F492268
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1257 | 471 | 2514 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300049762|Ga0501265_002920|Ga0501265_002920_39_728 |
| Length | 229 |
| Sequence | MHEALRIDGDSTMNNHGVLSPRLASRVPIESAGRIDYARRKEFCVEVLQLDVSGRPQAWISAKEAACIYASDGIAWTLGDAFYVLRGGTQRRTGLQSRIEVHPIIAVRGAIPSRAWRQTPALSNPKLFARDRHVCAYCGGHFHADDLTREHITPTSRGGRDTWMNCITACRPCNGRKGNRMPEEAHMSLMYLPYVPNLHEDMILRGRRILVDQMEFLLASVPRHSRLHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 101 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 102 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 118 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 226 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 228 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 232 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 235 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 249 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 250 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 275 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 276 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 282 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 283 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 284 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 285 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 286 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 287 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 288 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 289 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 290 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 291 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 292 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 293 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 294 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 295 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 296 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 297 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 298 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 299 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 300 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 301 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 302 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 303 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 304 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 305 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 306 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 307 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 308 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 309 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 310 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 311 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 312 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 313 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 314 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 315 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 316 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 317 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 318 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 319 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 320 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 321 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 322 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 323 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 324 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 388 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 389 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 390 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 391 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 392 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 393 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 394 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 395 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 396 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 400 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 401 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 402 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 403 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 404 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 405 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 406 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 407 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 408 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 409 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 410 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 411 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 412 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 413 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 414 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 415 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 416 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 417 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 418 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 419 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 420 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 424 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 425 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 426 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 427 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 428 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 429 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 430 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 436 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 440 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 443 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 444 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 445 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 446 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 447 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 448 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 449 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 450 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 451 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 452 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 453 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 454 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 455 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 456 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 457 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 458 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 459 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 460 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 461 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 462 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 463 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 464 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 465 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 466 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 467 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 469 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 470 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 471 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.27 |
| Nodule | 0.4 |
| Rhizoplane | 3.74 |
| Rhizosphere | 74.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501265_002920 | 3300049762 | Bacteria | 1940 |
| 2 | JGI24740J21852_10004029 | 3300001979 | Bacteria | 6361 |
| 3 | JGI24744J21845_10010959 | 3300002077 | Bacteria | 1856 |
| 4 | JGI25156J39149_1001303 | 3300002705 | Bacteria | 10788 |
| 5 | JGI25156J39149_1012545 | 3300002705 | Bacteria | 1853 |
| 6 | JGI25154J39366_1000343 | 3300002738 | Bacteria | 26705 |
| 7 | JGI25157J39369_1000304 | 3300002741 | Bacteria | 35531 |
| 8 | JGI25152J39213_1000710 | 3300002773 | Bacteria | 17271 |
| 9 | JGI25150J39212_1017649 | 3300002774 | Bacteria | 1149 |
| 10 | JGI25153J46596_10004579 | 3300003215 | Bacteria | 7412 |
| 11 | JGI25153J46596_10006328 | 3300003215 | Bacteria | 6019 |
| 12 | rootH1_10000527 | 3300003316 | Bacteria | 4022 |
| 13 | rootH1_10010629 | 3300003316 | Bacteria | 5506 |
| 14 | rootH2_10057083 | 3300003320 | Bacteria | 6357 |
| 15 | rootL2_10003309 | 3300003322 | Bacteria | 4899 |
| 16 | rootL2_10004014 | 3300003322 | Bacteria | 6597 |
| 17 | rootL2_10056084 | 3300003322 | Bacteria | 1258 |
| 18 | rootH1_10000048 | 3300003323 | Bacteria | 2903 |
| 19 | rootH1_10020306 | 3300003323 | Bacteria | 16958 |
| 20 | rootH1_10021990 | 3300003323 | Bacteria | 3895 |
| 21 | JGI26128J50194_1004871 | 3300003347 | Bacteria | 885 |
| 22 | Ga0055539_1002131 | 3300003752 | Bacteria | 3198 |
| 23 | Ga0055539_1002241 | 3300003752 | Bacteria | 3057 |
| 24 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 25 | Ga0055525_1000031 | 3300003759 | Bacteria | 314909 |
| 26 | Ga0055525_1000802 | 3300003759 | Bacteria | 9854 |
| 27 | Ga0055529_1000963 | 3300003763 | Bacteria | 14815 |
| 28 | Ga0055524_1000052 | 3300003775 | Bacteria | 144959 |
| 29 | Ga0055524_1017112 | 3300003775 | Bacteria | 2569 |
| 30 | Ga0055528_1051731 | 3300003790 | Bacteria | 826 |
| 31 | Ga0055530_10004973 | 3300003791 | Bacteria | 6572 |
| 32 | Ga0055530_10008463 | 3300003791 | Bacteria | 4117 |
| 33 | Ga0055540_1000123 | 3300003792 | Bacteria | 80351 |
| 34 | Ga0055540_1011833 | 3300003792 | Bacteria | 2782 |
| 35 | Ga0055531_10000001 | 3300003794 | Bacteria | 543586 |
| 36 | Ga0055531_10011952 | 3300003794 | Bacteria | 4129 |
| 37 | Ga0065165_1000836 | 3300005262 | Bacteria | 40452 |
| 38 | Ga0065165_1003047 | 3300005262 | Bacteria | 12576 |
| 39 | Ga0065707_10084569 | 3300005295 | Bacteria | 7048 |
| 40 | Ga0070658_10216772 | 3300005327 | Bacteria | 1618 |
| 41 | Ga0070658_10247639 | 3300005327 | Bacteria | 1511 |
| 42 | Ga0070658_10775629 | 3300005327 | Bacteria | 833 |
| 43 | Ga0070676_10008317 | 3300005328 | Bacteria | 5590 |
| 44 | Ga0070676_10010756 | 3300005328 | Bacteria | 4965 |
| 45 | Ga0070676_10081103 | 3300005328 | Bacteria | 1968 |
| 46 | Ga0070683_100231589 | 3300005329 | Bacteria | 1756 |
| 47 | Ga0070683_100802241 | 3300005329 | Bacteria | 902 |
| 48 | Ga0070690_100017502 | 3300005330 | Bacteria | 4311 |
| 49 | Ga0070690_100019706 | 3300005330 | Bacteria | 4100 |
| 50 | Ga0070690_100484460 | 3300005330 | Bacteria | 923 |
| 51 | Ga0070670_100009305 | 3300005331 | Bacteria | 8392 |
| 52 | Ga0070670_100009633 | 3300005331 | Bacteria | 8245 |
| 53 | Ga0070670_100081596 | 3300005331 | Bacteria | 2778 |
| 54 | Ga0070670_100290394 | 3300005331 | Bacteria | 1429 |
| 55 | Ga0070670_100728717 | 3300005331 | Bacteria | 893 |
| 56 | Ga0070677_10007611 | 3300005333 | Bacteria | 3621 |
| 57 | Ga0070677_10019703 | 3300005333 | Bacteria | 2448 |
| 58 | Ga0070677_10045673 | 3300005333 | Bacteria | 1748 |
| 59 | Ga0070677_10057710 | 3300005333 | Bacteria | 1592 |
| 60 | Ga0070677_10061857 | 3300005333 | Bacteria | 1547 |
| 61 | Ga0070677_10112427 | 3300005333 | Bacteria | 1218 |
| 62 | Ga0068869_100007348 | 3300005334 | Bacteria | 7032 |
| 63 | Ga0068869_100019197 | 3300005334 | Bacteria | 4665 |
| 64 | Ga0068869_100029467 | 3300005334 | Bacteria | 3846 |
| 65 | Ga0070666_10024212 | 3300005335 | Bacteria | 3954 |
| 66 | Ga0070666_10259975 | 3300005335 | Bacteria | 1230 |
| 67 | Ga0070680_100047155 | 3300005336 | Bacteria | 3508 |
| 68 | Ga0068868_100007149 | 3300005338 | Bacteria | 7933 |
| 69 | Ga0068868_100008040 | 3300005338 | Bacteria | 7542 |
| 70 | Ga0068868_100078021 | 3300005338 | Bacteria | 2651 |
| 71 | Ga0068868_100095120 | 3300005338 | Bacteria | 2404 |
| 72 | Ga0068868_100148702 | 3300005338 | Bacteria | 1928 |
| 73 | Ga0068868_100235186 | 3300005338 | Bacteria | 1538 |
| 74 | Ga0068868_100359980 | 3300005338 | Bacteria | 1248 |
| 75 | Ga0068868_100411011 | 3300005338 | Bacteria | 1170 |
| 76 | Ga0070660_100165433 | 3300005339 | Bacteria | 1784 |
| 77 | Ga0070660_100193201 | 3300005339 | Bacteria | 1649 |
| 78 | Ga0070689_100037388 | 3300005340 | Bacteria | 3712 |
| 79 | Ga0070689_100199233 | 3300005340 | Bacteria | 1634 |
| 80 | Ga0070687_100086448 | 3300005343 | Bacteria | 1724 |
| 81 | Ga0070661_100005819 | 3300005344 | Bacteria | 8479 |
| 82 | Ga0070661_100089480 | 3300005344 | Bacteria | 2279 |
| 83 | Ga0070661_100288126 | 3300005344 | Bacteria | 1275 |
| 84 | Ga0070661_100300894 | 3300005344 | Bacteria | 1249 |
| 85 | Ga0070668_100007635 | 3300005347 | Bacteria | 8026 |
| 86 | Ga0070668_100068725 | 3300005347 | Bacteria | 2754 |
| 87 | Ga0070668_100090366 | 3300005347 | Bacteria | 2412 |
| 88 | Ga0070668_100364257 | 3300005347 | Bacteria | 1226 |
| 89 | Ga0070669_100012068 | 3300005353 | Bacteria | 6131 |
| 90 | Ga0070669_100031165 | 3300005353 | Bacteria | 3851 |
| 91 | Ga0070669_100038839 | 3300005353 | Bacteria | 3457 |
| 92 | Ga0070669_100152211 | 3300005353 | Bacteria | 1791 |
| 93 | Ga0070669_100287569 | 3300005353 | Bacteria | 1319 |
| 94 | Ga0070675_100002907 | 3300005354 | Bacteria | 12912 |
| 95 | Ga0070675_100009944 | 3300005354 | Bacteria | 7417 |
| 96 | Ga0070675_100054029 | 3300005354 | Bacteria | 3304 |
| 97 | Ga0070675_100077116 | 3300005354 | Bacteria | 2773 |
| 98 | Ga0070675_100135095 | 3300005354 | Bacteria | 2104 |
| 99 | Ga0070675_100213751 | 3300005354 | Bacteria | 1677 |
| 100 | Ga0070675_100913163 | 3300005354 | Bacteria | 805 |
| 101 | Ga0070671_100004848 | 3300005355 | Bacteria | 10696 |
| 102 | Ga0070671_100009961 | 3300005355 | Bacteria | 7632 |
| 103 | Ga0070671_100016969 | 3300005355 | Bacteria | 5888 |
| 104 | Ga0070671_100023124 | 3300005355 | Bacteria | 5081 |
| 105 | Ga0070671_100048071 | 3300005355 | Bacteria | 3547 |
| 106 | Ga0070671_100064228 | 3300005355 | Bacteria | 3057 |
| 107 | Ga0070671_100236517 | 3300005355 | Bacteria | 1550 |
| 108 | Ga0070671_100490293 | 3300005355 | Bacteria | 1056 |
| 109 | Ga0070674_100013025 | 3300005356 | Bacteria | 5127 |
| 110 | Ga0070674_100017473 | 3300005356 | Bacteria | 4514 |
| 111 | Ga0070674_100035720 | 3300005356 | Bacteria | 3330 |
| 112 | Ga0070674_100123792 | 3300005356 | Bacteria | 1918 |
| 113 | Ga0070674_100266210 | 3300005356 | Bacteria | 1352 |
| 114 | Ga0070674_100372436 | 3300005356 | Bacteria | 1159 |
| 115 | Ga0070674_100599488 | 3300005356 | Bacteria | 931 |
| 116 | Ga0070673_100019027 | 3300005364 | Bacteria | 4925 |
| 117 | Ga0070673_100049839 | 3300005364 | Bacteria | 3271 |
| 118 | Ga0070673_100058470 | 3300005364 | Bacteria | 3048 |
| 119 | Ga0070673_100100373 | 3300005364 | Bacteria | 2382 |
| 120 | Ga0070673_100175085 | 3300005364 | Bacteria | 1833 |
| 121 | Ga0070673_100235304 | 3300005364 | Bacteria | 1590 |
| 122 | Ga0070673_100304247 | 3300005364 | Bacteria | 1404 |
| 123 | Ga0070673_100391149 | 3300005364 | Bacteria | 1241 |
| 124 | Ga0070688_100391523 | 3300005365 | Bacteria | 1027 |
| 125 | Ga0070659_100123684 | 3300005366 | Bacteria | 2097 |
| 126 | Ga0070659_100391202 | 3300005366 | Bacteria | 1172 |
| 127 | Ga0070667_100003174 | 3300005367 | Bacteria | 14089 |
| 128 | Ga0070667_100004063 | 3300005367 | Bacteria | 12377 |
| 129 | Ga0070667_100008844 | 3300005367 | Bacteria | 8337 |
| 130 | Ga0070667_100065662 | 3300005367 | Bacteria | 3081 |
| 131 | Ga0070667_100645831 | 3300005367 | Bacteria | 977 |
| 132 | Ga0070700_100091680 | 3300005441 | Bacteria | 1984 |
| 133 | Ga0070700_100314714 | 3300005441 | Bacteria | 1148 |
| 134 | Ga0070708_100063311 | 3300005445 | Bacteria | 3311 |
| 135 | Ga0070663_100018301 | 3300005455 | Bacteria | 4590 |
| 136 | Ga0070663_100371537 | 3300005455 | Bacteria | 1162 |
