteria 6822399
1022 2957405756 2957402308 Bacteria 6741770
1023 2957412877 2957408893 Bacteria 6558585
1024 2957420486 2957415311 Bacteria 6991633
1025 2957426825 2957422303 Bacteria 7172205
1026 2957430298 2957430029 Bacteria 7022557
1027 2957442729 2957437181 Bacteria 6568994
1028 2957453808 2957450854 Bacteria 6765715
1029 2957459975 2957457609 Bacteria 6967680
1030 2957464996 2957464669 Bacteria 6568877
1031 2957475224 2957471148 Bacteria 6797643
1032 2957483530 2957478035 Bacteria 6756658
1033 2957486866 2957484790 Bacteria 6703082
1034 2957492908 2957491536 Bacteria 6695180
1035 2957500200 2957498199 Bacteria 7126688
1036 2957506059 2957505466 Bacteria 7253085
1037 2958043392 2958041894 Bacteria 13082850
1038 2958064855 2958064165 Bacteria 7158582
1039 2958089759 2958084443 Bacteria 7312792
1040 2958100446 2958092219 Bacteria 6861151
1041 2958121517 2958115193 Bacteria 6923548
1042 2958131733 2958130278 Bacteria 6897202
1043 2958145578 2958144490 Bacteria 6677056
1044 2958165428 2958165035 Bacteria 6906348
1045 2958180793 2958179912 Bacteria 6874908
1046 2960585366 2960584000 Bacteria 6864594
1047 2960591738 2960591022 Bacteria 6622873
1048 2960601440 2960597568 Bacteria 6550735
1049 2960608269 2960603979 Bacteria 6898737
1050 2960615940 2960610863 Bacteria 6691244
1051 2960630158 2960624210 Bacteria 6875384
1052 2960637792 2960631154 Bacteria 6732508
1053 2960641159 2960637947 Bacteria 7296468
1054 2960652617 2960645483 Bacteria 7211087
1055 2960658452 2960652885 Bacteria 7083688
1056 2960668919 2960667422 Bacteria 6763020
1057 2960685172 2960680706 Bacteria 6624464
1058 2960691025 2960687367 Bacteria 6535474
1059 2960700900 2960693952 Bacteria 6749742
1060 2961078631 2961077736 Bacteria 7079850
1061 2961115486 2961114664 Bacteria 6680456
1062 2961129806 2961127735 Bacteria 7196641
1063 2961163886 2961163497 Bacteria 6901077
1064 2961171754 2961170736 Bacteria 7072258
1065 2963650094 2963644680 Bacteria 6530403
1066 2964619239 2964615318 Bacteria 6809089
1067 2964624587 2964621998 Bacteria 6834995
1068 2964634167 2964628898 Bacteria 7083044
1069 2964641392 2964636051 Bacteria 7091832
1070 2964649769 2964643177 Bacteria 6820887
1071 2964655629 2964649959 Bacteria 6675118
1072 2964658343 2964656573 Bacteria 7100150
1073 2964666744 2964663802 Bacteria 7019362
1074 2964672956 2964670856 Bacteria 6851364
1075 2964678902 2964678106 Bacteria 6792020
1076 2964690223 2964685014 Bacteria 6839111
1077 2964695378 2964691889 Bacteria 6802758
1078 2964701842 2964698721 Bacteria 6765331
1079 2964708431 2964705432 Bacteria 7114648
1080 2964715924 2964712639 Bacteria 6695970
1081 2964725585 2964719344 Bacteria 7286602
1082 2965018691 2965018300 Bacteria 6883036
1083 2965033482 2965032056 Bacteria 6887443
1084 2965069599 2965062239 Bacteria 7412989
1085 2965126612 2965119406 Bacteria 6956431
1086 2967670130 2967664464 Bacteria 6948836
1087 2967675018 2967671571 Bacteria 7021409
1088 2967685509 2967678726 Bacteria 7264382
1089 2967690717 2967686174 Bacteria 6678622
1090 2967694124 2967693043 Bacteria 6804451
1091 2967702777 2967699805 Bacteria 6854538
1092 2967709662 2967706974 Bacteria 7186053
1093 2967715922 2967714385 Bacteria 7000047
1094 2967722778 2967721400 Bacteria 7073753
1095 2967728668 2967728569 Bacteria 6641507
1096 2967739739 2967735183 Bacteria 6827012
1097 2967744235 2967742019 Bacteria 6794534
1098 2967750245 2967748971 Bacteria 6733771
1099 2967760386 2967755722 Bacteria 6814706
1100 2967764761 2967762386 Bacteria 6923502
1101 2967770066 2967769361 Bacteria 6587838
1102 2967781907 2967775926 Bacteria 6738189
1103 2967996541 2967996073 Bacteria 6787468
1104 2968010248 2968003550 Bacteria 6929263
1105 2968086595 2968083720 Bacteria 7351627
1106 2968095338 2968091066 Bacteria 6052692
1107 2968103086 2968097103 Bacteria 6107094
1108 2968111217 2968110612 Bacteria 6814636
1109 2968118894 2968117919 Bacteria 6536078
1110 2968128545 2968128360 Bacteria 6270294
1111 2968172292 2968171901 Bacteria 6894245
1112 2970025208 2970019648 Bacteria 7072033
1113 2970033067 2970026789 Bacteria 6785236
1114 2970035863 2970033650 Bacteria 7118744
1115 2970043236 2970040964 Bacteria 6731123
1116 2970050321 2970047711 Bacteria 7088379
1117 2970060717 2970054988 Bacteria 6611507
1118 2970063004 2970061556 Bacteria 7099761
1119 2970072410 2970068827 Bacteria 7123112
1120 2970077775 2970076120 Bacteria 6697332
1121 2970095079 2970088815 Bacteria 6933825
1122 2970099563 2970095765 Bacteria 6936963
1123 2970109066 2970102677 Bacteria 6812532
1124 2970113992 2970109326 Bacteria 6863976
1125 2970119854 2970116247 Bacteria 6501857
1126 2970129080 2970122695 Bacteria 6625855
1127 2970130759 2970129317 Bacteria 6806560
1128 2970139253 2970136068 Bacteria 7207982
1129 2970147212 2970143518 Bacteria 6446480
1130 2970152704 2970149975 Bacteria 6779706
1131 2970161249 2970156795 Bacteria 7168044
1132 2970165150 2970164137 Bacteria 6861252
1133 2970176300 2970170962 Bacteria 6876229
1134 2970184721 2970184632 Bacteria 7054431
1135 2970194055 2970191845 Bacteria 7032787
1136 2970504350 2970503327 Bacteria 7099517
1137 2970530276 2970524798 Bacteria 6840927
1138 2970547793 2970540015 Bacteria 6977556
1139 2970555382 2970554993 Bacteria 6814252
1140 2977519925 2977516862 Bacteria 6940108
1141 2977525249 2977523885 Bacteria 6960446
1142 2977536923 2977530762 Bacteria 6951399
1143 2977539336 2977537788 Bacteria 6929320
1144 2977546576 2977544691 Bacteria 6875412
1145 2977558702 2977551784 Bacteria 7125765
1146 2977564279 2977558990 Bacteria 6863948
1147 2977568651 2977565890 Bacteria 6901543
1148 2977575064 2977572785 Bacteria 6763888
1149 2977580664 2977579622 Bacteria 6772100
1150 2977823337 2977821940 Bacteria 6906439
1151 2977831310 2977828996 Bacteria 7007971
1152 2977845616 2977843712 Bacteria 6753583
1153 2977864090 2977858184 Bacteria 6215359
1154 2977866033 2977864932 Bacteria 7534097
1155 2977880162 2977872689 Bacteria 7270173
1156 2977899518 2977898635 Bacteria 6675551
1157 2977928381 2977922695 Bacteria 6956781
1158 2977962517 2977957713 Bacteria 6877875
1159 2977973239 2977971508 Bacteria 7472917
1160 2977987710 2977986579 Bacteria 6581278
1161 2979091316 2979089926 Bacteria 5670289
1162 2979096840 2979095461 Bacteria 5669583
1163 2979102560 2979100975 Bacteria 5423623
1164 2979747980 2979742915 Bacteria 7301278
1165 2979784863 2979779861 Bacteria 6219781
1166 2979793850 2979793036 Bacteria 6808957
1167 2979808987 2979808191 Bacteria 7179355
1168 2984509555 2984509177 Bacteria 5274802
1169 2984519747 2984518228 Bacteria 5277463
1170 2984537890 2984537506 Bacteria 5277481
1171 2984604635 2984601300 Bacteria 5455244
1172 2987637138 2987636660 Bacteria 8088555
1173 2987642185 2987636660 Bacteria 8088555
1174 2987659898 2987659509 Bacteria 6966464
1175 2987672960 2987666974 Bacteria 6509233
1176 2987678871 2987673487 Bacteria 6884027
1177 2996345381 2996341866 Bacteria 6643098
1178 2996393825 2996386984 Bacteria 6978667
1179 2996893022 2996887358 Bacteria 5795980
1180 3000020403 3000017691 Bacteria 3772574
1181 3000140977 3000135777 Bacteria 6891109
1182 3004188945 3004188549 Bacteria 6952365
1183 3004204107 3004203850 Bacteria 7307914
1184 3004215612 3004211236 Bacteria 7417683
1185 3004222084 3004218560 Bacteria 7421728
1186 3004243612 3004239961 Bacteria 6892290
1187 3005416652 3005416602 Bacteria 7064308
1188 3005488727 3005483717 Bacteria 7877331
1189 3005592095 3005587118 Bacteria 7794411
1190 637078901 637000159 Bacteria 7596297
1191 639645372 639633055 Bacteria 7751309
1192 643600620 643348564 Bacteria 8839022
1193 643822490 643692032 Bacteria 6891900
1194 648738626 648276728 Bacteria 6968865
1195 650843111 650716007 Bacteria 5573770
1196 8002869582 8002869464 Bacteria 3588529
1197 8003575458 8003570095 Bacteria 5747666
1198 8003997749 8003992118 Bacteria 7266902
1199 8004005444 8003999396 Bacteria 7063185
1200 8004313825 8004312739 Bacteria 7444653
1201 8004375698 8004374579 Bacteria 6898112
1202 8004389070 8004387939 Bacteria 7049250
1203 8004451938 8004445564 Bacteria 6322258
1204 8004697539 8004695233 Bacteria 6731676
1205 8004713250 8004703790 Bacteria 8006957
1206 8004716133 8004714634 Bacteria 6776161
1207 8005275948 8005275841 Bacteria 6929066
1208 8005285833 8005282627 Bacteria 6675747
1209 8005290849 8005289223 Bacteria 6634003
1210 8005301274 8005301065 Bacteria 6614431
1211 8005308298 8005307578 Bacteria 7395396
1212 8005320705 8005314921 Bacteria 7072929
1213 8005327549 8005321885 Bacteria 5795980
1214 8005380556 8005376324 Bacteria 6590079
1215 8005383381 8005382845 Bacteria 6732062
1216 8005398975 8005395548 Bacteria 6806915
1217 8005436582 8005430974 Bacteria 6689030
1218 8005467567 8005460587 Bacteria 7157962
1219 8005487620 8005484373 Bacteria 6297373
1220 8005501997 8005497431 Bacteria 6477605
1221 8005559482 8005556819 Bacteria 6908598
1222 8005566471 8005563573 Bacteria 7153261
1223 8005571150 8005570704 Bacteria 6957481
1224 8005624239 8005619151 Bacteria 7030230
1225 8005629505 8005626139 Bacteria 6534237
1226 8005651808 8005645114 Bacteria 6950293
1227 8005673419 8005668836 Bacteria 6953162