| 137 | Ga0070678_100022312 | 3300005456 | Bacteria | 4192 |
| 138 | Ga0070678_100073203 | 3300005456 | Bacteria | 2571 |
| 139 | Ga0070678_100083403 | 3300005456 | Bacteria | 2429 |
| 140 | Ga0070678_100108578 | 3300005456 | Bacteria | 2166 |
| 141 | Ga0070678_100109497 | 3300005456 | Bacteria | 2158 |
| 142 | Ga0070678_100144742 | 3300005456 | Bacteria | 1906 |
| 143 | Ga0070678_100192744 | 3300005456 | Bacteria | 1677 |
| 144 | Ga0070678_100295525 | 3300005456 | Bacteria | 1375 |
| 145 | Ga0070662_100021790 | 3300005457 | Bacteria | 4379 |
| 146 | Ga0070662_100036702 | 3300005457 | Bacteria | 3469 |
| 147 | Ga0070662_100039945 | 3300005457 | Bacteria | 3339 |
| 148 | Ga0070662_100105156 | 3300005457 | Bacteria | 2143 |
| 149 | Ga0070662_100151308 | 3300005457 | Bacteria | 1807 |
| 150 | Ga0070681_10176795 | 3300005458 | Bacteria | 2057 |
| 151 | Ga0070681_10237670 | 3300005458 | Bacteria | 1736 |
| 152 | Ga0068867_100000042 | 3300005459 | Bacteria | 77140 |
| 153 | Ga0068867_100002881 | 3300005459 | Bacteria | 12104 |
| 154 | Ga0068867_100005007 | 3300005459 | Bacteria | 9339 |
| 155 | Ga0068867_100010032 | 3300005459 | Bacteria | 6675 |
| 156 | Ga0068867_100027327 | 3300005459 | Bacteria | 4099 |
| 157 | Ga0068867_100045630 | 3300005459 | Bacteria | 3215 |
| 158 | Ga0068867_100078153 | 3300005459 | Bacteria | 2488 |
| 159 | Ga0068867_100080494 | 3300005459 | Bacteria | 2453 |
| 160 | Ga0068867_100171787 | 3300005459 | Bacteria | 1717 |
| 161 | Ga0068867_100290688 | 3300005459 | Bacteria | 1343 |
| 162 | Ga0070685_10191322 | 3300005466 | Bacteria | 1324 |
| 163 | Ga0070706_100003166 | 3300005467 | Bacteria | 16258 |
| 164 | Ga0070707_100072018 | 3300005468 | Bacteria | 3330 |
| 165 | Ga0070707_100512976 | 3300005468 | Bacteria | 1161 |
| 166 | Ga0070698_100072233 | 3300005471 | Bacteria | 3459 |
| 167 | Ga0070679_100024208 | 3300005530 | Bacteria | 5949 |
| 168 | Ga0070684_100556718 | 3300005535 | Bacteria | 1064 |
| 169 | Ga0068853_100008284 | 3300005539 | Bacteria | 8344 |
| 170 | Ga0068853_100144732 | 3300005539 | Bacteria | 2135 |
| 171 | Ga0068853_100278576 | 3300005539 | Bacteria | 1541 |
| 172 | Ga0068853_100294740 | 3300005539 | Bacteria | 1498 |
| 173 | Ga0068853_100405931 | 3300005539 | Bacteria | 1276 |
| 174 | Ga0068853_100407871 | 3300005539 | Bacteria | 1273 |
| 175 | Ga0068853_100429041 | 3300005539 | Bacteria | 1241 |
| 176 | Ga0070672_100000214 | 3300005543 | Bacteria | 31887 |
| 177 | Ga0070672_100003206 | 3300005543 | Bacteria | 10589 |
| 178 | Ga0070672_100012364 | 3300005543 | Bacteria | 5989 |
| 179 | Ga0070672_100111789 | 3300005543 | Bacteria | 2227 |
| 180 | Ga0070672_100132610 | 3300005543 | Bacteria | 2049 |
| 181 | Ga0070672_100137980 | 3300005543 | Bacteria | 2009 |
| 182 | Ga0070672_100286236 | 3300005543 | Bacteria | 1394 |
| 183 | Ga0070672_100378726 | 3300005543 | Bacteria | 1210 |
| 184 | Ga0070693_100446755 | 3300005547 | Bacteria | 906 |
| 185 | Ga0070665_100005964 | 3300005548 | Bacteria | 12470 |
| 186 | Ga0070665_100158040 | 3300005548 | Bacteria | 2269 |
| 187 | Ga0070665_100208289 | 3300005548 | Bacteria | 1956 |
| 188 | Ga0070665_100326872 | 3300005548 | Bacteria | 1538 |
| 189 | Ga0068855_100099856 | 3300005563 | Bacteria | 3342 |
| 190 | Ga0068855_100203891 | 3300005563 | Bacteria | 2225 |
| 191 | Ga0070664_100010180 | 3300005564 | Bacteria | 7627 |
| 192 | Ga0070664_100038998 | 3300005564 | Bacteria | 4001 |
| 193 | Ga0070664_100051636 | 3300005564 | Bacteria | 3481 |
| 194 | Ga0070664_100081876 | 3300005564 | Bacteria | 2782 |
| 195 | Ga0070664_100195387 | 3300005564 | Bacteria | 1803 |
| 196 | Ga0068857_100001367 | 3300005577 | Bacteria | 19219 |
| 197 | Ga0068857_100045914 | 3300005577 | Bacteria | 3876 |
| 198 | Ga0068857_100469934 | 3300005577 | Bacteria | 1178 |
| 199 | Ga0068854_100008084 | 3300005578 | Bacteria | 6746 |
| 200 | Ga0068854_100093052 | 3300005578 | Bacteria | 2246 |
| 201 | Ga0068854_100231763 | 3300005578 | Bacteria | 1466 |
| 202 | Ga0068856_100019461 | 3300005614 | Bacteria | 6589 |
| 203 | Ga0068856_100190462 | 3300005614 | Bacteria | 2065 |
| 204 | Ga0068856_100367005 | 3300005614 | Bacteria | 1458 |
| 205 | Ga0070702_100104818 | 3300005615 | Bacteria | 1741 |
| 206 | Ga0068852_100008019 | 3300005616 | Bacteria | 7746 |
| 207 | Ga0068852_100011640 | 3300005616 | Bacteria | 6635 |
| 208 | Ga0068852_100048307 | 3300005616 | Bacteria | 3635 |
| 209 | Ga0068852_100073257 | 3300005616 | Bacteria | 3012 |
| 210 | Ga0068852_100177745 | 3300005616 | Bacteria | 1999 |
| 211 | Ga0068852_100187534 | 3300005616 | Bacteria | 1949 |
| 212 | Ga0068852_100279862 | 3300005616 | Bacteria | 1608 |
| 213 | Ga0068852_100437440 | 3300005616 | Bacteria | 1292 |
| 214 | Ga0068852_100581796 | 3300005616 | Bacteria | 1122 |
| 215 | Ga0068859_100003371 | 3300005617 | Bacteria | 16241 |
| 216 | Ga0068859_100035640 | 3300005617 | Bacteria | 4993 |
| 217 | Ga0068859_100233270 | 3300005617 | Bacteria | 1929 |
| 218 | Ga0068859_100384114 | 3300005617 | Bacteria | 1500 |
| 219 | Ga0068864_100001559 | 3300005618 | Bacteria | 18876 |
| 220 | Ga0068864_100012414 | 3300005618 | Bacteria | 7045 |
| 221 | Ga0068864_100031702 | 3300005618 | Bacteria | 4486 |
| 222 | Ga0068864_100037258 | 3300005618 | Bacteria | 4150 |
| 223 | Ga0068864_100049747 | 3300005618 | Bacteria | 3607 |
| 224 | Ga0068864_100097230 | 3300005618 | Bacteria | 2606 |
| 225 | Ga0068864_100137810 | 3300005618 | Bacteria | 2198 |
| 226 | Ga0068864_100155641 | 3300005618 | Bacteria | 2074 |
| 227 | Ga0068864_100521484 | 3300005618 | Bacteria | 1145 |
| 228 | Ga0068864_100562440 | 3300005618 | Bacteria | 1103 |
| 229 | Ga0068866_10002006 | 3300005718 | Bacteria | 8473 |
| 230 | Ga0068866_10017749 | 3300005718 | Bacteria | 3205 |
| 231 | Ga0068866_10072147 | 3300005718 | Bacteria | 1828 |
| 232 | Ga0068861_100000532 | 3300005719 | Bacteria | 22319 |
| 233 | Ga0068861_100013654 | 3300005719 | Bacteria | 5687 |
| 234 | Ga0068861_100084254 | 3300005719 | Bacteria | 2495 |
| 235 | Ga0068861_100261087 | 3300005719 | Bacteria | 1483 |
| 236 | Ga0068861_101255109 | 3300005719 | Bacteria | 719 |
| 237 | Ga0068851_10020913 | 3300005834 | Bacteria | 3173 |
| 238 | Ga0068851_10067896 | 3300005834 | Bacteria | 1840 |
| 239 | Ga0068851_10159697 | 3300005834 | Bacteria | 1237 |
| 240 | Ga0068851_10381614 | 3300005834 | Bacteria | 826 |
| 241 | Ga0068870_10007498 | 3300005840 | Bacteria | 4868 |
| 242 | Ga0068870_10061290 | 3300005840 | Bacteria | 2022 |
| 243 | Ga0068870_10602287 | 3300005840 | Bacteria | 747 |
| 244 | Ga0068870_10625302 | 3300005840 | Bacteria | 734 |
| 245 | Ga0068863_100004398 | 3300005841 | Bacteria | 13892 |
| 246 | Ga0068863_100021795 | 3300005841 | Bacteria | 6114 |
| 247 | Ga0068863_100154370 | 3300005841 | Bacteria | 2198 |
| 248 | Ga0068863_100170460 | 3300005841 | Bacteria | 2087 |
| 249 | Ga0068863_100234480 | 3300005841 | Bacteria | 1771 |
| 250 | Ga0068858_100002862 | 3300005842 | Bacteria | 17353 |
| 251 | Ga0068858_100005186 | 3300005842 | Bacteria | 12762 |
| 252 | Ga0068858_100134191 | 3300005842 | Bacteria | 2322 |
| 253 | Ga0068858_100365770 | 3300005842 | Bacteria | 1383 |
| 254 | Ga0068858_100750717 | 3300005842 | Bacteria | 951 |
| 255 | Ga0068860_100007631 | 3300005843 | Bacteria | 10824 |
| 256 | Ga0068860_100027719 | 3300005843 | Bacteria | 5455 |
| 257 | Ga0068860_100050579 | 3300005843 | Bacteria | 3955 |
| 258 | Ga0068860_100478826 | 3300005843 | Bacteria | 1241 |
| 259 | Ga0068860_100702461 | 3300005843 | Bacteria | 1021 |
| 260 | Ga0068862_100011630 | 3300005844 | Bacteria | 7262 |
| 261 | Ga0068862_100021891 | 3300005844 | Bacteria | 5346 |
| 262 | Ga0068862_100044354 | 3300005844 | Bacteria | 3793 |
| 263 | Ga0068862_100299030 | 3300005844 | Bacteria | 1480 |
| 264 | Ga0068862_100902779 | 3300005844 | Bacteria | 869 |
| 265 | Ga0075368_10004618 | 3300006042 | Bacteria | 4682 |
| 266 | Ga0075368_10044832 | 3300006042 | Bacteria | 1746 |
| 267 | Ga0075368_10060057 | 3300006042 | Bacteria | 1522 |
| 268 | Ga0075363_100023918 | 3300006048 | Bacteria | 3102 |
| 269 | Ga0075363_100128897 | 3300006048 | Bacteria | 1418 |
| 270 | Ga0075364_10243101 | 3300006051 | Bacteria | 1223 |
| 271 | Ga0075432_10076876 | 3300006058 | Bacteria | 1206 |
| 272 | Ga0070715_10175733 | 3300006163 | Bacteria | 1070 |
| 273 | Ga0075362_10016384 | 3300006177 | Bacteria | 3034 |
| 274 | Ga0075362_10051026 | 3300006177 | Bacteria | 1851 |
| 275 | Ga0075362_10061016 | 3300006177 | Bacteria | 1705 |
| 276 | Ga0075367_10003951 | 3300006178 | Bacteria | 7153 |
| 277 | Ga0075367_10055501 | 3300006178 | Bacteria | 2351 |
| 278 | Ga0075367_10107393 | 3300006178 | Bacteria | 1711 |
| 279 | Ga0075369_10013422 | 3300006186 | Bacteria | 3252 |
| 280 | Ga0075369_10091722 | 3300006186 | Bacteria | 1356 |
| 281 | Ga0075369_10097041 | 3300006186 | Bacteria | 1320 |
| 282 | Ga0075366_10001365 | 3300006195 | Bacteria | 12201 |
| 283 | Ga0075366_10001515 | 3300006195 | Bacteria | 11597 |
| 284 | Ga0075366_10002469 | 3300006195 | Bacteria | 9470 |
| 285 | Ga0075366_10044579 | 3300006195 | Bacteria | 2629 |
| 286 | Ga0075366_10056238 | 3300006195 | Bacteria | 2337 |
| 287 | Ga0075366_10074701 | 3300006195 | Bacteria | 2021 |
| 288 | Ga0075366_10083894 | 3300006195 | Bacteria | 1904 |
| 289 | Ga0075366_10111437 | 3300006195 | Bacteria | 1646 |
| 290 | Ga0075366_10133817 | 3300006195 | Bacteria | 1497 |
| 291 | Ga0075366_10149214 | 3300006195 | Bacteria | 1415 |
| 292 | Ga0075366_10187262 | 3300006195 | Bacteria | 1257 |
| 293 | Ga0075366_10194922 | 3300006195 | Bacteria | 1231 |
| 294 | Ga0075366_10222552 | 3300006195 | Bacteria | 1150 |
| 295 | Ga0075366_10317254 | 3300006195 | Bacteria | 954 |
| 296 | Ga0075366_10327403 | 3300006195 | Bacteria | 939 |
| 297 | Ga0097621_100014007 | 3300006237 | Bacteria | 5991 |
| 298 | Ga0097621_100044502 | 3300006237 | Bacteria | 3581 |
| 299 | Ga0097621_100321429 | 3300006237 | Bacteria | 1371 |
| 300 | Ga0097621_100352274 | 3300006237 | Bacteria | 1309 |
| 301 | Ga0075370_10003547 | 3300006353 | Bacteria | 7454 |
| 302 | Ga0075370_10003987 | 3300006353 | Bacteria | 7092 |
| 303 | Ga0075370_10005826 | 3300006353 | Bacteria | 6156 |
| 304 | Ga0075370_10116873 | 3300006353 | Bacteria | 1550 |
| 305 | Ga0075370_10170466 | 3300006353 | Bacteria | 1279 |
| 306 | Ga0075370_10281879 | 3300006353 | Bacteria | 987 |
| 307 | Ga0068871_100023551 | 3300006358 | Bacteria | 4765 |
| 308 | Ga0068871_100028476 | 3300006358 | Bacteria | 4379 |
| 309 | Ga0068871_100053309 | 3300006358 | Bacteria | 3277 |
| 310 | Ga0068871_100149108 | 3300006358 | Bacteria | 1993 |
| 311 | Ga0068871_100444250 | 3300006358 | Bacteria | 1161 |
| 312 | Ga0075430_100065902 | 3300006846 | Bacteria | 3042 |
| 313 | Ga0075433_10575585 | 3300006852 | Bacteria | 989 |
| 314 | Ga0075429_100229141 | 3300006880 | Bacteria | 1627 |
| 315 | Ga0075429_100949764 | 3300006880 | Bacteria | 752 |
| 316 | Ga0068865_100017684 | 3300006881 | Bacteria | 4589 |
| 317 | Ga0068865_100023045 | 3300006881 | Bacteria | 4071 |
| 318 | Ga0068865_100074788 | 3300006881 | Bacteria | 2414 |
| 319 | Ga0068865_100188060 | 3300006881 | Bacteria | 1595 |
| 320 | Ga0068865_100357524 | 3300006881 | Bacteria | 1185 |
| 321 | Ga0068865_100360153 | 3300006881 | Bacteria | 1181 |
| 322 | Ga0068865_100407493 | 3300006881 | Bacteria | 1115 |
| 323 | Ga0068865_100766538 | 3300006881 | Bacteria | 830 |
| 324 | Ga0097620_100003371 | 3300006931 | Bacteria | 16241 |
| 325 | Ga0097620_100035640 | 3300006931 | Bacteria | 4993 |
| 326 | Ga0097620_100233247 | 3300006931 | Bacteria | 1929 |
| 327 | Ga0097620_100384094 | 3300006931 | Bacteria | 1500 |
| 328 | Ga0099824_1044356 | 3300006942 | Bacteria | 965 |
| 329 | Ga0099823_1000478 | 3300006944 | Bacteria | 26702 |
| 330 | Ga0079104_1000073 | 3300006946 | Bacteria | 152269 |
| 331 | Ga0105240_10238988 | 3300009093 | Bacteria | 2107 |
| 332 | Ga0105240_10316716 | 3300009093 | Bacteria | 1779 |
| 333 | Ga0105240_10406912 | 3300009093 | Bacteria | 1531 |
| 334 | Ga0111539_11204405 | 3300009094 | Bacteria | 880 |
| 335 | Ga0111539_11424277 | 3300009094 | Bacteria | 804 |
| 336 | Ga0105245_10040028 | 3300009098 | Bacteria | 4173 |
| 337 | Ga0105245_10057446 | 3300009098 | Bacteria | 3500 |
| 338 | Ga0105245_10080074 | 3300009098 | Bacteria | 2984 |
| 339 | Ga0105247_10152680 | 3300009101 | Bacteria | 1523 |
| 340 | Ga0114129_10221541 | 3300009147 | Bacteria | 2552 |
| 341 | Ga0114129_10816605 | 3300009147 | Bacteria | 1188 |
| 342 | Ga0105243_10000525 | 3300009148 | Bacteria | 39020 |
| 343 | Ga0105243_10016853 | 3300009148 | Bacteria | 5523 |
| 344 | Ga0105243_10103056 | 3300009148 | Bacteria | 2372 |
| 345 | Ga0105243_10108081 | 3300009148 | Bacteria | 2321 |
| 346 | Ga0105243_10233869 | 3300009148 | Bacteria | 1632 |
| 347 | Ga0105243_10308096 | 3300009148 | Bacteria | 1438 |
| 348 | Ga0105243_10583100 | 3300009148 | Bacteria | 1074 |
| 349 | Ga0105241_10177180 | 3300009174 | Bacteria | 1765 |
| 350 | Ga0105241_10265770 | 3300009174 | Bacteria | 1459 |
| 351 | Ga0105241_10271203 | 3300009174 | Bacteria | 1446 |
| 352 | Ga0105241_11281576 | 3300009174 | Bacteria | 697 |
| 353 | Ga0105242_10201510 | 3300009176 | Bacteria | 1768 |
| 354 | Ga0105242_10227154 | 3300009176 | Bacteria | 1671 |
| 355 | Ga0105242_10402634 | 3300009176 | Bacteria | 1278 |
| 356 | Ga0105242_10954026 | 3300009176 | Bacteria | 862 |
| 357 | Ga0105248_10004278 | 3300009177 | Bacteria | 15797 |
| 358 | Ga0105248_10020342 | 3300009177 | Bacteria | 7353 |
| 359 | Ga0105248_10034541 | 3300009177 | Bacteria | 5655 |
| 360 | Ga0105248_10096649 | 3300009177 | Bacteria | 3327 |
| 361 | Ga0105248_10472538 | 3300009177 | Bacteria | 1413 |
| 362 | Ga0105248_10687688 | 3300009177 | Bacteria | 1154 |
| 363 | Ga0105237_10000293 | 3300009545 | Bacteria | 69295 |
| 364 | Ga0105237_10010430 | 3300009545 | Bacteria | 9881 |
| 365 | Ga0105237_10124824 | 3300009545 | Bacteria | 2569 |
| 366 | Ga0105237_10339544 | 3300009545 | Bacteria | 1507 |
| 367 | Ga0105238_10003562 | 3300009551 | Bacteria | 15522 |
| 368 | Ga0105238_10068232 | 3300009551 | Bacteria | 3557 |
| 369 | Ga0105238_10094092 | 3300009551 | Bacteria | 2984 |
| 370 | Ga0105249_10001432 | 3300009553 | Bacteria | 20917 |
| 371 | Ga0105249_10012730 | 3300009553 | Bacteria | 7414 |
| 372 | Ga0105249_10020599 | 3300009553 | Bacteria | 5896 |
| 373 | Ga0105249_10720438 | 3300009553 | Bacteria | 1059 |
| 374 | Ga0105239_10002857 | 3300010375 | Bacteria | 21611 |
| 375 | Ga0105239_10075916 | 3300010375 | Bacteria | 3696 |
| 376 | Ga0105239_10092418 | 3300010375 | Bacteria | 3340 |
| 377 | Ga0105246_10509203 | 3300011119 | Bacteria | 1024 |
| 378 | Ga0157327_1002776 | 3300012512 | Bacteria | 1238 |
| 379 | Ga0157326_1035709 | 3300012513 | Bacteria | 677 |
| 380 | Ga0157371_10075565 | 3300013102 | Bacteria | 2386 |
| 381 | Ga0157371_10107401 | 3300013102 | Bacteria | 1981 |
| 382 | Ga0157371_10235021 | 3300013102 | Bacteria | 1318 |
| 383 | Ga0157371_10277075 | 3300013102 | Bacteria | 1211 |
| 384 | Ga0157369_10097256 | 3300013105 | Bacteria | 3140 |
| 385 | Ga0157369_10097287 | 3300013105 | Bacteria | 3140 |
| 386 | Ga0157374_10012660 | 3300013296 | Bacteria | 7347 |
| 387 | Ga0157374_10023686 | 3300013296 | Bacteria | 5495 |
| 388 | Ga0157374_10023909 | 3300013296 | Bacteria | 5473 |
| 389 | Ga0157374_10139538 | 3300013296 | Bacteria | 2352 |
| 390 | Ga0157374_10802172 | 3300013296 | Bacteria | 957 |
| 391 | Ga0157374_10989530 | 3300013296 | Bacteria | 860 |
| 392 | Ga0157378_10002431 | 3300013297 | Bacteria | 16564 |
| 393 | Ga0157378_10058929 | 3300013297 | Bacteria | 3425 |
| 394 | Ga0157378_10071947 | 3300013297 | Bacteria | 3106 |
| 395 | Ga0157378_10102354 | 3300013297 | Bacteria | 2616 |
| 396 | Ga0157378_10225438 | 3300013297 | Bacteria | 1783 |