1228 8005686028 8005682033 Bacteria 6726518
1229 8005688911 8005688590 Bacteria 6610080
1230 8005695467 8005695170 Bacteria 6912330
1231 8011356275 8011350971 Bacteria 6158957
1232 8016587319 8016583857 Bacteria 10421953
1233 8018132286 8018127388 Bacteria 7351159
1234 8018151249 8018150411 Bacteria 5549903
1235 8018163745 8018163183 Bacteria 7277977
1236 8018180836 8018176218 Bacteria 6896178
1237 8019623694 8019619141 Bacteria 9218857
1238 8019638340 8019629233 Bacteria 8687553
1239 8019641298 8019638758 Bacteria 9062356
1240 8019656845 8019648815 Bacteria 10014479
1241 8019666265 8019659431 Bacteria 8577854
1242 8019675761 8019668869 Bacteria 8791617
1243 8019680335 8019678201 Bacteria 8863603
1244 8023681567 8023680758 Bacteria 7729763
1245 8024481439 8024479707 Bacteria 6954785
1246 8024493049 8024486573 Bacteria 6540512
1247 8046774208 8046767195 Bacteria 7547379
1248 8049298101 8049293176 Bacteria 6128433
1249 8054005274 8054002106 Bacteria 7987183
1250 8054563375 8054558443 Bacteria 5204801
1251 8055621713 8055617313 Bacteria 7548464
1252 8056123618 8056120720 Bacteria 5758328
1253 8056381771 8056375014 Bacteria 7006639
1254 8057881300 8057874678 Bacteria 7494653
1255 JGI24736J21556_1000196
1256 JGI24741J21665_1000024
1257 JGI24740J21852_10001594
1258 JGI24740J21852_10006396
1259 JGI24739J22299_10001518
1260 JGI24738J21930_10003743
1261 JGI25155J39150_1000003
1262 JGI25155J39150_1000729
1263 JGI25156J39149_1000004
1264 JGI25162J39368_1000069
1265 JGI25154J39366_1000013
1266 JGI25154J39366_1000772
1267 JGI25157J39369_1000004
1268 JGI25152J39213_1000186
1269 JGI25159J45721_1000019
1270 JGI25151J46595_10000867
1271 JGI25165J46597_1000018
1272 JGI25165J46597_1000020
1273 JGI25165J46597_1000372
1274 JGI25165J46597_1005415
1275 JGI25153J46596_10000200
1276 JGI25153J46596_10000829
1277 JGI25153J46596_10020305
1278 rootH1_10018479
1279 rootH1_10010878
1280 rootH1_10084286
1281 JGI25160J50197_1000054
1282 JGI25160J50197_1000203
1283 JGI25160J50197_1002223
1284 JGI25161J50226_1000570
1285 JGI25161J50226_1002643
1286 JGI25161J50226_1003970
1287 Ga0055538_1000008
1288 Ga0055538_1000302
1289 Ga0055539_1000012
1290 Ga0055533_1000015
1291 Ga0055525_1000017
1292 Ga0055542_1000068
1293 Ga0055526_1000308
1294 Ga0055526_1002146
1295 Ga0055524_1002400
1296 Ga0055524_1017598
1297 Ga0055536_1000640
1298 Ga0055536_1001374
1299 Ga0055536_1004941
1300 Ga0055528_1000054
1301 Ga0055528_1000611
1302 Ga0055540_1000131
1303 Ga0055531_10000207
1304 Ga0055531_10003719
1305 Ga0055531_10020782
1306 Ga0055541_1000009
1307 Ga0058692_1004401
1308 Ga0055543_1000150
1309 Ga0055543_1000349
1310 Ga0055543_1001165
1311 Ga0065165_1000136
1312 Ga0065165_1000672
1313 Ga0070670_100025939
1314 Ga0070666_10002707
1315 Ga0068868_100011890
1316 Ga0070660_100012565
1317 Ga0070661_100062021
1318 Ga0070668_100046856
1319 Ga0070671_100017186
1320 Ga0070674_100034053
1321 Ga0070667_100009753
1322 Ga0070709_10004117
1323 Ga0070713_100020550
1324 Ga0070710_10001455
1325 Ga0070663_100006884
1326 Ga0070663_100008174
1327 Ga0070681_10053293
1328 Ga0070685_10001923
1329 Ga0070699_100068180
1330 Ga0070665_100000227
1331 Ga0070665_100040698
1332 Ga0070665_100059322
1333 Ga0070665_100153116
1334 Ga0068855_100001019
1335 Ga0068855_100153664
1336 Ga0068855_100186637
1337 Ga0068857_100120684
1338 Ga0068857_100279867
1339 Ga0068854_100010398
1340 Ga0068854_100031331
1341 Ga0068854_100063002
1342 Ga0068856_100009010
1343 Ga0068856_100009837
1344 Ga0068856_100017742
1345 Ga0068856_100154918
1346 Ga0068852_100000915
1347 Ga0068852_100201722
1348 Ga0068852_100206905
1349 Ga0068864_100187555
1350 Ga0068851_10001399
1351 Ga0068863_100051283
1352 Ga0068863_100106350
1353 Ga0068858_100004031
1354 Ga0068862_100176133
1355 Ga0081540_1003849
1356 Ga0070717_10064195
1357 Ga0075365_10000531
1358 Ga0075365_10009053
1359 Ga0075365_10010720
1360 Ga0075365_10017374
1361 Ga0075365_10019715
1362 Ga0075365_10022527
1363 Ga0075365_10030791
1364 Ga0075365_10081484
1365 Ga0075368_10034284
1366 Ga0075363_100000058
1367 Ga0075364_10014932
1368 Ga0070712_100016628
1369 Ga0075362_10010898
1370 Ga0075362_10015935
1371 Ga0075362_10040411
1372 Ga0075367_10000241
1373 Ga0075367_10049377
1374 Ga0075367_10094119
1375 Ga0075369_10002765
1376 Ga0075369_10004181
1377 Ga0075369_10006567
1378 Ga0075369_10009584
1379 Ga0075366_10006620
1380 Ga0075370_10008090
1381 Ga0075428_100005444
1382 Ga0075428_100117841
1383 Ga0075430_100010143
1384 Ga0075430_100012612
1385 Ga0075431_100000183
1386 Ga0099825_1029359
1387 Ga0099824_1023232
1388 Ga0099822_1023504
1389 Ga0099826_10000665