| 397 | Ga0157378_10352336 | 3300013297 | Bacteria | 1438 |
| 398 | Ga0157378_10554131 | 3300013297 | Bacteria | 1155 |
| 399 | Ga0163162_10001627 | 3300013306 | Bacteria | 21036 |
| 400 | Ga0163162_10019603 | 3300013306 | Bacteria | 6639 |
| 401 | Ga0163162_10244234 | 3300013306 | Bacteria | 1927 |
| 402 | Ga0157372_10030878 | 3300013307 | Bacteria | 5863 |
| 403 | Ga0157372_10201706 | 3300013307 | Bacteria | 2304 |
| 404 | Ga0157372_10321478 | 3300013307 | Bacteria | 1802 |
| 405 | Ga0157375_10008159 | 3300013308 | Bacteria | 9164 |
| 406 | Ga0157375_10016322 | 3300013308 | Bacteria | 6666 |
| 407 | Ga0157375_10056678 | 3300013308 | Bacteria | 3870 |
| 408 | Ga0157375_10063864 | 3300013308 | Bacteria | 3665 |
| 409 | Ga0157375_10066431 | 3300013308 | Bacteria | 3601 |
| 410 | Ga0157375_10126863 | 3300013308 | Bacteria | 2667 |
| 411 | Ga0157375_10191158 | 3300013308 | Bacteria | 2202 |
| 412 | Ga0157375_11167324 | 3300013308 | Bacteria | 902 |
| 413 | Ga0163163_10009402 | 3300014325 | Bacteria | 8727 |
| 414 | Ga0163163_10153059 | 3300014325 | Bacteria | 2349 |
| 415 | Ga0163163_10848203 | 3300014325 | Bacteria | 977 |
| 416 | Ga0157380_10006027 | 3300014326 | Bacteria | 8491 |
| 417 | Ga0157380_10006297 | 3300014326 | Bacteria | 8337 |
| 418 | Ga0157380_10028112 | 3300014326 | Bacteria | 4284 |
| 419 | Ga0157380_10203981 | 3300014326 | Bacteria | 1756 |
| 420 | Ga0157380_10221352 | 3300014326 | Bacteria | 1693 |
| 421 | Ga0157380_10509047 | 3300014326 | Bacteria | 1171 |
| 422 | Ga0157377_10000038 | 3300014745 | Bacteria | 113777 |
| 423 | Ga0157377_10000784 | 3300014745 | Bacteria | 13139 |
| 424 | Ga0157379_10001736 | 3300014968 | Bacteria | 18030 |
| 425 | Ga0157379_10002470 | 3300014968 | Bacteria | 15473 |
| 426 | Ga0157379_10015679 | 3300014968 | Bacteria | 6659 |
| 427 | Ga0157379_10018191 | 3300014968 | Bacteria | 6192 |
| 428 | Ga0157379_10038599 | 3300014968 | Bacteria | 4260 |
| 429 | Ga0157379_10047186 | 3300014968 | Bacteria | 3842 |
| 430 | Ga0157379_10055645 | 3300014968 | Bacteria | 3534 |
| 431 | Ga0157379_10263463 | 3300014968 | Bacteria | 1566 |
| 432 | Ga0157379_10318507 | 3300014968 | Bacteria | 1420 |
| 433 | Ga0157379_10339058 | 3300014968 | Bacteria | 1375 |
| 434 | Ga0157379_10539603 | 3300014968 | Bacteria | 1084 |
| 435 | Ga0157376_10023720 | 3300014969 | Bacteria | 4807 |
| 436 | Ga0157376_10061547 | 3300014969 | Bacteria | 3156 |
| 437 | Ga0157376_10092091 | 3300014969 | Bacteria | 2627 |
| 438 | Ga0157376_10179041 | 3300014969 | Bacteria | 1936 |
| 439 | Ga0157376_10360712 | 3300014969 | Bacteria | 1394 |
| 440 | Ga0182006_1121151 | 3300015261 | Bacteria | 908 |
| 441 | Ga0182007_10076658 | 3300015262 | Bacteria | 1096 |
| 442 | Ga0182005_1076329 | 3300015265 | Bacteria | 923 |
| 443 | Ga0163161_10005593 | 3300017792 | Bacteria | 8712 |
| 444 | Ga0163161_10043874 | 3300017792 | Bacteria | 3220 |
| 445 | Ga0163161_10113550 | 3300017792 | Bacteria | 2028 |
| 446 | Ga0213872_10000006 | 3300021361 | Bacteria | 249845 |
| 447 | Ga0213872_10000085 | 3300021361 | Bacteria | 85496 |
| 448 | Ga0213872_10001073 | 3300021361 | Bacteria | 18880 |
| 449 | Ga0213872_10057925 | 3300021361 | Bacteria | 1754 |
| 450 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 451 | Ga0209672_104503 | 3300025228 | Bacteria | 2576 |
| 452 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 453 | Ga0209563_100044 | 3300025230 | Bacteria | 396812 |
| 454 | Ga0207427_100341 | 3300025231 | Bacteria | 30455 |
| 455 | Ga0209258_100515 | 3300025242 | Bacteria | 37293 |
| 456 | Ga0209258_100693 | 3300025242 | Bacteria | 23226 |
| 457 | Ga0207425_1000802 | 3300025245 | Bacteria | 15938 |
| 458 | Ga0207425_1018613 | 3300025245 | Bacteria | 1505 |
| 459 | Ga0209646_1000069 | 3300025246 | Bacteria | 230340 |
| 460 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 461 | Ga0209677_100077 | 3300025253 | Bacteria | 126245 |
| 462 | Ga0209677_101016 | 3300025253 | Bacteria | 13419 |
| 463 | Ga0209677_104838 | 3300025253 | Bacteria | 3716 |
| 464 | Ga0209759_1000189 | 3300025256 | Bacteria | 98732 |
| 465 | Ga0209759_1002556 | 3300025256 | Bacteria | 7893 |
| 466 | Ga0209759_1005450 | 3300025256 | Bacteria | 4455 |
| 467 | Ga0209759_1006592 | 3300025256 | Bacteria | 3877 |
| 468 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 469 | Ga0209565_1024949 | 3300025263 | Bacteria | 1212 |
| 470 | Ga0209455_1000597 | 3300025272 | Bacteria | 23218 |
| 471 | Ga0209673_1001736 | 3300025273 | Bacteria | 18320 |
| 472 | Ga0209673_1005928 | 3300025273 | Bacteria | 6031 |
| 473 | Ga0209673_1007378 | 3300025273 | Bacteria | 5086 |
| 474 | Ga0209673_1014115 | 3300025273 | Bacteria | 3109 |
| 475 | Ga0207673_1020590 | 3300025290 | Bacteria | 890 |
| 476 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 477 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 478 | Ga0209758_1000099 | 3300025297 | Bacteria | 230054 |
| 479 | Ga0209758_1000234 | 3300025297 | Bacteria | 116217 |
| 480 | Ga0209050_1000691 | 3300025298 | Bacteria | 50632 |
| 481 | Ga0209050_1002840 | 3300025298 | Bacteria | 13744 |
| 482 | Ga0209050_1012415 | 3300025298 | Bacteria | 3908 |
| 483 | Ga0209050_1015253 | 3300025298 | Bacteria | 3243 |
| 484 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 485 | Ga0209256_1002027 | 3300025299 | Bacteria | 18044 |
| 486 | Ga0209256_1022129 | 3300025299 | Bacteria | 1933 |
| 487 | Ga0209051_1000068 | 3300025303 | Bacteria | 220063 |
| 488 | Ga0209051_1001546 | 3300025303 | Bacteria | 19061 |
| 489 | Ga0209051_1004282 | 3300025303 | Bacteria | 8877 |
| 490 | Ga0209051_1011828 | 3300025303 | Bacteria | 4272 |
| 491 | Ga0209051_1044190 | 3300025303 | Bacteria | 1554 |
| 492 | Ga0209257_1000033 | 3300025304 | Bacteria | 671006 |
| 493 | Ga0209257_1000146 | 3300025304 | Bacteria | 194261 |
| 494 | Ga0209257_1018570 | 3300025304 | Bacteria | 2667 |
| 495 | Ga0207697_10082007 | 3300025315 | Bacteria | 1359 |
| 496 | Ga0207656_10037754 | 3300025321 | Bacteria | 2034 |
| 497 | Ga0207656_10253131 | 3300025321 | Bacteria | 863 |
| 498 | Ga0207682_10002764 | 3300025893 | Bacteria | 7775 |
| 499 | Ga0207682_10006249 | 3300025893 | Bacteria | 4811 |
| 500 | Ga0207682_10022286 | 3300025893 | Bacteria | 2495 |
| 501 | Ga0207682_10057601 | 3300025893 | Bacteria | 1620 |
| 502 | Ga0207682_10069461 | 3300025893 | Bacteria | 1490 |
| 503 | Ga0207642_10007749 | 3300025899 | Bacteria | 3640 |
| 504 | Ga0207642_10030199 | 3300025899 | Bacteria | 2255 |
| 505 | Ga0207642_10032222 | 3300025899 | Bacteria | 2204 |
| 506 | Ga0207680_10013435 | 3300025903 | Bacteria | 4206 |
| 507 | Ga0207680_10064225 | 3300025903 | Bacteria | 2250 |
| 508 | Ga0207680_10548713 | 3300025903 | Bacteria | 825 |
| 509 | Ga0207645_10003679 | 3300025907 | Bacteria | 11565 |
| 510 | Ga0207645_10010823 | 3300025907 | Bacteria | 6252 |
| 511 | Ga0207645_10027395 | 3300025907 | Bacteria | 3680 |
| 512 | Ga0207645_10032784 | 3300025907 | Bacteria | 3339 |
| 513 | Ga0207645_10034580 | 3300025907 | Bacteria | 3247 |
| 514 | Ga0207645_10123856 | 3300025907 | Bacteria | 1679 |
| 515 | Ga0207645_10184706 | 3300025907 | Bacteria | 1368 |
| 516 | Ga0207645_10329518 | 3300025907 | Bacteria | 1019 |
| 517 | Ga0207645_10343404 | 3300025907 | Bacteria | 998 |
| 518 | Ga0207643_10009192 | 3300025908 | Bacteria | 5306 |
| 519 | Ga0207643_10106545 | 3300025908 | Bacteria | 1648 |
| 520 | Ga0207705_10031141 | 3300025909 | Bacteria | 3806 |
| 521 | Ga0207705_10074065 | 3300025909 | Bacteria | 2471 |
| 522 | Ga0207705_10100357 | 3300025909 | Bacteria | 2129 |
| 523 | Ga0207705_10158779 | 3300025909 | Bacteria | 1698 |
| 524 | Ga0207684_10002063 | 3300025910 | Bacteria | 20676 |
| 525 | Ga0207707_10117012 | 3300025912 | Bacteria | 2330 |
| 526 | Ga0207707_10137881 | 3300025912 | Bacteria | 2133 |
| 527 | Ga0207695_10054703 | 3300025913 | Bacteria | 4165 |
| 528 | Ga0207695_10110263 | 3300025913 | Bacteria | 2732 |
| 529 | Ga0207671_10002885 | 3300025914 | Bacteria | 17803 |
| 530 | Ga0207671_10056267 | 3300025914 | Bacteria | 2914 |
| 531 | Ga0207671_10289600 | 3300025914 | Bacteria | 1293 |
| 532 | Ga0207660_10018222 | 3300025917 | Bacteria | 4677 |
| 533 | Ga0207662_10010982 | 3300025918 | Bacteria | 5011 |
| 534 | Ga0207662_10051527 | 3300025918 | Bacteria | 2449 |
| 535 | Ga0207657_10119150 | 3300025919 | Bacteria | 2172 |
| 536 | Ga0207657_10165076 | 3300025919 | Bacteria | 1797 |
| 537 | Ga0207657_10213629 | 3300025919 | Bacteria | 1547 |
| 538 | Ga0207657_10326074 | 3300025919 | Bacteria | 1213 |
| 539 | Ga0207657_10331574 | 3300025919 | Bacteria | 1202 |
| 540 | Ga0207649_10001094 | 3300025920 | Bacteria | 16484 |
| 541 | Ga0207649_10051405 | 3300025920 | Bacteria | 2552 |
| 542 | Ga0207649_10312387 | 3300025920 | Bacteria | 1152 |
| 543 | Ga0207649_10384869 | 3300025920 | Bacteria | 1046 |
| 544 | Ga0207652_10013195 | 3300025921 | Bacteria | 6691 |
| 545 | Ga0207681_10015959 | 3300025923 | Bacteria | 4690 |
| 546 | Ga0207681_10028289 | 3300025923 | Bacteria | 3630 |
| 547 | Ga0207681_10096707 | 3300025923 | Bacteria | 2120 |
| 548 | Ga0207681_10126404 | 3300025923 | Bacteria | 1883 |
| 549 | Ga0207681_11176146 | 3300025923 | Bacteria | 644 |
| 550 | Ga0207694_10036898 | 3300025924 | Bacteria | 3751 |
| 551 | Ga0207694_10242241 | 3300025924 | Bacteria | 1474 |
| 552 | Ga0207694_10536374 | 3300025924 | Bacteria | 981 |
| 553 | Ga0207650_10001670 | 3300025925 | Bacteria | 15762 |
| 554 | Ga0207650_10003627 | 3300025925 | Bacteria | 10576 |
| 555 | Ga0207650_10005846 | 3300025925 | Bacteria | 8397 |
| 556 | Ga0207650_10064306 | 3300025925 | Bacteria | 2746 |
| 557 | Ga0207650_10195654 | 3300025925 | Bacteria | 1617 |
| 558 | Ga0207659_10002852 | 3300025926 | Bacteria | 10305 |
| 559 | Ga0207659_10008593 | 3300025926 | Bacteria | 6350 |
| 560 | Ga0207659_10055044 | 3300025926 | Bacteria | 2843 |
| 561 | Ga0207659_10115972 | 3300025926 | Bacteria | 2044 |
| 562 | Ga0207659_10238027 | 3300025926 | Bacteria | 1471 |
| 563 | Ga0207659_10457999 | 3300025926 | Bacteria | 1075 |
| 564 | Ga0207659_10580892 | 3300025926 | Bacteria | 954 |
| 565 | Ga0207687_10062753 | 3300025927 | Bacteria | 2629 |
| 566 | Ga0207687_10088022 | 3300025927 | Bacteria | 2258 |
| 567 | Ga0207687_10092521 | 3300025927 | Bacteria | 2208 |
| 568 | Ga0207687_10246672 | 3300025927 | Bacteria | 1418 |
| 569 | Ga0207644_10014014 | 3300025931 | Bacteria | 5358 |
| 570 | Ga0207644_10024985 | 3300025931 | Bacteria | 4104 |
| 571 | Ga0207644_10048053 | 3300025931 | Bacteria | 3048 |
| 572 | Ga0207644_10130504 | 3300025931 | Bacteria | 1923 |
| 573 | Ga0207644_10347617 | 3300025931 | Bacteria | 1203 |
| 574 | Ga0207644_10519550 | 3300025931 | Bacteria | 983 |
| 575 | Ga0207644_11059510 | 3300025931 | Bacteria | 681 |
| 576 | Ga0207690_10002003 | 3300025932 | Bacteria | 12479 |
| 577 | Ga0207690_10017625 | 3300025932 | Bacteria | 4366 |
| 578 | Ga0207690_10236024 | 3300025932 | Bacteria | 1406 |
| 579 | Ga0207690_10383752 | 3300025932 | Bacteria | 1117 |
| 580 | Ga0207690_10401396 | 3300025932 | Bacteria | 1093 |
| 581 | Ga0207690_11197902 | 3300025932 | Bacteria | 634 |
| 582 | Ga0207706_10003398 | 3300025933 | Bacteria | 15204 |
| 583 | Ga0207706_10003614 | 3300025933 | Bacteria | 14775 |
| 584 | Ga0207706_10057563 | 3300025933 | Bacteria | 3424 |
| 585 | Ga0207706_10105780 | 3300025933 | Bacteria | 2476 |
| 586 | Ga0207706_10185836 | 3300025933 | Bacteria | 1825 |
| 587 | Ga0207686_10160889 | 3300025934 | Bacteria | 1573 |
| 588 | Ga0207686_10262340 | 3300025934 | Bacteria | 1267 |
| 589 | Ga0207686_10328181 | 3300025934 | Bacteria | 1146 |
| 590 | Ga0207686_10342093 | 3300025934 | Bacteria | 1124 |
| 591 | Ga0207709_10001781 | 3300025935 | Bacteria | 14449 |
| 592 | Ga0207709_10006230 | 3300025935 | Bacteria | 6708 |
| 593 | Ga0207709_10339145 | 3300025935 | Bacteria | 1131 |
| 594 | Ga0207670_10280059 | 3300025936 | Bacteria | 1299 |
| 595 | Ga0207669_10007179 | 3300025937 | Bacteria | 5131 |
| 596 | Ga0207669_10066197 | 3300025937 | Bacteria | 2245 |
| 597 | Ga0207669_10205381 | 3300025937 | Bacteria | 1433 |
| 598 | Ga0207669_10420893 | 3300025937 | Bacteria | 1051 |
| 599 | Ga0207704_10000810 | 3300025938 | Bacteria | 13815 |
| 600 | Ga0207704_10026710 | 3300025938 | Bacteria | 3172 |
| 601 | Ga0207704_10031983 | 3300025938 | Bacteria | 2971 |
| 602 | Ga0207704_10035673 | 3300025938 | Bacteria | 2853 |
| 603 | Ga0207704_10313538 | 3300025938 | Bacteria | 1207 |
| 604 | Ga0207665_10101598 | 3300025939 | Bacteria | 2008 |
| 605 | Ga0207691_10002842 | 3300025940 | Bacteria | 16869 |
| 606 | Ga0207691_10003320 | 3300025940 | Bacteria | 15667 |
| 607 | Ga0207691_10012250 | 3300025940 | Bacteria | 8221 |
| 608 | Ga0207691_10031619 | 3300025940 | Bacteria | 4938 |
| 609 | Ga0207691_10037603 | 3300025940 | Bacteria | 4482 |
| 610 | Ga0207691_10087976 | 3300025940 | Bacteria | 2786 |
| 611 | Ga0207691_10128681 | 3300025940 | Bacteria | 2238 |
| 612 | Ga0207711_10024886 | 3300025941 | Bacteria | 5022 |
| 613 | Ga0207711_10033943 | 3300025941 | Bacteria | 4319 |
| 614 | Ga0207711_10046960 | 3300025941 | Bacteria | 3690 |
| 615 | Ga0207711_10058246 | 3300025941 | Bacteria | 3323 |
| 616 | Ga0207711_10067665 | 3300025941 | Bacteria | 3092 |
| 617 | Ga0207711_10261951 | 3300025941 | Bacteria | 1589 |
| 618 | Ga0207711_10645761 | 3300025941 | Bacteria | 987 |
| 619 | Ga0207689_10004129 | 3300025942 | Bacteria | 13196 |
| 620 | Ga0207689_10015115 | 3300025942 | Bacteria | 6544 |
| 621 | Ga0207689_10018115 | 3300025942 | Bacteria | 5947 |
| 622 | Ga0207689_10048816 | 3300025942 | Bacteria | 3492 |
| 623 | Ga0207689_10131531 | 3300025942 | Bacteria | 2059 |
| 624 | Ga0207689_10151649 | 3300025942 | Bacteria | 1911 |
| 625 | Ga0207661_10150790 | 3300025944 | Bacteria | 2009 |
| 626 | Ga0207661_10364047 | 3300025944 | Bacteria | 1306 |
| 627 | Ga0207679_10008499 | 3300025945 | Bacteria | 6542 |
| 628 | Ga0207679_10027429 | 3300025945 | Bacteria | 3938 |
| 629 | Ga0207679_10118822 | 3300025945 | Bacteria | 2100 |
| 630 | Ga0207679_10179239 | 3300025945 | Bacteria | 1751 |
| 631 | Ga0207679_10239298 | 3300025945 | Bacteria | 1537 |
| 632 | Ga0207679_10277212 | 3300025945 | Bacteria | 1437 |
| 633 | Ga0207679_10279880 | 3300025945 | Bacteria | 1430 |
| 634 | Ga0207679_10387234 | 3300025945 | Bacteria | 1227 |
| 635 | Ga0207679_10453038 | 3300025945 | Bacteria | 1138 |
| 636 | Ga0207667_10057801 | 3300025949 | Bacteria | 4070 |
| 637 | Ga0207667_10074299 | 3300025949 | Bacteria | 3531 |
| 638 | Ga0207667_10178337 | 3300025949 | Bacteria | 2182 |
| 639 | Ga0207667_10191020 | 3300025949 | Bacteria | 2101 |
| 640 | Ga0207667_10278911 | 3300025949 | Bacteria | 1708 |
| 641 | Ga0207667_10728589 | 3300025949 | Bacteria | 992 |
| 642 | Ga0207651_10012328 | 3300025960 | Bacteria | 4833 |
| 643 | Ga0207651_10018112 | 3300025960 | Bacteria | 4182 |
| 644 | Ga0207651_10035487 | 3300025960 | Bacteria | 3243 |
| 645 | Ga0207651_10184451 | 3300025960 | Bacteria | 1658 |
| 646 | Ga0207651_10186327 | 3300025960 | Bacteria | 1651 |
| 647 | Ga0207651_10589679 | 3300025960 | Bacteria | 970 |
| 648 | Ga0207712_10004226 | 3300025961 | Bacteria | 9060 |
| 649 | Ga0207712_10006036 | 3300025961 | Bacteria | 7641 |
| 650 | Ga0207712_10123761 | 3300025961 | Bacteria | 1961 |
| 651 | Ga0207712_10375602 | 3300025961 | Bacteria | 1188 |
| 652 | Ga0207668_10013659 | 3300025972 | Bacteria | 5009 |
| 653 | Ga0207668_10028650 | 3300025972 | Bacteria | 3644 |
| 654 | Ga0207668_10240814 | 3300025972 | Bacteria | 1463 |
| 655 | Ga0207668_10419226 | 3300025972 | Bacteria | 1136 |
| 656 | Ga0207640_10003992 | 3300025981 | Bacteria | 7969 |
| 657 | Ga0207640_10072562 | 3300025981 | Bacteria | 2323 |
| 658 | Ga0207640_10073987 | 3300025981 | Bacteria | 2304 |
| 659 | Ga0207640_10262206 | 3300025981 | Bacteria | 1347 |
| 660 | Ga0207658_10003042 | 3300025986 | Bacteria | 11987 |
| 661 | Ga0207658_10005459 | 3300025986 | Bacteria | 8722 |
| 662 | Ga0207658_10016705 | 3300025986 | Bacteria | 5051 |
| 663 | Ga0207658_10172763 | 3300025986 | Bacteria | 1782 |
| 664 | Ga0207658_10246403 | 3300025986 | Bacteria | 1516 |
| 665 | Ga0207658_10464734 | 3300025986 | Bacteria | 1122 |
| 666 | Ga0207658_10570336 | 3300025986 | Bacteria | 1014 |
| 667 | Ga0207658_10624764 | 3300025986 | Bacteria | 969 |
| 668 | Ga0207677_10035383 | 3300026023 | Bacteria | 3243 |
| 669 | Ga0207677_10053941 | 3300026023 | Bacteria | 2740 |
| 670 | Ga0207677_10093173 | 3300026023 | Bacteria | 2195 |
| 671 | Ga0207677_10105233 | 3300026023 | Bacteria | 2088 |
| 672 | Ga0207677_10305150 | 3300026023 | Bacteria | 1316 |
| 673 | Ga0207677_10393288 | 3300026023 | Bacteria | 1173 |
| 674 | Ga0207703_10007785 | 3300026035 | Bacteria | 8479 |
| 675 | Ga0207703_10020766 | 3300026035 | Bacteria | 5139 |
| 676 | Ga0207703_10037216 | 3300026035 | Bacteria | 3876 |
| 677 | Ga0207703_10118229 | 3300026035 | Bacteria | 2272 |
| 678 | Ga0207703_10127660 | 3300026035 | Bacteria | 2192 |
| 679 | Ga0207703_10298809 | 3300026035 | Bacteria | 1468 |
| 680 | Ga0207703_10369466 | 3300026035 | Bacteria | 1325 |
| 681 | Ga0207639_10060943 | 3300026041 | Bacteria | 2912 |
| 682 | Ga0207639_10240583 | 3300026041 | Bacteria | 1573 |
| 683 | Ga0207639_10284363 | 3300026041 | Bacteria | 1456 |
| 684 | Ga0207639_10308364 | 3300026041 | Bacteria | 1401 |
| 685 | Ga0207639_10718561 | 3300026041 | Bacteria | 928 |
| 686 | Ga0207639_10879865 | 3300026041 | Bacteria | 837 |
| 687 | Ga0207678_10004010 | 3300026067 | Bacteria | 13252 |
| 688 | Ga0207678_10048730 | 3300026067 | Bacteria | 3661 |
| 689 | Ga0207678_10101468 | 3300026067 | Bacteria | 2457 |
| 690 | Ga0207678_10166070 | 3300026067 | Bacteria | 1885 |
| 691 | Ga0207678_10188630 | 3300026067 | Bacteria | 1761 |
| 692 | Ga0207678_10381762 | 3300026067 | Bacteria | 1218 |
| 693 | Ga0207678_11358459 | 3300026067 | Bacteria | 628 |
| 694 | Ga0207708_10026826 | 3300026075 | Bacteria | 4361 |
| 695 | Ga0207708_10046076 | 3300026075 | Bacteria | 3322 |
| 696 | Ga0207708_10056463 | 3300026075 | Bacteria | 2995 |
| 697 | Ga0207702_10084197 | 3300026078 | Bacteria | 2768 |
| 698 | Ga0207702_10479534 | 3300026078 | Bacteria | 1210 |
| 699 | Ga0207702_10662444 | 3300026078 | Bacteria | 1027 |
| 700 | Ga0207641_10002465 | 3300026088 | Bacteria | 17092 |
| 701 | Ga0207641_10048522 | 3300026088 | Bacteria | 3583 |
| 702 | Ga0207641_10101777 | 3300026088 | Bacteria | 2532 |
| 703 | Ga0207641_10119819 | 3300026088 | Bacteria | 2346 |
| 704 | Ga0207641_10175133 | 3300026088 | Bacteria | 1961 |
| 705 | Ga0207641_10430282 | 3300026088 | Bacteria | 1272 |
| 706 | Ga0207641_10559951 | 3300026088 | Bacteria | 1115 |
| 707 | Ga0207641_10707034 | 3300026088 | Bacteria | 993 |
| 708 | Ga0207641_10740094 | 3300026088 | Bacteria | 970 |
| 709 | Ga0207648_10000118 | 3300026089 | Bacteria | 77144 |
| 710 | Ga0207648_10000842 | 3300026089 | Bacteria | 34576 |
| 711 | Ga0207648_10005129 | 3300026089 | Bacteria | 13267 |
| 712 | Ga0207648_10006969 | 3300026089 | Bacteria | 11186 |
| 713 | Ga0207648_10024991 | 3300026089 | Bacteria | 5325 |
| 714 | Ga0207648_10048224 | 3300026089 | Bacteria | 3730 |
| 715 | Ga0207648_10096211 | 3300026089 | Bacteria | 2591 |
| 716 | Ga0207648_10344581 | 3300026089 | Bacteria | 1342 |
| 717 | Ga0207648_10401067 | 3300026089 | Bacteria | 1243 |
| 718 | Ga0207676_10058884 | 3300026095 | Bacteria | 3032 |
| 719 | Ga0207676_10070932 | 3300026095 | Bacteria | 2795 |
| 720 | Ga0207676_10099637 | 3300026095 | Bacteria | 2405 |
| 721 | Ga0207676_10148246 | 3300026095 | Bacteria | 2017 |
| 722 | Ga0207676_10317590 | 3300026095 | Bacteria | 1428 |
| 723 | Ga0207676_10535952 | 3300026095 | Bacteria | 1116 |
| 724 | Ga0207674_10021612 | 3300026116 | Bacteria | 6927 |
| 725 | Ga0207674_10069067 | 3300026116 | Bacteria | 3554 |
| 726 | Ga0207674_10102519 | 3300026116 | Bacteria | 2842 |
| 727 | Ga0207674_10235918 | 3300026116 | Bacteria | 1777 |
| 728 | Ga0207674_10385128 | 3300026116 | Bacteria | 1356 |
| 729 | Ga0207675_100001529 | 3300026118 | Bacteria | 23189 |
| 730 | Ga0207675_100017659 | 3300026118 | Bacteria | 6655 |
| 731 | Ga0207675_100033361 | 3300026118 | Bacteria | 4797 |
| 732 | Ga0207675_100033388 | 3300026118 | Bacteria | 4795 |
| 733 | Ga0207675_100052353 | 3300026118 | Bacteria | 3809 |
| 734 | Ga0207675_100164655 | 3300026118 | Bacteria | 2117 |
| 735 | Ga0207675_100284304 | 3300026118 | Bacteria | 1608 |
| 736 | Ga0207675_100584014 | 3300026118 | Bacteria | 1119 |
| 737 | Ga0207675_101081565 | 3300026118 | Bacteria | 821 |
| 738 | Ga0207683_10044884 | 3300026121 | Bacteria | 3864 |
| 739 | Ga0207683_10087739 | 3300026121 | Bacteria | 2767 |
| 740 | Ga0207683_10098615 | 3300026121 | Bacteria | 2607 |
| 741 | Ga0207683_10112711 | 3300026121 | Bacteria | 2436 |
| 742 | Ga0207683_10152584 | 3300026121 | Bacteria | 2085 |
| 743 | Ga0207683_10304377 | 3300026121 | Bacteria | 1458 |
| 744 | Ga0207683_10405959 | 3300026121 | Bacteria | 1254 |
| 745 | Ga0207683_10634584 | 3300026121 | Bacteria | 989 |
| 746 | Ga0207698_10001763 | 3300026142 | Bacteria | 12625 |
| 747 | Ga0207698_10074135 | 3300026142 | Bacteria | 2713 |
| 748 | Ga0207698_10089371 | 3300026142 | Bacteria | 2515 |
| 749 | Ga0207698_10094822 | 3300026142 | Bacteria | 2455 |
| 750 | Ga0207698_10219326 | 3300026142 | Bacteria | 1717 |
| 751 | Ga0207698_10376661 | 3300026142 | Bacteria | 1349 |
| 752 | Ga0207698_10396163 | 3300026142 | Bacteria | 1318 |
| 753 | Ga0207698_10547501 | 3300026142 | Bacteria | 1133 |
| 754 | Ga0207698_11700686 | 3300026142 | Bacteria | 646 |
| 755 | Ga0209281_1000736 | 3300027111 | Bacteria | 32018 |
| 756 | Ga0209389_1020739 | 3300027296 | Bacteria | 5862 |
| 757 | Ga0209995_1005033 | 3300027471 | Bacteria | 2121 |
| 758 | Ga0209968_1001331 | 3300027526 | Bacteria | 3755 |
| 759 | Ga0209971_1008514 | 3300027682 | Bacteria | 2434 |
| 760 | Ga0209966_1000162 | 3300027695 | Bacteria | 28187 |
| 761 | Ga0209813_10005576 | 3300027866 | Bacteria | 3063 |
| 762 | Ga0209813_10181558 | 3300027866 | Bacteria | 770 |
| 763 | Ga0209974_10005095 | 3300027876 | Bacteria | 4638 |
| 764 | Ga0268266_10121172 | 3300028379 | Bacteria | 2328 |
| 765 | Ga0268266_10195518 | 3300028379 | Bacteria | 1848 |
| 766 | Ga0268266_10487036 | 3300028379 | Bacteria | 1176 |
| 767 | Ga0268265_10024537 | 3300028380 | Bacteria | 4267 |
| 768 | Ga0268265_10077830 | 3300028380 | Bacteria | 2606 |
| 769 | Ga0268265_10553223 | 3300028380 | Bacteria | 1093 |
| 770 | Ga0268265_10988912 | 3300028380 | Bacteria | 830 |
| 771 | Ga0268264_10000858 | 3300028381 | Bacteria | 32293 |
| 772 | Ga0268264_10040299 | 3300028381 | Bacteria | 3859 |
| 773 | Ga0268264_10043465 | 3300028381 | Bacteria | 3723 |
| 774 | Ga0268264_10245396 | 3300028381 | Bacteria | 1661 |
| 775 | Ga0268264_10514003 | 3300028381 | Bacteria | 1170 |
| 776 | Ga0268264_10856558 | 3300028381 | Bacteria | 910 |
| 777 | Ga0265336_10000013 | 3300028666 | Bacteria | 252156 |
| 778 | Ga0307517_10000131 | 3300028786 | Bacteria | 113233 |
| 779 | Ga0307517_10139515 | 3300028786 | Bacteria | 1708 |
| 780 | Ga0307517_10216895 | 3300028786 | Bacteria | 1169 |
| 781 | Ga0307517_10458448 | 3300028786 | Bacteria | 658 |
| 782 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 783 | Ga0307515_10000138 | 3300028794 | Bacteria | 173220 |
| 784 | Ga0307515_10000382 | 3300028794 | Bacteria | 107907 |
| 785 | Ga0307515_10001206 | 3300028794 | Bacteria | 59045 |
| 786 | Ga0307515_10003938 | 3300028794 | Bacteria | 30997 |
| 787 | Ga0307515_10030322 | 3300028794 | Bacteria | 9088 |
| 788 | Ga0307515_10049807 | 3300028794 | Bacteria | 6289 |
| 789 | Ga0307515_10065551 | 3300028794 | Bacteria | 5051 |
| 790 | Ga0307515_10207397 | 3300028794 | Bacteria | 1815 |
| 791 | Ga0307515_10250785 | 3300028794 | Bacteria | 1523 |
| 792 | Ga0307515_10368899 | 3300028794 | Bacteria | 1073 |
| 793 | Ga0265324_10000432 | 3300029957 | Bacteria | 29768 |
| 794 | Ga0307512_10037633 | 3300030522 | Bacteria | 4083 |
| 795 | Ga0307512_10056737 | 3300030522 | Bacteria | 3071 |
| 796 | Ga0307512_10057621 | 3300030522 | Bacteria | 3036 |
| 797 | Ga0307512_10222233 | 3300030522 | Bacteria | 985 |
| 798 | Ga0265328_10011442 | 3300031239 | Bacteria | 3543 |
| 799 | Ga0265328_10011544 | 3300031239 | Bacteria | 3526 |
| 800 | Ga0265331_10001252 | 3300031250 | Bacteria | 19038 |
| 801 | Ga0265327_10000042 | 3300031251 | Bacteria | 287487 |
| 802 | Ga0265327_10000174 | 3300031251 | Bacteria | 138922 |
| 803 | Ga0307513_10006637 | 3300031456 | Bacteria | 15105 |
| 804 | Ga0307513_10008888 | 3300031456 | Bacteria | 12776 |
| 805 | Ga0307513_10040500 | 3300031456 | Bacteria | 5150 |
| 806 | Ga0307513_10249003 | 3300031456 | Bacteria | 1575 |
| 807 | Ga0307513_10253042 | 3300031456 | Bacteria | 1557 |
| 808 | Ga0307513_10390773 | 3300031456 | Bacteria | 1128 |
| 809 | Ga0307509_10004119 | 3300031507 | Bacteria | 21260 |
| 810 | Ga0307509_10005021 | 3300031507 | Bacteria | 18658 |
| 811 | Ga0307509_10007961 | 3300031507 | Bacteria | 13668 |
| 812 | Ga0307509_10045866 | 3300031507 | Bacteria | 4709 |
| 813 | Ga0307509_10068229 | 3300031507 | Bacteria | 3722 |
| 814 | Ga0307509_10131019 | 3300031507 | Bacteria | 2463 |
| 815 | Ga0307509_10251599 | 3300031507 | Bacteria | 1550 |
| 816 | Ga0307509_10297350 | 3300031507 | Bacteria | 1365 |
| 817 | Ga0307408_100000037 | 3300031548 | Bacteria | 187096 |
| 818 | Ga0307408_100405031 | 3300031548 | Bacteria | 1172 |
| 819 | Ga0307508_10000727 | 3300031616 | Bacteria | 39082 |
| 820 | Ga0307508_10016265 | 3300031616 | Bacteria | 6770 |
| 821 | Ga0307508_10063507 | 3300031616 | Bacteria | 3258 |
| 822 | Ga0307508_10322762 | 3300031616 | Bacteria | 1136 |
| 823 | Ga0307508_10344109 | 3300031616 | Bacteria | 1082 |
| 824 | Ga0307508_10393564 | 3300031616 | Bacteria | 977 |
| 825 | Ga0307514_10000390 | 3300031649 | Bacteria | 99924 |
| 826 | Ga0307514_10002716 | 3300031649 | Bacteria | 17874 |
| 827 | Ga0307514_10065265 | 3300031649 | Bacteria | 2758 |
| 828 | Ga0307516_10000559 | 3300031730 | Bacteria | 50194 |
| 829 | Ga0307516_10001343 | 3300031730 | Bacteria | 34183 |
| 830 | Ga0307516_10006485 | 3300031730 | Bacteria | 13704 |
| 831 | Ga0307516_10335360 | 3300031730 | Bacteria | 1180 |
| 832 | Ga0307516_10475680 | 3300031730 | Bacteria | 904 |
| 833 | Ga0307405_10002935 | 3300031731 | Bacteria | 7692 |
| 834 | Ga0307405_10107459 | 3300031731 | Bacteria | 1884 |
| 835 | Ga0307405_10150554 | 3300031731 | Bacteria | 1635 |
| 836 | Ga0307405_10365846 | 3300031731 | Bacteria | 1118 |
| 837 | Ga0307413_10016247 | 3300031824 | Bacteria | 3839 |
| 838 | Ga0307413_11257263 | 3300031824 | Bacteria | 646 |
| 839 | Ga0307410_10028168 | 3300031852 | Bacteria | 3560 |
| 840 | Ga0307410_10174111 | 3300031852 | Bacteria | 1624 |
| 841 | Ga0307410_10249965 | 3300031852 | Bacteria | 1378 |
| 842 | Ga0307410_10308742 | 3300031852 | Bacteria | 1251 |
| 843 | Ga0307410_10368146 | 3300031852 | Bacteria | 1153 |
| 844 | Ga0307406_10178736 | 3300031901 | Bacteria | 1543 |
| 845 | Ga0307407_10347238 | 3300031903 | Bacteria | 1050 |
| 846 | Ga0307407_10489762 | 3300031903 | Bacteria | 899 |
| 847 | Ga0307412_10023995 | 3300031911 | Bacteria | 3761 |
| 848 | Ga0307412_10127635 | 3300031911 | Bacteria | 1842 |
| 849 | Ga0307409_100014831 | 3300031995 | Bacteria | 5087 |
| 850 | Ga0307409_100015029 | 3300031995 | Bacteria | 5063 |
| 851 | Ga0307409_100350884 | 3300031995 | Bacteria | 1392 |
| 852 | Ga0307416_100001622 | 3300032002 | Bacteria | 12383 |
| 853 | Ga0307416_100074296 | 3300032002 | Bacteria | 2839 |
| 854 | Ga0307416_100079922 | 3300032002 | Bacteria | 2758 |
| 855 | Ga0307416_100092016 | 3300032002 | Bacteria | 2607 |
| 856 | Ga0307416_100409062 | 3300032002 | Bacteria | 1397 |
| 857 | Ga0307416_100715878 | 3300032002 | Bacteria | 1091 |
| 858 | Ga0307416_100864899 | 3300032002 | Bacteria | 1003 |
| 859 | Ga0307416_101147545 | 3300032002 | Bacteria | 882 |
| 860 | Ga0307416_101977863 | 3300032002 | Bacteria | 686 |
| 861 | Ga0307414_10016912 | 3300032004 | Bacteria | 4450 |
| 862 | Ga0307414_10820959 | 3300032004 | Bacteria | 849 |
| 863 | Ga0307411_10000494 | 3300032005 | Bacteria | 13741 |
| 864 | Ga0307411_10027470 | 3300032005 | Bacteria | 3444 |
| 865 | Ga0307415_100002203 | 3300032126 | Bacteria | 9643 |
| 866 | Ga0307415_100034318 | 3300032126 | Bacteria | 3302 |
| 867 | Ga0307507_10029403 | 3300033179 | Bacteria | 5827 |
| 868 | Ga0307507_10151038 | 3300033179 | Bacteria | 1747 |
| 869 | Ga0307510_10007325 | 3300033180 | Bacteria | 13142 |
| 870 | Ga0307510_10047690 | 3300033180 | Bacteria | 4585 |
| 871 | Ga0307510_10178338 | 3300033180 | Bacteria | 1691 |
| 872 | Ga0373930_0040359 | 3300034816 | Bacteria | 992 |
| 873 | Ga0373959_0026677 | 3300034820 | Bacteria | 1143 |
| 874 | Ga0373959_0120729 | 3300034820 | Bacteria | 640 |
| 875 | Ga0373940_0034838 | 3300035088 | Bacteria | 1360 |
| 876 | Ga0373951_0029991 | 3300035091 | Bacteria | 1278 |
| 877 | Ga0373932_0114193 | 3300035112 | Bacteria | 893 |
| 878 | Ga0373936_0030416 | 3300035113 | Bacteria | 2129 |
| 879 | Ga0373936_0114062 | 3300035113 | Bacteria | 1150 |
| 880 | Ga0373939_0000130 | 3300035114 | Bacteria | 22040 |
| 881 | Ga0373939_0034204 | 3300035114 | Bacteria | 1490 |
| 882 | Ga0373939_0196592 | 3300035114 | Bacteria | 760 |
| 883 | Ga0373941_0171835 | 3300035115 | Bacteria | 808 |
| 884 | Ga0373945_0024452 | 3300035116 | Bacteria | 2093 |
| 885 | Ga0373945_0109486 | 3300035116 | Bacteria | 1089 |
| 886 | Ga0373954_0096475 | 3300035118 | Bacteria | 1424 |
| 887 | Ga0373960_0152422 | 3300035121 | Bacteria | 790 |
| 888 | Ga0373943_0031046 | 3300035170 | Bacteria | 2533 |
| 889 | Ga0373946_0132198 | 3300035171 | Bacteria | 1149 |
| 890 | Ga0373955_0026724 | 3300035172 | Bacteria | 2977 |
| 891 | Ga0373961_0016647 | 3300035241 | Bacteria | 1896 |
| 892 | Ga0373962_0083098 | 3300035242 | Bacteria | 975 |
| 893 | Ga0373924_0033543 | 3300035410 | Bacteria | 2073 |
| 894 | Ga0373931_0000077 | 3300035691 | Bacteria | 45225 |
| 895 | Ga0373931_0004391 | 3300035691 | Bacteria | 6440 |
| 896 | Ga0373931_0043713 | 3300035691 | Bacteria | 2360 |
| 897 | Ga0373931_0309889 | 3300035691 | Bacteria | 977 |
| 898 | Ga0373931_0645903 | 3300035691 | Bacteria | 695 |
| 899 | Ga0373937_0029553 | 3300036401 | Bacteria | 4964 |
| 900 | Ga0373937_0553807 | 3300036401 | Bacteria | 1092 |
| 901 | Ga0373925_0037784 | 3300037068 | Bacteria | 3566 |
| 902 | Ga0395900_0000879 | 3300037418 | Bacteria | 39414 |
| 903 | Ga0395900_0414590 | 3300037418 | Bacteria | 1309 |
| 904 | Ga0395898_0001863 | 3300037466 | Bacteria | 27013 |
| 905 | Ga0395905_0003332 | 3300037471 | Bacteria | 17241 |
| 906 | Ga0395905_0007069 | 3300037471 | Bacteria | 11222 |
| 907 | Ga0395905_0019367 | 3300037471 | Bacteria | 6451 |
| 908 | Ga0395905_0504915 | 3300037471 | Bacteria | 1109 |
| 909 | Ga0395901_0001781 | 3300038443 | Bacteria | 22224 |
| 910 | Ga0436361_0019641 | 3300039447 | Bacteria | 127735 |
| 911 | Ga0436361_0085209 | 3300039447 | Bacteria | 38016 |
| 912 | Ga0436361_0255611 | 3300039447 | Bacteria | 10944 |
| 913 | Ga0436361_0463922 | 3300039447 | Bacteria | 6537 |
| 914 | Ga0436361_1020604 | 3300039447 | Bacteria | 2364 |
| 915 | Ga0436361_1048578 | 3300039447 | Bacteria | 2558 |
| 916 | Ga0436361_1181151 | 3300039447 | Bacteria | 5390 |
| 917 | Ga0436363_0491953 | 3300039450 | Bacteria | 788 |
| 918 | Ga0436363_1399792 | 3300039450 | Bacteria | 2141 |
| 919 | Ga0451789_0465154 | 3300041443 | Bacteria | 2628 |
| 920 | Ga0451789_1272523 | 3300041443 | Bacteria | 1044 |
| 921 | Ga0451791_1347236 | 3300041451 | Bacteria | 860 |
| 922 | Ga0451797_1576900 | 3300041453 | Bacteria | 1055 |