1390 Ga0105251_10031549
1391 Ga0105244_10048482
1392 Ga0105240_10000217
1393 Ga0105240_10001044
1394 Ga0105240_10136724
1395 Ga0105240_10176549
1396 Ga0114129_10032402
1397 Ga0105243_10007647
1398 Ga0105243_10018759
1399 Ga0105241_10001102
1400 Ga0105242_10210522
1401 Ga0105248_10029402
1402 Ga0105237_10000978
1403 Ga0105237_10003836
1404 Ga0105237_10010892
1405 Ga0105237_10016626
1406 Ga0105237_10045493
1407 Ga0105237_10116983
1408 Ga0105238_10000111
1409 Ga0105238_10006969
1410 Ga0105238_10073563
1411 Ga0105238_10148003
1412 Ga0105238_10209138
1413 Ga0105249_10007119
1414 Ga0105249_10085551
1415 Ga0123341_1000093
1416 Ga0123342_1019635
1417 Ga0123342_1024823
1418 Ga0105239_10008101
1419 Ga0105239_10027600
1420 Ga0105239_10164192
1421 Ga0157373_10004938
1422 Ga0157373_10010185
1423 Ga0157371_10000002
1424 Ga0157370_10003627
1425 Ga0157370_10005183
1426 Ga0157369_10104600
1427 Ga0157369_10177423
1428 Ga0171463_1002
1429 Ga0157374_10035329
1430 Ga0157372_10234891
1431 Ga0163163_10000004
1432 Ga0163163_10013631
1433 Ga0182007_10004509
1434 Ga0182005_1014944
1435 Ga0183363_1041
1436 Ga0163161_10043176
1437 Ga0214544_1000018
1438 Ga0214544_1009587
1439 Ga0214542_1000307
1440 Ga0214542_1001549
1441 Ga0214542_1018955
1442 Ga0214545_1005475
1443 Ga0214543_1000195
1444 Ga0214543_1007141
1445 Ga0214543_1011326
1446 Ga0228711_1004587
1447 Ga0228710_1004744
1448 Ga0209435_100006
1449 Ga0209436_100404
1450 Ga0209436_102987
1451 Ga0209784_100005
1452 Ga0209784_100312
1453 Ga0209566_100005
1454 Ga0209674_100009
1455 Ga0209672_105623
1456 Ga0209563_100012
1457 Ga0209437_100022
1458 Ga0207425_1002753
1459 Ga0207425_1003951
1460 Ga0209646_1000015
1461 Ga0209646_1000108
1462 Ga0209026_1000039
1463 Ga0209677_100006
1464 Ga0209677_100826
1465 Ga0209148_1000078
1466 Ga0209148_1000790
1467 Ga0209148_1006123
1468 Ga0209148_1010791
1469 Ga0209759_1000005
1470 Ga0209759_1001092
1471 Ga0209759_1019371
1472 Ga0209129_1000255
1473 Ga0209129_1000669
1474 Ga0209233_1000031
1475 Ga0209233_1000047
1476 Ga0209233_1000324
1477 Ga0209233_1000330
1478 Ga0209233_1011262
1479 Ga0209455_1000193
1480 Ga0209455_1000641
1481 Ga0209455_1005792
1482 Ga0209455_1009389
1483 Ga0209673_1000067
1484 Ga0209673_1000291
1485 Ga0209673_1000473
1486 Ga0209673_1000642
1487 Ga0209673_1013619
1488 Ga0209130_1000120
1489 Ga0209130_1000242
1490 Ga0209675_1014646
1491 Ga0209676_1000470
1492 Ga0209676_1001059
1493 Ga0209676_1001988
1494 Ga0209676_1002891
1495 Ga0209676_1022144
1496 Ga0209025_1000240
1497 Ga0209025_1000430
1498 Ga0209025_1000708
1499 Ga0209025_1001534
1500 Ga0209025_1006332
1501 Ga0209564_1000092
1502 Ga0209564_1000338
1503 Ga0209564_1000876
1504 Ga0209564_1018490
1505 Ga0209758_1000131
1506 Ga0209758_1000490
1507 Ga0209758_1000508
1508 Ga0209758_1000610
1509 Ga0209758_1008376
1510 Ga0209050_1001238
1511 Ga0209050_1006857
1512 Ga0209050_1009556
1513 Ga0209050_1013160
1514 Ga0209256_1000788
1515 Ga0209256_1001230
1516 Ga0209256_1001843
1517 Ga0209256_1002067
1518 Ga0207426_1000075
1519 Ga0207426_1000206
1520 Ga0207426_1000483
1521 Ga0209051_1000038
1522 Ga0209051_1002802
1523 Ga0209051_1002894
1524 Ga0209051_1016836
1525 Ga0209257_1000545
1526 Ga0209257_1001781
1527 Ga0209257_1003568
1528 Ga0209257_1003646
1529 Ga0207656_10025224
1530 Ga0207655_1051164
1531 Ga0207713_1036400
1532 Ga0207692_10012086
1533 Ga0207680_10001300
1534 Ga0207647_10000500
1535 Ga0207647_10001555
1536 Ga0207647_10003982
1537 Ga0207699_10001044
1538 Ga0207654_10008998
1539 Ga0207654_10058718
1540 Ga0207695_10000007
1541 Ga0207695_10001205
1542 Ga0207695_10022351
1543 Ga0207695_10031196
1544 Ga0207695_10036514
1545 Ga0207695_10130548
1546 Ga0207671_10000793
1547 Ga0207671_10003510
1548 Ga0207671_10008685
1549 Ga0207671_10209851
1550 Ga0207693_10025190
1551 Ga0207657_10062390
1552 Ga0207694_10000199
1553 Ga0207694_10005080
1554 Ga0207694_10007856
1555 Ga0207694_10009453
1556 Ga0207694_10011666
1557 Ga0207694_10039024
1558 Ga0207650_10010601
1559 Ga0207644_10021404
1560 Ga0207706_10020155
1561 Ga0207706_10046067
1562 Ga0207706_10107587
1563 Ga0207706_10120797
1564 Ga0207669_10066859
1565 Ga0207704_10053054
1566 Ga0207665_10001859
1567 Ga0207691_10078053
1568 Ga0207711_10040250
1569 Ga0207667_10000028
1570 Ga0207667_10090804
1571 Ga0207712_10000169
1572 Ga0207712_10024258
1573 Ga0207668_10033246
1574 Ga0207668_10047884
1575 Ga0207640_10001595
1576 Ga0207640_10017441
1577 Ga0207658_10013181
1578 Ga0207703_10001066
1579 Ga0207639_10000560
1580 Ga0207678_10002324
1581 Ga0207678_10033763
1582 Ga0207678_10035730
1583 Ga0207702_10004405