| 923 | Ga0451798_0217509 | 3300041458 | Bacteria | 655 |
| 924 | Ga0451798_0867094 | 3300041458 | Bacteria | 1556 |
| 925 | Ga0451807_1959080 | 3300041486 | Bacteria | 1176 |
| 926 | Ga0451833_0958391 | 3300041491 | Bacteria | 919 |
| 927 | Ga0451839_0595639 | 3300041496 | Bacteria | 766 |
| 928 | Ga0451851_0070177 | 3300041507 | Bacteria | 668 |
| 929 | Ga0451843_1230032 | 3300041509 | Bacteria | 1584 |
| 930 | Ga0451853_0407793 | 3300041512 | Bacteria | 1592 |
| 931 | Ga0439431_0010770 | 3300041997 | Bacteria | 2081 |
| 932 | Ga0439433_0112376 | 3300041999 | Bacteria | 682 |
| 933 | Ga0439437_006821 | 3300042000 | Bacteria | 1268 |
| 934 | Ga0439441_037049 | 3300042001 | Bacteria | 966 |
| 935 | Ga0439449_0055644 | 3300042007 | Bacteria | 1461 |
| 936 | Ga0439449_0146662 | 3300042007 | Bacteria | 880 |
| 937 | Ga0439450_004588 | 3300042008 | Bacteria | 2371 |
| 938 | Ga0439457_042981 | 3300042014 | Bacteria | 1008 |
| 939 | Ga0450917_001065 | 3300042120 | Bacteria | 2015 |
| 940 | Ga0450888_000177 | 3300042126 | Bacteria | 5576 |
| 941 | Ga0450890_000922 | 3300042127 | Bacteria | 4247 |
| 942 | Ga0450891_000060 | 3300042129 | Bacteria | 8748 |
| 943 | Ga0450898_015057 | 3300042134 | Bacteria | 1307 |
| 944 | Ga0450899_013185 | 3300042135 | Bacteria | 932 |
| 945 | Ga0450903_013782 | 3300042138 | Bacteria | 1285 |
| 946 | Ga0450889_000922 | 3300042144 | Bacteria | 3132 |
| 947 | Ga0439435_0160003 | 3300042436 | Bacteria | 727 |
| 948 | Ga0439459_0010455 | 3300042438 | Bacteria | 1619 |
| 949 | Ga0439464_0015176 | 3300042439 | Bacteria | 2077 |
| 950 | Ga0450916_001089 | 3300042530 | Bacteria | 2648 |
| 951 | Ga0450918_000326 | 3300042531 | Bacteria | 10718 |
| 952 | Ga0450893_0010581 | 3300042532 | Bacteria | 1517 |
| 953 | Ga0450901_026210 | 3300042533 | Bacteria | 636 |
| 954 | Ga0451577_0001866 | 3300042876 | Bacteria | 26858 |
| 955 | Ga0451577_0032633 | 3300042876 | Bacteria | 4691 |
| 956 | Ga0451577_0127972 | 3300042876 | Bacteria | 2277 |
| 957 | Ga0466969_0000020 | 3300044656 | Bacteria | 101861 |
| 958 | Ga0466969_0101384 | 3300044656 | Bacteria | 1354 |
| 959 | Ga0466965_0000493 | 3300044683 | Bacteria | 14004 |
| 960 | Ga0466965_0011312 | 3300044683 | Bacteria | 4179 |
| 961 | Ga0466965_0038922 | 3300044683 | Bacteria | 2336 |
| 962 | Ga0466965_0109992 | 3300044683 | Bacteria | 1415 |
| 963 | Ga0466966_0001239 | 3300044684 | Bacteria | 16360 |
| 964 | Ga0466966_0011170 | 3300044684 | Bacteria | 5956 |
| 965 | Ga0466961_0013718 | 3300044693 | Bacteria | 5192 |
| 966 | Ga0466961_0037361 | 3300044693 | Bacteria | 3115 |
| 967 | Ga0466963_0039303 | 3300044694 | Bacteria | 3098 |
| 968 | Ga0466963_0077538 | 3300044694 | Bacteria | 2245 |
| 969 | Ga0466963_0101194 | 3300044694 | Bacteria | 1973 |
| 970 | Ga0466964_0000949 | 3300044706 | Bacteria | 9595 |
| 971 | Ga0466964_0014413 | 3300044706 | Bacteria | 3006 |
| 972 | Ga0466964_0062857 | 3300044706 | Bacteria | 1549 |
| 973 | Ga0453684_0042883 | 3300044712 | Bacteria | 6090 |
| 974 | Ga0453684_0066790 | 3300044712 | Bacteria | 4577 |
| 975 | Ga0453684_0410522 | 3300044712 | Bacteria | 1515 |
| 976 | Ga0453684_0591572 | 3300044712 | Bacteria | 1217 |
| 977 | Ga0453684_0687081 | 3300044712 | Bacteria | 1113 |
| 978 | Ga0453684_0875581 | 3300044712 | Bacteria | 963 |
| 979 | Ga0466971_0002813 | 3300044719 | Bacteria | 7367 |
| 980 | Ga0466971_0003163 | 3300044719 | Bacteria | 7020 |
| 981 | Ga0466971_0023819 | 3300044719 | Bacteria | 2728 |
| 982 | Ga0466968_0013862 | 3300044735 | Bacteria | 3175 |
| 983 | Ga0466970_0005378 | 3300044765 | Bacteria | 6352 |
| 984 | Ga0466970_0033153 | 3300044765 | Bacteria | 2730 |
| 985 | Ga0466970_0192540 | 3300044765 | Bacteria | 1133 |
| 986 | Ga0466957_0027220 | 3300044842 | Bacteria | 3396 |
| 987 | Ga0466957_0063458 | 3300044842 | Bacteria | 2271 |
| 988 | Ga0466957_0269486 | 3300044842 | Bacteria | 1136 |
| 989 | Ga0466959_0001531 | 3300045049 | Bacteria | 14217 |
| 990 | Ga0466959_0046516 | 3300045049 | Bacteria | 3192 |
| 991 | Ga0466959_0067872 | 3300045049 | Bacteria | 2584 |
| 992 | Ga0451576_0009077 | 3300045051 | Bacteria | 11576 |
| 993 | Ga0451576_0124243 | 3300045051 | Bacteria | 2688 |
| 994 | Ga0451576_0257121 | 3300045051 | Bacteria | 1825 |
| 995 | Ga0451576_0284685 | 3300045051 | Bacteria | 1728 |
| 996 | Ga0451576_0509554 | 3300045051 | Bacteria | 1264 |
| 997 | Ga0451576_0665852 | 3300045051 | Bacteria | 1094 |
| 998 | Ga0451576_1515972 | 3300045051 | Bacteria | 696 |
| 999 | Ga0466958_0041460 | 3300045836 | Bacteria | 2768 |
| 1000 | Ga0466958_0063036 | 3300045836 | Bacteria | 2260 |
| 1001 | Ga0466967_0025052 | 3300045976 | Bacteria | 4913 |
| 1002 | Ga0495592_0000746 | 3300046454 | Bacteria | 22679 |
| 1003 | Ga0495592_0215835 | 3300046454 | Bacteria | 1286 |
| 1004 | Ga0495592_0272189 | 3300046454 | Bacteria | 1111 |
| 1005 | Ga0495603_0078723 | 3300046455 | Bacteria | 1933 |
| 1006 | Ga0495590_0031730 | 3300046457 | Bacteria | 1848 |
| 1007 | Ga0495590_0141131 | 3300046457 | Bacteria | 869 |
| 1008 | Ga0495629_0166233 | 3300046459 | Bacteria | 1532 |
| 1009 | Ga0495638_0031475 | 3300046460 | Bacteria | 3410 |
| 1010 | Ga0495651_0106790 | 3300046462 | Bacteria | 2075 |
| 1011 | Ga0495653_0559191 | 3300046463 | Bacteria | 707 |
| 1012 | Ga0495650_0008561 | 3300046471 | Bacteria | 5947 |
| 1013 | Ga0495650_0029377 | 3300046471 | Bacteria | 2506 |
| 1014 | Ga0495580_0041734 | 3300046472 | Bacteria | 3271 |
| 1015 | Ga0495580_0626935 | 3300046472 | Bacteria | 709 |
| 1016 | Ga0495662_0395224 | 3300046476 | Bacteria | 679 |
| 1017 | Ga0495583_0000034 | 3300046506 | Bacteria | 246856 |
| 1018 | Ga0495583_0079676 | 3300046506 | Bacteria | 1425 |
| 1019 | Ga0495606_0006285 | 3300046507 | Bacteria | 11017 |
| 1020 | Ga0495606_0358723 | 3300046507 | Bacteria | 771 |
| 1021 | Ga0495608_0264507 | 3300046511 | Bacteria | 1070 |
| 1022 | Ga0495610_0024206 | 3300046512 | Bacteria | 3281 |
| 1023 | Ga0495610_0036866 | 3300046512 | Bacteria | 2495 |
| 1024 | Ga0495618_0406174 | 3300046514 | Bacteria | 832 |
| 1025 | Ga0495620_0259601 | 3300046515 | Bacteria | 662 |
| 1026 | Ga0495628_0163090 | 3300046516 | Bacteria | 1693 |
| 1027 | Ga0495630_0040768 | 3300046517 | Bacteria | 3470 |
| 1028 | Ga0495631_0098292 | 3300046518 | Bacteria | 1260 |
| 1029 | Ga0495632_0066020 | 3300046519 | Bacteria | 1746 |
| 1030 | Ga0495632_0095371 | 3300046519 | Bacteria | 1406 |
| 1031 | Ga0495643_0072167 | 3300046522 | Bacteria | 1811 |
| 1032 | Ga0495644_0192133 | 3300046523 | Bacteria | 786 |
| 1033 | Ga0495648_0055873 | 3300046524 | Bacteria | 2378 |
| 1034 | Ga0495648_0064351 | 3300046524 | Bacteria | 2161 |
| 1035 | Ga0495648_0122432 | 3300046524 | Bacteria | 1396 |
| 1036 | Ga0495663_0077585 | 3300046525 | Bacteria | 1066 |
| 1037 | Ga0495640_0292472 | 3300046533 | Bacteria | 1013 |
| 1038 | Ga0495586_0120873 | 3300046535 | Bacteria | 1463 |
| 1039 | Ga0495598_0018950 | 3300046537 | Bacteria | 1796 |
| 1040 | Ga0495609_0167602 | 3300046538 | Bacteria | 929 |
| 1041 | Ga0495621_0021135 | 3300046539 | Bacteria | 2142 |
| 1042 | Ga0495621_0279558 | 3300046539 | Bacteria | 687 |
| 1043 | Ga0495621_0285045 | 3300046539 | Bacteria | 681 |
| 1044 | Ga0495597_0017935 | 3300046542 | Bacteria | 3324 |
| 1045 | Ga0495667_0174150 | 3300046559 | Bacteria | 1382 |
| 1046 | Ga0495656_0129509 | 3300046615 | Bacteria | 1200 |
| 1047 | Ga0495668_0021789 | 3300046616 | Bacteria | 3668 |
| 1048 | Ga0495668_0294669 | 3300046616 | Bacteria | 889 |
| 1049 | Ga0495625_0006159 | 3300046660 | Bacteria | 10745 |
| 1050 | Ga0495625_0020810 | 3300046660 | Bacteria | 5058 |
| 1051 | Ga0495635_0101360 | 3300046663 | Bacteria | 1968 |
| 1052 | Ga0495646_0040454 | 3300046680 | Bacteria | 2871 |
| 1053 | Ga0495646_0157199 | 3300046680 | Bacteria | 1261 |
| 1054 | Ga0495647_0245915 | 3300046681 | Bacteria | 795 |
| 1055 | Ga0495658_0204009 | 3300046683 | Bacteria | 1233 |
| 1056 | Ga0495669_0026759 | 3300046684 | Bacteria | 2521 |
| 1057 | Ga0495669_0317274 | 3300046684 | Bacteria | 752 |
| 1058 | Ga0495613_0152544 | 3300046689 | Bacteria | 1647 |
| 1059 | Ga0495670_0060761 | 3300046691 | Bacteria | 1899 |
| 1060 | Ga0495670_0129903 | 3300046691 | Bacteria | 1313 |
| 1061 | Ga0495671_0097137 | 3300046692 | Bacteria | 1441 |
| 1062 | Ga0495671_0106988 | 3300046692 | Bacteria | 1366 |
| 1063 | Ga0495649_0000728 | 3300046694 | Bacteria | 26762 |
| 1064 | Ga0495649_0029913 | 3300046694 | Bacteria | 3009 |
| 1065 | Ga0495660_0015408 | 3300046810 | Bacteria | 4416 |
| 1066 | Ga0495660_0079409 | 3300046810 | Bacteria | 1723 |
| 1067 | Ga0495674_0289346 | 3300047319 | Bacteria | 1340 |
| 1068 | Ga0495680_0111095 | 3300047322 | Bacteria | 2031 |
| 1069 | Ga0495687_000248 | 3300047443 | Bacteria | 72947 |
| 1070 | Ga0495687_018539 | 3300047443 | Bacteria | 3438 |
| 1071 | Ga0495673_0183303 | 3300047469 | Bacteria | 792 |
| 1072 | Ga0495681_0172549 | 3300047470 | Bacteria | 894 |
| 1073 | Ga0495686_0000739 | 3300047472 | Bacteria | 43610 |
| 1074 | Ga0495686_0039653 | 3300047472 | Bacteria | 3006 |
| 1075 | Ga0495686_0165775 | 3300047472 | Bacteria | 1288 |
| 1076 | Ga0495614_0217942 | 3300048089 | Bacteria | 867 |
| 1077 | Ga0495626_0073934 | 3300048091 | Bacteria | 1526 |
| 1078 | Ga0496100_0035391 | 3300048903 | Bacteria | 3140 |
| 1079 | Ga0496100_0103186 | 3300048903 | Bacteria | 1969 |
| 1080 | Ga0496100_0582321 | 3300048903 | Bacteria | 868 |
| 1081 | Ga0496100_0774405 | 3300048903 | Bacteria | 751 |
| 1082 | Ga0496100_1044664 | 3300048903 | Bacteria | 643 |
| 1083 | Ga0496101_0024303 | 3300048904 | Bacteria | 4193 |
| 1084 | Ga0496102_0006045 | 3300048905 | Bacteria | 10311 |
| 1085 | Ga0496102_0008100 | 3300048905 | Bacteria | 8990 |
| 1086 | Ga0496102_0095541 | 3300048905 | Bacteria | 2755 |
| 1087 | Ga0496103_0378788 | 3300048906 | Bacteria | 909 |
| 1088 | Ga0496104_0087183 | 3300048907 | Bacteria | 2981 |
| 1089 | Ga0496104_0123106 | 3300048907 | Bacteria | 2490 |
| 1090 | Ga0496104_0212089 | 3300048907 | Bacteria | 1848 |
| 1091 | Ga0496104_0994531 | 3300048907 | Bacteria | 743 |
| 1092 | Ga0496105_0218711 | 3300048908 | Bacteria | 1551 |
| 1093 | Ga0496105_0284964 | 3300048908 | Bacteria | 1331 |
| 1094 | Ga0496105_0388177 | 3300048908 | Bacteria | 1110 |
| 1095 | Ga0496106_0023565 | 3300048909 | Bacteria | 4572 |
| 1096 | Ga0496106_0027147 | 3300048909 | Bacteria | 4264 |
| 1097 | Ga0496107_0004099 | 3300048910 | Bacteria | 9815 |
| 1098 | Ga0496108_0112517 | 3300048911 | Bacteria | 2329 |
| 1099 | Ga0496108_0132616 | 3300048911 | Bacteria | 2141 |
| 1100 | Ga0496108_0133591 | 3300048911 | Bacteria | 2133 |
| 1101 | Ga0496109_0042557 | 3300048912 | Bacteria | 4115 |
| 1102 | Ga0496109_0143033 | 3300048912 | Bacteria | 2237 |
| 1103 | Ga0496109_0179034 | 3300048912 | Bacteria | 1991 |
| 1104 | Ga0496109_0195803 | 3300048912 | Bacteria | 1899 |
| 1105 | Ga0496109_0328802 | 3300048912 | Bacteria | 1443 |
| 1106 | Ga0496109_0337113 | 3300048912 | Bacteria | 1424 |
| 1107 | Ga0496110_0069048 | 3300048913 | Bacteria | 3128 |
| 1108 | Ga0496110_0394290 | 3300048913 | Bacteria | 1262 |
| 1109 | Ga0496111_0176869 | 3300048914 | Bacteria | 1586 |
| 1110 | Ga0496111_0477267 | 3300048914 | Bacteria | 919 |
| 1111 | Ga0496112_0061214 | 3300048915 | Bacteria | 3710 |
| 1112 | Ga0496112_0425437 | 3300048915 | Bacteria | 1266 |
| 1113 | Ga0496113_0013003 | 3300048916 | Bacteria | 5617 |
| 1114 | Ga0496113_0241481 | 3300048916 | Bacteria | 1441 |
| 1115 | Ga0496113_0398556 | 3300048916 | Bacteria | 1105 |
| 1116 | Ga0496114_0070435 | 3300048917 | Bacteria | 2937 |
| 1117 | Ga0496114_0599381 | 3300048917 | Bacteria | 971 |
| 1118 | Ga0496121_0026182 | 3300048924 | Bacteria | 5506 |
| 1119 | Ga0496124_0000126 | 3300048927 | Bacteria | 159539 |
| 1120 | Ga0496124_0079515 | 3300048927 | Bacteria | 2700 |
| 1121 | Ga0496125_0003500 | 3300048928 | Bacteria | 18970 |
| 1122 | Ga0501298_011150 | 3300049521 | Bacteria | 1557 |
| 1123 | Ga0501300_009888 | 3300049523 | Bacteria | 1390 |
| 1124 | Ga0501043_0000009 | 3300049579 | Bacteria | 214823 |
| 1125 | Ga0501046_0000022 | 3300049580 | Bacteria | 215451 |
| 1126 | Ga0501047_0000021 | 3300049581 | Bacteria | 254841 |
| 1127 | Ga0501198_000019 | 3300049649 | Bacteria | 83282 |
| 1128 | Ga0501201_001792 | 3300049651 | Bacteria | 1989 |
| 1129 | Ga0501211_000655 | 3300049658 | Bacteria | 3485 |
| 1130 | Ga0501222_000059 | 3300049662 | Bacteria | 34949 |
| 1131 | Ga0501222_002805 | 3300049662 | Bacteria | 2412 |
| 1132 | Ga0501223_012519 | 3300049663 | Bacteria | 1695 |
| 1133 | Ga0501233_008494 | 3300049668 | Bacteria | 1981 |
| 1134 | Ga0501235_002288 | 3300049669 | Bacteria | 4120 |
| 1135 | Ga0501236_019964 | 3300049670 | Bacteria | 982 |
| 1136 | Ga0501249_007648 | 3300049679 | Bacteria | 2237 |
| 1137 | Ga0501253_020996 | 3300049683 | Bacteria | 1145 |
| 1138 | Ga0501253_060348 | 3300049683 | Bacteria | 816 |
| 1139 | Ga0501255_023119 | 3300049684 | Bacteria | 819 |
| 1140 | Ga0501221_004219 | 3300049704 | Bacteria | 2381 |
| 1141 | Ga0501229_000329 | 3300049706 | Bacteria | 5361 |
| 1142 | Ga0501232_007753 | 3300049757 | Bacteria | 1140 |
| 1143 | Ga0501262_001965 | 3300049759 | Bacteria | 2316 |
| 1144 | Ga0501263_040320 | 3300049760 | Bacteria | 685 |
| 1145 | Ga0501266_015299 | 3300049763 | Bacteria | 1012 |
| 1146 | Ga0501267_001228 | 3300049764 | Bacteria | 2158 |
| 1147 | Ga0501271_004112 | 3300049768 | Bacteria | 1368 |
| 1148 | Ga0501272_005415 | 3300049769 | Bacteria | 1342 |
| 1149 | Ga0501283_005530 | 3300049779 | Bacteria | 1741 |
| 1150 | Ga0501035_0304530 | 3300049822 | Bacteria | 1342 |
| 1151 | Ga0501044_0661707 | 3300049823 | Bacteria | 933 |
| 1152 | Ga0501045_0025044 | 3300049824 | Bacteria | 4287 |
| 1153 | nmdc:mga03683_287767_c1 | 3300050489 | Bacteria | 769 |
| 1154 | nmdc:mga03683_439_c1 | 3300050489 | Bacteria | 9088 |
| 1155 | nmdc:mga03683_5178_c1 | 3300050489 | Bacteria | 4384 |
| 1156 | nmdc:mga03n38_361453_c1 | 3300050490 | Bacteria | 792 |
| 1157 | nmdc:mga03n38_70060_c1 | 3300050490 | Bacteria | 1621 |
| 1158 | nmdc:mga03n38_86560_c1 | 3300050490 | Bacteria | 1483 |
| 1159 | nmdc:mga00v17_297159_c1 | 3300050491 | Bacteria | 1049 |
| 1160 | nmdc:mga0yw44_19242_c1 | 3300050492 | Bacteria | 3760 |
| 1161 | nmdc:mga0k408_118638_c1 | 3300050493 | Bacteria | 1566 |
| 1162 | nmdc:mga0k408_127486_c1 | 3300050493 | Bacteria | 1510 |
| 1163 | nmdc:mga0k408_12953_c1 | 3300050493 | Bacteria | 4566 |
| 1164 | nmdc:mga0k408_130339_c1 | 3300050493 | Bacteria | 1493 |
| 1165 | nmdc:mga0k408_146879_c1 | 3300050493 | Bacteria | 1404 |
| 1166 | nmdc:mga0k408_1705_c1 | 3300050493 | Bacteria | 11835 |
| 1167 | nmdc:mga0k408_173373_c1 | 3300050493 | Bacteria | 1286 |
| 1168 | nmdc:mga0k408_19355_c1 | 3300050493 | Bacteria | 3804 |
| 1169 | nmdc:mga0k408_212864_c1 | 3300050493 | Bacteria | 1154 |
| 1170 | nmdc:mga0k408_240212_c1 | 3300050493 | Bacteria | 1082 |
| 1171 | nmdc:mga0k408_259539_c1 | 3300050493 | Bacteria | 1038 |
| 1172 | nmdc:mga0k408_27836_c1 | 3300050493 | Bacteria | 3212 |
| 1173 | nmdc:mga0k408_376315_c1 | 3300050493 | Bacteria | 846 |
| 1174 | nmdc:mga0k408_406_c1 | 3300050493 | Bacteria | 23501 |
| 1175 | nmdc:mga0k408_41032_c1 | 3300050493 | Bacteria | 2664 |
| 1176 | nmdc:mga0k408_42240_c1 | 3300050493 | Bacteria | 2626 |
| 1177 | nmdc:mga0k408_527_c1 | 3300050493 | Bacteria | 11830 |
| 1178 | nmdc:mga0k408_54354_c1 | 3300050493 | Bacteria | 2320 |
| 1179 | nmdc:mga0k408_59264_c1 | 3300050493 | Bacteria | 2224 |
| 1180 | nmdc:mga0k408_85785_c1 | 3300050493 | Bacteria | 1848 |
| 1181 | nmdc:mga0k408_88156_c1 | 3300050493 | Bacteria | 1822 |
| 1182 | nmdc:mga06z11_11864_c1 | 3300050494 | Bacteria | 3771 |
| 1183 | nmdc:mga06z11_258805_c1 | 3300050494 | Bacteria | 1026 |
| 1184 | nmdc:mga06z11_57689_c1 | 3300050494 | Bacteria | 2012 |
| 1185 | nmdc:mga06z11_64211_c1 | 3300050494 | Bacteria | 1923 |
| 1186 | nmdc:mga06z11_76716_c1 | 3300050494 | Bacteria | 1782 |
| 1187 | nmdc:mga04h51_317948_c1 | 3300050495 | Bacteria | 638 |
| 1188 | nmdc:mga04h51_7612_c1 | 3300050495 | Bacteria | 2866 |
| 1189 | nmdc:mga07m45_10360_c1 | 3300050496 | Bacteria | 4867 |
| 1190 | nmdc:mga07m45_103654_c1 | 3300050496 | Bacteria | 1635 |
| 1191 | nmdc:mga07m45_10939_c1 | 3300050496 | Bacteria | 4754 |
| 1192 | nmdc:mga07m45_117_c1 | 3300050496 | Bacteria | 31533 |
| 1193 | nmdc:mga07m45_136154_c1 | 3300050496 | Bacteria | 1422 |
| 1194 | nmdc:mga07m45_1620_c1 | 3300050496 | Bacteria | 10359 |
| 1195 | nmdc:mga07m45_207586_c1 | 3300050496 | Bacteria | 1140 |
| 1196 | nmdc:mga07m45_30645_c1 | 3300050496 | Bacteria | 2980 |
| 1197 | nmdc:mga07m45_4614_c1 | 3300050496 | Bacteria | 6755 |
| 1198 | nmdc:mga07m45_5537_c1 | 3300050496 | Bacteria | 6298 |
| 1199 | nmdc:mga07m45_6725_c1 | 3300050496 | Bacteria | 5835 |
| 1200 | nmdc:mga05p37_109740_c1 | 3300050507 | Bacteria | 3394 |
| 1201 | nmdc:mga09592_53741_c1 | 3300050508 | Bacteria | 3402 |
| 1202 | nmdc:mga0qj67_360672_c1 | 3300050509 | Bacteria | 1174 |
| 1203 | nmdc:mga0qj67_76608_c1 | 3300050509 | Bacteria | 2675 |
| 1204 | nmdc:mga08y16_1178426_c1 | 3300050511 | Bacteria | 738 |
| 1205 | nmdc:mga0sz30_17453_c1 | 3300050516 | Bacteria | 2863 |
| 1206 | nmdc:mga0sz30_191152_c1 | 3300050516 | Bacteria | 909 |
| 1207 | nmdc:mga0sz30_69443_c1 | 3300050516 | Bacteria | 1515 |
| 1208 | Ga0495601_0019457 | 3300053077 | Bacteria | 4140 |
| 1209 | Ga0500635_0000011 | 3300053080 | Bacteria | 144219 |
| 1210 | Ga0495619_0143834 | 3300053085 | Bacteria | 1643 |
| 1211 | Ga0500578_0000673 | 3300053086 | Bacteria | 40901 |
| 1212 | Ga0500578_0174805 | 3300053086 | Bacteria | 1326 |
| 1213 | Ga0500578_0554643 | 3300053086 | Bacteria | 638 |
| 1214 | Ga0500643_032481 | 3300053087 | Bacteria | 1585 |
| 1215 | Ga0500644_0018787 | 3300053088 | Bacteria | 2031 |
| 1216 | Ga0500646_0014486 | 3300053090 | Bacteria | 2047 |
| 1217 | Ga0500583_0054394 | 3300053092 | Bacteria | 1869 |
| 1218 | Ga0500651_0051962 | 3300053093 | Bacteria | 2570 |
| 1219 | Ga0500651_0229625 | 3300053093 | Bacteria | 1086 |
| 1220 | Ga0500648_346063 | 3300053097 | Bacteria | 611 |
| 1221 | Ga0500650_0046653 | 3300053098 | Bacteria | 2007 |
| 1222 | Ga0500555_030106 | 3300053103 | Bacteria | 1541 |
| 1223 | Ga0500562_026334 | 3300053108 | Bacteria | 1524 |
| 1224 | Ga0500562_037530 | 3300053108 | Bacteria | 1286 |
| 1225 | Ga0500569_007978 | 3300053109 | Bacteria | 2403 |
| 1226 | Ga0500593_000680 | 3300053117 | Bacteria | 12914 |
| 1227 | Ga0500594_0000470 | 3300053118 | Bacteria | 8860 |
| 1228 | Ga0500595_073612 | 3300053119 | Bacteria | 1010 |
| 1229 | Ga0500607_118133 | 3300053121 | Bacteria | 1288 |
| 1230 | Ga0500608_246768 | 3300053122 | Bacteria | 700 |
| 1231 | Ga0500623_072496 | 3300053127 | Bacteria | 1666 |
| 1232 | Ga0500628_018338 | 3300053129 | Bacteria | 1378 |
| 1233 | Ga0500628_075548 | 3300053129 | Bacteria | 853 |
| 1234 | Ga0500652_000123 | 3300053131 | Bacteria | 29418 |
| 1235 | Ga0500652_208186 | 3300053131 | Bacteria | 791 |
| 1236 | Ga0500655_004744 | 3300053133 | Bacteria | 2445 |
| 1237 | Ga0500655_017284 | 3300053133 | Bacteria | 1333 |
| 1238 | Ga0500658_0044915 | 3300053134 | Bacteria | 1784 |
| 1239 | Ga0500658_0237260 | 3300053134 | Bacteria | 837 |
| 1240 | Ga0500559_0000407 | 3300053136 | Bacteria | 30942 |
| 1241 | Ga0500559_0153931 | 3300053136 | Bacteria | 1079 |
| 1242 | Ga0500568_0112756 | 3300053139 | Bacteria | 1015 |
| 1243 | Ga0500577_0009622 | 3300053142 | Bacteria | 2813 |
| 1244 | Ga0500590_023408 | 3300053148 | Bacteria | 3207 |
| 1245 | Ga0500604_0007671 | 3300053151 | Bacteria | 2859 |
| 1246 | Ga0500619_000006 | 3300053154 | Bacteria | 77270 |
| 1247 | Ga0500622_0000799 | 3300053156 | Bacteria | 27135 |
| 1248 | Ga0500622_0006741 | 3300053156 | Bacteria | 6616 |
| 1249 | Ga0500622_0095912 | 3300053156 | Bacteria | 1466 |
| 1250 | Ga0500622_0097209 | 3300053156 | Bacteria | 1454 |
| 1251 | Ga0500636_0005079 | 3300053177 | Bacteria | 7470 |
| 1252 | Ga0500645_008009 | 3300053730 | Bacteria | 3640 |
| 1253 | Ga0500645_042335 | 3300053730 | Bacteria | 1344 |
| 1254 | Ga0500661_002023 | 3300055283 | Bacteria | 3827 |
| 1255 | Ga0590071_000174 | 3300059421 | Bacteria | 18568 |
| 1256 | Ga0466962_0004166 | 3300061719 | Bacteria | 6929 |
| 1257 | Ga0466962_0046420 | 3300061719 | Bacteria | 2075 |
| 1258 | Ga0501265_002920 | |||
| 1259 | JGI24740J21852_10004029 | |||
| 1260 | JGI24744J21845_10010959 | |||
| 1261 | JGI25156J39149_1001303 | |||
| 1262 | JGI25156J39149_1012545 | |||
| 1263 | JGI25154J39366_1000343 | |||
| 1264 | JGI25157J39369_1000304 | |||
| 1265 | JGI25152J39213_1000710 | |||
| 1266 | JGI25150J39212_1017649 | |||
| 1267 | JGI25153J46596_10004579 | |||
| 1268 | JGI25153J46596_10006328 | |||
| 1269 | rootH1_10000527 | |||
| 1270 | rootH1_10010629 | |||
| 1271 | rootH2_10057083 | |||
| 1272 | rootL2_10003309 | |||
| 1273 | rootL2_10004014 | |||
| 1274 | rootL2_10056084 | |||
| 1275 | rootH1_10000048 | |||
| 1276 | rootH1_10020306 | |||
| 1277 | rootH1_10021990 | |||
| 1278 | JGI26128J50194_1004871 | |||
| 1279 | Ga0055539_1002131 | |||
| 1280 | Ga0055539_1002241 | |||
| 1281 | Ga0055533_1000016 | |||
| 1282 | Ga0055525_1000031 | |||
| 1283 | Ga0055525_1000802 | |||
| 1284 | Ga0055529_1000963 | |||
| 1285 | Ga0055524_1000052 | |||
| 1286 | Ga0055524_1017112 | |||
| 1287 | Ga0055528_1051731 | |||
| 1288 | Ga0055530_10004973 | |||
| 1289 | Ga0055530_10008463 | |||
| 1290 | Ga0055540_1000123 | |||
| 1291 | Ga0055540_1011833 | |||
| 1292 | Ga0055531_10000001 | |||
| 1293 | Ga0055531_10011952 | |||
| 1294 | Ga0065165_1000836 | |||
| 1295 | Ga0065165_1003047 | |||
| 1296 | Ga0065707_10084569 | |||
| 1297 | Ga0070658_10216772 | |||
| 1298 | Ga0070658_10247639 | |||
| 1299 | Ga0070658_10775629 | |||
| 1300 | Ga0070676_10008317 | |||
| 1301 | Ga0070676_10010756 | |||
| 1302 | Ga0070676_10081103 | |||
| 1303 | Ga0070683_100231589 | |||
| 1304 | Ga0070683_100802241 | |||
| 1305 | Ga0070690_100017502 | |||
| 1306 | Ga0070690_100019706 | |||
| 1307 | Ga0070690_100484460 | |||
| 1308 | Ga0070670_100009305 | |||
| 1309 | Ga0070670_100009633 | |||
| 1310 | Ga0070670_100081596 | |||
| 1311 | Ga0070670_100290394 | |||
| 1312 | Ga0070670_100728717 | |||
| 1313 | Ga0070677_10007611 | |||
| 1314 | Ga0070677_10019703 | |||
| 1315 | Ga0070677_10045673 | |||
| 1316 | Ga0070677_10057710 | |||
| 1317 | Ga0070677_10061857 | |||
| 1318 | Ga0070677_10112427 | |||
| 1319 | Ga0068869_100007348 | |||
| 1320 | Ga0068869_100019197 | |||
| 1321 | Ga0068869_100029467 | |||
| 1322 | Ga0070666_10024212 | |||
| 1323 | Ga0070666_10259975 | |||
| 1324 | Ga0070680_100047155 | |||
| 1325 | Ga0068868_100007149 | |||
| 1326 | Ga0068868_100008040 | |||
| 1327 | Ga0068868_100078021 | |||
| 1328 | Ga0068868_100095120 | |||
| 1329 | Ga0068868_100148702 | |||
| 1330 | Ga0068868_100235186 | |||
| 1331 | Ga0068868_100359980 | |||
| 1332 | Ga0068868_100411011 | |||
| 1333 | Ga0070660_100165433 | |||
| 1334 | Ga0070660_100193201 | |||
| 1335 | Ga0070689_100037388 | |||
| 1336 | Ga0070689_100199233 | |||
| 1337 | Ga0070687_100086448 | |||
| 1338 | Ga0070661_100005819 | |||
| 1339 | Ga0070661_100089480 | |||
| 1340 | Ga0070661_100288126 | |||
| 1341 | Ga0070661_100300894 | |||
| 1342 | Ga0070668_100007635 | |||
| 1343 | Ga0070668_100068725 | |||
| 1344 | Ga0070668_100090366 | |||
| 1345 | Ga0070668_100364257 | |||
| 1346 | Ga0070669_100012068 | |||
| 1347 | Ga0070669_100031165 | |||
| 1348 | Ga0070669_100038839 | |||
| 1349 | Ga0070669_100152211 | |||
| 1350 | Ga0070669_100287569 | |||
| 1351 | Ga0070675_100002907 | |||
| 1352 | Ga0070675_100009944 | |||
| 1353 | Ga0070675_100054029 | |||
| 1354 | Ga0070675_100077116 | |||
| 1355 | Ga0070675_100135095 | |||
| 1356 | Ga0070675_100213751 | |||
| 1357 | Ga0070675_100913163 | |||
| 1358 | Ga0070671_100004848 | |||
| 1359 | Ga0070671_100009961 | |||
| 1360 | Ga0070671_100016969 | |||
| 1361 | Ga0070671_100023124 | |||
| 1362 | Ga0070671_100048071 | |||
| 1363 | Ga0070671_100064228 | |||
| 1364 | Ga0070671_100236517 | |||
| 1365 | Ga0070671_100490293 | |||
| 1366 | Ga0070674_100013025 | |||
| 1367 | Ga0070674_100017473 | |||
| 1368 | Ga0070674_100035720 | |||
| 1369 | Ga0070674_100123792 | |||
| 1370 | Ga0070674_100266210 | |||
| 1371 | Ga0070674_100372436 | |||
| 1372 | Ga0070674_100599488 | |||
| 1373 | Ga0070673_100019027 | |||
| 1374 | Ga0070673_100049839 | |||
| 1375 | Ga0070673_100058470 | |||
| 1376 | Ga0070673_100100373 | |||
| 1377 | Ga0070673_100175085 | |||
| 1378 | Ga0070673_100235304 | |||
| 1379 | Ga0070673_100304247 | |||
| 1380 | Ga0070673_100391149 | |||
| 1381 | Ga0070688_100391523 | |||
| 1382 | Ga0070659_100123684 | |||
| 1383 | Ga0070659_100391202 | |||
| 1384 | Ga0070667_100003174 | |||
| 1385 | Ga0070667_100004063 | |||
| 1386 | Ga0070667_100008844 | |||
| 1387 | Ga0070667_100065662 | |||
| 1388 | Ga0070667_100645831 | |||
| 1389 | Ga0070700_100091680 | |||
| 1390 | Ga0070700_100314714 | |||
| 1391 | Ga0070708_100063311 | |||
| 1392 | Ga0070663_100018301 | |||
| 1393 | Ga0070663_100371537 | |||
| 1394 | Ga0070678_100022312 | |||
| 1395 | Ga0070678_100073203 | |||
| 1396 | Ga0070678_100083403 | |||
| 1397 | Ga0070678_100108578 | |||
| 1398 | Ga0070678_100109497 | |||
| 1399 | Ga0070678_100144742 | |||
| 1400 | Ga0070678_100192744 | |||
| 1401 | Ga0070678_100295525 | |||
| 1402 | Ga0070662_100021790 | |||
| 1403 | Ga0070662_100036702 | |||
| 1404 | Ga0070662_100039945 | |||
| 1405 | Ga0070662_100105156 | |||
| 1406 | Ga0070662_100151308 | |||
| 1407 | Ga0070681_10176795 | |||
| 1408 | Ga0070681_10237670 | |||
| 1409 | Ga0068867_100000042 | |||
| 1410 | Ga0068867_100002881 | |||
| 1411 | Ga0068867_100005007 | |||
| 1412 | Ga0068867_100010032 | |||
| 1413 | Ga0068867_100027327 | |||
| 1414 | Ga0068867_100045630 | |||
| 1415 | Ga0068867_100078153 | |||
| 1416 | Ga0068867_100080494 | |||
| 1417 | Ga0068867_100171787 | |||
| 1418 | Ga0068867_100290688 | |||
| 1419 | Ga0070685_10191322 | |||
| 1420 | Ga0070706_100003166 | |||
| 1421 | Ga0070707_100072018 | |||
| 1422 | Ga0070707_100512976 | |||
| 1423 | Ga0070698_100072233 | |||
| 1424 | Ga0070679_100024208 | |||
| 1425 | Ga0070684_100556718 | |||
| 1426 | Ga0068853_100008284 | |||
| 1427 | Ga0068853_100144732 | |||
| 1428 | Ga0068853_100278576 | |||
| 1429 | Ga0068853_100294740 | |||
| 1430 | Ga0068853_100405931 | |||
| 1431 | Ga0068853_100407871 | |||
| 1432 | Ga0068853_100429041 | |||
| 1433 | Ga0070672_100000214 | |||
| 1434 | Ga0070672_100003206 | |||
| 1435 | Ga0070672_100012364 | |||
| 1436 | Ga0070672_100111789 | |||
| 1437 | Ga0070672_100132610 | |||
| 1438 | Ga0070672_100137980 | |||
| 1439 | Ga0070672_100286236 | |||
| 1440 | Ga0070672_100378726 | |||
| 1441 | Ga0070693_100446755 | |||
| 1442 | Ga0070665_100005964 | |||
| 1443 | Ga0070665_100158040 | |||
| 1444 | Ga0070665_100208289 | |||
| 1445 | Ga0070665_100326872 | |||
| 1446 | Ga0068855_100099856 | |||
| 1447 | Ga0068855_100203891 | |||
| 1448 | Ga0070664_100010180 | |||
| 1449 | Ga0070664_100038998 | |||
| 1450 | Ga0070664_100051636 | |||
| 1451 | Ga0070664_100081876 | |||
| 1452 | Ga0070664_100195387 | |||
| 1453 | Ga0068857_100001367 | |||
| 1454 | Ga0068857_100045914 | |||
| 1455 | Ga0068857_100469934 | |||
| 1456 | Ga0068854_100008084 | |||
| 1457 | Ga0068854_100093052 | |||
| 1458 | Ga0068854_100231763 | |||
| 1459 | Ga0068856_100019461 | |||
| 1460 | Ga0068856_100190462 | |||
| 1461 | Ga0068856_100367005 | |||
| 1462 | Ga0070702_100104818 | |||
| 1463 | Ga0068852_100008019 | |||
| 1464 | Ga0068852_100011640 | |||
| 1465 | Ga0068852_100048307 | |||
| 1466 | Ga0068852_100073257 | |||
| 1467 | Ga0068852_100177745 | |||
| 1468 | Ga0068852_100187534 | |||
| 1469 | Ga0068852_100279862 | |||
| 1470 | Ga0068852_100437440 | |||
| 1471 | Ga0068852_100581796 | |||
| 1472 | Ga0068859_100003371 | |||
| 1473 | Ga0068859_100035640 | |||
| 1474 | Ga0068859_100233270 | |||
| 1475 | Ga0068859_100384114 | |||
| 1476 | Ga0068864_100001559 | |||
| 1477 | Ga0068864_100012414 | |||
| 1478 | Ga0068864_100031702 | |||
| 1479 | Ga0068864_100037258 | |||
| 1480 | Ga0068864_100049747 | |||
| 1481 | Ga0068864_100097230 | |||
| 1482 | Ga0068864_100137810 | |||
| 1483 | Ga0068864_100155641 | |||
| 1484 | Ga0068864_100521484 | |||
| 1485 | Ga0068864_100562440 | |||
| 1486 | Ga0068866_10002006 | |||
| 1487 | Ga0068866_10017749 | |||
| 1488 | Ga0068866_10072147 | |||
| 1489 | Ga0068861_100000532 | |||
| 1490 | Ga0068861_100013654 | |||
| 1491 | Ga0068861_100084254 | |||
| 1492 | Ga0068861_100261087 | |||
| 1493 | Ga0068861_101255109 | |||
| 1494 | Ga0068851_10020913 | |||
| 1495 | Ga0068851_10067896 | |||
| 1496 | Ga0068851_10159697 | |||
| 1497 | Ga0068851_10381614 | |||
| 1498 | Ga0068870_10007498 | |||
| 1499 | Ga0068870_10061290 | |||
| 1500 | Ga0068870_10602287 | |||
| 1501 | Ga0068870_10625302 | |||
| 1502 | Ga0068863_100004398 | |||
| 1503 | Ga0068863_100021795 | |||
| 1504 | Ga0068863_100154370 | |||
| 1505 | Ga0068863_100170460 | |||
| 1506 | Ga0068863_100234480 | |||
| 1507 | Ga0068858_100002862 | |||
| 1508 | Ga0068858_100005186 | |||
| 1509 | Ga0068858_100134191 | |||
| 1510 | Ga0068858_100365770 | |||
| 1511 | Ga0068858_100750717 | |||
| 1512 | Ga0068860_100007631 | |||
| 1513 | Ga0068860_100027719 | |||
| 1514 | Ga0068860_100050579 | |||
| 1515 | Ga0068860_100478826 | |||
| 1516 | Ga0068860_100702461 | |||
| 1517 | Ga0068862_100011630 | |||
| 1518 | Ga0068862_100021891 | |||
| 1519 | Ga0068862_100044354 | |||
| 1520 | Ga0068862_100299030 | |||
| 1521 | Ga0068862_100902779 | |||
| 1522 | Ga0075368_10004618 | |||
| 1523 | Ga0075368_10044832 | |||
| 1524 | Ga0075368_10060057 | |||
| 1525 | Ga0075363_100023918 | |||
| 1526 | Ga0075363_100128897 | |||
| 1527 | Ga0075364_10243101 | |||
| 1528 | Ga0075432_10076876 | |||
| 1529 | Ga0070715_10175733 | |||
| 1530 | Ga0075362_10016384 | |||
| 1531 | Ga0075362_10051026 | |||
| 1532 | Ga0075362_10061016 | |||
| 1533 | Ga0075367_10003951 | |||
| 1534 | Ga0075367_10055501 | |||
| 1535 | Ga0075367_10107393 | |||
| 1536 | Ga0075369_10013422 | |||
| 1537 | Ga0075369_10091722 | |||
| 1538 | Ga0075369_10097041 | |||
| 1539 | Ga0075366_10001365 | |||
| 1540 | Ga0075366_10001515 | |||
| 1541 | Ga0075366_10002469 | |||
| 1542 | Ga0075366_10044579 | |||
| 1543 | Ga0075366_10056238 | |||
| 1544 | Ga0075366_10074701 | |||
| 1545 | Ga0075366_10083894 | |||
| 1546 | Ga0075366_10111437 | |||
| 1547 | Ga0075366_10133817 | |||
| 1548 | Ga0075366_10149214 | |||
| 1549 | Ga0075366_10187262 | |||
| 1550 | Ga0075366_10194922 | |||
| 1551 | Ga0075366_10222552 | |||
| 1552 | Ga0075366_10317254 | |||
| 1553 | Ga0075366_10327403 | |||
| 1554 | Ga0097621_100014007 | |||
| 1555 | Ga0097621_100044502 | |||
| 1556 | Ga0097621_100321429 | |||
| 1557 | Ga0097621_100352274 | |||
| 1558 | Ga0075370_10003547 | |||
| 1559 | Ga0075370_10003987 | |||
| 1560 | Ga0075370_10005826 | |||
| 1561 | Ga0075370_10116873 | |||
| 1562 | Ga0075370_10170466 | |||
| 1563 | Ga0075370_10281879 | |||
| 1564 | Ga0068871_100023551 | |||
| 1565 | Ga0068871_100028476 | |||
| 1566 | Ga0068871_100053309 | |||
| 1567 | Ga0068871_100149108 | |||
| 1568 | Ga0068871_100444250 | |||
| 1569 | Ga0075430_100065902 | |||
| 1570 | Ga0075433_10575585 | |||
| 1571 | Ga0075429_100229141 | |||
| 1572 | Ga0075429_100949764 | |||
| 1573 | Ga0068865_100017684 | |||
| 1574 | Ga0068865_100023045 | |||
| 1575 | Ga0068865_100074788 | |||
| 1576 | Ga0068865_100188060 | |||
| 1577 | Ga0068865_100357524 | |||
| 1578 | Ga0068865_100360153 | |||
| 1579 | Ga0068865_100407493 | |||
| 1580 | Ga0068865_100766538 | |||
| 1581 | Ga0097620_100003371 | |||
| 1582 | Ga0097620_100035640 | |||