1584 Ga0207702_10013019
1585 Ga0207702_10034297
1586 Ga0207641_10094135
1587 Ga0207648_10084397
1588 Ga0207674_10124592
1589 Ga0207674_10141337
1590 Ga0207675_100107710
1591 Ga0207683_10091692
1592 Ga0207683_10181519
1593 Ga0207698_10140736
1594 Ga0209281_1000491
1595 Ga0209281_1000981
1596 Ga0209389_1004138
1597 Ga0209371_1000003
1598 Ga0209371_1000324
1599 Ga0209589_1002342
1600 Ga0209589_1007145
1601 Ga0209489_106154
1602 Ga0209489_106733
1603 Ga0209700_100005
1604 Ga0209282_1000108
1605 Ga0209282_1000604
1606 Ga0209813_10001351
1607 Ga0268266_10000006
1608 Ga0268266_10029411
1609 Ga0268266_10033739
1610 Ga0268266_10096000
1611 Ga0268264_10127213
1612 Ga0307515_10001625
1613 Ga0307515_10001999
1614 Ga0307515_10051586
1615 Ga0307515_10233095
1616 Ga0265338_10189785
1617 Ga0268256_1000004
1618 Ga0268256_1001615
1619 Ga0307513_10095186
1620 Ga0307408_100000948
1621 Ga0307514_10000850
1622 Ga0307405_10019055
1623 Ga0307406_10064691
1624 Ga0307412_10007012
1625 Ga0315914_1000427
1626 Ga0307416_100082647
1627 Ga0307414_10128900
1628 Ga0307411_10099176
1629 Ga0315913_1001358
1630 Ga0315915_1000032
1631 Ga0316574_0008040
1632 Ga0316574_0032447
1633 Ga0373927_0000581
1634 Ga0316584_0142313
1635 Ga0373925_0003311
1636 Ga0395900_0170554
1637 Ga0395905_0001624
1638 Ga0395905_0018526
1639 Ga0395905_0168297
1640 Ga0395901_0037069
1641 Ga0395901_0099665
1642 Ga0400487_39107
1643 Ga0436365_1690000
1644 Ga0436361_0082211
1645 Ga0436361_1160430
1646 Ga0439436_0032326
1647 Ga0439465_0001210
1648 Ga0439465_0008515
1649 Ga0451849_0513859
1650 Ga0451851_0276965
1651 Ga0451843_1077282
1652 Ga0451853_1283853
1653 Ga0439432_003974
1654 Ga0439449_0019041
1655 Ga0450906_003989
1656 Ga0450907_007441
1657 Ga0439446_0009399
1658 Ga0439434_0010852
1659 Ga0439434_0015659
1660 Ga0450918_000330
1661 Ga0466963_0008944
1662 Ga0466968_0006460
1663 Ga0466970_0000136
1664 Ga0466959_0056743
1665 Ga0451576_0121180
1666 Ga0466958_0004964
1667 Ga0495617_006379
1668 Ga0495629_0009432
1669 Ga0495638_0001519
1670 Ga0495650_0060858
1671 Ga0495605_0020476
1672 Ga0495585_0033722
1673 Ga0495585_0099629
1674 Ga0495606_0006572
1675 Ga0495606_0021433
1676 Ga0495606_0079141
1677 Ga0495610_0016880
1678 Ga0495620_0001877
1679 Ga0495637_0014296
1680 Ga0495643_0001015
1681 Ga0495643_0038695
1682 Ga0495648_0043713
1683 Ga0495654_0000920
1684 Ga0495597_0007987
1685 Ga0495622_0001480
1686 Ga0495633_0044363
1687 Ga0495633_0063020
1688 Ga0495668_0027729
1689 Ga0495625_0014937
1690 Ga0495625_0028129
1691 Ga0495625_0169879
1692 Ga0495635_0069085
1693 Ga0495661_0038541
1694 Ga0495588_0000630
1695 Ga0495600_0091745
1696 Ga0495604_0000886
1697 Ga0495672_0017946
1698 Ga0495672_0037928
1699 Ga0495687_008305
1700 Ga0495681_0002578
1701 Ga0495681_0009025
1702 Ga0496101_0015346
1703 Ga0496102_0003274
1704 Ga0496103_0005911
1705 Ga0496104_0012545
1706 Ga0496105_0003825
1707 Ga0496106_0006011
1708 Ga0496108_0026952
1709 Ga0496109_0018060
1710 Ga0496110_0010594
1711 Ga0496110_0020290
1712 Ga0496110_0031938
1713 Ga0496112_0010380
1714 Ga0496112_0084625
1715 Ga0496112_0090216
1716 Ga0496116_0031320
1717 Ga0496116_0144165
1718 Ga0496117_0000016
1719 Ga0496117_0041396
1720 Ga0496117_0077648
1721 Ga0496118_0000153
1722 Ga0496118_0001953
1723 Ga0496118_0023476
1724 Ga0496118_0060873
1725 Ga0496119_0007331
1726 Ga0496119_0021185
1727 Ga0496119_0026665
1728 Ga0496119_0045015
1729 Ga0496119_0053504
1730 Ga0496120_0000660
1731 Ga0496120_0004196
1732 Ga0496120_0006449
1733 Ga0496121_0000191
1734 Ga0496121_0001476
1735 Ga0496121_0016949
1736 Ga0496121_0023957
1737 Ga0496121_0077608
1738 Ga0496121_0159878
1739 Ga0496122_0000002
1740 Ga0496122_0002358
1741 Ga0496122_0002550
1742 Ga0496122_0003859
1743 Ga0496123_0000002
1744 Ga0496123_0021716
1745 Ga0496124_0000006
1746 Ga0496124_0004712
1747 Ga0496124_0008231
1748 Ga0496124_0011294
1749 Ga0496124_0029218
1750 Ga0496125_0000428
1751 Ga0496125_0001524
1752 Ga0496125_0014527
1753 Ga0496125_0014609
1754 Ga0496125_0023312
1755 Ga0496125_0050628
1756 Ga0496125_0065695
1757 Ga0496125_0120723
1758 Ga0496126_0001278
1759 Ga0496126_0109555
1760 Ga0501031_0139909
1761 Ga0501032_0008522
1762 Ga0501032_0041410
1763 Ga0501033_0002403
1764 Ga0501034_0000003
1765 Ga0501034_0267192
1766 Ga0501037_0000028
1767 Ga0501039_0073800
1768 Ga0501043_0000028
1769 Ga0501069_0000014
1770 Ga0501070_0000121
1771 Ga0501073_0021852
1772 Ga0501074_0000004
1773 Ga0501080_0000027
1774 Ga0501083_0000025
1775 Ga0501035_0000129
1776 Ga0501044_0000052
1777 nmdc:mga03683_12598_c1
1778 nmdc:mga03683_14537_c1
1779 nmdc:mga00v17_11453_c1
1780 nmdc:mga00v17_11939_c1
1781 nmdc:mga00v17_3_c1
1782 nmdc:mga0yw44_10540_c1
1783 nmdc:mga0yw44_31834_c1
1784 nmdc:mga0yw44_6443_c1
1785 nmdc:mga0yw44_9013_c1
1786 nmdc:mga0k408_1643_c1
1787 nmdc:mga0k408_28205_c1
1788 nmdc:mga06z11_19394_c1
1789 nmdc:mga06z11_42757_c1
1790 nmdc:mga06z11_98357_c1
1791 nmdc:mga07m45_40126_c1
1792 nmdc:mga07m45_7997_c1
1793 nmdc:mga05p37_114737_c1
1794 nmdc:mga05p37_602_c1
1795 nmdc:mga09592_1214_c1
1796 nmdc:mga0qj67_30261_c1
1797 nmdc:mga0qj67_41540_c1
1798 nmdc:mga06r32_2662_c1
1799 nmdc:mga0sz30_17402_c1
1800 nmdc:mga0sz30_28733_c1
1801 nmdc:mga0sz30_514_c1
1802 nmdc:mga0sz30_5788_c1
1803 Ga0500610_0019641
1804 Ga0495655_0007607
1805 Ga0500643_019909
1806 Ga0500560_001318
1807 Ga0500569_006377
1808 Ga0500618_006461
1809 Ga0500618_012616
1810 Ga0500658_0001866
1811 Ga0500561_0000133
1812 Ga0500568_0012171
1813 Ga0500573_0014457
1814 Ga0500590_002599
1815 Ga0500616_0005939
1816 Ga0500616_0038875
1817 Ga0500624_000016
1818 Ga0500624_000337
1819 Ga0500636_0000001
1820 Ga0500636_0056283
1821 Ga0500637_0000007
1822 Ga0590075_012034
1823 2922387161
1824 2503200940
1825 2508697127
1826 2508731299
1827 2509110597
1828 2509390882
1829 2509441942
1830 2510136131
1831 2510306054
1832 2510892866
1833 2511135584
1834 2511184947
1835 2511195131
1836 2511500084
1837 2512036700
1838 2512530307
1839 2512531411
1840 2512929141
1841 2512975259
1842 2513568432
1843 2513579469
1844 2513584457
1845 2513606794
1846 2513611562
1847 2513619603
1848 2513624778
1849 2513630711
1850 2513711937
1851 2513876258
1852 2513883181
1853 2513904255
1854 2514001812
1855 2514006996
1856 2514017071
1857 2514018266
1858 2514035816
1859 2514423386
1860 2514592343
1861 2515108942
1862 2515613292
1863 2515624310
1864 2515633053
1865 2515640258
1866 2515656339
1867 2515738477
1868 2516207161
1869 2516897615
1870 2517040883
1871 2517080514
1872 2517098483
1873 2517409967
1874 2517566663
1875 2521557009
1876 2524453369
1877 2524459173
1878 2530648702
1879 2537877487
1880 2551674840
1881 2551687092
1882 2551697280
1883 2551714289
1884 2551737641
1885 2553004808
1886 2554245480
1887 2554817817
1888 2558864946
1889 2559296690
1890 2585232684
1891 2585268269
1892 2585272659
1893 2585281209
1894 2585327295
1895 2585334519
1896 2585391165
1897 2585396262
1898 2585526838
1899 2585536131
1900 2585542400
1901 2585557616
1902 2585562327
1903 2585841872
1904 2585896767
1905 2585906506
1906 2585993365
1907 2586004005
1908 2587981928
1909 2588514384
1910 2597813921
1911 2599602806
1912 2599940080
1913 2600197381
1914 2600362990
1915 2601610439
1916 2601747231
1917 2608380858
1918 2616298025
1919 2616310989
1920 2616555589
1921 2617353962
1922 2617378920
1923 2617385521
1924 2643917329
1925 2643984692
1926 2644153017
1927 2644520818
1928 2644673434
1929 2657685739
1930 2671113169
1931 2692318306
1932 2719184850
1933 2719389825
1934 2719668850
1935 2719728870
1936 2720489543
1937 2720610218
1938 2720617642
1939 2720628784
1940 2720772733
1941 2721144561
1942 2721156053
1943 2721161931
1944 2721403468
1945 2722843076
1946 2723030173
1947 2723564578
1948 2723569780
1949 2723575019
1950 2724035044
1951 2724041895
1952 2724092762
1953 2724101327
1954 2724113149
1955 2725949400
1956 2730110706
1957 2730160965
1958 2730295586
1959 2739038466
1960 2753357764
1961 2753462802
1962 2758638030
1963 2765468807
1964 2766068870
1965 2770198471
1966 2774873147
1967 2776265227
1968 2776910705
1969 2778174844
1970 2792583722
1971 2792619363
1972 2792627135
1973 2792640931
1974 2792752212
1975 2793299129
1976 2793312722
1977 2793324244
1978 2793329904
1979 2793333871
1980 2793340789
1981 2793345739
1982 2793361865
1983 2793367418
1984 2802720137
1985 2802723824
1986 2802734149
1987 2802739611
1988 2802746003
1989 2802753402
1990 2804754997
1991 2805935169
1992 2806048809
1993 2806056012
1994 2806062841
1995 2806070263
1996 2806077249
1997 2808987143
1998 2812370262
1999 2819557519
2000 2819613183
2001 2819616808
2002 2819641745
2003 2819683579
2004 2824681602
2005 2838020495
2006 2838031685
2007 2838049936
2008 2838062204
2009 2838069438
2010 2838078636
2011 2838129598
2012 2838677968
2013 2838686166
2014 2838690474
2015 2838700463
2016 2838713742
2017 2838717126
2018 2838722263
2019 2838727875
2020 2838733169
2021 2838747242
2022 2840770218
2023 2840881958
2024 2840882554
2025 2841849533
2026 2841855395
2027 2841861427
2028 2841865785
2029 2841946245
2030 2841952271
2031 2841967914
2032 2841982754
2033 2842083105
2034 2842116975
2035 2842124087
2036 2842127719
2037 2842132861
2038 2842154854
2039 2842160898