| 1583 | Ga0097620_100233247 | |||
| 1584 | Ga0097620_100384094 | |||
| 1585 | Ga0099824_1044356 | |||
| 1586 | Ga0099823_1000478 | |||
| 1587 | Ga0079104_1000073 | |||
| 1588 | Ga0105240_10238988 | |||
| 1589 | Ga0105240_10316716 | |||
| 1590 | Ga0105240_10406912 | |||
| 1591 | Ga0111539_11204405 | |||
| 1592 | Ga0111539_11424277 | |||
| 1593 | Ga0105245_10040028 | |||
| 1594 | Ga0105245_10057446 | |||
| 1595 | Ga0105245_10080074 | |||
| 1596 | Ga0105247_10152680 | |||
| 1597 | Ga0114129_10221541 | |||
| 1598 | Ga0114129_10816605 | |||
| 1599 | Ga0105243_10000525 | |||
| 1600 | Ga0105243_10016853 | |||
| 1601 | Ga0105243_10103056 | |||
| 1602 | Ga0105243_10108081 | |||
| 1603 | Ga0105243_10233869 | |||
| 1604 | Ga0105243_10308096 | |||
| 1605 | Ga0105243_10583100 | |||
| 1606 | Ga0105241_10177180 | |||
| 1607 | Ga0105241_10265770 | |||
| 1608 | Ga0105241_10271203 | |||
| 1609 | Ga0105241_11281576 | |||
| 1610 | Ga0105242_10201510 | |||
| 1611 | Ga0105242_10227154 | |||
| 1612 | Ga0105242_10402634 | |||
| 1613 | Ga0105242_10954026 | |||
| 1614 | Ga0105248_10004278 | |||
| 1615 | Ga0105248_10020342 | |||
| 1616 | Ga0105248_10034541 | |||
| 1617 | Ga0105248_10096649 | |||
| 1618 | Ga0105248_10472538 | |||
| 1619 | Ga0105248_10687688 | |||
| 1620 | Ga0105237_10000293 | |||
| 1621 | Ga0105237_10010430 | |||
| 1622 | Ga0105237_10124824 | |||
| 1623 | Ga0105237_10339544 | |||
| 1624 | Ga0105238_10003562 | |||
| 1625 | Ga0105238_10068232 | |||
| 1626 | Ga0105238_10094092 | |||
| 1627 | Ga0105249_10001432 | |||
| 1628 | Ga0105249_10012730 | |||
| 1629 | Ga0105249_10020599 | |||
| 1630 | Ga0105249_10720438 | |||
| 1631 | Ga0105239_10002857 | |||
| 1632 | Ga0105239_10075916 | |||
| 1633 | Ga0105239_10092418 | |||
| 1634 | Ga0105246_10509203 | |||
| 1635 | Ga0157327_1002776 | |||
| 1636 | Ga0157326_1035709 | |||
| 1637 | Ga0157371_10075565 | |||
| 1638 | Ga0157371_10107401 | |||
| 1639 | Ga0157371_10235021 | |||
| 1640 | Ga0157371_10277075 | |||
| 1641 | Ga0157369_10097256 | |||
| 1642 | Ga0157369_10097287 | |||
| 1643 | Ga0157374_10012660 | |||
| 1644 | Ga0157374_10023686 | |||
| 1645 | Ga0157374_10023909 | |||
| 1646 | Ga0157374_10139538 | |||
| 1647 | Ga0157374_10802172 | |||
| 1648 | Ga0157374_10989530 | |||
| 1649 | Ga0157378_10002431 | |||
| 1650 | Ga0157378_10058929 | |||
| 1651 | Ga0157378_10071947 | |||
| 1652 | Ga0157378_10102354 | |||
| 1653 | Ga0157378_10225438 | |||
| 1654 | Ga0157378_10352336 | |||
| 1655 | Ga0157378_10554131 | |||
| 1656 | Ga0163162_10001627 | |||
| 1657 | Ga0163162_10019603 | |||
| 1658 | Ga0163162_10244234 | |||
| 1659 | Ga0157372_10030878 | |||
| 1660 | Ga0157372_10201706 | |||
| 1661 | Ga0157372_10321478 | |||
| 1662 | Ga0157375_10008159 | |||
| 1663 | Ga0157375_10016322 | |||
| 1664 | Ga0157375_10056678 | |||
| 1665 | Ga0157375_10063864 | |||
| 1666 | Ga0157375_10066431 | |||
| 1667 | Ga0157375_10126863 | |||
| 1668 | Ga0157375_10191158 | |||
| 1669 | Ga0157375_11167324 | |||
| 1670 | Ga0163163_10009402 | |||
| 1671 | Ga0163163_10153059 | |||
| 1672 | Ga0163163_10848203 | |||
| 1673 | Ga0157380_10006027 | |||
| 1674 | Ga0157380_10006297 | |||
| 1675 | Ga0157380_10028112 | |||
| 1676 | Ga0157380_10203981 | |||
| 1677 | Ga0157380_10221352 | |||
| 1678 | Ga0157380_10509047 | |||
| 1679 | Ga0157377_10000038 | |||
| 1680 | Ga0157377_10000784 | |||
| 1681 | Ga0157379_10001736 | |||
| 1682 | Ga0157379_10002470 | |||
| 1683 | Ga0157379_10015679 | |||
| 1684 | Ga0157379_10018191 | |||
| 1685 | Ga0157379_10038599 | |||
| 1686 | Ga0157379_10047186 | |||
| 1687 | Ga0157379_10055645 | |||
| 1688 | Ga0157379_10263463 | |||
| 1689 | Ga0157379_10318507 | |||
| 1690 | Ga0157379_10339058 | |||
| 1691 | Ga0157379_10539603 | |||
| 1692 | Ga0157376_10023720 | |||
| 1693 | Ga0157376_10061547 | |||
| 1694 | Ga0157376_10092091 | |||
| 1695 | Ga0157376_10179041 | |||
| 1696 | Ga0157376_10360712 | |||
| 1697 | Ga0182006_1121151 | |||
| 1698 | Ga0182007_10076658 | |||
| 1699 | Ga0182005_1076329 | |||
| 1700 | Ga0163161_10005593 | |||
| 1701 | Ga0163161_10043874 | |||
| 1702 | Ga0163161_10113550 | |||
| 1703 | Ga0213872_10000006 | |||
| 1704 | Ga0213872_10000085 | |||
| 1705 | Ga0213872_10001073 | |||
| 1706 | Ga0213872_10057925 | |||
| 1707 | Ga0209674_100041 | |||
| 1708 | Ga0209672_104503 | |||
| 1709 | Ga0209563_100043 | |||
| 1710 | Ga0209563_100044 | |||
| 1711 | Ga0207427_100341 | |||
| 1712 | Ga0209258_100515 | |||
| 1713 | Ga0209258_100693 | |||
| 1714 | Ga0207425_1000802 | |||
| 1715 | Ga0207425_1018613 | |||
| 1716 | Ga0209646_1000069 | |||
| 1717 | Ga0209026_1000006 | |||
| 1718 | Ga0209677_100077 | |||
| 1719 | Ga0209677_101016 | |||
| 1720 | Ga0209677_104838 | |||
| 1721 | Ga0209759_1000189 | |||
| 1722 | Ga0209759_1002556 | |||
| 1723 | Ga0209759_1005450 | |||
| 1724 | Ga0209759_1006592 | |||
| 1725 | Ga0209129_1000012 | |||
| 1726 | Ga0209565_1024949 | |||
| 1727 | Ga0209455_1000597 | |||
| 1728 | Ga0209673_1001736 | |||
| 1729 | Ga0209673_1005928 | |||
| 1730 | Ga0209673_1007378 | |||
| 1731 | Ga0209673_1014115 | |||
| 1732 | Ga0207673_1020590 | |||
| 1733 | Ga0209564_1000008 | |||
| 1734 | Ga0209564_1000022 | |||
| 1735 | Ga0209758_1000099 | |||
| 1736 | Ga0209758_1000234 | |||
| 1737 | Ga0209050_1000691 | |||
| 1738 | Ga0209050_1002840 | |||
| 1739 | Ga0209050_1012415 | |||
| 1740 | Ga0209050_1015253 | |||
| 1741 | Ga0209256_1000036 | |||
| 1742 | Ga0209256_1002027 | |||
| 1743 | Ga0209256_1022129 | |||
| 1744 | Ga0209051_1000068 | |||
| 1745 | Ga0209051_1001546 | |||
| 1746 | Ga0209051_1004282 | |||
| 1747 | Ga0209051_1011828 | |||
| 1748 | Ga0209051_1044190 | |||
| 1749 | Ga0209257_1000033 | |||
| 1750 | Ga0209257_1000146 | |||
| 1751 | Ga0209257_1018570 | |||
| 1752 | Ga0207697_10082007 | |||
| 1753 | Ga0207656_10037754 | |||
| 1754 | Ga0207656_10253131 | |||
| 1755 | Ga0207682_10002764 | |||
| 1756 | Ga0207682_10006249 | |||
| 1757 | Ga0207682_10022286 | |||
| 1758 | Ga0207682_10057601 | |||
| 1759 | Ga0207682_10069461 | |||
| 1760 | Ga0207642_10007749 | |||
| 1761 | Ga0207642_10030199 | |||
| 1762 | Ga0207642_10032222 | |||
| 1763 | Ga0207680_10013435 | |||
| 1764 | Ga0207680_10064225 | |||
| 1765 | Ga0207680_10548713 | |||
| 1766 | Ga0207645_10003679 | |||
| 1767 | Ga0207645_10010823 | |||
| 1768 | Ga0207645_10027395 | |||
| 1769 | Ga0207645_10032784 | |||
| 1770 | Ga0207645_10034580 | |||
| 1771 | Ga0207645_10123856 | |||
| 1772 | Ga0207645_10184706 | |||
| 1773 | Ga0207645_10329518 | |||
| 1774 | Ga0207645_10343404 | |||
| 1775 | Ga0207643_10009192 | |||
| 1776 | Ga0207643_10106545 | |||
| 1777 | Ga0207705_10031141 | |||
| 1778 | Ga0207705_10074065 | |||
| 1779 | Ga0207705_10100357 | |||
| 1780 | Ga0207705_10158779 | |||
| 1781 | Ga0207684_10002063 | |||
| 1782 | Ga0207707_10117012 | |||
| 1783 | Ga0207707_10137881 | |||
| 1784 | Ga0207695_10054703 | |||
| 1785 | Ga0207695_10110263 | |||
| 1786 | Ga0207671_10002885 | |||
| 1787 | Ga0207671_10056267 | |||
| 1788 | Ga0207671_10289600 | |||
| 1789 | Ga0207660_10018222 | |||
| 1790 | Ga0207662_10010982 | |||
| 1791 | Ga0207662_10051527 | |||
| 1792 | Ga0207657_10119150 | |||
| 1793 | Ga0207657_10165076 | |||
| 1794 | Ga0207657_10213629 | |||
| 1795 | Ga0207657_10326074 | |||
| 1796 | Ga0207657_10331574 | |||
| 1797 | Ga0207649_10001094 | |||
| 1798 | Ga0207649_10051405 | |||
| 1799 | Ga0207649_10312387 | |||
| 1800 | Ga0207649_10384869 | |||
| 1801 | Ga0207652_10013195 | |||
| 1802 | Ga0207681_10015959 | |||
| 1803 | Ga0207681_10028289 | |||
| 1804 | Ga0207681_10096707 | |||
| 1805 | Ga0207681_10126404 | |||
| 1806 | Ga0207681_11176146 | |||
| 1807 | Ga0207694_10036898 | |||
| 1808 | Ga0207694_10242241 | |||
| 1809 | Ga0207694_10536374 | |||
| 1810 | Ga0207650_10001670 | |||
| 1811 | Ga0207650_10003627 | |||
| 1812 | Ga0207650_10005846 | |||
| 1813 | Ga0207650_10064306 | |||
| 1814 | Ga0207650_10195654 | |||
| 1815 | Ga0207659_10002852 | |||
| 1816 | Ga0207659_10008593 | |||
| 1817 | Ga0207659_10055044 | |||
| 1818 | Ga0207659_10115972 | |||
| 1819 | Ga0207659_10238027 | |||
| 1820 | Ga0207659_10457999 | |||
| 1821 | Ga0207659_10580892 | |||
| 1822 | Ga0207687_10062753 | |||
| 1823 | Ga0207687_10088022 | |||
| 1824 | Ga0207687_10092521 | |||
| 1825 | Ga0207687_10246672 | |||
| 1826 | Ga0207644_10014014 | |||
| 1827 | Ga0207644_10024985 | |||
| 1828 | Ga0207644_10048053 | |||
| 1829 | Ga0207644_10130504 | |||
| 1830 | Ga0207644_10347617 | |||
| 1831 | Ga0207644_10519550 | |||
| 1832 | Ga0207644_11059510 | |||
| 1833 | Ga0207690_10002003 | |||
| 1834 | Ga0207690_10017625 | |||
| 1835 | Ga0207690_10236024 | |||
| 1836 | Ga0207690_10383752 | |||
| 1837 | Ga0207690_10401396 | |||
| 1838 | Ga0207690_11197902 | |||
| 1839 | Ga0207706_10003398 | |||
| 1840 | Ga0207706_10003614 | |||
| 1841 | Ga0207706_10057563 | |||
| 1842 | Ga0207706_10105780 | |||
| 1843 | Ga0207706_10185836 | |||
| 1844 | Ga0207686_10160889 | |||
| 1845 | Ga0207686_10262340 | |||
| 1846 | Ga0207686_10328181 | |||
| 1847 | Ga0207686_10342093 | |||
| 1848 | Ga0207709_10001781 | |||
| 1849 | Ga0207709_10006230 | |||
| 1850 | Ga0207709_10339145 | |||
| 1851 | Ga0207670_10280059 | |||
| 1852 | Ga0207669_10007179 | |||
| 1853 | Ga0207669_10066197 | |||
| 1854 | Ga0207669_10205381 | |||
| 1855 | Ga0207669_10420893 | |||
| 1856 | Ga0207704_10000810 | |||
| 1857 | Ga0207704_10026710 | |||
| 1858 | Ga0207704_10031983 | |||
| 1859 | Ga0207704_10035673 | |||
| 1860 | Ga0207704_10313538 | |||
| 1861 | Ga0207665_10101598 | |||
| 1862 | Ga0207691_10002842 | |||
| 1863 | Ga0207691_10003320 | |||
| 1864 | Ga0207691_10012250 | |||
| 1865 | Ga0207691_10031619 | |||
| 1866 | Ga0207691_10037603 | |||
| 1867 | Ga0207691_10087976 | |||
| 1868 | Ga0207691_10128681 | |||
| 1869 | Ga0207711_10024886 | |||
| 1870 | Ga0207711_10033943 | |||
| 1871 | Ga0207711_10046960 | |||
| 1872 | Ga0207711_10058246 | |||
| 1873 | Ga0207711_10067665 | |||
| 1874 | Ga0207711_10261951 | |||
| 1875 | Ga0207711_10645761 | |||
| 1876 | Ga0207689_10004129 | |||
| 1877 | Ga0207689_10015115 | |||
| 1878 | Ga0207689_10018115 | |||
| 1879 | Ga0207689_10048816 | |||
| 1880 | Ga0207689_10131531 | |||
| 1881 | Ga0207689_10151649 | |||
| 1882 | Ga0207661_10150790 | |||
| 1883 | Ga0207661_10364047 | |||
| 1884 | Ga0207679_10008499 | |||
| 1885 | Ga0207679_10027429 | |||
| 1886 | Ga0207679_10118822 | |||
| 1887 | Ga0207679_10179239 | |||
| 1888 | Ga0207679_10239298 | |||
| 1889 | Ga0207679_10277212 | |||
| 1890 | Ga0207679_10279880 | |||
| 1891 | Ga0207679_10387234 | |||
| 1892 | Ga0207679_10453038 | |||
| 1893 | Ga0207667_10057801 | |||
| 1894 | Ga0207667_10074299 | |||
| 1895 | Ga0207667_10178337 | |||
| 1896 | Ga0207667_10191020 | |||
| 1897 | Ga0207667_10278911 | |||
| 1898 | Ga0207667_10728589 | |||
| 1899 | Ga0207651_10012328 | |||
| 1900 | Ga0207651_10018112 | |||
| 1901 | Ga0207651_10035487 | |||
| 1902 | Ga0207651_10184451 | |||
| 1903 | Ga0207651_10186327 | |||
| 1904 | Ga0207651_10589679 | |||
| 1905 | Ga0207712_10004226 | |||
| 1906 | Ga0207712_10006036 | |||
| 1907 | Ga0207712_10123761 | |||
| 1908 | Ga0207712_10375602 | |||
| 1909 | Ga0207668_10013659 | |||
| 1910 | Ga0207668_10028650 | |||
| 1911 | Ga0207668_10240814 | |||
| 1912 | Ga0207668_10419226 | |||
| 1913 | Ga0207640_10003992 | |||
| 1914 | Ga0207640_10072562 | |||
| 1915 | Ga0207640_10073987 | |||
| 1916 | Ga0207640_10262206 | |||
| 1917 | Ga0207658_10003042 | |||
| 1918 | Ga0207658_10005459 | |||
| 1919 | Ga0207658_10016705 | |||
| 1920 | Ga0207658_10172763 | |||
| 1921 | Ga0207658_10246403 | |||
| 1922 | Ga0207658_10464734 | |||
| 1923 | Ga0207658_10570336 | |||
| 1924 | Ga0207658_10624764 | |||
| 1925 | Ga0207677_10035383 | |||
| 1926 | Ga0207677_10053941 | |||
| 1927 | Ga0207677_10093173 | |||
| 1928 | Ga0207677_10105233 | |||
| 1929 | Ga0207677_10305150 | |||
| 1930 | Ga0207677_10393288 | |||
| 1931 | Ga0207703_10007785 | |||
| 1932 | Ga0207703_10020766 | |||
| 1933 | Ga0207703_10037216 | |||
| 1934 | Ga0207703_10118229 | |||
| 1935 | Ga0207703_10127660 | |||
| 1936 | Ga0207703_10298809 | |||
| 1937 | Ga0207703_10369466 | |||
| 1938 | Ga0207639_10060943 | |||
| 1939 | Ga0207639_10240583 | |||
| 1940 | Ga0207639_10284363 | |||
| 1941 | Ga0207639_10308364 | |||
| 1942 | Ga0207639_10718561 | |||
| 1943 | Ga0207639_10879865 | |||
| 1944 | Ga0207678_10004010 | |||
| 1945 | Ga0207678_10048730 | |||
| 1946 | Ga0207678_10101468 | |||
| 1947 | Ga0207678_10166070 | |||
| 1948 | Ga0207678_10188630 | |||
| 1949 | Ga0207678_10381762 | |||
| 1950 | Ga0207678_11358459 | |||
| 1951 | Ga0207708_10026826 | |||
| 1952 | Ga0207708_10046076 | |||
| 1953 | Ga0207708_10056463 | |||
| 1954 | Ga0207702_10084197 | |||
| 1955 | Ga0207702_10479534 | |||
| 1956 | Ga0207702_10662444 | |||
| 1957 | Ga0207641_10002465 | |||
| 1958 | Ga0207641_10048522 | |||
| 1959 | Ga0207641_10101777 | |||
| 1960 | Ga0207641_10119819 | |||
| 1961 | Ga0207641_10175133 | |||
| 1962 | Ga0207641_10430282 | |||
| 1963 | Ga0207641_10559951 | |||
| 1964 | Ga0207641_10707034 | |||
| 1965 | Ga0207641_10740094 | |||
| 1966 | Ga0207648_10000118 | |||
| 1967 | Ga0207648_10000842 | |||
| 1968 | Ga0207648_10005129 | |||
| 1969 | Ga0207648_10006969 | |||
| 1970 | Ga0207648_10024991 | |||
| 1971 | Ga0207648_10048224 | |||
| 1972 | Ga0207648_10096211 | |||
| 1973 | Ga0207648_10344581 | |||
| 1974 | Ga0207648_10401067 | |||
| 1975 | Ga0207676_10058884 | |||
| 1976 | Ga0207676_10070932 | |||
| 1977 | Ga0207676_10099637 | |||
| 1978 | Ga0207676_10148246 | |||
| 1979 | Ga0207676_10317590 | |||
| 1980 | Ga0207676_10535952 | |||
| 1981 | Ga0207674_10021612 | |||
| 1982 | Ga0207674_10069067 | |||
| 1983 | Ga0207674_10102519 | |||
| 1984 | Ga0207674_10235918 | |||
| 1985 | Ga0207674_10385128 | |||
| 1986 | Ga0207675_100001529 | |||
| 1987 | Ga0207675_100017659 | |||
| 1988 | Ga0207675_100033361 | |||
| 1989 | Ga0207675_100033388 | |||
| 1990 | Ga0207675_100052353 | |||
| 1991 | Ga0207675_100164655 | |||
| 1992 | Ga0207675_100284304 | |||
| 1993 | Ga0207675_100584014 | |||
| 1994 | Ga0207675_101081565 | |||
| 1995 | Ga0207683_10044884 | |||
| 1996 | Ga0207683_10087739 | |||
| 1997 | Ga0207683_10098615 | |||
| 1998 | Ga0207683_10112711 | |||
| 1999 | Ga0207683_10152584 | |||
| 2000 | Ga0207683_10304377 | |||
| 2001 | Ga0207683_10405959 | |||
| 2002 | Ga0207683_10634584 | |||
| 2003 | Ga0207698_10001763 | |||
| 2004 | Ga0207698_10074135 | |||
| 2005 | Ga0207698_10089371 | |||
| 2006 | Ga0207698_10094822 | |||
| 2007 | Ga0207698_10219326 | |||
| 2008 | Ga0207698_10376661 | |||
| 2009 | Ga0207698_10396163 | |||
| 2010 | Ga0207698_10547501 | |||
| 2011 | Ga0207698_11700686 | |||
| 2012 | Ga0209281_1000736 | |||
| 2013 | Ga0209389_1020739 | |||
| 2014 | Ga0209995_1005033 | |||
| 2015 | Ga0209968_1001331 | |||
| 2016 | Ga0209971_1008514 | |||
| 2017 | Ga0209966_1000162 | |||
| 2018 | Ga0209813_10005576 | |||
| 2019 | Ga0209813_10181558 | |||
| 2020 | Ga0209974_10005095 | |||
| 2021 | Ga0268266_10121172 | |||
| 2022 | Ga0268266_10195518 | |||
| 2023 | Ga0268266_10487036 | |||
| 2024 | Ga0268265_10024537 | |||
| 2025 | Ga0268265_10077830 | |||
| 2026 | Ga0268265_10553223 | |||
| 2027 | Ga0268265_10988912 | |||
| 2028 | Ga0268264_10000858 | |||
| 2029 | Ga0268264_10040299 | |||
| 2030 | Ga0268264_10043465 | |||
| 2031 | Ga0268264_10245396 | |||
| 2032 | Ga0268264_10514003 | |||
| 2033 | Ga0268264_10856558 | |||
| 2034 | Ga0265336_10000013 | |||
| 2035 | Ga0307517_10000131 | |||
| 2036 | Ga0307517_10139515 | |||
| 2037 | Ga0307517_10216895 | |||
| 2038 | Ga0307517_10458448 | |||
| 2039 | Ga0307515_10000011 | |||
| 2040 | Ga0307515_10000138 | |||
| 2041 | Ga0307515_10000382 | |||
| 2042 | Ga0307515_10001206 | |||
| 2043 | Ga0307515_10003938 | |||
| 2044 | Ga0307515_10030322 | |||
| 2045 | Ga0307515_10049807 | |||
| 2046 | Ga0307515_10065551 | |||
| 2047 | Ga0307515_10207397 | |||