2040 2842164427
2041 2842173353
2042 2842178475
2043 2842184514
2044 2842190234
2045 2842214548
2046 2842219660
2047 2842227267
2048 2842232097
2049 2842243155
2050 2842248501
2051 2842262691
2052 2842264815
2053 2842275212
2054 2842297364
2055 2842300960
2056 2842307352
2057 2842345763
2058 2842360024
2059 2842364031
2060 2842376215
2061 2842383758
2062 2842390897
2063 2842405945
2064 2842412529
2065 2842419173
2066 2842422629
2067 2842429132
2068 2842435745
2069 2842441393
2070 2842449790
2071 2842463558
2072 2842470075
2073 2842478417
2074 2842505637
2075 2842513861
2076 2842518306
2077 2842527322
2078 2844004716
2079 2844460130
2080 2847423190
2081 2847674871
2082 2848997414
2083 2850084669
2084 2852394165
2085 2854922459
2086 2855830471
2087 2855845757
2088 2855874179
2089 2856317245
2090 2856344135
2091 2856353638
2092 2856366199
2093 2856745978
2094 2857350039
2095 2857354406
2096 2857517696
2097 2858805149
2098 2869163894
2099 2869257483
2100 2869287233
2101 2871430533
2102 2871489473
2103 2871496301
2104 2874103466
2105 2874128221
2106 2874149190
2107 2874156025
2108 2874170187
2109 2874595402
2110 2874634384
2111 2874651828
2112 2876367301
2113 2876373607
2114 2876393653
2115 2876415387
2116 2876775596
2117 2876823588
2118 2878038283
2119 2878742314
2120 2878746965
2121 2878754122
2122 2878760530
2123 2878767493
2124 2879079687
2125 2879133909
2126 2879145042
2127 2881151121
2128 2881161511
2129 2881163414
2130 2881668843
2131 2881849006
2132 2881868083
2133 2882463174
2134 2882637520
2135 2882919046
2136 2885305845
2137 2885324123
2138 2885327741
2139 2885340061
2140 2885350136
2141 2885353215
2142 2885367994
2143 2885416464
2144 2888338835
2145 2888347647
2146 2888352437
2147 2889020772
2148 2889034635
2149 2891398135
2150 2891556478
2151 2896387521
2152 2899796470
2153 2899849998
2154 2903453229
2155 2903494575
2156 2903500518
2157 2903526792
2158 2903530589
2159 2903541095
2160 2904440286
2161 2904530801
2162 2904585784
2163 2904592403
2164 2904601464
2165 2904660161
2166 2906309779
2167 2906322414
2168 2906331868
2169 2906355017
2170 2906417307
2171 2906629032
2172 2906646436
2173 2913297014
2174 2915984318
2175 2915987020
2176 2915999437
2177 2916004071
2178 2916012468
2179 2916014704
2180 2916026929
2181 2916034040
2182 2916038597
2183 2916046326
2184 2916050825
2185 2916060592
2186 2916066637
2187 2916071650
2188 2916079557
2189 2919049819
2190 2919082886
2191 2919117384
2192 2919176256
2193 2919412937
2194 2919682597
2195 2920763331
2196 2920827226
2197 2921205387
2198 2921210709
2199 2921240627
2200 2921249603
2201 2921254274
2202 2921261697
2203 2921269608
2204 2921285052
2205 2921294220
2206 2921299008
2207 2922138177
2208 2922163056
2209 2922189176
2210 2922400154
2211 2923515641
2212 2923524350
2213 2924144379
2214 2924151613
2215 2924159489
2216 2924172618
2217 2924178730
2218 2924185771
2219 2924196070
2220 2924201328
2221 2924210160
2222 2924218921
2223 2924227617
2224 2924230877
2225 2924712830
2226 2924729552
2227 2924737401
2228 2924761777
2229 2924769108
2230 2924780114
2231 2924788800
2232 2926758831
2233 2926763644
2234 2928134541
2235 2933009764
2236 2933013935
2237 2933573992
2238 2933593275
2239 2933595745
2240 2933600101
2241 2935900780
2242 2935906112
2243 2935983010
2244 2935988092
2245 2936374683
2246 2936375883
2247 2936382415
2248 2937005415
2249 2937013000
2250 2937018022
2251 2937029536
2252 2937033952
2253 2937037251
2254 2937043398
2255 2937051951
2256 2937066249
2257 2937077054
2258 2937080488
2259 2937091509
2260 2937096443
2261 2937105700
2262 2937110939
2263 2937116806
2264 2937125029
2265 2937132860
2266 2937814924
2267 2937848802
2268 2937882634
2269 2937891539
2270 2937994948
2271 2941505433
2272 2957379797
2273 2957385597
2274 2957390216
2275 2957398852
2276 2957405756
2277 2957412877
2278 2957420486
2279 2957426825
2280 2957430298
2281 2957442729
2282 2957453808
2283 2957459975
2284 2957464996
2285 2957475224
2286 2957483530
2287 2957486866
2288 2957492908
2289 2957500200
2290 2957506059
2291 2958043392
2292 2958064855
2293 2958089759
2294 2958100446
2295 2958121517
2296 2958131733
2297 2958145578
2298 2958165428
2299 2958180793
2300 2960585366
2301 2960591738
2302 2960601440
2303 2960608269
2304 2960615940
2305 2960630158
2306 2960637792
2307 2960641159
2308 2960652617
2309 2960658452
2310 2960668919
2311 2960685172
2312 2960691025
2313 2960700900
2314 2961078631
2315 2961115486
2316 2961129806
2317 2961163886
2318 2961171754
2319 2963650094
2320 2964619239
2321 2964624587
2322 2964634167
2323 2964641392
2324 2964649769
2325 2964655629
2326 2964658343
2327 2964666744
2328 2964672956
2329 2964678902
2330 2964690223
2331 2964695378
2332 2964701842
2333 2964708431
2334 2964715924
2335 2964725585
2336 2965018691
2337 2965033482
2338 2965069599
2339 2965126612
2340 2967670130
2341 2967675018
2342 2967685509
2343 2967690717
2344 2967694124
2345 2967702777
2346 2967709662
2347 2967715922
2348 2967722778
2349 2967728668
2350 2967739739
2351 2967744235
2352 2967750245
2353 2967760386
2354 2967764761
2355 2967770066
2356 2967781907
2357 2967996541
2358 2968010248
2359 2968086595
2360 2968095338
2361 2968103086
2362 2968111217
2363 2968118894
2364 2968128545
2365 2968172292
2366 2970025208
2367 2970033067
2368 2970035863
2369 2970043236
2370 2970050321
2371 2970060717
2372 2970063004
2373 2970072410
2374 2970077775
2375 2970095079
2376 2970099563
2377 2970109066
2378 2970113992
2379 2970119854
2380 2970129080
2381 2970130759
2382 2970139253
2383 2970147212
2384 2970152704
2385 2970161249
2386 2970165150
2387 2970176300
2388 2970184721
2389 2970194055
2390 2970504350
2391 2970530276
2392 2970547793
2393 2970555382
2394 2977519925
2395 2977525249
2396 2977536923
2397 2977539336
2398 2977546576
2399 2977558702
2400 2977564279
2401 2977568651
2402 2977575064
2403 2977580664
2404 2977823337
2405 2977831310
2406 2977845616
2407 2977864090
2408 2977866033
2409 2977880162
2410 2977899518
2411 2977928381
2412 2977962517
2413 2977973239
2414 2977987710
2415 2979091316
2416 2979096840
2417 2979102560
2418 2979747980
2419 2979784863
2420 2979793850
2421 2979808987
2422 2984509555
2423 2984519747
2424 2984537890
2425 2984604635
2426 2987637138
2427 2987642185
2428 2987659898
2429 2987672960
2430 2987678871
2431 2996345381
2432 2996393825
2433 2996893022
2434 3000020403
2435 3000140977
2436 3004188945
2437 3004204107
2438 3004215612
2439 3004222084
2440 3004243612
2441 3005416652
2442 3005488727
2443 3005592095
2444 637078901
2445 639645372
2446 643600620
2447 643822490
2448 648738626
2449 650843111
2450 8002869582
2451 8003575458
2452 8003997749
2453 8004005444
2454 8004313825
2455 8004375698
2456 8004389070
2457 8004451938
2458 8004697539
2459 8004713250
2460 8004716133
2461 8005275948
2462 8005285833
2463 8005290849
2464 8005301274
2465 8005308298
2466 8005320705
2467 8005327549
2468 8005380556
2469 8005383381
2470 8005398975
2471 8005436582
2472 8005467567
2473 8005487620
2474 8005501997
2475 8005559482
2476 8005566471
2477 8005571150
2478 8005624239
2479 8005629505
2480 8005651808
2481 8005673419
2482 8005686028
2483 8005688911
2484 8005695467
2485 8011356275
2486 8016587319
2487 8018132286
2488 8018151249
2489 8018163745
2490 8018180836
2491 8019623694
2492 8019638340
2493 8019641298
2494 8019656845
2495 8019666265
2496 8019675761
2497 8019680335
2498 8023681567
2499 8024481439
2500 8024493049
2501 8046774208
2502 8049298101
2503 8054005274
2504 8054563375
2505 8055621713
2506 8056123618
2507 8056381771
2508 8057881300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

95

518

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kqw-assembly2.cif.gz_D directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries 0.9721 9 442
5kr3-assembly1.cif.gz_B directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries 0.9717 7 442
5kr5-assembly1.cif.gz_B directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries 0.9715 9 440
5kr6-assembly1.cif.gz_A directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries 0.971 9 440
5kqu-assembly1.cif.gz_A directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries 0.9704 9 442
ID Description Score Start End Superfamily
5kquA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9765 55 329 3.40.640.10
af_A0A1D6DZK7_115_400_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.974 58 329 3.40.640.10
6fyqA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9708 55 331 3.40.640.10
6io1A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.97 55 331 3.40.640.10
5lhaB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9683 55 329 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A534ARV6-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9917 333 449 GO:0008483
GO:0030170
AF-A0A149SA99-F1-model_v4 deleted 0.9836 9 365
AF-A0A3M1GGM4-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.976 1 300 GO:0005829
GO:0008483
GO:0030170
AF-A0A534ARV6-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9752 333 449 GO:0008483
GO:0030170
AF-A0A7C3AS51-F1-model_v4 Aspartate aminotransferase family protein 0.9732 52 439 GO:0008483
GO:0030170

Map