| 2048 | Ga0307515_10250785 | |||
| 2049 | Ga0307515_10368899 | |||
| 2050 | Ga0265324_10000432 | |||
| 2051 | Ga0307512_10037633 | |||
| 2052 | Ga0307512_10056737 | |||
| 2053 | Ga0307512_10057621 | |||
| 2054 | Ga0307512_10222233 | |||
| 2055 | Ga0265328_10011442 | |||
| 2056 | Ga0265328_10011544 | |||
| 2057 | Ga0265331_10001252 | |||
| 2058 | Ga0265327_10000042 | |||
| 2059 | Ga0265327_10000174 | |||
| 2060 | Ga0307513_10006637 | |||
| 2061 | Ga0307513_10008888 | |||
| 2062 | Ga0307513_10040500 | |||
| 2063 | Ga0307513_10249003 | |||
| 2064 | Ga0307513_10253042 | |||
| 2065 | Ga0307513_10390773 | |||
| 2066 | Ga0307509_10004119 | |||
| 2067 | Ga0307509_10005021 | |||
| 2068 | Ga0307509_10007961 | |||
| 2069 | Ga0307509_10045866 | |||
| 2070 | Ga0307509_10068229 | |||
| 2071 | Ga0307509_10131019 | |||
| 2072 | Ga0307509_10251599 | |||
| 2073 | Ga0307509_10297350 | |||
| 2074 | Ga0307408_100000037 | |||
| 2075 | Ga0307408_100405031 | |||
| 2076 | Ga0307508_10000727 | |||
| 2077 | Ga0307508_10016265 | |||
| 2078 | Ga0307508_10063507 | |||
| 2079 | Ga0307508_10322762 | |||
| 2080 | Ga0307508_10344109 | |||
| 2081 | Ga0307508_10393564 | |||
| 2082 | Ga0307514_10000390 | |||
| 2083 | Ga0307514_10002716 | |||
| 2084 | Ga0307514_10065265 | |||
| 2085 | Ga0307516_10000559 | |||
| 2086 | Ga0307516_10001343 | |||
| 2087 | Ga0307516_10006485 | |||
| 2088 | Ga0307516_10335360 | |||
| 2089 | Ga0307516_10475680 | |||
| 2090 | Ga0307405_10002935 | |||
| 2091 | Ga0307405_10107459 | |||
| 2092 | Ga0307405_10150554 | |||
| 2093 | Ga0307405_10365846 | |||
| 2094 | Ga0307413_10016247 | |||
| 2095 | Ga0307413_11257263 | |||
| 2096 | Ga0307410_10028168 | |||
| 2097 | Ga0307410_10174111 | |||
| 2098 | Ga0307410_10249965 | |||
| 2099 | Ga0307410_10308742 | |||
| 2100 | Ga0307410_10368146 | |||
| 2101 | Ga0307406_10178736 | |||
| 2102 | Ga0307407_10347238 | |||
| 2103 | Ga0307407_10489762 | |||
| 2104 | Ga0307412_10023995 | |||
| 2105 | Ga0307412_10127635 | |||
| 2106 | Ga0307409_100014831 | |||
| 2107 | Ga0307409_100015029 | |||
| 2108 | Ga0307409_100350884 | |||
| 2109 | Ga0307416_100001622 | |||
| 2110 | Ga0307416_100074296 | |||
| 2111 | Ga0307416_100079922 | |||
| 2112 | Ga0307416_100092016 | |||
| 2113 | Ga0307416_100409062 | |||
| 2114 | Ga0307416_100715878 | |||
| 2115 | Ga0307416_100864899 | |||
| 2116 | Ga0307416_101147545 | |||
| 2117 | Ga0307416_101977863 | |||
| 2118 | Ga0307414_10016912 | |||
| 2119 | Ga0307414_10820959 | |||
| 2120 | Ga0307411_10000494 | |||
| 2121 | Ga0307411_10027470 | |||
| 2122 | Ga0307415_100002203 | |||
| 2123 | Ga0307415_100034318 | |||
| 2124 | Ga0307507_10029403 | |||
| 2125 | Ga0307507_10151038 | |||
| 2126 | Ga0307510_10007325 | |||
| 2127 | Ga0307510_10047690 | |||
| 2128 | Ga0307510_10178338 | |||
| 2129 | Ga0373930_0040359 | |||
| 2130 | Ga0373959_0026677 | |||
| 2131 | Ga0373959_0120729 | |||
| 2132 | Ga0373940_0034838 | |||
| 2133 | Ga0373951_0029991 | |||
| 2134 | Ga0373932_0114193 | |||
| 2135 | Ga0373936_0030416 | |||
| 2136 | Ga0373936_0114062 | |||
| 2137 | Ga0373939_0000130 | |||
| 2138 | Ga0373939_0034204 | |||
| 2139 | Ga0373939_0196592 | |||
| 2140 | Ga0373941_0171835 | |||
| 2141 | Ga0373945_0024452 | |||
| 2142 | Ga0373945_0109486 | |||
| 2143 | Ga0373954_0096475 | |||
| 2144 | Ga0373960_0152422 | |||
| 2145 | Ga0373943_0031046 | |||
| 2146 | Ga0373946_0132198 | |||
| 2147 | Ga0373955_0026724 | |||
| 2148 | Ga0373961_0016647 | |||
| 2149 | Ga0373962_0083098 | |||
| 2150 | Ga0373924_0033543 | |||
| 2151 | Ga0373931_0000077 | |||
| 2152 | Ga0373931_0004391 | |||
| 2153 | Ga0373931_0043713 | |||
| 2154 | Ga0373931_0309889 | |||
| 2155 | Ga0373931_0645903 | |||
| 2156 | Ga0373937_0029553 | |||
| 2157 | Ga0373937_0553807 | |||
| 2158 | Ga0373925_0037784 | |||
| 2159 | Ga0395900_0000879 | |||
| 2160 | Ga0395900_0414590 | |||
| 2161 | Ga0395898_0001863 | |||
| 2162 | Ga0395905_0003332 | |||
| 2163 | Ga0395905_0007069 | |||
| 2164 | Ga0395905_0019367 | |||
| 2165 | Ga0395905_0504915 | |||
| 2166 | Ga0395901_0001781 | |||
| 2167 | Ga0436361_0019641 | |||
| 2168 | Ga0436361_0085209 | |||
| 2169 | Ga0436361_0255611 | |||
| 2170 | Ga0436361_0463922 | |||
| 2171 | Ga0436361_1020604 | |||
| 2172 | Ga0436361_1048578 | |||
| 2173 | Ga0436361_1181151 | |||
| 2174 | Ga0436363_0491953 | |||
| 2175 | Ga0436363_1399792 | |||
| 2176 | Ga0451789_0465154 | |||
| 2177 | Ga0451789_1272523 | |||
| 2178 | Ga0451791_1347236 | |||
| 2179 | Ga0451797_1576900 | |||
| 2180 | Ga0451798_0217509 | |||
| 2181 | Ga0451798_0867094 | |||
| 2182 | Ga0451807_1959080 | |||
| 2183 | Ga0451833_0958391 | |||
| 2184 | Ga0451839_0595639 | |||
| 2185 | Ga0451851_0070177 | |||
| 2186 | Ga0451843_1230032 | |||
| 2187 | Ga0451853_0407793 | |||
| 2188 | Ga0439431_0010770 | |||
| 2189 | Ga0439433_0112376 | |||
| 2190 | Ga0439437_006821 | |||
| 2191 | Ga0439441_037049 | |||
| 2192 | Ga0439449_0055644 | |||
| 2193 | Ga0439449_0146662 | |||
| 2194 | Ga0439450_004588 | |||
| 2195 | Ga0439457_042981 | |||
| 2196 | Ga0450917_001065 | |||
| 2197 | Ga0450888_000177 | |||
| 2198 | Ga0450890_000922 | |||
| 2199 | Ga0450891_000060 | |||
| 2200 | Ga0450898_015057 | |||
| 2201 | Ga0450899_013185 | |||
| 2202 | Ga0450903_013782 | |||
| 2203 | Ga0450889_000922 | |||
| 2204 | Ga0439435_0160003 | |||
| 2205 | Ga0439459_0010455 | |||
| 2206 | Ga0439464_0015176 | |||
| 2207 | Ga0450916_001089 | |||
| 2208 | Ga0450918_000326 | |||
| 2209 | Ga0450893_0010581 | |||
| 2210 | Ga0450901_026210 | |||
| 2211 | Ga0451577_0001866 | |||
| 2212 | Ga0451577_0032633 | |||
| 2213 | Ga0451577_0127972 | |||
| 2214 | Ga0466969_0000020 | |||
| 2215 | Ga0466969_0101384 | |||
| 2216 | Ga0466965_0000493 | |||
| 2217 | Ga0466965_0011312 | |||
| 2218 | Ga0466965_0038922 | |||
| 2219 | Ga0466965_0109992 | |||
| 2220 | Ga0466966_0001239 | |||
| 2221 | Ga0466966_0011170 | |||
| 2222 | Ga0466961_0013718 | |||
| 2223 | Ga0466961_0037361 | |||
| 2224 | Ga0466963_0039303 | |||
| 2225 | Ga0466963_0077538 | |||
| 2226 | Ga0466963_0101194 | |||
| 2227 | Ga0466964_0000949 | |||
| 2228 | Ga0466964_0014413 | |||
| 2229 | Ga0466964_0062857 | |||
| 2230 | Ga0453684_0042883 | |||
| 2231 | Ga0453684_0066790 | |||
| 2232 | Ga0453684_0410522 | |||
| 2233 | Ga0453684_0591572 | |||
| 2234 | Ga0453684_0687081 | |||
| 2235 | Ga0453684_0875581 | |||
| 2236 | Ga0466971_0002813 | |||
| 2237 | Ga0466971_0003163 | |||
| 2238 | Ga0466971_0023819 | |||
| 2239 | Ga0466968_0013862 | |||
| 2240 | Ga0466970_0005378 | |||
| 2241 | Ga0466970_0033153 | |||
| 2242 | Ga0466970_0192540 | |||
| 2243 | Ga0466957_0027220 | |||
| 2244 | Ga0466957_0063458 | |||
| 2245 | Ga0466957_0269486 | |||
| 2246 | Ga0466959_0001531 | |||
| 2247 | Ga0466959_0046516 | |||
| 2248 | Ga0466959_0067872 | |||
| 2249 | Ga0451576_0009077 | |||
| 2250 | Ga0451576_0124243 | |||
| 2251 | Ga0451576_0257121 | |||
| 2252 | Ga0451576_0284685 | |||
| 2253 | Ga0451576_0509554 | |||
| 2254 | Ga0451576_0665852 | |||
| 2255 | Ga0451576_1515972 | |||
| 2256 | Ga0466958_0041460 | |||
| 2257 | Ga0466958_0063036 | |||
| 2258 | Ga0466967_0025052 | |||
| 2259 | Ga0495592_0000746 | |||
| 2260 | Ga0495592_0215835 | |||
| 2261 | Ga0495592_0272189 | |||
| 2262 | Ga0495603_0078723 | |||
| 2263 | Ga0495590_0031730 | |||
| 2264 | Ga0495590_0141131 | |||
| 2265 | Ga0495629_0166233 | |||
| 2266 | Ga0495638_0031475 | |||
| 2267 | Ga0495651_0106790 | |||
| 2268 | Ga0495653_0559191 | |||
| 2269 | Ga0495650_0008561 | |||
| 2270 | Ga0495650_0029377 | |||
| 2271 | Ga0495580_0041734 | |||
| 2272 | Ga0495580_0626935 | |||
| 2273 | Ga0495662_0395224 | |||
| 2274 | Ga0495583_0000034 | |||
| 2275 | Ga0495583_0079676 | |||
| 2276 | Ga0495606_0006285 | |||
| 2277 | Ga0495606_0358723 | |||
| 2278 | Ga0495608_0264507 | |||
| 2279 | Ga0495610_0024206 | |||
| 2280 | Ga0495610_0036866 | |||
| 2281 | Ga0495618_0406174 | |||
| 2282 | Ga0495620_0259601 | |||
| 2283 | Ga0495628_0163090 | |||
| 2284 | Ga0495630_0040768 | |||
| 2285 | Ga0495631_0098292 | |||
| 2286 | Ga0495632_0066020 | |||
| 2287 | Ga0495632_0095371 | |||
| 2288 | Ga0495643_0072167 | |||
| 2289 | Ga0495644_0192133 | |||
| 2290 | Ga0495648_0055873 | |||
| 2291 | Ga0495648_0064351 | |||
| 2292 | Ga0495648_0122432 | |||
| 2293 | Ga0495663_0077585 | |||
| 2294 | Ga0495640_0292472 | |||
| 2295 | Ga0495586_0120873 | |||
| 2296 | Ga0495598_0018950 | |||
| 2297 | Ga0495609_0167602 | |||
| 2298 | Ga0495621_0021135 | |||
| 2299 | Ga0495621_0279558 | |||
| 2300 | Ga0495621_0285045 | |||
| 2301 | Ga0495597_0017935 | |||
| 2302 | Ga0495667_0174150 | |||
| 2303 | Ga0495656_0129509 | |||
| 2304 | Ga0495668_0021789 | |||
| 2305 | Ga0495668_0294669 | |||
| 2306 | Ga0495625_0006159 | |||
| 2307 | Ga0495625_0020810 | |||
| 2308 | Ga0495635_0101360 | |||
| 2309 | Ga0495646_0040454 | |||
| 2310 | Ga0495646_0157199 | |||
| 2311 | Ga0495647_0245915 | |||
| 2312 | Ga0495658_0204009 | |||
| 2313 | Ga0495669_0026759 | |||
| 2314 | Ga0495669_0317274 | |||
| 2315 | Ga0495613_0152544 | |||
| 2316 | Ga0495670_0060761 | |||
| 2317 | Ga0495670_0129903 | |||
| 2318 | Ga0495671_0097137 | |||
| 2319 | Ga0495671_0106988 | |||
| 2320 | Ga0495649_0000728 | |||
| 2321 | Ga0495649_0029913 | |||
| 2322 | Ga0495660_0015408 | |||
| 2323 | Ga0495660_0079409 | |||
| 2324 | Ga0495674_0289346 | |||
| 2325 | Ga0495680_0111095 | |||
| 2326 | Ga0495687_000248 | |||
| 2327 | Ga0495687_018539 | |||
| 2328 | Ga0495673_0183303 | |||
| 2329 | Ga0495681_0172549 | |||
| 2330 | Ga0495686_0000739 | |||
| 2331 | Ga0495686_0039653 | |||
| 2332 | Ga0495686_0165775 | |||
| 2333 | Ga0495614_0217942 | |||
| 2334 | Ga0495626_0073934 | |||
| 2335 | Ga0496100_0035391 | |||
| 2336 | Ga0496100_0103186 | |||
| 2337 | Ga0496100_0582321 | |||
| 2338 | Ga0496100_0774405 | |||
| 2339 | Ga0496100_1044664 | |||
| 2340 | Ga0496101_0024303 | |||
| 2341 | Ga0496102_0006045 | |||
| 2342 | Ga0496102_0008100 | |||
| 2343 | Ga0496102_0095541 | |||
| 2344 | Ga0496103_0378788 | |||
| 2345 | Ga0496104_0087183 | |||
| 2346 | Ga0496104_0123106 | |||
| 2347 | Ga0496104_0212089 | |||
| 2348 | Ga0496104_0994531 | |||
| 2349 | Ga0496105_0218711 | |||
| 2350 | Ga0496105_0284964 | |||
| 2351 | Ga0496105_0388177 | |||
| 2352 | Ga0496106_0023565 | |||
| 2353 | Ga0496106_0027147 | |||
| 2354 | Ga0496107_0004099 | |||
| 2355 | Ga0496108_0112517 | |||
| 2356 | Ga0496108_0132616 | |||
| 2357 | Ga0496108_0133591 | |||
| 2358 | Ga0496109_0042557 | |||
| 2359 | Ga0496109_0143033 | |||
| 2360 | Ga0496109_0179034 | |||
| 2361 | Ga0496109_0195803 | |||
| 2362 | Ga0496109_0328802 | |||
| 2363 | Ga0496109_0337113 | |||
| 2364 | Ga0496110_0069048 | |||
| 2365 | Ga0496110_0394290 | |||
| 2366 | Ga0496111_0176869 | |||
| 2367 | Ga0496111_0477267 | |||
| 2368 | Ga0496112_0061214 | |||
| 2369 | Ga0496112_0425437 | |||
| 2370 | Ga0496113_0013003 | |||
| 2371 | Ga0496113_0241481 | |||
| 2372 | Ga0496113_0398556 | |||
| 2373 | Ga0496114_0070435 | |||
| 2374 | Ga0496114_0599381 | |||
| 2375 | Ga0496121_0026182 | |||
| 2376 | Ga0496124_0000126 | |||
| 2377 | Ga0496124_0079515 | |||
| 2378 | Ga0496125_0003500 | |||
| 2379 | Ga0501298_011150 | |||
| 2380 | Ga0501300_009888 | |||
| 2381 | Ga0501043_0000009 | |||
| 2382 | Ga0501046_0000022 | |||
| 2383 | Ga0501047_0000021 | |||
| 2384 | Ga0501198_000019 | |||
| 2385 | Ga0501201_001792 | |||
| 2386 | Ga0501211_000655 | |||
| 2387 | Ga0501222_000059 | |||
| 2388 | Ga0501222_002805 | |||
| 2389 | Ga0501223_012519 | |||
| 2390 | Ga0501233_008494 | |||
| 2391 | Ga0501235_002288 | |||
| 2392 | Ga0501236_019964 | |||
| 2393 | Ga0501249_007648 | |||
| 2394 | Ga0501253_020996 | |||
| 2395 | Ga0501253_060348 | |||
| 2396 | Ga0501255_023119 | |||
| 2397 | Ga0501221_004219 | |||
| 2398 | Ga0501229_000329 | |||
| 2399 | Ga0501232_007753 | |||
| 2400 | Ga0501262_001965 | |||
| 2401 | Ga0501263_040320 | |||
| 2402 | Ga0501266_015299 | |||
| 2403 | Ga0501267_001228 | |||
| 2404 | Ga0501271_004112 | |||
| 2405 | Ga0501272_005415 | |||
| 2406 | Ga0501283_005530 | |||
| 2407 | Ga0501035_0304530 | |||
| 2408 | Ga0501044_0661707 | |||
| 2409 | Ga0501045_0025044 | |||
| 2410 | nmdc:mga03683_287767_c1 | |||
| 2411 | nmdc:mga03683_439_c1 | |||
| 2412 | nmdc:mga03683_5178_c1 | |||
| 2413 | nmdc:mga03n38_361453_c1 | |||
| 2414 | nmdc:mga03n38_70060_c1 | |||
| 2415 | nmdc:mga03n38_86560_c1 | |||
| 2416 | nmdc:mga00v17_297159_c1 | |||
| 2417 | nmdc:mga0yw44_19242_c1 | |||
| 2418 | nmdc:mga0k408_118638_c1 | |||
| 2419 | nmdc:mga0k408_127486_c1 | |||
| 2420 | nmdc:mga0k408_12953_c1 | |||
| 2421 | nmdc:mga0k408_130339_c1 | |||
| 2422 | nmdc:mga0k408_146879_c1 | |||
| 2423 | nmdc:mga0k408_1705_c1 | |||
| 2424 | nmdc:mga0k408_173373_c1 | |||
| 2425 | nmdc:mga0k408_19355_c1 | |||
| 2426 | nmdc:mga0k408_212864_c1 | |||
| 2427 | nmdc:mga0k408_240212_c1 | |||
| 2428 | nmdc:mga0k408_259539_c1 | |||
| 2429 | nmdc:mga0k408_27836_c1 | |||
| 2430 | nmdc:mga0k408_376315_c1 | |||
| 2431 | nmdc:mga0k408_406_c1 | |||
| 2432 | nmdc:mga0k408_41032_c1 | |||
| 2433 | nmdc:mga0k408_42240_c1 | |||
| 2434 | nmdc:mga0k408_527_c1 | |||
| 2435 | nmdc:mga0k408_54354_c1 | |||
| 2436 | nmdc:mga0k408_59264_c1 | |||
| 2437 | nmdc:mga0k408_85785_c1 | |||
| 2438 | nmdc:mga0k408_88156_c1 | |||
| 2439 | nmdc:mga06z11_11864_c1 | |||
| 2440 | nmdc:mga06z11_258805_c1 | |||
| 2441 | nmdc:mga06z11_57689_c1 | |||
| 2442 | nmdc:mga06z11_64211_c1 | |||
| 2443 | nmdc:mga06z11_76716_c1 | |||
| 2444 | nmdc:mga04h51_317948_c1 | |||
| 2445 | nmdc:mga04h51_7612_c1 | |||
| 2446 | nmdc:mga07m45_10360_c1 | |||
| 2447 | nmdc:mga07m45_103654_c1 | |||
| 2448 | nmdc:mga07m45_10939_c1 | |||
| 2449 | nmdc:mga07m45_117_c1 | |||
| 2450 | nmdc:mga07m45_136154_c1 | |||
| 2451 | nmdc:mga07m45_1620_c1 | |||
| 2452 | nmdc:mga07m45_207586_c1 | |||
| 2453 | nmdc:mga07m45_30645_c1 | |||
| 2454 | nmdc:mga07m45_4614_c1 | |||
| 2455 | nmdc:mga07m45_5537_c1 | |||
| 2456 | nmdc:mga07m45_6725_c1 | |||
| 2457 | nmdc:mga05p37_109740_c1 | |||
| 2458 | nmdc:mga09592_53741_c1 | |||
| 2459 | nmdc:mga0qj67_360672_c1 | |||
| 2460 | nmdc:mga0qj67_76608_c1 | |||
| 2461 | nmdc:mga08y16_1178426_c1 | |||
| 2462 | nmdc:mga0sz30_17453_c1 | |||
| 2463 | nmdc:mga0sz30_191152_c1 | |||
| 2464 | nmdc:mga0sz30_69443_c1 | |||
| 2465 | Ga0495601_0019457 | |||
| 2466 | Ga0500635_0000011 | |||
| 2467 | Ga0495619_0143834 | |||
| 2468 | Ga0500578_0000673 | |||
| 2469 | Ga0500578_0174805 | |||
| 2470 | Ga0500578_0554643 | |||
| 2471 | Ga0500643_032481 | |||
| 2472 | Ga0500644_0018787 | |||
| 2473 | Ga0500646_0014486 | |||
| 2474 | Ga0500583_0054394 | |||
| 2475 | Ga0500651_0051962 | |||
| 2476 | Ga0500651_0229625 | |||
| 2477 | Ga0500648_346063 | |||
| 2478 | Ga0500650_0046653 | |||
| 2479 | Ga0500555_030106 | |||
| 2480 | Ga0500562_026334 | |||
| 2481 | Ga0500562_037530 | |||
| 2482 | Ga0500569_007978 | |||
| 2483 | Ga0500593_000680 | |||
| 2484 | Ga0500594_0000470 | |||
| 2485 | Ga0500595_073612 | |||
| 2486 | Ga0500607_118133 | |||
| 2487 | Ga0500608_246768 | |||
| 2488 | Ga0500623_072496 | |||
| 2489 | Ga0500628_018338 | |||
| 2490 | Ga0500628_075548 | |||
| 2491 | Ga0500652_000123 | |||
| 2492 | Ga0500652_208186 | |||
| 2493 | Ga0500655_004744 | |||
| 2494 | Ga0500655_017284 | |||
| 2495 | Ga0500658_0044915 | |||
| 2496 | Ga0500658_0237260 | |||
| 2497 | Ga0500559_0000407 | |||
| 2498 | Ga0500559_0153931 | |||
| 2499 | Ga0500568_0112756 | |||
| 2500 | Ga0500577_0009622 | |||
| 2501 | Ga0500590_023408 | |||
| 2502 | Ga0500604_0007671 | |||
| 2503 | Ga0500619_000006 | |||
| 2504 | Ga0500622_0000799 | |||
| 2505 | Ga0500622_0006741 | |||
| 2506 | Ga0500622_0095912 | |||
| 2507 | Ga0500622_0097209 | |||
| 2508 | Ga0500636_0005079 | |||
| 2509 | Ga0500645_008009 | |||
| 2510 | Ga0500645_042335 | |||
| 2511 | Ga0500661_002023 | |||
| 2512 | Ga0590071_000174 | |||
| 2513 | Ga0466962_0004166 | |||
| 2514 | Ga0466962_0046420 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy