F492271

General Info

Members Datasets Scaffolds Average Seq Length
1258 517 2516 170

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100009196|Ga0070662_1000091968
Length 201
Sequence MVIAALPEPASDSYHLLHRVVDMTRTVQETSMTETASYRTVFGSLDRYEKGGVQAISDDVKHYAFSNCFEIASKSKPYEKVVFGQNQIYVLETLRAEGDSPWYTCAHDEFALVMDGEVDVHLVKLDAAQTVPDTEHNGAVRVEGEPRGTNMGWMRLRRGHQALLPKNTAYRFRSAKPGVVVLQTCKGDLSIERWAEICQTA

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
115 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
130 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
131 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
149 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
150 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
232 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
240 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
243 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
244 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
245 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
246 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
247 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
250 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
260 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
261 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
275 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
276 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
277 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
278 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
279 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
280 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
281 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
282 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
283 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
284 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
285 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
288 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
289 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
290 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
291 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
292 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
293 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
294 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
295 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
296 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
297 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
298 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
299 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
300 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
301 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
302 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
303 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
304 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
305 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
306 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
307 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
308 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
309 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
310 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
311 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
312 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
313 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
314 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
315 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
316 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
317 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
318 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
319 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
320 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
321 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
322 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
323 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
324 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
325 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
326 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
327 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
328 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
329 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
330 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
331 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
332 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
335 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
336 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
337 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
338 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
341 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
342 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
343 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
344 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
345 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
346 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
347 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
348 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
349 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
350 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
351 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
352 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
353 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
354 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
355 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
356 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
357 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
358 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
359 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
360 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
361 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
362 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
363 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
364 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
365 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
366 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
367 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
368 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
369 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
370 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
371 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
372 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
373 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
374 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
375 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
376 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
377 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
378 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
379 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
380 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
381 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
382 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
383 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
384 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
385 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
386 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
387 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
388 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
389 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
390 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
393 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
394 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
395 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
396 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
397 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
398 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
399 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
400 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
401 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
402 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
403 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
404 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
405 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
406 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
407 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
408 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
409 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
410 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
411 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
412 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
413 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
414 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
415 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
416 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
423 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
424 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
425 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
426 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
427 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
428 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
429 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
430 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
431 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
432 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
433 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
434 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
435 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
436 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
437 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
438 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
439 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
440 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
441 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
442 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
443 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
444 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
445 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
446 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
447 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
448 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
449 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
450 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
451 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
452 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
453 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
454 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
455 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
456 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
457 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
458 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
459 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
460 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
461 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
462 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
463 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
464 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
465 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
466 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
467 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
468 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
469 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
470 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
471 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
472 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
473 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
474 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
475 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
476 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
477 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
478 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
479 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
480 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
481 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
482 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
483 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
484 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
485 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
486 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
487 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
488 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
489 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
490 2643221658 Variovorax sp. Root411 Isolate Unclassified
491 2643221660 Methylibium sp. Root1272 Isolate Unclassified
492 2643221672 Variovorax sp. Root434 Isolate Unclassified
493 2643221683 Variovorax sp. Root473 Isolate Unclassified
494 2738541277 Variovorax sp. GV051 Isolate Unclassified
495 2738541307 Variovorax sp. GV008 Isolate Unclassified
496 2738543013 Variovorax sp. BT01 Isolate Unclassified
497 2738543019 Variovorax sp. GV040 Isolate Unclassified
498 2818991446 Variovorax sp. 1180 Isolate Unclassified
499 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
500 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
501 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
502 2885198086 Variovorax sp. 679 Isolate Unclassified
503 2885211737 Variovorax sp. 553 Isolate Unclassified
504 2899924645 Variovorax sp. 369 Isolate Unclassified
505 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
506 2904456579 Variovorax sp. 2002 Isolate Unclassified
507 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
508 2928037797 Variovorax sp. 1126 Isolate Unclassified
509 2928044640 Variovorax sp. 1128 Isolate Unclassified
510 2928051484 Variovorax sp. 1133 Isolate Unclassified
511 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
512 2928070936 Variovorax gossypii 1167 Isolate Unclassified
513 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
514 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
515 2929520902 Variovorax beijingensis 502 Isolate Unclassified
516 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
517 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 0
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.41
Nodule 0.24
Rhizoplane 1.99
Rhizosphere 73.13
Stem 0
Stem Tuber 0
Unclassified 2.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100009196 3300005457 Bacteria 6451
2 JGI24740J21852_10010212 3300001979 Bacteria 3628
3 JGI25152J39213_1014372 3300002773 Bacteria 1609
4 JGI25150J39212_1000692 3300002774 Bacteria 12226
5 JGI25159J45721_1008171 3300002987 Bacteria 2904
6 JGI25159J45721_1024032 3300002987 Bacteria 1093
7 JGI25159J45721_1034896 3300002987 Bacteria 775
8 JGI25151J46595_10000966 3300003187 Bacteria 21838
9 JGI25151J46595_10032862 3300003187 Bacteria 2005
10 JGI25151J46595_10033648 3300003187 Bacteria 1970
11 JGI25151J46595_10049812 3300003187 Bacteria 1433
12 JGI25153J46596_10015324 3300003215 Bacteria 3129
13 JGI25153J46596_10038516 3300003215 Bacteria 1506
14 rootH2_10009454 3300003320 Bacteria 2620
15 rootL2_10020422 3300003322 Bacteria 3875
16 rootL2_10113471 3300003322 Bacteria 1287
17 JGI25160J50197_1051024 3300003354 Bacteria 877
18 JGI25160J50197_1058914 3300003354 Bacteria 775
19 JGI25407J50210_10071250 3300003373 Bacteria 867
20 JGI25161J50226_1006587 3300003374 Bacteria 2076
21 JGI25161J50226_1019299 3300003374 Bacteria 698
22 Ga0055532_1015032 3300003758 Bacteria 860
23 Ga0055527_1008415 3300003760 Bacteria 1232
24 Ga0055535_1001074 3300003761 Bacteria 16812
25 Ga0055542_1000074 3300003762 Bacteria 141185
26 Ga0055526_1042004 3300003771 Bacteria 1132
27 Ga0055526_1063622 3300003771 Bacteria 775
28 Ga0055537_1013714 3300003773 Bacteria 1506
29 Ga0055537_1014024 3300003773 Bacteria 1473
30 Ga0055524_1061519 3300003775 Bacteria 775
31 Ga0055536_1000980 3300003781 Bacteria 18127
32 Ga0055536_1013599 3300003781 Bacteria 2920
33 Ga0055534_1006770 3300003784 Bacteria 2834
34 Ga0055534_1011553 3300003784 Bacteria 1789
35 Ga0055534_1018300 3300003784 Bacteria 1221
36 Ga0055534_1018301 3300003784 Bacteria 1221
37 Ga0055528_1015002 3300003790 Bacteria 2823
38 Ga0055528_1029096 3300003790 Bacteria 1506
39 Ga0055530_10000437 3300003791 Bacteria 37027
40 Ga0055530_10011577 3300003791 Bacteria 3153
41 Ga0055540_1002229 3300003792 Bacteria 10495
42 Ga0055540_1005977 3300003792 Bacteria 4940
43 Ga0055540_1007891 3300003792 Bacteria 3927
44 Ga0055531_10000809 3300003794 Bacteria 25914
45 Ga0055531_10025336 3300003794 Bacteria 2158
46 Ga0055531_10027333 3300003794 Bacteria 2005
47 Ga0055543_1043910 3300004625 Bacteria 747
48 Ga0065165_1011798 3300005262 Bacteria 3603
49 Ga0065714_10104460 3300005288 Bacteria 1584
50 Ga0065714_10204003 3300005288 Bacteria 886
51 Ga0065704_10081990 3300005289 Bacteria 3672
52 Ga0065712_10316088 3300005290 Bacteria 836
53 Ga0065707_10101401 3300005295 Bacteria 2867
54 Ga0070658_10057194 3300005327 Bacteria 3172
55 Ga0070658_10382387 3300005327 Bacteria 1208
56 Ga0070658_10682662 3300005327 Bacteria 891
57 Ga0070676_10002959 3300005328 Bacteria 8775
58 Ga0070676_10003006 3300005328 Bacteria 8721
59 Ga0070676_10009607 3300005328 Bacteria 5226
60 Ga0070676_10048770 3300005328 Bacteria 2476
61 Ga0070676_10115300 3300005328 Bacteria 1678
62 Ga0070683_100124461 3300005329 Unclassified 2437
63 Ga0070683_100179924 3300005329 Bacteria 2007
64 Ga0070683_100503711 3300005329 Unclassified 1157
65 Ga0070690_100176086 3300005330 Bacteria 1475
66 Ga0070690_100300565 3300005330 Bacteria 1151
67 Ga0070670_100011371 3300005331 Bacteria 7609
68 Ga0070670_100158075 3300005331 Bacteria 1964
69 Ga0070670_100166921 3300005331 Bacteria 1909
70 Ga0070670_100254958 3300005331 Bacteria 1529
71 Ga0070677_10265891 3300005333 Bacteria 858
72 Ga0068869_100004690 3300005334 Bacteria 8530
73 Ga0068869_100014419 3300005334 Bacteria 5279
74 Ga0068869_100066156 3300005334 Bacteria 2662
75 Ga0068869_101290440 3300005334 Bacteria 644
76 Ga0070666_10002130 3300005335 Bacteria 12031
77 Ga0070666_10242878 3300005335 Bacteria 1274
78 Ga0070666_10582288 3300005335 Bacteria 816
79 Ga0070680_100051495 3300005336 Bacteria 3360
80 Ga0070680_100311391 3300005336 Bacteria 1336
81 Ga0068868_100051509 3300005338 Bacteria 3239
82 Ga0068868_100054986 3300005338 Bacteria 3139
83 Ga0068868_100155069 3300005338 Bacteria 1888
84 Ga0068868_100964320 3300005338 Unclassified 778
85 Ga0068868_101602450 3300005338 Bacteria 612
86 Ga0070689_100014421 3300005340 Bacteria 5741
87 Ga0070691_10218433 3300005341 Bacteria 1009
88 Ga0070691_10281495 3300005341 Bacteria 902
89 Ga0070687_100118412 3300005343 Bacteria 1511
90 Ga0070661_100143938 3300005344 Bacteria 1798
91 Ga0070668_100010950 3300005347 Bacteria 6748
92 Ga0070668_100122730 3300005347 Bacteria 2078
93 Ga0070668_100256205 3300005347 Bacteria 1454
94 Ga0070668_100574926 3300005347 Bacteria 983
95 Ga0070669_100250334 3300005353 Bacteria 1411
96 Ga0070669_100568517 3300005353 Bacteria 947
97 Ga0070669_100947023 3300005353 Bacteria 737
98 Ga0070669_101122731 3300005353 Unclassified 677
99 Ga0070675_100008998 3300005354 Bacteria 7757
100 Ga0070675_100278711 3300005354 Bacteria 1469
101 Ga0070675_100488535 3300005354 Bacteria 1108
102 Ga0070671_100001982 3300005355 Bacteria 15714
103 Ga0070671_100049526 3300005355 Bacteria 3495
104 Ga0070671_100073564 3300005355 Bacteria 2854
105 Ga0070671_100199979 3300005355 Bacteria 1694
106 Ga0070671_100283273 3300005355 Bacteria 1410
107 Ga0070671_101205393 3300005355 Unclassified 666
108 Ga0070674_100031734 3300005356 Bacteria 3503
109 Ga0070674_100104587 3300005356 Bacteria 2069
110 Ga0070674_100388003 3300005356 Bacteria 1138
111 Ga0070674_100775468 3300005356 Bacteria 826
112 Ga0070673_100000636 3300005364 Bacteria 19252
113 Ga0070673_100017149 3300005364 Bacteria 5140
114 Ga0070673_100068716 3300005364 Bacteria 2838
115 Ga0070673_100582773 3300005364 Bacteria 1019
116 Ga0070673_100772804 3300005364 Bacteria 886
117 Ga0070688_100206154 3300005365 Bacteria 1378
118 Ga0070688_100241403 3300005365 Bacteria 1282
119 Ga0070659_100368624 3300005366 Bacteria 1208
120 Ga0070667_100000916 3300005367 Bacteria 27234
121 Ga0070667_100001639 3300005367 Bacteria 20014
122 Ga0070667_100108331 3300005367 Bacteria 2407
123 Ga0070667_100254517 3300005367 Bacteria 1570
124 Ga0070667_100276685 3300005367 Bacteria 1506
125 Ga0070667_101108948 3300005367 Bacteria 740
126 Ga0070709_10041462 3300005434 Bacteria 2837
127 Ga0070713_100079415 3300005436 Bacteria 2795
128 Ga0070710_11181176 3300005437 Bacteria 565
129 Ga0070701_10067484 3300005438 Bacteria 1903
130 Ga0070701_10236218 3300005438 Bacteria 1097
131 Ga0070705_100187047 3300005440 Unclassified 1408
132 Ga0070700_100021338 3300005441 Bacteria 3764
133 Ga0070700_100046369 3300005441 Bacteria 2685
134 Ga0070700_100766040 3300005441 Bacteria 774
135 Ga0070700_101235732 3300005441 Bacteria 625
136 Ga0070708_100033241 3300005445 Bacteria 4481
137 Ga0070708_100188876 3300005445 Unclassified 1927
138 Ga0070708_100197772 3300005445 Bacteria 1881
139 Ga0070708_100373113 3300005445 Bacteria 1345
140 Ga0070708_100551649 3300005445 Bacteria 1087
141 Ga0070663_100185389 3300005455 Bacteria 1617
142 Ga0070663_101674885 3300005455 Bacteria 568
143 Ga0070678_100005995 3300005456 Bacteria 7083
144 Ga0070678_100178927 3300005456 Bacteria 1734
145 Ga0070678_100282242 3300005456 Bacteria 1405
146 Ga0070678_100296129 3300005456 Bacteria 1373
147 Ga0070678_100581387 3300005456 Bacteria 998
148 Ga0070678_101275078 3300005456 Bacteria 683
149 Ga0070662_100002338 3300005457 Bacteria 11655
150 Ga0070662_100074970 3300005457 Bacteria 2504
151 Ga0070662_100189153 3300005457 Bacteria 1627
152 Ga0070681_10029856 3300005458 Bacteria 5472
153 Ga0070681_10631726 3300005458 Unclassified 986
154 Ga0070681_10961264 3300005458 Unclassified 773
155 Ga0068867_100000664 3300005459 Bacteria 22809
156 Ga0068867_100013814 3300005459 Bacteria 5717
157 Ga0068867_100029743 3300005459 Bacteria 3936
158 Ga0068867_100032411 3300005459 Bacteria 3779
159 Ga0068867_100142501 3300005459 Bacteria 1875
160 Ga0068867_100154895 3300005459 Bacteria 1803
161 Ga0068867_100212789 3300005459 Bacteria 1553
162 Ga0068867_100843491 3300005459 Bacteria 820
163 Ga0070685_10514457 3300005466 Bacteria 849
164 Ga0070685_10633233 3300005466 Bacteria 773
165 Ga0070685_10678964 3300005466 Bacteria 749
166 Ga0070685_10681485 3300005466 Bacteria 748
167 Ga0070707_100010736 3300005468 Bacteria 8530
168 Ga0070698_100423339 3300005471 Bacteria 1266
169 Ga0070698_100833995 3300005471 Bacteria 866
170 Ga0070679_100183717 3300005530 Bacteria 2063
171 Ga0070684_100026516 3300005535 Bacteria 4885
172 Ga0070697_100010956 3300005536 Bacteria 7083
173 Ga0068853_100009688 3300005539 Bacteria 7768
174 Ga0068853_100011188 3300005539 Bacteria 7280
175 Ga0068853_100509540 3300005539 Bacteria 1137
176 Ga0068853_101150454 3300005539 Bacteria 749
177 Ga0070672_100000215 3300005543 Bacteria 31837
178 Ga0070672_100007533 3300005543 Bacteria 7394
179 Ga0070672_100220183 3300005543 Bacteria 1592
180 Ga0070672_100375068 3300005543 Bacteria 1216
181 Ga0070672_100383809 3300005543 Bacteria 1202
182 Ga0070672_100529513 3300005543 Bacteria 1021
183 Ga0070672_101011538 3300005543 Bacteria 737
184 Ga0070686_100058846 3300005544 Bacteria 2474
185 Ga0070695_101196718 3300005545 Unclassified 625
186 Ga0070665_100025474 3300005548 Bacteria 5959
187 Ga0070665_100055275 3300005548 Bacteria 3981
188 Ga0070665_100409201 3300005548 Bacteria 1365
189 Ga0070665_100446518 3300005548 Bacteria 1303
190 Ga0068855_100000166 3300005563 Bacteria 83838
191 Ga0068855_100164792 3300005563 Plasmid 2513
192 Ga0068855_100242436 3300005563 Bacteria 2013
193 Ga0070664_100022201 3300005564 Bacteria 5235
194 Ga0070664_100241622 3300005564 Bacteria 1621
195 Ga0068857_100006977 3300005577 Bacteria 9719
196 Ga0068857_100012327 3300005577 Bacteria 7440
197 Ga0068857_100069621 3300005577 Bacteria 3133
198 Ga0068857_100209974 3300005577 Bacteria 1776
199 Ga0068854_100039212 3300005578 Bacteria 3336
200 Ga0068854_100169572 3300005578 Bacteria 1697
201 Ga0068856_100123773 3300005614 Plasmid 2588
202 Ga0068856_100198462 3300005614 Bacteria 2021
203 Ga0068856_100649653 3300005614 Bacteria 1075
204 Ga0070702_101158956 3300005615 Bacteria 621
205 Ga0068852_100180934 3300005616 Bacteria 1982
206 Ga0068852_100291220 3300005616 Bacteria 1577
207 Ga0068852_100516312 3300005616 Bacteria 1192
208 Ga0068852_101004876 3300005616 Bacteria 853
209 Ga0068852_102122197 3300005616 Bacteria 584
210 Ga0068859_100010428 3300005617 Bacteria 9349
211 Ga0068859_100154256 3300005617 Bacteria 2373
212 Ga0068859_100175040 3300005617 Bacteria 2228
213 Ga0068859_100252906 3300005617 Bacteria 1852
214 Ga0068859_100338867 3300005617 Bacteria 1598
215 Ga0068859_100413590 3300005617 Bacteria 1445
216 Ga0068864_100011184 3300005618 Bacteria 7416
217 Ga0068864_100015192 3300005618 Bacteria 6403
218 Ga0068864_100735631 3300005618 Bacteria 966
219 Ga0068866_10019710 3300005718 Bacteria 3077
220 Ga0068866_10064676 3300005718 Bacteria 1910
221 Ga0068861_100006063 3300005719 Bacteria 8218
222 Ga0068861_100136966 3300005719 Bacteria 1993
223 Ga0068851_10040298 3300005834 Bacteria 2348
224 Ga0068851_10045449 3300005834 Bacteria 2219
225 Ga0068870_10032629 3300005840 Bacteria 2650
226 Ga0068870_10504622 3300005840 Bacteria 807
227 Ga0068863_100001567 3300005841 Bacteria 22604
228 Ga0068863_100001722 3300005841 Bacteria 21666
229 Ga0068863_100380730 3300005841 Bacteria 1378
230 Ga0068858_100000628 3300005842 Bacteria 36756
231 Ga0068858_100058676 3300005842 Bacteria 3559
232 Ga0068858_100323282 3300005842 Bacteria 1475
233 Ga0068858_100488267 3300005842 Bacteria 1189
234 Ga0068858_100852913 3300005842 Bacteria 890
235 Ga0068858_101001619 3300005842 Bacteria 819
236 Ga0068860_100002622 3300005843 Bacteria 18697
237 Ga0068860_100008901 3300005843 Bacteria 10002
238 Ga0068860_100184807 3300005843 Bacteria 2015
239 Ga0068860_100474576 3300005843 Bacteria 1246
240 Ga0068860_101064532 3300005843 Bacteria 828
241 Ga0068862_100049227 3300005844 Bacteria 3599
242 Ga0068862_100071248 3300005844 Bacteria 3001
243 Ga0068862_100087624 3300005844 Bacteria 2707
244 Ga0068862_100223968 3300005844 Bacteria 1704
245 Ga0068862_100483613 3300005844 Bacteria 1172
246 Ga0068862_101026749 3300005844 Bacteria 816
247 Ga0081455_10732466 3300005937 Bacteria 627
248 Ga0075365_10000402 3300006038 Bacteria 15892
249 Ga0075365_10188804 3300006038 Bacteria 1442
250 Ga0075368_10072401 3300006042 Bacteria 1394
251 Ga0075363_100006788 3300006048 Bacteria 5228
252 Ga0075364_10006947 3300006051 Bacteria 6686
253 Ga0075432_10028523 3300006058 Bacteria 1926
254 Ga0075362_10018359 3300006177 Bacteria 2892
255 Ga0075362_10026331 3300006177 Bacteria 2483
256 Ga0075362_10075241 3300006177 Bacteria 1548
257 Ga0075362_10079367 3300006177 Bacteria 1511
258 Ga0075362_10123620 3300006177 Bacteria 1226
259 Ga0075367_10052723 3300006178 Bacteria 2408
260 Ga0075367_10106928 3300006178 Bacteria 1715
261 Ga0075367_10173445 3300006178 Bacteria 1343
262 Ga0075367_10355351 3300006178 Bacteria 925
263 Ga0075367_10371852 3300006178 Bacteria 903
264 Ga0075369_10162193 3300006186 Bacteria 1025
265 Ga0075366_10006489 3300006195 Bacteria 6413
266 Ga0075366_10015968 3300006195 Bacteria 4311
267 Ga0075366_10018726 3300006195 Bacteria 4000
268 Ga0075366_10021592 3300006195 Bacteria 3742
269 Ga0075366_10038020 3300006195 Bacteria 2842
270 Ga0075366_10053152 3300006195 Bacteria 2406
271 Ga0075366_10064372 3300006195 Bacteria 2181
272 Ga0075366_10073073 3300006195 Bacteria 2044
273 Ga0075366_10077864 3300006195 Bacteria 1979
274 Ga0075366_10095547 3300006195 Bacteria 1782
275 Ga0075366_10153377 3300006195 Bacteria 1395
276 Ga0075366_10212788 3300006195 Bacteria 1177
277 Ga0075366_10774203 3300006195 Bacteria 597
278 Ga0097621_100007488 3300006237 Bacteria 7815
279 Ga0097621_100019592 3300006237 Bacteria 5197
280 Ga0097621_100186892 3300006237 Bacteria 1793
281 Ga0097621_100763867 3300006237 Bacteria 893
282 Ga0097621_100779391 3300006237 Bacteria 885
283 Ga0075370_10023306 3300006353 Bacteria 3407
284 Ga0075370_10024490 3300006353 Bacteria 3335
285 Ga0075370_10031608 3300006353 Bacteria 2955
286 Ga0075370_10053353 3300006353 Bacteria 2294
287 Ga0075370_10070417 3300006353 Bacteria 2000
288 Ga0075370_10177611 3300006353 Bacteria 1252
289 Ga0075370_10361938 3300006353 Bacteria 867
290 Ga0075370_10416635 3300006353 Bacteria 807
291 Ga0068871_100003128 3300006358 Bacteria 11356
292 Ga0068871_100012228 3300006358 Bacteria 6320
293 Ga0068871_100066423 3300006358 Bacteria 2956
294 Ga0075428_100002991 3300006844 Bacteria 18429
295 Ga0075428_100004497 3300006844 Bacteria 15397
296 Ga0075428_100600102 3300006844 Bacteria 1176
297 Ga0075428_102160969 3300006844 Bacteria 575
298 Ga0075430_100019067 3300006846 Bacteria 5836
299 Ga0075430_100053854 3300006846 Bacteria 3387
300 Ga0075431_100308981 3300006847 Bacteria 1596
301 Ga0075431_100604847 3300006847 Bacteria 1080
302 Ga0075433_10174388 3300006852 Bacteria 1913
303 Ga0075429_100022565 3300006880 Bacteria 5457
304 Ga0075429_100264976 3300006880 Bacteria 1505
305 Ga0068865_100003193 3300006881 Bacteria 9812
306 Ga0068865_100003621 3300006881 Bacteria 9279
307 Ga0068865_100005535 3300006881 Bacteria 7663
308 Ga0068865_100037561 3300006881 Bacteria 3271
309 Ga0068865_100199681 3300006881 Bacteria 1552
310 Ga0068865_100204342 3300006881 Bacteria 1535
311 Ga0068865_100703363 3300006881 Bacteria 864
312 Ga0097620_100010429 3300006931 Bacteria 9349
313 Ga0097620_100154273 3300006931 Bacteria 2373
314 Ga0097620_100175044 3300006931 Bacteria 2228
315 Ga0097620_100252899 3300006931 Bacteria 1852
316 Ga0097620_100338915 3300006931 Bacteria 1598
317 Ga0097620_100413575 3300006931 Bacteria 1445
318 Ga0099826_10065661 3300006948 Bacteria 2332
319 Ga0105244_10017711 3300009036 Bacteria 4018
320 Ga0105244_10140250 3300009036 Bacteria 1163
321 Ga0105240_10000470 3300009093 Bacteria 74442
322 Ga0105240_10002416 3300009093 Bacteria 30014
323 Ga0105240_10173426 3300009093 Bacteria 2552
324 Ga0105240_10876762 3300009093 Bacteria 967
325 Ga0111539_10007916 3300009094 Bacteria 13552
326 Ga0111539_10012627 3300009094 Bacteria 10584
327 Ga0105245_10012561 3300009098 Bacteria 7370
328 Ga0105245_10018645 3300009098 Bacteria 6069
329 Ga0105245_10038455 3300009098 Bacteria 4257
330 Ga0105245_10406613 3300009098 Bacteria 1362
331 Ga0105245_10436021 3300009098 Bacteria 1316
332 Ga0105245_10987911 3300009098 Bacteria 886
333 Ga0114129_10008968 3300009147 Bacteria 14262
334 Ga0105243_10000437 3300009148 Bacteria 43696
335 Ga0105243_10002267 3300009148 Bacteria 16166
336 Ga0105243_10016045 3300009148 Bacteria 5667
337 Ga0105243_10035573 3300009148 Bacteria 3861
338 Ga0105243_10149101 3300009148 Bacteria 2004
339 Ga0105243_10214642 3300009148 Bacteria 1696
340 Ga0105241_10024541 3300009174 Bacteria 4476
341 Ga0105241_10076022 3300009174 Bacteria 2618
342 Ga0105241_10198017 3300009174 Bacteria 1676
343 Ga0105241_10228970 3300009174 Unclassified 1566
344 Ga0105242_10005571 3300009176 Bacteria 9715
345 Ga0105242_10025391 3300009176 Bacteria 4689
346 Ga0105242_10172499 3300009176 Bacteria 1902
347 Ga0105242_10295810 3300009176 Bacteria 1476
348 Ga0105242_10356237 3300009176 Bacteria 1353
349 Ga0105242_10640995 3300009176 Bacteria 1032
350 Ga0105248_10002934 3300009177 Bacteria 18928
351 Ga0105248_10110965 3300009177 Bacteria 3093
352 Ga0105248_10315388 3300009177 Bacteria 1761
353 Ga0105237_10001223 3300009545 Bacteria 34228
354 Ga0105237_10004017 3300009545 Bacteria 17192
355 Ga0105237_10010476 3300009545 Bacteria 9854
356 Ga0105237_10066362 3300009545 Bacteria 3603
357 Ga0105237_10102414 3300009545 Bacteria 2855
358 Ga0105237_10189785 3300009545 Bacteria 2055
359 Ga0105238_10000294 3300009551 Bacteria 55283
360 Ga0105238_10006384 3300009551 Bacteria 11730
361 Ga0105238_10017161 3300009551 Bacteria 7350
362 Ga0105238_10071647 3300009551 Bacteria 3463
363 Ga0105238_10122079 3300009551 Bacteria 2585
364 Ga0105238_10158793 3300009551 Bacteria 2237
365 Ga0105238_10500661 3300009551 Bacteria 1216
366 Ga0105238_10848515 3300009551 Unclassified 930
367 Ga0105249_10007568 3300009553 Bacteria 9475
368 Ga0105249_10010948 3300009553 Bacteria 7972
369 Ga0105249_10432539 3300009553 Bacteria 1352
370 Ga0105239_10002071 3300010375 Bacteria 25990
371 Ga0105239_10016024 3300010375 Bacteria 8296
372 Ga0105239_10031117 3300010375 Bacteria 5871
373 Ga0105239_10043988 3300010375 Bacteria 4896
374 Ga0105239_10317522 3300010375 Bacteria 1756
375 Ga0105239_10420815 3300010375 Bacteria 1513
376 Ga0105239_10683668 3300010375 Bacteria 1173
377 Ga0105246_10069868 3300011119 Bacteria 2468
378 Ga0105246_10204120 3300011119 Bacteria 1539
379 Ga0105246_10286655 3300011119 Bacteria 1323
380 Ga0105246_10594420 3300011119 Bacteria 955
381 Ga0105246_10833173 3300011119 Bacteria 821
382 Ga0157322_1011987 3300012490 Bacteria 724
383 Ga0157345_1008467 3300012498 Bacteria 860
384 Ga0157339_1003029 3300012505 Bacteria 1183
385 Ga0157373_10079134 3300013100 Bacteria 2318
386 Ga0157371_10216837 3300013102 Bacteria 1374
387 Ga0157370_10003332 3300013104 Bacteria 18929
388 Ga0157370_10036164 3300013104 Bacteria 4794
389 Ga0157369_10054666 3300013105 Bacteria 4311
390 Ga0157369_10345339 3300013105 Unclassified 1546
391 Ga0157374_10018835 3300013296 Bacteria 6102
392 Ga0157374_10190956 3300013296 Bacteria 2004
393 Ga0157374_10223789 3300013296 Bacteria 1847
394 Ga0157374_10390070 3300013296 Bacteria 1388
395 Ga0157374_10438862 3300013296 Bacteria 1306
396 Ga0157378_10012717 3300013297 Bacteria 7364
397 Ga0157378_10025572 3300013297 Bacteria 5198
398 Ga0157378_10068930 3300013297 Bacteria 3172
399 Ga0157378_10181822 3300013297 Bacteria 1979
400 Ga0157378_10217874 3300013297 Bacteria 1813
401 Ga0157378_10629129 3300013297 Bacteria 1087
402 Ga0163162_10000954 3300013306 Bacteria 26824
403 Ga0163162_10049343 3300013306 Bacteria 4218
404 Ga0163162_10084244 3300013306 Bacteria 3254
405 Ga0163162_10093337 3300013306 Bacteria 3094
406 Ga0163162_10261827 3300013306 Bacteria 1861
407 Ga0163162_10271330 3300013306 Bacteria 1828
408 Ga0163162_11109334 3300013306 Unclassified 896
409 Ga0163162_11322846 3300013306 Bacteria 819
410 Ga0157372_10036787 3300013307 Bacteria 5398
411 Ga0157372_10239142 3300013307 Unclassified 2107
412 Ga0157372_10921368 3300013307 Unclassified 1013
413 Ga0157375_10000550 3300013308 Bacteria 33739
414 Ga0157375_10018289 3300013308 Bacteria 6353
415 Ga0157375_10033787 3300013308 Bacteria 4864
416 Ga0157375_10111508 3300013308 Bacteria 2834
417 Ga0157375_11135788 3300013308 Bacteria 915
418 Ga0163163_10018301 3300014325 Bacteria 6554
419 Ga0163163_10146821 3300014325 Bacteria 2403
420 Ga0157380_10000489 3300014326 Bacteria 24116
421 Ga0157380_10009763 3300014326 Bacteria 6888
422 Ga0157380_10012837 3300014326 Bacteria 6087
423 Ga0157380_10117607 3300014326 Bacteria 2245
424 Ga0157380_10124752 3300014326 Bacteria 2187
425 Ga0182008_10007679 3300014497 Bacteria 5941
426 Ga0182008_10050118 3300014497 Bacteria 2072
427 Ga0157377_10324933 3300014745 Bacteria 1023
428 Ga0157377_11084443 3300014745 Unclassified 612
429 Ga0157379_10000439 3300014968 Bacteria 33735
430 Ga0157379_10047612 3300014968 Bacteria 3825
431 Ga0157379_10094579 3300014968 Bacteria 2681
432 Ga0157379_10160691 3300014968 Bacteria 2028
433 Ga0157379_10294445 3300014968 Bacteria 1478
434 Ga0157379_10305253 3300014968 Bacteria 1451
435 Ga0157376_10029133 3300014969 Bacteria 4397
436 Ga0157376_10203034 3300014969 Bacteria 1825
437 Ga0157376_10266833 3300014969 Bacteria 1606
438 Ga0157376_10585657 3300014969 Bacteria 1108
439 Ga0157376_10940849 3300014969 Bacteria 884
440 Ga0182006_1001748 3300015261 Bacteria 12603
441 Ga0182006_1003709 3300015261 Bacteria 7719
442 Ga0182006_1127927 3300015261 Bacteria 876
443 Ga0182007_10004346 3300015262 Bacteria 6440
444 Ga0182005_1031429 3300015265 Bacteria 1446
445 Ga0182005_1059851 3300015265 Bacteria 1040
446 Ga0183362_10005 3300015683 Bacteria 437616
447 Ga0163161_10006931 3300017792 Bacteria 7836
448 Ga0163161_10052953 3300017792 Bacteria 2942
449 Ga0163161_10120687 3300017792 Bacteria 1970
450 Ga0163161_10121160 3300017792 Bacteria 1966
451 Ga0163161_10127999 3300017792 Bacteria 1913
452 Ga0213872_10023309 3300021361 Bacteria 2848
453 Ga0213876_10181594 3300021384 Bacteria 1119
454 Ga0209436_115256 3300025208 Bacteria 1194
455 Ga0209672_101328 3300025228 Bacteria 9426
456 Ga0209147_101428 3300025229 Bacteria 8692
457 Ga0209258_100176 3300025242 Bacteria 141261
458 Ga0207425_1000133 3300025245 Bacteria 67802
459 Ga0207425_1011401 3300025245 Bacteria 2123
460 Ga0207425_1044847 3300025245 Bacteria 829
461 Ga0209148_1000033 3300025254 Bacteria 555508
462 Ga0209129_1000186 3300025258 Bacteria 85793
463 Ga0209129_1007298 3300025258 Bacteria 3328
464 Ga0209129_1009268 3300025258 Bacteria 2619
465 Ga0209565_1000190 3300025263 Bacteria 75207
466 Ga0209565_1004293 3300025263 Bacteria 4388
467 Ga0209673_1000209 3300025273 Bacteria 117670
468 Ga0209673_1000393 3300025273 Bacteria 78531
469 Ga0209673_1001625 3300025273 Bacteria 19511
470 Ga0209673_1008405 3300025273 Bacteria 4598
471 Ga0209673_1051779 3300025273 Bacteria 1081
472 Ga0209130_1000372 3300025284 Bacteria 50940
473 Ga0209130_1010030 3300025284 Bacteria 2640
474 Ga0209130_1015881 3300025284 Bacteria 1840
475 Ga0209675_1000902 3300025291 Bacteria 19011
476 Ga0209675_1001575 3300025291 Bacteria 12922
477 Ga0209675_1006482 3300025291 Bacteria 4679
478 Ga0209675_1017081 3300025291 Bacteria 2085
479 Ga0209675_1037045 3300025291 Bacteria 1099
480 Ga0209676_1000048 3300025292 Bacteria 403716
481 Ga0209676_1000368 3300025292 Bacteria 83764
482 Ga0209676_1000433 3300025292 Bacteria 72480
483 Ga0209676_1000937 3300025292 Bacteria 35920
484 Ga0209025_1000324 3300025294 Bacteria 106257
485 Ga0209025_1001380 3300025294 Bacteria 32437
486 Ga0209025_1001614 3300025294 Bacteria 28196
487 Ga0209025_1019492 3300025294 Bacteria 3770
488 Ga0209025_1079347 3300025294 Bacteria 1123
489 Ga0209025_1096798 3300025294 Bacteria 947
490 Ga0209564_1000417 3300025295 Bacteria 74808
491 Ga0209564_1000423 3300025295 Bacteria 74528
492 Ga0209758_1000092 3300025297 Bacteria 241910
493 Ga0209758_1010418 3300025297 Bacteria 5566
494 Ga0209050_1000012 3300025298 Bacteria 813717
495 Ga0209050_1000912 3300025298 Bacteria 39073
496 Ga0209050_1004084 3300025298 Bacteria 10213
497 Ga0209050_1051799 3300025298 Bacteria 1032
498 Ga0209256_1000094 3300025299 Bacteria 208177
499 Ga0209256_1000095 3300025299 Bacteria 206120
500 Ga0207426_1000084 3300025302 Bacteria 298123
501 Ga0207426_1000161 3300025302 Bacteria 172765
502 Ga0209051_1000178 3300025303 Bacteria 115109
503 Ga0209051_1000207 3300025303 Bacteria 103683
504 Ga0209051_1000931 3300025303 Bacteria 28957
505 Ga0209051_1004369 3300025303 Bacteria 8755
506 Ga0209051_1016148 3300025303 Bacteria 3400
507 Ga0209051_1021299 3300025303 Bacteria 2764
508 Ga0209051_1026224 3300025303 Bacteria 2354
509 Ga0209257_1000024 3300025304 Bacteria 726068
510 Ga0209257_1000249 3300025304 Bacteria 124522
511 Ga0209257_1004734 3300025304 Bacteria 10176
512 Ga0209257_1019883 3300025304 Bacteria 2508
513 Ga0207697_10018594 3300025315 Bacteria 2849
514 Ga0207656_10005089 3300025321 Bacteria 4623
515 Ga0207656_10018338 3300025321 Bacteria 2754
516 Ga0207655_1004770 3300025728 Bacteria 9456
517 Ga0207655_1067730 3300025728 Bacteria 1342
518 Ga0207655_1125068 3300025728 Bacteria 846
519 Ga0207682_10019861 3300025893 Bacteria 2634
520 Ga0207682_10366174 3300025893 Bacteria 680
521 Ga0207642_10005581 3300025899 Bacteria 4117
522 Ga0207642_10375526 3300025899 Bacteria 845
523 Ga0207680_10086167 3300025903 Bacteria 1986
524 Ga0207680_10152926 3300025903 Bacteria 1540
525 Ga0207680_10320938 3300025903 Bacteria 1083
526 Ga0207680_10338048 3300025903 Bacteria 1056
527 Ga0207680_10509501 3300025903 Bacteria 857
528 Ga0207680_10993635 3300025903 Bacteria 601
529 Ga0207699_10035483 3300025906 Bacteria 2838
530 Ga0207645_10002573 3300025907 Bacteria 14148
531 Ga0207645_10008080 3300025907 Bacteria 7380
532 Ga0207645_10017297 3300025907 Bacteria 4763
533 Ga0207643_10014794 3300025908 Bacteria 4243
534 Ga0207643_10087791 3300025908 Bacteria 1809
535 Ga0207684_10007194 3300025910 Bacteria 10057
536 Ga0207684_10536269 3300025910 Bacteria 1002
537 Ga0207654_10125138 3300025911 Unclassified 1620
538 Ga0207654_10299021 3300025911 Unclassified 1094
539 Ga0207707_10006936 3300025912 Bacteria 9879
540 Ga0207695_10005377 3300025913 Bacteria 17023
541 Ga0207695_10007940 3300025913 Bacteria 13392
542 Ga0207695_10138130 3300025913 Bacteria 2389
543 Ga0207695_10376627 3300025913 Bacteria 1305
544 Ga0207695_10665193 3300025913 Bacteria 922
545 Ga0207671_10007085 3300025914 Bacteria 9808
546 Ga0207671_10056053 3300025914 Bacteria 2920
547 Ga0207671_10070997 3300025914 Bacteria 2597
548 Ga0207671_10294875 3300025914 Bacteria 1281
549 Ga0207671_10995659 3300025914 Unclassified 661
550 Ga0207660_10068643 3300025917 Bacteria 2571
551 Ga0207660_10532301 3300025917 Bacteria 955
552 Ga0207662_10130324 3300025918 Bacteria 1585
553 Ga0207657_10627702 3300025919 Bacteria 837
554 Ga0207649_10266254 3300025920 Bacteria 1240
555 Ga0207652_10145045 3300025921 Unclassified 2124
556 Ga0207646_10101910 3300025922 Bacteria 2574
557 Ga0207681_10000644 3300025923 Bacteria 23228
558 Ga0207681_10185542 3300025923 Bacteria 1588
559 Ga0207681_10238766 3300025923 Bacteria 1414
560 Ga0207681_10245131 3300025923 Bacteria 1396
561 Ga0207681_10904756 3300025923 Bacteria 739
562 Ga0207694_10000601 3300025924 Bacteria 32556
563 Ga0207694_10000920 3300025924 Bacteria 26083
564 Ga0207694_10024601 3300025924 Bacteria 4574
565 Ga0207694_10155247 3300025924 Bacteria 1845
566 Ga0207650_10006427 3300025925 Bacteria 8009
567 Ga0207650_10657425 3300025925 Bacteria 884
568 Ga0207650_10704442 3300025925 Bacteria 853
569 Ga0207659_10000751 3300025926 Bacteria 19207
570 Ga0207659_10006069 3300025926 Bacteria 7376
571 Ga0207659_10753015 3300025926 Bacteria 836
572 Ga0207687_10011986 3300025927 Bacteria 5669
573 Ga0207687_10038600 3300025927 Bacteria 3264
574 Ga0207687_10071514 3300025927 Bacteria 2479
575 Ga0207687_10547425 3300025927 Bacteria 971
576 Ga0207687_10563588 3300025927 Bacteria 957
577 Ga0207644_10010084 3300025931 Bacteria 6222
578 Ga0207644_10020786 3300025931 Bacteria 4465
579 Ga0207644_10031885 3300025931 Bacteria 3675
580 Ga0207644_10039620 3300025931 Bacteria 3326
581 Ga0207644_10248176 3300025931 Bacteria 1419
582 Ga0207690_10147513 3300025932 Bacteria 1741
583 Ga0207706_10006980 3300025933 Bacteria 10440
584 Ga0207706_10017696 3300025933 Bacteria 6421
585 Ga0207686_10080424 3300025934 Bacteria 2124
586 Ga0207686_10104914 3300025934 Bacteria 1894
587 Ga0207686_10167181 3300025934 Bacteria 1547
588 Ga0207686_10402841 3300025934 Bacteria 1043
589 Ga0207686_10627384 3300025934 Bacteria 848
590 Ga0207709_10001937 3300025935 Bacteria 13608
591 Ga0207709_10002102 3300025935 Bacteria 12830
592 Ga0207709_10025447 3300025935 Bacteria 3389
593 Ga0207709_10047583 3300025935 Bacteria 2608
594 Ga0207709_10053433 3300025935 Bacteria 2486
595 Ga0207709_10343225 3300025935 Bacteria 1125
596 Ga0207709_10587663 3300025935 Bacteria 880
597 Ga0207670_10008093 3300025936 Bacteria 5915
598 Ga0207670_10197679 3300025936 Bacteria 1525
599 Ga0207669_10001517 3300025937 Bacteria 9895
600 Ga0207669_10013519 3300025937 Bacteria 4056
601 Ga0207669_10074307 3300025937 Bacteria 2149
602 Ga0207669_10138672 3300025937 Bacteria 1684
603 Ga0207704_10001175 3300025938 Bacteria 11675
604 Ga0207704_10055018 3300025938 Bacteria 2429
605 Ga0207704_10056013 3300025938 Bacteria 2413
606 Ga0207704_10207072 3300025938 Bacteria 1440
607 Ga0207704_10225534 3300025938 Bacteria 1390
608 Ga0207691_10000347 3300025940 Bacteria 46651
609 Ga0207691_10003219 3300025940 Bacteria 15925
610 Ga0207691_10061540 3300025940 Bacteria 3409
611 Ga0207691_10093373 3300025940 Bacteria 2694
612 Ga0207691_10170221 3300025940 Bacteria 1908
613 Ga0207691_10175507 3300025940 Bacteria 1874
614 Ga0207691_10564074 3300025940 Bacteria 965
615 Ga0207711_10004936 3300025941 Bacteria 11328
616 Ga0207711_10096742 3300025941 Bacteria 2606
617 Ga0207689_10002269 3300025942 Bacteria 18022
618 Ga0207689_10010698 3300025942 Bacteria 7893
619 Ga0207689_10293180 3300025942 Bacteria 1348
620 Ga0207661_10142452 3300025944 Bacteria 2064
621 Ga0207661_10895452 3300025944 Bacteria 817
622 Ga0207661_11124060 3300025944 Unclassified 723
623 Ga0207679_10013107 3300025945 Bacteria 5428
624 Ga0207679_10013127 3300025945 Bacteria 5425
625 Ga0207679_10271542 3300025945 Bacteria 1450
626 Ga0207667_10000078 3300025949 Bacteria 165061
627 Ga0207667_10185710 3300025949 Unclassified 2134
628 Ga0207667_10539441 3300025949 Bacteria 1180
629 Ga0207651_10000398 3300025960 Bacteria 18449
630 Ga0207651_10012112 3300025960 Bacteria 4862
631 Ga0207651_10022279 3300025960 Bacteria 3870
632 Ga0207712_10009709 3300025961 Bacteria 6099
633 Ga0207712_10015478 3300025961 Bacteria 4922
634 Ga0207668_10000809 3300025972 Bacteria 19171
635 Ga0207668_10042364 3300025972 Bacteria 3083
636 Ga0207668_10230808 3300025972 Bacteria 1492
637 Ga0207668_10287476 3300025972 Bacteria 1351
638 Ga0207668_10653087 3300025972 Bacteria 921
639 Ga0207640_10057156 3300025981 Bacteria 2565
640 Ga0207658_10002681 3300025986 Bacteria 12869
641 Ga0207658_10010019 3300025986 Bacteria 6439
642 Ga0207658_10035740 3300025986 Bacteria 3559
643 Ga0207658_10074759 3300025986 Bacteria 2575
644 Ga0207658_10380315 3300025986 Bacteria 1236
645 Ga0207677_10004451 3300026023 Bacteria 7523
646 Ga0207677_10008191 3300026023 Bacteria 5822
647 Ga0207677_10011928 3300026023 Bacteria 4974
648 Ga0207677_10031948 3300026023 Bacteria 3378
649 Ga0207677_10138338 3300026023 Bacteria 1860
650 Ga0207703_10002510 3300026035 Bacteria 15864
651 Ga0207703_10013182 3300026035 Bacteria 6439
652 Ga0207703_10800538 3300026035 Bacteria 900
653 Ga0207639_10053359 3300026041 Bacteria 3084
654 Ga0207639_10801366 3300026041 Bacteria 878
655 Ga0207678_10013862 3300026067 Bacteria 7082
656 Ga0207678_10083066 3300026067 Bacteria 2740
657 Ga0207678_10247629 3300026067 Bacteria 1526
658 Ga0207678_10786432 3300026067 Bacteria 840
659 Ga0207708_10013570 3300026075 Bacteria 6091
660 Ga0207708_10022713 3300026075 Bacteria 4737
661 Ga0207708_10083169 3300026075 Bacteria 2461
662 Ga0207708_10144528 3300026075 Bacteria 1868
663 Ga0207702_10311891 3300026078 Bacteria 1496
664 Ga0207702_10352657 3300026078 Bacteria 1408
665 Ga0207702_10760449 3300026078 Unclassified 957
666 Ga0207641_10017015 3300026088 Bacteria 5951
667 Ga0207641_10055684 3300026088 Bacteria 3358
668 Ga0207648_10001863 3300026089 Bacteria 23045
669 Ga0207648_10002881 3300026089 Bacteria 18214
670 Ga0207648_10007895 3300026089 Bacteria 10381
671 Ga0207648_10021442 3300026089 Bacteria 5807
672 Ga0207648_10047745 3300026089 Bacteria 3751
673 Ga0207648_10078374 3300026089 Bacteria 2882
674 Ga0207648_10179559 3300026089 Bacteria 1873
675 Ga0207676_10000082 3300026095 Bacteria 92500
676 Ga0207676_10050076 3300026095 Bacteria 3254
677 Ga0207676_11089170 3300026095 Bacteria 790
678 Ga0207674_10018126 3300026116 Bacteria 7660
679 Ga0207674_10048359 3300026116 Bacteria 4354
680 Ga0207674_10063779 3300026116 Bacteria 3718
681 Ga0207674_10144755 3300026116 Bacteria 2335
682 Ga0207674_10352299 3300026116 Bacteria 1423
683 Ga0207675_100000927 3300026118 Bacteria 29280
684 Ga0207675_100001409 3300026118 Bacteria 24039
685 Ga0207675_100309568 3300026118 Bacteria 1540
686 Ga0207675_100866912 3300026118 Bacteria 918
687 Ga0207675_100940636 3300026118 Bacteria 881
688 Ga0207683_10210587 3300026121 Bacteria 1769
689 Ga0207683_10214579 3300026121 Bacteria 1752
690 Ga0207683_10216547 3300026121 Bacteria 1744
691 Ga0207683_10242335 3300026121 Bacteria 1645
692 Ga0207683_10624846 3300026121 Bacteria 998
693 Ga0207683_10951444 3300026121 Bacteria 798
694 Ga0207698_10100486 3300026142 Bacteria 2396
695 Ga0207698_10255540 3300026142 Bacteria 1606
696 Ga0207698_10292253 3300026142 Bacteria 1513
697 Ga0207698_10353948 3300026142 Bacteria 1388
698 Ga0207698_10661934 3300026142 Bacteria 1035
699 Ga0207698_10688782 3300026142 Bacteria 1016
700 Ga0209282_1105991 3300027666 Bacteria 1437
701 Ga0209813_10122536 3300027866 Bacteria 906
702 Ga0207428_10041116 3300027907 Bacteria 3745
703 Ga0268266_10066894 3300028379 Bacteria 3109
704 Ga0268266_10244025 3300028379 Bacteria 1659
705 Ga0268266_10368331 3300028379 Bacteria 1353
706 Ga0268265_10093044 3300028380 Bacteria 2414
707 Ga0268265_10110441 3300028380 Bacteria 2243
708 Ga0268264_10002202 3300028381 Bacteria 17310
709 Ga0268264_10012690 3300028381 Bacteria 6936
710 Ga0268264_10041350 3300028381 Bacteria 3813
711 Ga0268264_10377324 3300028381 Bacteria 1357
712 Ga0268264_10762697 3300028381 Bacteria 964
713 Ga0307517_10004553 3300028786 Bacteria 21271
714 Ga0307517_10179854 3300028786 Bacteria 1368
715 Ga0307517_10413969 3300028786 Bacteria 709
716 Ga0307515_10000419 3300028794 Bacteria 102271
717 Ga0307515_10000425 3300028794 Bacteria 101790
718 Ga0307515_10000672 3300028794 Bacteria 78835
719 Ga0307515_10011668 3300028794 Bacteria 16643
720 Ga0307515_10023797 3300028794 Bacteria 10710
721 Ga0307515_10050319 3300028794 Bacteria 6244
722 Ga0307515_10083885 3300028794 Bacteria 4101
723 Ga0307515_10102188 3300028794 Bacteria 3451
724 Ga0307515_10126323 3300028794 Bacteria 2854
725 Ga0307515_10470527 3300028794 Bacteria 870
726 Ga0307512_10022817 3300030522 Bacteria 5609
727 Ga0307512_10023039 3300030522 Bacteria 5573
728 Ga0307512_10063478 3300030522 Bacteria 2823
729 Ga0307512_10124236 3300030522 Bacteria 1645
730 Ga0307512_10285754 3300030522 Bacteria 783
731 Ga0265316_10316812 3300031344 Unclassified 1134
732 Ga0307513_10001868 3300031456 Bacteria 29930
733 Ga0307513_10008367 3300031456 Bacteria 13248
734 Ga0307513_10077369 3300031456 Bacteria 3446
735 Ga0307513_10086955 3300031456 Bacteria 3202
736 Ga0307513_10090348 3300031456 Bacteria 3124
737 Ga0307513_10203853 3300031456 Bacteria 1815
738 Ga0307513_10323141 3300031456 Bacteria 1300
739 Ga0307513_10550424 3300031456 Bacteria 866
740 Ga0307509_10003708 3300031507 Bacteria 22858
741 Ga0307509_10004745 3300031507 Bacteria 19393
742 Ga0307509_10007851 3300031507 Bacteria 13797
743 Ga0307509_10038154 3300031507 Bacteria 5244
744 Ga0307509_10236325 3300031507 Bacteria 1625
745 Ga0307509_10332143 3300031507 Bacteria 1251
746 Ga0307509_10603647 3300031507 Bacteria 770
747 Ga0307408_100564043 3300031548 Bacteria 1006
748 Ga0307408_100947544 3300031548 Bacteria 790
749 Ga0307408_101100691 3300031548 Bacteria 737
750 Ga0307508_10000278 3300031616 Bacteria 62985
751 Ga0307508_10008282 3300031616 Bacteria 9624
752 Ga0307508_10016618 3300031616 Bacteria 6696
753 Ga0307508_10072891 3300031616 Bacteria 3009
754 Ga0307514_10001174 3300031649 Bacteria 35389
755 Ga0307514_10009496 3300031649 Bacteria 8170
756 Ga0307514_10096609 3300031649 Bacteria 2134
757 Ga0307514_10237904 3300031649 Bacteria 1095
758 Ga0265314_10178784 3300031711 Bacteria 1273
759 Ga0265314_10231927 3300031711 Bacteria 1070
760 Ga0307516_10000237 3300031730 Bacteria 70929
761 Ga0307516_10099481 3300031730 Bacteria 2725
762 Ga0307516_10344365 3300031730 Bacteria 1157
763 Ga0307405_10164268 3300031731 Bacteria 1576
764 Ga0307405_10254616 3300031731 Bacteria 1308
765 Ga0307413_10201349 3300031824 Bacteria 1438
766 Ga0307410_10087844 3300031852 Bacteria 2200
767 Ga0307406_10033320 3300031901 Bacteria 3153
768 Ga0307406_10123962 3300031901 Bacteria 1801
769 Ga0307406_10365334 3300031901 Bacteria 1133
770 Ga0307406_10442887 3300031901 Bacteria 1040
771 Ga0307406_10472442 3300031901 Bacteria 1011
772 Ga0307412_10034281 3300031911 Bacteria 3234
773 Ga0307412_10431217 3300031911 Bacteria 1081
774 Ga0307412_10692821 3300031911 Bacteria 874
775 Ga0307412_10714539 3300031911 Bacteria 861
776 Ga0307412_11382326 3300031911 Bacteria 636
777 Ga0307409_100028240 3300031995 Bacteria 3993
778 Ga0307409_100030037 3300031995 Bacteria 3899
779 Ga0307409_100566255 3300031995 Bacteria 1118
780 Ga0307416_100033297 3300032002 Bacteria 3905
781 Ga0307416_100106923 3300032002 Bacteria 2454
782 Ga0307416_100287504 3300032002 Unclassified 1625
783 Ga0307416_101019003 3300032002 Unclassified 931
784 Ga0307416_101020974 3300032002 Bacteria 930
785 Ga0307411_10057995 3300032005 Bacteria 2560
786 Ga0307411_11475033 3300032005 Bacteria 624
787 Ga0307415_100151750 3300032126 Bacteria 1784
788 Ga0307415_101284880 3300032126 Bacteria 693
789 Ga0307507_10104119 3300033179 Bacteria 2357
790 Ga0307510_10022805 3300033180 Bacteria 7262
791 Ga0307510_10173630 3300033180 Bacteria 1730
792 Ga0307510_10276625 3300033180 Bacteria 1151
793 Ga0373944_0067142 3300035089 Bacteria 1161
794 Ga0373944_0115874 3300035089 Bacteria 919
795 Ga0373939_0195590 3300035114 Bacteria 762
796 Ga0373945_0182128 3300035116 Bacteria 865
797 Ga0373943_0005469 3300035170 Bacteria 5718
798 Ga0373946_0021686 3300035171 Bacteria 2493
799 Ga0373946_0095441 3300035171 Bacteria 1325
800 Ga0373931_0495605 3300035691 Bacteria 787
801 Ga0373935_0115537 3300035692 Bacteria 1786
802 Ga0373935_0669197 3300035692 Bacteria 762
803 Ga0373927_0031372 3300035695 Bacteria 3464
804 Ga0373927_0040785 3300035695 Bacteria 3011
805 Ga0373947_0008740 3300035725 Bacteria 5824
806 Ga0373937_0047465 3300036401 Bacteria 3929
807 Ga0373937_0125469 3300036401 Bacteria 2394
808 Ga0373925_0004060 3300037068 Bacteria 11121
809 Ga0373925_0122348 3300037068 Bacteria 2021
810 Ga0373925_0193640 3300037068 Bacteria 1614
811 Ga0395898_0237105 3300037466 Bacteria 1740
812 Ga0395905_0005642 3300037471 Bacteria 12729
813 Ga0395905_0006264 3300037471 Bacteria 12008
814 Ga0395905_0115347 3300037471 Bacteria 2524
815 Ga0395905_0285411 3300037471 Bacteria 1537
816 Ga0395905_0489662 3300037471 Bacteria 1129
817 Ga0395901_0518233 3300038443 Bacteria 1212
818 Ga0436365_1402919 3300039437 Bacteria 1910
819 Ga0436361_0221167 3300039447 Bacteria 2159
820 Ga0436361_0644663 3300039447 Bacteria 3077
821 Ga0436363_1469836 3300039450 Bacteria 2615
822 Ga0439436_0000134 3300041404 Bacteria 16918
823 Ga0439436_0000962 3300041404 Bacteria 7953
824 Ga0439438_125193 3300041405 Bacteria 617
825 Ga0439439_0004760 3300041406 Bacteria 3073
826 Ga0439439_0038287 3300041406 Bacteria 1238
827 Ga0439447_031631 3300041407 Bacteria 1327
828 Ga0439461_0004034 3300041410 Bacteria 2437
829 Ga0439461_0024933 3300041410 Bacteria 1212
830 Ga0439466_0006068 3300041411 Bacteria 4600
831 Ga0439465_0000339 3300041413 Bacteria 13362
832 Ga0451791_0210227 3300041451 Bacteria 865
833 Ga0451793_0124799 3300041452 Bacteria 983
834 Ga0451800_0939557 3300041459 Bacteria 628
835 Ga0451853_1321958 3300041512 Bacteria 925
836 Ga0439431_0009901 3300041997 Bacteria 2157
837 Ga0439433_0000087 3300041999 Bacteria 12676
838 Ga0439441_021416 3300042001 Unclassified 1193
839 Ga0439442_001006 3300042002 Bacteria 5694
840 Ga0439445_0009738 3300042004 Bacteria 2267
841 Ga0439445_0018295 3300042004 Bacteria 1738
842 Ga0439432_000527 3300042006 Bacteria 14248
843 Ga0439432_036027 3300042006 Bacteria 1584
844 Ga0439449_0000385 3300042007 Bacteria 16338
845 Ga0439449_0004263 3300042007 Bacteria 5531
846 Ga0439449_0011605 3300042007 Bacteria 3313
847 Ga0439450_052174 3300042008 Bacteria 974
848 Ga0439452_002869 3300042010 Bacteria 6196
849 Ga0439455_0018540 3300042012 Bacteria 1632
850 Ga0439455_0089309 3300042012 Bacteria 844
851 Ga0439457_021681 3300042014 Bacteria 1424
852 Ga0439462_0001243 3300042015 Bacteria 5579
853 Ga0439462_0005291 3300042015 Bacteria 3178
854 Ga0450911_000225 3300042115 Bacteria 21810
855 Ga0450923_002780 3300042125 Bacteria 2560
856 Ga0450894_015107 3300042131 Bacteria 1021
857 Ga0450896_024752 3300042133 Bacteria 890
858 Ga0450898_015921 3300042134 Bacteria 1279
859 Ga0450898_025829 3300042134 Bacteria 1056
860 Ga0450898_028365 3300042134 Bacteria 1017
861 Ga0450905_009627 3300042142 Bacteria 1331
862 Ga0439446_0035330 3300042156 Bacteria 1457
863 Ga0439434_0003391 3300042435 Bacteria 4665
864 Ga0439434_0116530 3300042435 Bacteria 868
865 Ga0450918_040166 3300042531 Bacteria 838
866 Ga0451577_0068194 3300042876 Bacteria 3173
867 Ga0466960_0143879 3300044901 Bacteria 1268
868 Ga0495617_001251 3300046452 Bacteria 11401
869 Ga0495592_0000211 3300046454 Bacteria 49780
870 Ga0495603_0362366 3300046455 Bacteria 832
871 Ga0495590_0000092 3300046457 Bacteria 55212
872 Ga0495590_0001972 3300046457 Bacteria 8648
873 Ga0495590_0013034 3300046457 Bacteria 3065
874 Ga0495629_0032522 3300046459 Bacteria 3692
875 Ga0495629_0042748 3300046459 Bacteria 3184
876 Ga0495638_0015754 3300046460 Bacteria 5066
877 Ga0495638_0022034 3300046460 Bacteria 4187
878 Ga0495638_0074021 3300046460 Bacteria 2078
879 Ga0495638_0090658 3300046460 Bacteria 1842
880 Ga0495653_0380860 3300046463 Bacteria 901
881 Ga0495650_0008406 3300046471 Bacteria 6028
882 Ga0495650_0136472 3300046471 Bacteria 891
883 Ga0495580_0074019 3300046472 Bacteria 2378
884 Ga0495582_0085048 3300046473 Bacteria 1759
885 Ga0495582_0185706 3300046473 Bacteria 1185
886 Ga0495605_0039596 3300046474 Bacteria 2360
887 Ga0495605_0045936 3300046474 Bacteria 2149
888 Ga0495605_0133015 3300046474 Bacteria 1120
889 Ga0495605_0309183 3300046474 Bacteria 667
890 Ga0495639_0071706 3300046475 Bacteria 1600
891 Ga0495639_0106342 3300046475 Bacteria 1328
892 Ga0495639_0235238 3300046475 Bacteria 903
893 Ga0495584_0000300 3300046491 Bacteria 34910
894 Ga0495584_0296713 3300046491 Bacteria 821
895 Ga0495584_0489128 3300046491 Unclassified 627
896 Ga0495585_0018990 3300046492 Bacteria 3966
897 Ga0495585_0022023 3300046492 Bacteria 3658
898 Ga0495585_0053439 3300046492 Bacteria 2235
899 Ga0495594_0164175 3300046499 Bacteria 1263
900 Ga0495594_0472226 3300046499 Unclassified 713
901 Ga0495596_0006345 3300046500 Bacteria 5452
902 Ga0495596_0023058 3300046500 Bacteria 2528
903 Ga0495607_0000359 3300046501 Bacteria 47053
904 Ga0495607_0041673 3300046501 Bacteria 2725
905 Ga0495607_0071949 3300046501 Bacteria 1926
906 Ga0495607_0293988 3300046501 Bacteria 766
907 Ga0495583_0000067 3300046506 Bacteria 189381
908 Ga0495583_0000563 3300046506 Bacteria 51367
909 Ga0495583_0067301 3300046506 Bacteria 1583
910 Ga0495583_0167731 3300046506 Bacteria 903
911 Ga0495583_0168690 3300046506 Bacteria 900
912 Ga0495583_0375639 3300046506 Bacteria 559
913 Ga0495606_0002420 3300046507 Bacteria 21749
914 Ga0495606_0256544 3300046507 Bacteria 967
915 Ga0495606_0262079 3300046507 Bacteria 954
916 Ga0495610_0089206 3300046512 Bacteria 1400
917 Ga0495610_0298873 3300046512 Bacteria 621
918 Ga0495616_0000933 3300046513 Bacteria 21041
919 Ga0495616_0006364 3300046513 Bacteria 7157
920 Ga0495616_0040782 3300046513 Bacteria 2370
921 Ga0495618_0318948 3300046514 Bacteria 963
922 Ga0495620_0010656 3300046515 Bacteria 4840
923 Ga0495628_0124485 3300046516 Bacteria 1976
924 Ga0495628_0404365 3300046516 Bacteria 997
925 Ga0495631_0000176 3300046518 Bacteria 43388
926 Ga0495631_0050645 3300046518 Bacteria 1816
927 Ga0495632_0023431 3300046519 Bacteria 3297
928 Ga0495637_0003577 3300046520 Bacteria 8236
929 Ga0495637_0026699 3300046520 Bacteria 2589
930 Ga0495637_0232339 3300046520 Bacteria 668
931 Ga0495643_0009326 3300046522 Bacteria 6109
932 Ga0495643_0048890 3300046522 Bacteria 2283
933 Ga0495643_0121266 3300046522 Bacteria 1321
934 Ga0495644_0000501 3300046523 Bacteria 16743
935 Ga0495648_0000831 3300046524 Bacteria 32651
936 Ga0495648_0012948 3300046524 Bacteria 6194
937 Ga0495648_0026694 3300046524 Bacteria 3884
938 Ga0495648_0139802 3300046524 Bacteria 1276
939 Ga0495663_0065291 3300046525 Bacteria 1150
940 Ga0495642_0001270 3300046528 Bacteria 11421
941 Ga0495642_0092321 3300046528 Bacteria 1282
942 Ga0495642_0359572 3300046528 Bacteria 640
943 Ga0495654_0003149 3300046530 Bacteria 10235
944 Ga0495654_0003294 3300046530 Bacteria 9952
945 Ga0495654_0115443 3300046530 Bacteria 1221
946 Ga0495654_0211074 3300046530 Bacteria 826
947 Ga0495665_0103479 3300046531 Bacteria 1494
948 Ga0495640_0123366 3300046533 Bacteria 1682
949 Ga0495640_0240409 3300046533 Bacteria 1137
950 Ga0495609_0001479 3300046538 Bacteria 15589
951 Ga0495609_0036063 3300046538 Bacteria 2235
952 Ga0495609_0212485 3300046538 Bacteria 805
953 Ga0495621_0003592 3300046539 Bacteria 4282
954 Ga0495597_0005431 3300046542 Bacteria 6745
955 Ga0495597_0020388 3300046542 Bacteria 3089
956 Ga0495597_0039235 3300046542 Bacteria 2121
957 Ga0495597_0082577 3300046542 Bacteria 1372
958 Ga0495622_0000011 3300046557 Bacteria 201507
959 Ga0495622_0017968 3300046557 Bacteria 3294
960 Ga0495622_0062685 3300046557 Bacteria 1721
961 Ga0495633_0013261 3300046558 Bacteria 4350
962 Ga0495633_0015014 3300046558 Bacteria 4026
963 Ga0495656_0000055 3300046615 Bacteria 53908
964 Ga0495656_0001368 3300046615 Bacteria 7975
965 Ga0495656_0014289 3300046615 Bacteria 2974
966 Ga0495656_0029376 3300046615 Bacteria 2213
967 Ga0495656_0306741 3300046615 Bacteria 815
968 Ga0495668_0009680 3300046616 Bacteria 5893
969 Ga0495668_0014680 3300046616 Bacteria 4587
970 Ga0495668_0032416 3300046616 Bacteria 2940
971 Ga0495668_0049884 3300046616 Bacteria 2321
972 Ga0495668_0211190 3300046616 Bacteria 1063
973 Ga0495634_0268308 3300046642 Bacteria 1039
974 Ga0495611_0008860 3300046648 Bacteria 4254
975 Ga0495625_0000708 3300046660 Bacteria 47135
976 Ga0495625_0019127 3300046660 Bacteria 5326
977 Ga0495625_0019215 3300046660 Bacteria 5307
978 Ga0495625_0020257 3300046660 Bacteria 5139
979 Ga0495625_0056406 3300046660 Bacteria 2796
980 Ga0495625_0069863 3300046660 Bacteria 2467
981 Ga0495635_0102477 3300046663 Bacteria 1956
982 Ga0495635_0171602 3300046663 Bacteria 1475
983 Ga0495635_0320566 3300046663 Bacteria 1037
984 Ga0495659_0000193 3300046664 Bacteria 26723
985 Ga0495659_0048214 3300046664 Bacteria 1543
986 Ga0495661_0000755 3300046665 Bacteria 31313
987 Ga0495661_0000987 3300046665 Bacteria 25699
988 Ga0495661_0004847 3300046665 Bacteria 9638
989 Ga0495661_0185973 3300046665 Bacteria 1097
990 Ga0495661_0261924 3300046665 Bacteria 878
991 Ga0495661_0266886 3300046665 Bacteria 867
992 Ga0495661_0315951 3300046665 Bacteria 777
993 Ga0495588_0097954 3300046674 Bacteria 1539
994 Ga0495588_0368698 3300046674 Bacteria 754
995 Ga0495599_0297918 3300046678 Bacteria 974
996 Ga0495646_0259762 3300046680 Bacteria 928
997 Ga0495647_0037297 3300046681 Bacteria 1833
998 Ga0495647_0053062 3300046681 Bacteria 1580
999 Ga0495647_0159299 3300046681 Bacteria 972
1000 Ga0495647_0176505 3300046681 Bacteria 928
1001 Ga0495658_0015016 3300046683 Bacteria 3968
1002 Ga0495658_0070109 3300046683 Bacteria 2033
1003 Ga0495658_0081857 3300046683 Bacteria 1896
1004 Ga0495658_0354995 3300046683 Bacteria 932
1005 Ga0495613_0669775 3300046689 Bacteria 685
1006 Ga0495624_0073836 3300046690 Bacteria 2120
1007 Ga0495624_0084705 3300046690 Bacteria 1959
1008 Ga0495670_0005694 3300046691 Bacteria 6109
1009 Ga0495670_0005878 3300046691 Bacteria 6015
1010 Ga0495670_0105166 3300046691 Bacteria 1457
1011 Ga0495670_0401552 3300046691 Bacteria 740
1012 Ga0495671_0001321 3300046692 Bacteria 16827
1013 Ga0495671_0005250 3300046692 Bacteria 7605
1014 Ga0495671_0125520 3300046692 Bacteria 1251
1015 Ga0495671_0135871 3300046692 Bacteria 1199
1016 Ga0495671_0441055 3300046692 Bacteria 622
1017 Ga0495649_0001209 3300046694 Bacteria 19919
1018 Ga0495589_0020773 3300046794 Bacteria 3357
1019 Ga0495589_0069801 3300046794 Bacteria 1718
1020 Ga0495600_0032003 3300046809 Bacteria 3411
1021 Ga0495600_0425893 3300046809 Bacteria 823
1022 Ga0495600_0564390 3300046809 Bacteria 694
1023 Ga0495660_0004413 3300046810 Bacteria 8519
1024 Ga0495660_0015585 3300046810 Bacteria 4391
1025 Ga0495660_0046913 3300046810 Bacteria 2368
1026 Ga0495660_0057750 3300046810 Bacteria 2093
1027 Ga0495581_0205380 3300047315 Bacteria 1152
1028 Ga0495636_0000302 3300047318 Bacteria 19376
1029 Ga0495674_0152238 3300047319 Bacteria 1939
1030 Ga0495674_0466405 3300047319 Bacteria 1013
1031 Ga0495672_0003302 3300047320 Bacteria 13939
1032 Ga0495672_0150664 3300047320 Bacteria 1206
1033 Ga0495676_0061675 3300047321 Bacteria 2932
1034 Ga0495676_0109107 3300047321 Bacteria 2035
1035 Ga0495676_0236496 3300047321 Bacteria 1252
1036 Ga0495683_0068546 3300047323 Bacteria 1744
1037 Ga0495683_0181697 3300047323 Bacteria 960
1038 Ga0495687_000153 3300047443 Bacteria 105215
1039 Ga0495687_003793 3300047443 Bacteria 10667
1040 Ga0495687_008489 3300047443 Bacteria 5875
1041 Ga0495687_012212 3300047443 Bacteria 4556
1042 Ga0495677_0001414 3300047445 Bacteria 9642
1043 Ga0495677_0184931 3300047445 Bacteria 808
1044 Ga0495679_001633 3300047446 Bacteria 12492
1045 Ga0495685_000011 3300047447 Bacteria 83484
1046 Ga0495685_086382 3300047447 Bacteria 1042
1047 Ga0495685_176602 3300047447 Bacteria 689
1048 Ga0495673_0004503 3300047469 Bacteria 8702
1049 Ga0495681_0055933 3300047470 Bacteria 1838
1050 Ga0495684_0115155 3300047471 Bacteria 2027
1051 Ga0495684_0666773 3300047471 Bacteria 694
1052 Ga0495686_0001736 3300047472 Bacteria 22399
1053 Ga0495593_0017494 3300047673 Bacteria 4035
1054 Ga0495593_0090851 3300047673 Bacteria 1572
1055 Ga0495614_0081431 3300048089 Bacteria 1402
1056 Ga0495614_0082709 3300048089 Bacteria 1392
1057 Ga0495614_0452816 3300048089 Bacteria 607
1058 Ga0495615_0068733 3300048090 Bacteria 950
1059 Ga0495626_0000657 3300048091 Bacteria 33248
1060 Ga0495626_0000701 3300048091 Bacteria 31837
1061 Ga0495626_0009276 3300048091 Bacteria 5323
1062 Ga0495626_0022010 3300048091 Bacteria 3153
1063 Ga0495626_0198048 3300048091 Bacteria 825
1064 Ga0496100_0101842 3300048903 Bacteria 1980
1065 Ga0496101_0010546 3300048904 Bacteria 6103
1066 Ga0496102_0014578 3300048905 Bacteria 6831
1067 Ga0496102_0125873 3300048905 Bacteria 2395
1068 Ga0496103_0010336 3300048906 Bacteria 5523
1069 Ga0496104_0015327 3300048907 Bacteria 6941
1070 Ga0496104_1466667 3300048907 Bacteria 585
1071 Ga0496105_0002074 3300048908 Bacteria 14503
1072 Ga0496106_0024302 3300048909 Bacteria 4504
1073 Ga0496106_0894476 3300048909 Bacteria 701
1074 Ga0496107_0036652 3300048910 Bacteria 3518
1075 Ga0496108_0022182 3300048911 Bacteria 5220
1076 Ga0496110_0029223 3300048913 Bacteria 4741
1077 Ga0496111_0124593 3300048914 Bacteria 1904
1078 Ga0496113_0350757 3300048916 Bacteria 1184
1079 Ga0496113_0780584 3300048916 Unclassified 760
1080 Ga0496114_0069772 3300048917 Bacteria 2951
1081 Ga0496114_0485770 3300048917 Bacteria 1093
1082 Ga0496114_1502968 3300048917 Bacteria 561
1083 Ga0496116_0057954 3300048919 Bacteria 2528
1084 Ga0496116_0089477 3300048919 Bacteria 1877
1085 Ga0496117_0013969 3300048920 Bacteria 6958
1086 Ga0496117_0016300 3300048920 Bacteria 6278
1087 Ga0496117_0076287 3300048920 Bacteria 2223
1088 Ga0496118_0027766 3300048921 Bacteria 4781
1089 Ga0496118_0028081 3300048921 Bacteria 4747
1090 Ga0496121_0199642 3300048924 Bacteria 1426
1091 Ga0496121_0453743 3300048924 Bacteria 825
1092 Ga0496123_0103082 3300048926 Bacteria 1654
1093 Ga0496123_0127159 3300048926 Bacteria 1420
1094 Ga0496124_0300654 3300048927 Bacteria 1159
1095 Ga0496125_0027812 3300048928 Bacteria 5118
1096 Ga0496125_0438466 3300048928 Bacteria 752
1097 Ga0496126_0081296 3300048929 Bacteria 2865
1098 Ga0496126_0639021 3300048929 Bacteria 834
1099 Ga0495678_000367 3300049459 Bacteria 46226
1100 Ga0495678_008149 3300049459 Bacteria 5331
1101 Ga0495682_0000199 3300049460 Bacteria 48422
1102 Ga0495682_0001987 3300049460 Bacteria 10110
1103 Ga0495682_0109679 3300049460 Bacteria 989
1104 Ga0495682_0271472 3300049460 Bacteria 599
1105 Ga0501292_009487 3300049515 Bacteria 1445
1106 Ga0501292_022134 3300049515 Unclassified 1033
1107 Ga0501294_008077 3300049517 Bacteria 1022
1108 Ga0501298_002185 3300049521 Bacteria 2946
1109 Ga0501299_032863 3300049522 Bacteria 1009
1110 Ga0501032_0110228 3300049569 Bacteria 1822
1111 Ga0501041_0406562 3300049577 Bacteria 863
1112 Ga0501043_0000004 3300049579 Bacteria 291085
1113 Ga0501046_0000016 3300049580 Bacteria 234374
1114 Ga0501047_0000012 3300049581 Bacteria 368824
1115 Ga0501048_0000926 3300049582 Bacteria 21609
1116 Ga0501048_0791366 3300049582 Bacteria 681
1117 Ga0501071_0041686 3300049587 Plasmid 3288
1118 Ga0501071_0114982 3300049587 Bacteria 1991
1119 Ga0501071_1111199 3300049587 Archaea 611
1120 Ga0501199_013270 3300049650 Bacteria 906
1121 Ga0501206_002813 3300049653 Bacteria 2190
1122 Ga0501257_037872 3300049686 Bacteria 1177
1123 Ga0501259_058687 3300049688 Bacteria 799
1124 Ga0501081_0455501 3300049743 Bacteria 951
1125 Ga0501262_009881 3300049759 Bacteria 1186
1126 Ga0501273_006673 3300049770 Bacteria 1341
1127 Ga0501281_03099 3300049777 Bacteria 1191
1128 Ga0501045_0002191 3300049824 Bacteria 13251
1129 Ga0501045_0704258 3300049824 Unclassified 745
1130 nmdc:mga03683_107284_c1 3300050489 Bacteria 1232
1131 nmdc:mga03683_12530_c1 3300050489 Bacteria 3100
1132 nmdc:mga03683_37272_c1 3300050489 Bacteria 1981
1133 nmdc:mga03n38_19665_c1 3300050490 Bacteria 2687
1134 nmdc:mga03n38_62210_c1 3300050490 Bacteria 1702
1135 nmdc:mga00v17_152623_c1 3300050491 Bacteria 1484
1136 nmdc:mga00v17_2771_c1 3300050491 Bacteria 8996
1137 nmdc:mga00v17_344318_c1 3300050491 Bacteria 969
1138 nmdc:mga0yw44_119897_c1 3300050492 Bacteria 1693
1139 nmdc:mga0yw44_5627_c1 3300050492 Bacteria 5959
1140 nmdc:mga0k408_19767_c1 3300050493 Bacteria 3768
1141 nmdc:mga0k408_251645_c1 3300050493 Bacteria 1055
1142 nmdc:mga0k408_31050_c1 3300050493 Bacteria 3049
1143 nmdc:mga0k408_33051_c1 3300050493 Bacteria 2957
1144 nmdc:mga0k408_33349_c1 3300050493 Bacteria 2945
1145 nmdc:mga0k408_33984_c1 3300050493 Bacteria 2918
1146 nmdc:mga0k408_36165_c1 3300050493 Bacteria 2834
1147 nmdc:mga0k408_44858_c1 3300050493 Bacteria 2550
1148 nmdc:mga0k408_55074_c1 3300050493 Bacteria 2306
1149 nmdc:mga0k408_5871_c1 3300050493 Bacteria 6542
1150 nmdc:mga0k408_60655_c1 3300050493 Bacteria 2198
1151 nmdc:mga0k408_73875_c1 3300050493 Bacteria 1992
1152 nmdc:mga0k408_80835_c1 3300050493 Bacteria 1903
1153 nmdc:mga0k408_92205_c1 3300050493 Bacteria 1475
1154 nmdc:mga06z11_707678_c1 3300050494 Bacteria 614
1155 nmdc:mga04h51_150436_c1 3300050495 Bacteria 889
1156 nmdc:mga07m45_103848_c1 3300050496 Bacteria 1634
1157 nmdc:mga07m45_1144_c1 3300050496 Bacteria 11893
1158 nmdc:mga07m45_2026_c2 3300050496 Bacteria 4488
1159 nmdc:mga07m45_245524_c1 3300050496 Bacteria 1042
1160 nmdc:mga07m45_2594_c1 3300050496 Bacteria 8516
1161 nmdc:mga07m45_397680_c1 3300050496 Bacteria 800
1162 nmdc:mga07m45_607872_c1 3300050496 Bacteria 631
1163 nmdc:mga07m45_83596_c1 3300050496 Bacteria 1825
1164 nmdc:mga05p37_286583_c1 3300050507 Bacteria 1962
1165 nmdc:mga05p37_922713_c1 3300050507 Bacteria 938
1166 nmdc:mga09592_288559_c1 3300050508 Bacteria 1423
1167 nmdc:mga0qj67_520062_c1 3300050509 Unclassified 956
1168 nmdc:mga06r32_186776_c1 3300050510 Bacteria 2060
1169 nmdc:mga08y16_183385_c1 3300050511 Bacteria 2172
1170 nmdc:mga08y16_62434_c1 3300050511 Bacteria 3891
1171 nmdc:mga08y16_755306_c1 3300050511 Bacteria 968
1172 nmdc:mga0a205_191393_c1 3300050515 Bacteria 1938
1173 nmdc:mga0sz30_110451_c1 3300050516 Bacteria 1205
1174 nmdc:mga0sz30_230223_c1 3300050516 Bacteria 825
1175 nmdc:mga0sz30_34397_c1 3300050516 Bacteria 2109
1176 Ga0495601_0018255 3300053077 Bacteria 4267
1177 Ga0495612_0084174 3300053078 Bacteria 1339
1178 Ga0495612_0123928 3300053078 Bacteria 1113
1179 Ga0500610_0003534 3300053079 Bacteria 6027
1180 Ga0500610_0032538 3300053079 Bacteria 2655
1181 Ga0495619_0048380 3300053085 Bacteria 2802
1182 Ga0500643_008391 3300053087 Bacteria 4062
1183 Ga0500644_0007132 3300053088 Bacteria 2898
1184 Ga0500583_0049976 3300053092 Bacteria 1937
1185 Ga0500651_0000289 3300053093 Bacteria 29197
1186 Ga0500651_0135524 3300053093 Bacteria 1487
1187 Ga0500566_0078985 3300053094 Bacteria 1835
1188 Ga0500562_004272 3300053108 Bacteria 3615
1189 Ga0500562_020605 3300053108 Bacteria 1712
1190 Ga0500571_000089 3300053110 Bacteria 29120
1191 Ga0500572_076012 3300053111 Bacteria 1045
1192 Ga0500592_004261 3300053116 Bacteria 2284
1193 Ga0500594_0010549 3300053118 Bacteria 2147
1194 Ga0500607_000942 3300053121 Bacteria 27845
1195 Ga0500607_012041 3300053121 Bacteria 5094
1196 Ga0500608_011017 3300053122 Bacteria 3908
1197 Ga0500608_075230 3300053122 Bacteria 1601
1198 Ga0500618_027127 3300053125 Bacteria 1364
1199 Ga0500618_027711 3300053125 Bacteria 1346
1200 Ga0500628_060006 3300053129 Bacteria 927
1201 Ga0500658_0000137 3300053134 Bacteria 34691
1202 Ga0500658_0000140 3300053134 Bacteria 34349
1203 Ga0500658_0015270 3300053134 Bacteria 2849
1204 Ga0500559_0000166 3300053136 Bacteria 51944
1205 Ga0500564_057811 3300053138 Bacteria 1764
1206 Ga0500564_066507 3300053138 Bacteria 1630
1207 Ga0500568_0000735 3300053139 Bacteria 23510
1208 Ga0500568_0025308 3300053139 Bacteria 2505
1209 Ga0500574_019578 3300053141 Bacteria 1687
1210 Ga0500577_0079072 3300053142 Bacteria 1307
1211 Ga0500586_016719 3300053145 Bacteria 2232
1212 Ga0500589_010275 3300053147 Bacteria 3996
1213 Ga0500616_0079167 3300053153 Bacteria 1655
1214 Ga0500619_069489 3300053154 Bacteria 1169
1215 Ga0500627_0043809 3300053158 Bacteria 1931
1216 Ga0500634_0011590 3300053161 Bacteria 4557
1217 Ga0500634_0018046 3300053161 Bacteria 3784
1218 Ga0500638_046305 3300053162 Bacteria 2108
1219 Ga0500636_0044573 3300053177 Bacteria 2616
1220 Ga0500625_029427 3300053729 Bacteria 2608
1221 Ga0500587_002063 3300053739 Bacteria 2868
1222 Ga0501084_0280439 3300054114 Bacteria 1407
1223 Ga0590071_021025 3300059421 Bacteria 1537
1224 Ga0466962_0096217 3300061719 Bacteria 1420
1225 Ga0530510_0390804 3300061734 Unclassified 1048
1226 2513230589 2513020051 Bacteria 6053213
1227 2599626406 2599185214 Bacteria 8209958
1228 2599676270 2599185226 Bacteria 8233575
1229 2599682108 2599185227 Bacteria 8246414
1230 2599695758 2599185229 Bacteria 8216126
1231 2644328564 2643221658 Bacteria 6064537
1232 2644338858 2643221660 Bacteria 4208257
1233 2644399804 2643221672 Bacteria 6322190
1234 2644465032 2643221683 Bacteria 5749203
1235 2738721379 2738541277 Bacteria 7458140
1236 2738880738 2738541307 Bacteria 8606193
1237 2739249625 2738543013 Bacteria 5618633
1238 2739281048 2738543019 Bacteria 7459457
1239 2819601682 2818991446 Bacteria 7757362
1240 2831272118 2831265667 Bacteria 7184833
1241 2838059281 2838054893 Bacteria 7451788
1242 2885195012 2885192300 Bacteria 5882526
1243 2885202982 2885198086 Bacteria 7212419
1244 2885216621 2885211737 Bacteria 7212420
1245 2899930749 2899924645 Bacteria 7487985
1246 2904456480 2904449895 Bacteria 6927402
1247 2904461462 2904456579 Bacteria 6819253
1248 2904545375 2904541872 Bacteria 8915136
1249 2928040930 2928037797 Bacteria 7273642
1250 2928047772 2928044640 Bacteria 7271509
1251 2928055663 2928051484 Bacteria 7773759
1252 2928069761 2928064002 Bacteria 7419480
1253 2928075381 2928070936 Bacteria 8062541
1254 2928088461 2928084124 Bacteria 7159212
1255 2929165565 2929160207 Bacteria 9075316
1256 2929522996 2929520902 Bacteria 6765052
1257 2945909761 2945909444 Bacteria 7065066
1258 8047673713 8047673197 Bacteria 7395230
1259 Ga0070662_100009196
1260 JGI24740J21852_10010212
1261 JGI25152J39213_1014372
1262 JGI25150J39212_1000692
1263 JGI25159J45721_1008171
1264 JGI25159J45721_1024032
1265 JGI25159J45721_1034896
1266 JGI25151J46595_10000966
1267 JGI25151J46595_10032862
1268 JGI25151J46595_10033648
1269 JGI25151J46595_10049812
1270 JGI25153J46596_10015324
1271 JGI25153J46596_10038516
1272 rootH2_10009454
1273 rootL2_10020422
1274 rootL2_10113471
1275 JGI25160J50197_1051024
1276 JGI25160J50197_1058914
1277 JGI25407J50210_10071250
1278 JGI25161J50226_1006587
1279 JGI25161J50226_1019299
1280 Ga0055532_1015032
1281 Ga0055527_1008415
1282 Ga0055535_1001074
1283 Ga0055542_1000074
1284 Ga0055526_1042004
1285 Ga0055526_1063622
1286 Ga0055537_1013714
1287 Ga0055537_1014024
1288 Ga0055524_1061519
1289 Ga0055536_1000980
1290 Ga0055536_1013599
1291 Ga0055534_1006770
1292 Ga0055534_1011553
1293 Ga0055534_1018300
1294 Ga0055534_1018301
1295 Ga0055528_1015002
1296 Ga0055528_1029096
1297 Ga0055530_10000437
1298 Ga0055530_10011577
1299 Ga0055540_1002229
1300 Ga0055540_1005977
1301 Ga0055540_1007891
1302 Ga0055531_10000809
1303 Ga0055531_10025336
1304 Ga0055531_10027333
1305 Ga0055543_1043910
1306 Ga0065165_1011798
1307 Ga0065714_10104460
1308 Ga0065714_10204003
1309 Ga0065704_10081990
1310 Ga0065712_10316088
1311 Ga0065707_10101401
1312 Ga0070658_10057194
1313 Ga0070658_10382387
1314 Ga0070658_10682662
1315 Ga0070676_10002959
1316 Ga0070676_10003006
1317 Ga0070676_10009607
1318 Ga0070676_10048770
1319 Ga0070676_10115300
1320 Ga0070683_100124461
1321 Ga0070683_100179924
1322 Ga0070683_100503711
1323 Ga0070690_100176086
1324 Ga0070690_100300565
1325 Ga0070670_100011371
1326 Ga0070670_100158075
1327 Ga0070670_100166921
1328 Ga0070670_100254958
1329 Ga0070677_10265891
1330 Ga0068869_100004690
1331 Ga0068869_100014419
1332 Ga0068869_100066156
1333 Ga0068869_101290440
1334 Ga0070666_10002130
1335 Ga0070666_10242878
1336 Ga0070666_10582288
1337 Ga0070680_100051495
1338 Ga0070680_100311391
1339 Ga0068868_100051509
1340 Ga0068868_100054986
1341 Ga0068868_100155069
1342 Ga0068868_100964320
1343 Ga0068868_101602450
1344 Ga0070689_100014421
1345 Ga0070691_10218433
1346 Ga0070691_10281495
1347 Ga0070687_100118412
1348 Ga0070661_100143938
1349 Ga0070668_100010950
1350 Ga0070668_100122730
1351 Ga0070668_100256205
1352 Ga0070668_100574926
1353 Ga0070669_100250334
1354 Ga0070669_100568517
1355 Ga0070669_100947023
1356 Ga0070669_101122731
1357 Ga0070675_100008998
1358 Ga0070675_100278711
1359 Ga0070675_100488535
1360 Ga0070671_100001982
1361 Ga0070671_100049526
1362 Ga0070671_100073564
1363 Ga0070671_100199979
1364 Ga0070671_100283273
1365 Ga0070671_101205393
1366 Ga0070674_100031734
1367 Ga0070674_100104587
1368 Ga0070674_100388003
1369 Ga0070674_100775468
1370 Ga0070673_100000636
1371 Ga0070673_100017149
1372 Ga0070673_100068716
1373 Ga0070673_100582773
1374 Ga0070673_100772804
1375 Ga0070688_100206154
1376 Ga0070688_100241403
1377 Ga0070659_100368624
1378 Ga0070667_100000916
1379 Ga0070667_100001639
1380 Ga0070667_100108331
1381 Ga0070667_100254517
1382 Ga0070667_100276685
1383 Ga0070667_101108948
1384 Ga0070709_10041462
1385 Ga0070713_100079415
1386 Ga0070710_11181176
1387 Ga0070701_10067484
1388 Ga0070701_10236218
1389 Ga0070705_100187047
1390 Ga0070700_100021338
1391 Ga0070700_100046369
1392 Ga0070700_100766040
1393 Ga0070700_101235732
1394 Ga0070708_100033241
1395 Ga0070708_100188876
1396 Ga0070708_100197772
1397 Ga0070708_100373113
1398 Ga0070708_100551649
1399 Ga0070663_100185389
1400 Ga0070663_101674885
1401 Ga0070678_100005995
1402 Ga0070678_100178927
1403 Ga0070678_100282242
1404 Ga0070678_100296129
1405 Ga0070678_100581387
1406 Ga0070678_101275078
1407 Ga0070662_100002338
1408 Ga0070662_100074970
1409 Ga0070662_100189153
1410 Ga0070681_10029856
1411 Ga0070681_10631726
1412 Ga0070681_10961264
1413 Ga0068867_100000664
1414 Ga0068867_100013814
1415 Ga0068867_100029743
1416 Ga0068867_100032411
1417 Ga0068867_100142501
1418 Ga0068867_100154895
1419 Ga0068867_100212789
1420 Ga0068867_100843491
1421 Ga0070685_10514457
1422 Ga0070685_10633233
1423 Ga0070685_10678964
1424 Ga0070685_10681485
1425 Ga0070707_100010736
1426 Ga0070698_100423339
1427 Ga0070698_100833995
1428 Ga0070679_100183717
1429 Ga0070684_100026516
1430 Ga0070697_100010956
1431 Ga0068853_100009688
1432 Ga0068853_100011188
1433 Ga0068853_100509540
1434 Ga0068853_101150454
1435 Ga0070672_100000215
1436 Ga0070672_100007533
1437 Ga0070672_100220183
1438 Ga0070672_100375068
1439 Ga0070672_100383809
1440 Ga0070672_100529513
1441 Ga0070672_101011538
1442 Ga0070686_100058846
1443 Ga0070695_101196718
1444 Ga0070665_100025474
1445 Ga0070665_100055275
1446 Ga0070665_100409201
1447 Ga0070665_100446518
1448 Ga0068855_100000166
1449 Ga0068855_100164792
1450 Ga0068855_100242436
1451 Ga0070664_100022201
1452 Ga0070664_100241622
1453 Ga0068857_100006977
1454 Ga0068857_100012327
1455 Ga0068857_100069621
1456 Ga0068857_100209974
1457 Ga0068854_100039212
1458 Ga0068854_100169572
1459 Ga0068856_100123773
1460 Ga0068856_100198462
1461 Ga0068856_100649653
1462 Ga0070702_101158956
1463 Ga0068852_100180934
1464 Ga0068852_100291220
1465 Ga0068852_100516312
1466 Ga0068852_101004876
1467 Ga0068852_102122197
1468 Ga0068859_100010428
1469 Ga0068859_100154256
1470 Ga0068859_100175040
1471 Ga0068859_100252906
1472 Ga0068859_100338867
1473 Ga0068859_100413590
1474 Ga0068864_100011184
1475 Ga0068864_100015192
1476 Ga0068864_100735631
1477 Ga0068866_10019710
1478 Ga0068866_10064676
1479 Ga0068861_100006063
1480 Ga0068861_100136966
1481 Ga0068851_10040298
1482 Ga0068851_10045449
1483 Ga0068870_10032629
1484 Ga0068870_10504622
1485 Ga0068863_100001567
1486 Ga0068863_100001722
1487 Ga0068863_100380730
1488 Ga0068858_100000628
1489 Ga0068858_100058676
1490 Ga0068858_100323282
1491 Ga0068858_100488267
1492 Ga0068858_100852913
1493 Ga0068858_101001619
1494 Ga0068860_100002622
1495 Ga0068860_100008901
1496 Ga0068860_100184807
1497 Ga0068860_100474576
1498 Ga0068860_101064532
1499 Ga0068862_100049227
1500 Ga0068862_100071248
1501 Ga0068862_100087624
1502 Ga0068862_100223968
1503 Ga0068862_100483613
1504 Ga0068862_101026749
1505 Ga0081455_10732466
1506 Ga0075365_10000402
1507 Ga0075365_10188804
1508 Ga0075368_10072401
1509 Ga0075363_100006788
1510 Ga0075364_10006947
1511 Ga0075432_10028523
1512 Ga0075362_10018359
1513 Ga0075362_10026331
1514 Ga0075362_10075241
1515 Ga0075362_10079367
1516 Ga0075362_10123620
1517 Ga0075367_10052723
1518 Ga0075367_10106928
1519 Ga0075367_10173445
1520 Ga0075367_10355351
1521 Ga0075367_10371852
1522 Ga0075369_10162193
1523 Ga0075366_10006489
1524 Ga0075366_10015968
1525 Ga0075366_10018726
1526 Ga0075366_10021592
1527 Ga0075366_10038020
1528 Ga0075366_10053152
1529 Ga0075366_10064372
1530 Ga0075366_10073073
1531 Ga0075366_10077864
1532 Ga0075366_10095547
1533 Ga0075366_10153377
1534 Ga0075366_10212788
1535 Ga0075366_10774203
1536 Ga0097621_100007488
1537 Ga0097621_100019592
1538 Ga0097621_100186892
1539 Ga0097621_100763867
1540 Ga0097621_100779391
1541 Ga0075370_10023306
1542 Ga0075370_10024490
1543 Ga0075370_10031608
1544 Ga0075370_10053353
1545 Ga0075370_10070417
1546 Ga0075370_10177611
1547 Ga0075370_10361938
1548 Ga0075370_10416635
1549 Ga0068871_100003128
1550 Ga0068871_100012228
1551 Ga0068871_100066423
1552 Ga0075428_100002991
1553 Ga0075428_100004497
1554 Ga0075428_100600102
1555 Ga0075428_102160969
1556 Ga0075430_100019067
1557 Ga0075430_100053854
1558 Ga0075431_100308981
1559 Ga0075431_100604847
1560 Ga0075433_10174388
1561 Ga0075429_100022565
1562 Ga0075429_100264976
1563 Ga0068865_100003193
1564 Ga0068865_100003621
1565 Ga0068865_100005535
1566 Ga0068865_100037561
1567 Ga0068865_100199681
1568 Ga0068865_100204342
1569 Ga0068865_100703363
1570 Ga0097620_100010429
1571 Ga0097620_100154273
1572 Ga0097620_100175044
1573 Ga0097620_100252899
1574 Ga0097620_100338915
1575 Ga0097620_100413575
1576 Ga0099826_10065661
1577 Ga0105244_10017711
1578 Ga0105244_10140250
1579 Ga0105240_10000470
1580 Ga0105240_10002416
1581 Ga0105240_10173426
1582 Ga0105240_10876762
1583 Ga0111539_10007916
1584 Ga0111539_10012627
1585 Ga0105245_10012561
1586 Ga0105245_10018645
1587 Ga0105245_10038455
1588 Ga0105245_10406613
1589 Ga0105245_10436021
1590 Ga0105245_10987911
1591 Ga0114129_10008968
1592 Ga0105243_10000437
1593 Ga0105243_10002267
1594 Ga0105243_10016045
1595 Ga0105243_10035573
1596 Ga0105243_10149101
1597 Ga0105243_10214642
1598 Ga0105241_10024541
1599 Ga0105241_10076022
1600 Ga0105241_10198017
1601 Ga0105241_10228970
1602 Ga0105242_10005571
1603 Ga0105242_10025391
1604 Ga0105242_10172499
1605 Ga0105242_10295810
1606 Ga0105242_10356237
1607 Ga0105242_10640995
1608 Ga0105248_10002934
1609 Ga0105248_10110965
1610 Ga0105248_10315388
1611 Ga0105237_10001223
1612 Ga0105237_10004017
1613 Ga0105237_10010476
1614 Ga0105237_10066362
1615 Ga0105237_10102414
1616 Ga0105237_10189785
1617 Ga0105238_10000294
1618 Ga0105238_10006384
1619 Ga0105238_10017161
1620 Ga0105238_10071647
1621 Ga0105238_10122079
1622 Ga0105238_10158793
1623 Ga0105238_10500661
1624 Ga0105238_10848515
1625 Ga0105249_10007568
1626 Ga0105249_10010948
1627 Ga0105249_10432539
1628 Ga0105239_10002071
1629 Ga0105239_10016024
1630 Ga0105239_10031117
1631 Ga0105239_10043988
1632 Ga0105239_10317522
1633 Ga0105239_10420815
1634 Ga0105239_10683668
1635 Ga0105246_10069868
1636 Ga0105246_10204120
1637 Ga0105246_10286655
1638 Ga0105246_10594420
1639 Ga0105246_10833173
1640 Ga0157322_1011987
1641 Ga0157345_1008467
1642 Ga0157339_1003029
1643 Ga0157373_10079134
1644 Ga0157371_10216837
1645 Ga0157370_10003332
1646 Ga0157370_10036164
1647 Ga0157369_10054666
1648 Ga0157369_10345339
1649 Ga0157374_10018835
1650 Ga0157374_10190956
1651 Ga0157374_10223789
1652 Ga0157374_10390070
1653 Ga0157374_10438862
1654 Ga0157378_10012717
1655 Ga0157378_10025572
1656 Ga0157378_10068930
1657 Ga0157378_10181822
1658 Ga0157378_10217874
1659 Ga0157378_10629129
1660 Ga0163162_10000954
1661 Ga0163162_10049343
1662 Ga0163162_10084244
1663 Ga0163162_10093337
1664 Ga0163162_10261827
1665 Ga0163162_10271330
1666 Ga0163162_11109334
1667 Ga0163162_11322846
1668 Ga0157372_10036787
1669 Ga0157372_10239142
1670 Ga0157372_10921368
1671 Ga0157375_10000550
1672 Ga0157375_10018289
1673 Ga0157375_10033787
1674 Ga0157375_10111508
1675 Ga0157375_11135788
1676 Ga0163163_10018301
1677 Ga0163163_10146821
1678 Ga0157380_10000489
1679 Ga0157380_10009763
1680 Ga0157380_10012837
1681 Ga0157380_10117607
1682 Ga0157380_10124752
1683 Ga0182008_10007679
1684 Ga0182008_10050118
1685 Ga0157377_10324933
1686 Ga0157377_11084443
1687 Ga0157379_10000439
1688 Ga0157379_10047612
1689 Ga0157379_10094579
1690 Ga0157379_10160691
1691 Ga0157379_10294445
1692 Ga0157379_10305253
1693 Ga0157376_10029133
1694 Ga0157376_10203034
1695 Ga0157376_10266833
1696 Ga0157376_10585657
1697 Ga0157376_10940849
1698 Ga0182006_1001748
1699 Ga0182006_1003709
1700 Ga0182006_1127927
1701 Ga0182007_10004346
1702 Ga0182005_1031429
1703 Ga0182005_1059851
1704 Ga0183362_10005
1705 Ga0163161_10006931
1706 Ga0163161_10052953
1707 Ga0163161_10120687
1708 Ga0163161_10121160
1709 Ga0163161_10127999
1710 Ga0213872_10023309
1711 Ga0213876_10181594
1712 Ga0209436_115256
1713 Ga0209672_101328
1714 Ga0209147_101428
1715 Ga0209258_100176
1716 Ga0207425_1000133
1717 Ga0207425_1011401
1718 Ga0207425_1044847
1719 Ga0209148_1000033
1720 Ga0209129_1000186
1721 Ga0209129_1007298
1722 Ga0209129_1009268
1723 Ga0209565_1000190
1724 Ga0209565_1004293
1725 Ga0209673_1000209
1726 Ga0209673_1000393
1727 Ga0209673_1001625
1728 Ga0209673_1008405
1729 Ga0209673_1051779
1730 Ga0209130_1000372
1731 Ga0209130_1010030
1732 Ga0209130_1015881
1733 Ga0209675_1000902
1734 Ga0209675_1001575
1735 Ga0209675_1006482
1736 Ga0209675_1017081
1737 Ga0209675_1037045
1738 Ga0209676_1000048
1739 Ga0209676_1000368
1740 Ga0209676_1000433
1741 Ga0209676_1000937
1742 Ga0209025_1000324
1743 Ga0209025_1001380
1744 Ga0209025_1001614
1745 Ga0209025_1019492
1746 Ga0209025_1079347
1747 Ga0209025_1096798
1748 Ga0209564_1000417
1749 Ga0209564_1000423
1750 Ga0209758_1000092
1751 Ga0209758_1010418
1752 Ga0209050_1000012
1753 Ga0209050_1000912
1754 Ga0209050_1004084
1755 Ga0209050_1051799
1756 Ga0209256_1000094
1757 Ga0209256_1000095
1758 Ga0207426_1000084
1759 Ga0207426_1000161
1760 Ga0209051_1000178
1761 Ga0209051_1000207
1762 Ga0209051_1000931
1763 Ga0209051_1004369
1764 Ga0209051_1016148
1765 Ga0209051_1021299
1766 Ga0209051_1026224
1767 Ga0209257_1000024
1768 Ga0209257_1000249
1769 Ga0209257_1004734
1770 Ga0209257_1019883
1771 Ga0207697_10018594
1772 Ga0207656_10005089
1773 Ga0207656_10018338
1774 Ga0207655_1004770
1775 Ga0207655_1067730
1776 Ga0207655_1125068
1777 Ga0207682_10019861
1778 Ga0207682_10366174
1779 Ga0207642_10005581
1780 Ga0207642_10375526
1781 Ga0207680_10086167
1782 Ga0207680_10152926
1783 Ga0207680_10320938
1784 Ga0207680_10338048
1785 Ga0207680_10509501
1786 Ga0207680_10993635
1787 Ga0207699_10035483
1788 Ga0207645_10002573
1789 Ga0207645_10008080
1790 Ga0207645_10017297
1791 Ga0207643_10014794
1792 Ga0207643_10087791
1793 Ga0207684_10007194
1794 Ga0207684_10536269
1795 Ga0207654_10125138
1796 Ga0207654_10299021
1797 Ga0207707_10006936
1798 Ga0207695_10005377
1799 Ga0207695_10007940
1800 Ga0207695_10138130
1801 Ga0207695_10376627
1802 Ga0207695_10665193
1803 Ga0207671_10007085
1804 Ga0207671_10056053
1805 Ga0207671_10070997
1806 Ga0207671_10294875
1807 Ga0207671_10995659
1808 Ga0207660_10068643
1809 Ga0207660_10532301
1810 Ga0207662_10130324
1811 Ga0207657_10627702
1812 Ga0207649_10266254
1813 Ga0207652_10145045
1814 Ga0207646_10101910
1815 Ga0207681_10000644
1816 Ga0207681_10185542
1817 Ga0207681_10238766
1818 Ga0207681_10245131
1819 Ga0207681_10904756
1820 Ga0207694_10000601
1821 Ga0207694_10000920
1822 Ga0207694_10024601
1823 Ga0207694_10155247
1824 Ga0207650_10006427
1825 Ga0207650_10657425
1826 Ga0207650_10704442
1827 Ga0207659_10000751
1828 Ga0207659_10006069
1829 Ga0207659_10753015
1830 Ga0207687_10011986
1831 Ga0207687_10038600
1832 Ga0207687_10071514
1833 Ga0207687_10547425
1834 Ga0207687_10563588
1835 Ga0207644_10010084
1836 Ga0207644_10020786
1837 Ga0207644_10031885
1838 Ga0207644_10039620
1839 Ga0207644_10248176
1840 Ga0207690_10147513
1841 Ga0207706_10006980
1842 Ga0207706_10017696
1843 Ga0207686_10080424
1844 Ga0207686_10104914
1845 Ga0207686_10167181
1846 Ga0207686_10402841
1847 Ga0207686_10627384
1848 Ga0207709_10001937
1849 Ga0207709_10002102
1850 Ga0207709_10025447
1851 Ga0207709_10047583
1852 Ga0207709_10053433
1853 Ga0207709_10343225
1854 Ga0207709_10587663
1855 Ga0207670_10008093
1856 Ga0207670_10197679
1857 Ga0207669_10001517
1858 Ga0207669_10013519
1859 Ga0207669_10074307
1860 Ga0207669_10138672
1861 Ga0207704_10001175
1862 Ga0207704_10055018
1863 Ga0207704_10056013
1864 Ga0207704_10207072
1865 Ga0207704_10225534
1866 Ga0207691_10000347
1867 Ga0207691_10003219
1868 Ga0207691_10061540
1869 Ga0207691_10093373
1870 Ga0207691_10170221
1871 Ga0207691_10175507
1872 Ga0207691_10564074
1873 Ga0207711_10004936
1874 Ga0207711_10096742
1875 Ga0207689_10002269
1876 Ga0207689_10010698
1877 Ga0207689_10293180
1878 Ga0207661_10142452
1879 Ga0207661_10895452
1880 Ga0207661_11124060
1881 Ga0207679_10013107
1882 Ga0207679_10013127
1883 Ga0207679_10271542
1884 Ga0207667_10000078
1885 Ga0207667_10185710
1886 Ga0207667_10539441
1887 Ga0207651_10000398
1888 Ga0207651_10012112
1889 Ga0207651_10022279
1890 Ga0207712_10009709
1891 Ga0207712_10015478
1892 Ga0207668_10000809
1893 Ga0207668_10042364
1894 Ga0207668_10230808
1895 Ga0207668_10287476
1896 Ga0207668_10653087
1897 Ga0207640_10057156
1898 Ga0207658_10002681
1899 Ga0207658_10010019
1900 Ga0207658_10035740
1901 Ga0207658_10074759
1902 Ga0207658_10380315
1903 Ga0207677_10004451
1904 Ga0207677_10008191
1905 Ga0207677_10011928
1906 Ga0207677_10031948
1907 Ga0207677_10138338
1908 Ga0207703_10002510
1909 Ga0207703_10013182
1910 Ga0207703_10800538
1911 Ga0207639_10053359
1912 Ga0207639_10801366
1913 Ga0207678_10013862
1914 Ga0207678_10083066
1915 Ga0207678_10247629
1916 Ga0207678_10786432
1917 Ga0207708_10013570
1918 Ga0207708_10022713
1919 Ga0207708_10083169
1920 Ga0207708_10144528
1921 Ga0207702_10311891
1922 Ga0207702_10352657
1923 Ga0207702_10760449
1924 Ga0207641_10017015
1925 Ga0207641_10055684
1926 Ga0207648_10001863
1927 Ga0207648_10002881
1928 Ga0207648_10007895
1929 Ga0207648_10021442
1930 Ga0207648_10047745
1931 Ga0207648_10078374
1932 Ga0207648_10179559
1933 Ga0207676_10000082
1934 Ga0207676_10050076
1935 Ga0207676_11089170
1936 Ga0207674_10018126
1937 Ga0207674_10048359
1938 Ga0207674_10063779
1939 Ga0207674_10144755
1940 Ga0207674_10352299
1941 Ga0207675_100000927
1942 Ga0207675_100001409
1943 Ga0207675_100309568
1944 Ga0207675_100866912
1945 Ga0207675_100940636
1946 Ga0207683_10210587
1947 Ga0207683_10214579
1948 Ga0207683_10216547
1949 Ga0207683_10242335
1950 Ga0207683_10624846
1951 Ga0207683_10951444
1952 Ga0207698_10100486
1953 Ga0207698_10255540
1954 Ga0207698_10292253
1955 Ga0207698_10353948
1956 Ga0207698_10661934
1957 Ga0207698_10688782
1958 Ga0209282_1105991
1959 Ga0209813_10122536
1960 Ga0207428_10041116
1961 Ga0268266_10066894
1962 Ga0268266_10244025
1963 Ga0268266_10368331
1964 Ga0268265_10093044
1965 Ga0268265_10110441
1966 Ga0268264_10002202
1967 Ga0268264_10012690
1968 Ga0268264_10041350
1969 Ga0268264_10377324
1970 Ga0268264_10762697
1971 Ga0307517_10004553
1972 Ga0307517_10179854
1973 Ga0307517_10413969
1974 Ga0307515_10000419
1975 Ga0307515_10000425
1976 Ga0307515_10000672
1977 Ga0307515_10011668
1978 Ga0307515_10023797
1979 Ga0307515_10050319
1980 Ga0307515_10083885
1981 Ga0307515_10102188
1982 Ga0307515_10126323
1983 Ga0307515_10470527
1984 Ga0307512_10022817
1985 Ga0307512_10023039
1986 Ga0307512_10063478
1987 Ga0307512_10124236
1988 Ga0307512_10285754
1989 Ga0265316_10316812
1990 Ga0307513_10001868
1991 Ga0307513_10008367
1992 Ga0307513_10077369
1993 Ga0307513_10086955
1994 Ga0307513_10090348
1995 Ga0307513_10203853
1996 Ga0307513_10323141
1997 Ga0307513_10550424
1998 Ga0307509_10003708
1999 Ga0307509_10004745
2000 Ga0307509_10007851
2001 Ga0307509_10038154
2002 Ga0307509_10236325
2003 Ga0307509_10332143
2004 Ga0307509_10603647
2005 Ga0307408_100564043
2006 Ga0307408_100947544
2007 Ga0307408_101100691
2008 Ga0307508_10000278
2009 Ga0307508_10008282
2010 Ga0307508_10016618
2011 Ga0307508_10072891
2012 Ga0307514_10001174
2013 Ga0307514_10009496
2014 Ga0307514_10096609
2015 Ga0307514_10237904
2016 Ga0265314_10178784
2017 Ga0265314_10231927
2018 Ga0307516_10000237
2019 Ga0307516_10099481
2020 Ga0307516_10344365
2021 Ga0307405_10164268
2022 Ga0307405_10254616
2023 Ga0307413_10201349
2024 Ga0307410_10087844
2025 Ga0307406_10033320
2026 Ga0307406_10123962
2027 Ga0307406_10365334
2028 Ga0307406_10442887
2029 Ga0307406_10472442
2030 Ga0307412_10034281
2031 Ga0307412_10431217
2032 Ga0307412_10692821
2033 Ga0307412_10714539
2034 Ga0307412_11382326
2035 Ga0307409_100028240
2036 Ga0307409_100030037
2037 Ga0307409_100566255
2038 Ga0307416_100033297
2039 Ga0307416_100106923
2040 Ga0307416_100287504
2041 Ga0307416_101019003
2042 Ga0307416_101020974
2043 Ga0307411_10057995
2044 Ga0307411_11475033
2045 Ga0307415_100151750
2046 Ga0307415_101284880
2047 Ga0307507_10104119
2048 Ga0307510_10022805
2049 Ga0307510_10173630
2050 Ga0307510_10276625
2051 Ga0373944_0067142
2052 Ga0373944_0115874
2053 Ga0373939_0195590
2054 Ga0373945_0182128
2055 Ga0373943_0005469
2056 Ga0373946_0021686
2057 Ga0373946_0095441
2058 Ga0373931_0495605
2059 Ga0373935_0115537
2060 Ga0373935_0669197
2061 Ga0373927_0031372
2062 Ga0373927_0040785
2063 Ga0373947_0008740
2064 Ga0373937_0047465
2065 Ga0373937_0125469
2066 Ga0373925_0004060
2067 Ga0373925_0122348
2068 Ga0373925_0193640
2069 Ga0395898_0237105
2070 Ga0395905_0005642
2071 Ga0395905_0006264
2072 Ga0395905_0115347
2073 Ga0395905_0285411
2074 Ga0395905_0489662
2075 Ga0395901_0518233
2076 Ga0436365_1402919
2077 Ga0436361_0221167
2078 Ga0436361_0644663
2079 Ga0436363_1469836
2080 Ga0439436_0000134
2081 Ga0439436_0000962
2082 Ga0439438_125193
2083 Ga0439439_0004760
2084 Ga0439439_0038287
2085 Ga0439447_031631
2086 Ga0439461_0004034
2087 Ga0439461_0024933
2088 Ga0439466_0006068
2089 Ga0439465_0000339
2090 Ga0451791_0210227
2091 Ga0451793_0124799
2092 Ga0451800_0939557
2093 Ga0451853_1321958
2094 Ga0439431_0009901
2095 Ga0439433_0000087
2096 Ga0439441_021416
2097 Ga0439442_001006
2098 Ga0439445_0009738
2099 Ga0439445_0018295
2100 Ga0439432_000527
2101 Ga0439432_036027
2102 Ga0439449_0000385
2103 Ga0439449_0004263
2104 Ga0439449_0011605
2105 Ga0439450_052174
2106 Ga0439452_002869
2107 Ga0439455_0018540
2108 Ga0439455_0089309
2109 Ga0439457_021681
2110 Ga0439462_0001243
2111 Ga0439462_0005291
2112 Ga0450911_000225
2113 Ga0450923_002780
2114 Ga0450894_015107
2115 Ga0450896_024752
2116 Ga0450898_015921
2117 Ga0450898_025829
2118 Ga0450898_028365
2119 Ga0450905_009627
2120 Ga0439446_0035330
2121 Ga0439434_0003391
2122 Ga0439434_0116530
2123 Ga0450918_040166
2124 Ga0451577_0068194
2125 Ga0466960_0143879
2126 Ga0495617_001251
2127 Ga0495592_0000211
2128 Ga0495603_0362366
2129 Ga0495590_0000092
2130 Ga0495590_0001972
2131 Ga0495590_0013034
2132 Ga0495629_0032522
2133 Ga0495629_0042748
2134 Ga0495638_0015754
2135 Ga0495638_0022034
2136 Ga0495638_0074021
2137 Ga0495638_0090658
2138 Ga0495653_0380860
2139 Ga0495650_0008406
2140 Ga0495650_0136472
2141 Ga0495580_0074019
2142 Ga0495582_0085048
2143 Ga0495582_0185706
2144 Ga0495605_0039596
2145 Ga0495605_0045936
2146 Ga0495605_0133015
2147 Ga0495605_0309183
2148 Ga0495639_0071706
2149 Ga0495639_0106342
2150 Ga0495639_0235238
2151 Ga0495584_0000300
2152 Ga0495584_0296713
2153 Ga0495584_0489128
2154 Ga0495585_0018990
2155 Ga0495585_0022023
2156 Ga0495585_0053439
2157 Ga0495594_0164175
2158 Ga0495594_0472226
2159 Ga0495596_0006345
2160 Ga0495596_0023058
2161 Ga0495607_0000359
2162 Ga0495607_0041673
2163 Ga0495607_0071949
2164 Ga0495607_0293988
2165 Ga0495583_0000067
2166 Ga0495583_0000563
2167 Ga0495583_0067301
2168 Ga0495583_0167731
2169 Ga0495583_0168690
2170 Ga0495583_0375639
2171 Ga0495606_0002420
2172 Ga0495606_0256544
2173 Ga0495606_0262079
2174 Ga0495610_0089206
2175 Ga0495610_0298873
2176 Ga0495616_0000933
2177 Ga0495616_0006364
2178 Ga0495616_0040782
2179 Ga0495618_0318948
2180 Ga0495620_0010656
2181 Ga0495628_0124485
2182 Ga0495628_0404365
2183 Ga0495631_0000176
2184 Ga0495631_0050645
2185 Ga0495632_0023431
2186 Ga0495637_0003577
2187 Ga0495637_0026699
2188 Ga0495637_0232339
2189 Ga0495643_0009326
2190 Ga0495643_0048890
2191 Ga0495643_0121266
2192 Ga0495644_0000501
2193 Ga0495648_0000831
2194 Ga0495648_0012948
2195 Ga0495648_0026694
2196 Ga0495648_0139802
2197 Ga0495663_0065291
2198 Ga0495642_0001270
2199 Ga0495642_0092321
2200 Ga0495642_0359572
2201 Ga0495654_0003149
2202 Ga0495654_0003294
2203 Ga0495654_0115443
2204 Ga0495654_0211074
2205 Ga0495665_0103479
2206 Ga0495640_0123366
2207 Ga0495640_0240409
2208 Ga0495609_0001479
2209 Ga0495609_0036063
2210 Ga0495609_0212485
2211 Ga0495621_0003592
2212 Ga0495597_0005431
2213 Ga0495597_0020388
2214 Ga0495597_0039235
2215 Ga0495597_0082577
2216 Ga0495622_0000011
2217 Ga0495622_0017968
2218 Ga0495622_0062685
2219 Ga0495633_0013261
2220 Ga0495633_0015014
2221 Ga0495656_0000055
2222 Ga0495656_0001368
2223 Ga0495656_0014289
2224 Ga0495656_0029376
2225 Ga0495656_0306741
2226 Ga0495668_0009680
2227 Ga0495668_0014680
2228 Ga0495668_0032416
2229 Ga0495668_0049884
2230 Ga0495668_0211190
2231 Ga0495634_0268308
2232 Ga0495611_0008860
2233 Ga0495625_0000708
2234 Ga0495625_0019127
2235 Ga0495625_0019215
2236 Ga0495625_0020257
2237 Ga0495625_0056406
2238 Ga0495625_0069863
2239 Ga0495635_0102477
2240 Ga0495635_0171602
2241 Ga0495635_0320566
2242 Ga0495659_0000193
2243 Ga0495659_0048214
2244 Ga0495661_0000755
2245 Ga0495661_0000987
2246 Ga0495661_0004847
2247 Ga0495661_0185973
2248 Ga0495661_0261924
2249 Ga0495661_0266886
2250 Ga0495661_0315951
2251 Ga0495588_0097954
2252 Ga0495588_0368698
2253 Ga0495599_0297918
2254 Ga0495646_0259762
2255 Ga0495647_0037297
2256 Ga0495647_0053062
2257 Ga0495647_0159299
2258 Ga0495647_0176505
2259 Ga0495658_0015016
2260 Ga0495658_0070109
2261 Ga0495658_0081857
2262 Ga0495658_0354995
2263 Ga0495613_0669775
2264 Ga0495624_0073836
2265 Ga0495624_0084705
2266 Ga0495670_0005694
2267 Ga0495670_0005878
2268 Ga0495670_0105166
2269 Ga0495670_0401552
2270 Ga0495671_0001321
2271 Ga0495671_0005250
2272 Ga0495671_0125520
2273 Ga0495671_0135871
2274 Ga0495671_0441055
2275 Ga0495649_0001209
2276 Ga0495589_0020773
2277 Ga0495589_0069801
2278 Ga0495600_0032003
2279 Ga0495600_0425893
2280 Ga0495600_0564390
2281 Ga0495660_0004413
2282 Ga0495660_0015585
2283 Ga0495660_0046913
2284 Ga0495660_0057750
2285 Ga0495581_0205380
2286 Ga0495636_0000302
2287 Ga0495674_0152238
2288 Ga0495674_0466405
2289 Ga0495672_0003302
2290 Ga0495672_0150664
2291 Ga0495676_0061675
2292 Ga0495676_0109107
2293 Ga0495676_0236496
2294 Ga0495683_0068546
2295 Ga0495683_0181697
2296 Ga0495687_000153
2297 Ga0495687_003793
2298 Ga0495687_008489
2299 Ga0495687_012212
2300 Ga0495677_0001414
2301 Ga0495677_0184931
2302 Ga0495679_001633
2303 Ga0495685_000011
2304 Ga0495685_086382
2305 Ga0495685_176602
2306 Ga0495673_0004503
2307 Ga0495681_0055933
2308 Ga0495684_0115155
2309 Ga0495684_0666773
2310 Ga0495686_0001736
2311 Ga0495593_0017494
2312 Ga0495593_0090851
2313 Ga0495614_0081431
2314 Ga0495614_0082709
2315 Ga0495614_0452816
2316 Ga0495615_0068733
2317 Ga0495626_0000657
2318 Ga0495626_0000701
2319 Ga0495626_0009276
2320 Ga0495626_0022010
2321 Ga0495626_0198048
2322 Ga0496100_0101842
2323 Ga0496101_0010546
2324 Ga0496102_0014578
2325 Ga0496102_0125873
2326 Ga0496103_0010336
2327 Ga0496104_0015327
2328 Ga0496104_1466667
2329 Ga0496105_0002074
2330 Ga0496106_0024302
2331 Ga0496106_0894476
2332 Ga0496107_0036652
2333 Ga0496108_0022182
2334 Ga0496110_0029223
2335 Ga0496111_0124593
2336 Ga0496113_0350757
2337 Ga0496113_0780584
2338 Ga0496114_0069772
2339 Ga0496114_0485770
2340 Ga0496114_1502968
2341 Ga0496116_0057954
2342 Ga0496116_0089477
2343 Ga0496117_0013969
2344 Ga0496117_0016300
2345 Ga0496117_0076287
2346 Ga0496118_0027766
2347 Ga0496118_0028081
2348 Ga0496121_0199642
2349 Ga0496121_0453743
2350 Ga0496123_0103082
2351 Ga0496123_0127159
2352 Ga0496124_0300654
2353 Ga0496125_0027812
2354 Ga0496125_0438466
2355 Ga0496126_0081296
2356 Ga0496126_0639021
2357 Ga0495678_000367
2358 Ga0495678_008149
2359 Ga0495682_0000199
2360 Ga0495682_0001987
2361 Ga0495682_0109679
2362 Ga0495682_0271472
2363 Ga0501292_009487
2364 Ga0501292_022134
2365 Ga0501294_008077
2366 Ga0501298_002185
2367 Ga0501299_032863
2368 Ga0501032_0110228
2369 Ga0501041_0406562
2370 Ga0501043_0000004
2371 Ga0501046_0000016
2372 Ga0501047_0000012
2373 Ga0501048_0000926
2374 Ga0501048_0791366
2375 Ga0501071_0041686
2376 Ga0501071_0114982
2377 Ga0501071_1111199
2378 Ga0501199_013270
2379 Ga0501206_002813
2380 Ga0501257_037872
2381 Ga0501259_058687
2382 Ga0501081_0455501
2383 Ga0501262_009881
2384 Ga0501273_006673
2385 Ga0501281_03099
2386 Ga0501045_0002191
2387 Ga0501045_0704258
2388 nmdc:mga03683_107284_c1
2389 nmdc:mga03683_12530_c1
2390 nmdc:mga03683_37272_c1
2391 nmdc:mga03n38_19665_c1
2392 nmdc:mga03n38_62210_c1
2393 nmdc:mga00v17_152623_c1
2394 nmdc:mga00v17_2771_c1
2395 nmdc:mga00v17_344318_c1
2396 nmdc:mga0yw44_119897_c1
2397 nmdc:mga0yw44_5627_c1
2398 nmdc:mga0k408_19767_c1
2399 nmdc:mga0k408_251645_c1
2400 nmdc:mga0k408_31050_c1
2401 nmdc:mga0k408_33051_c1
2402 nmdc:mga0k408_33349_c1
2403 nmdc:mga0k408_33984_c1
2404 nmdc:mga0k408_36165_c1
2405 nmdc:mga0k408_44858_c1
2406 nmdc:mga0k408_55074_c1
2407 nmdc:mga0k408_5871_c1
2408 nmdc:mga0k408_60655_c1
2409 nmdc:mga0k408_73875_c1
2410 nmdc:mga0k408_80835_c1
2411 nmdc:mga0k408_92205_c1
2412 nmdc:mga06z11_707678_c1
2413 nmdc:mga04h51_150436_c1
2414 nmdc:mga07m45_103848_c1
2415 nmdc:mga07m45_1144_c1
2416 nmdc:mga07m45_2026_c2
2417 nmdc:mga07m45_245524_c1
2418 nmdc:mga07m45_2594_c1
2419 nmdc:mga07m45_397680_c1
2420 nmdc:mga07m45_607872_c1
2421 nmdc:mga07m45_83596_c1
2422 nmdc:mga05p37_286583_c1
2423 nmdc:mga05p37_922713_c1
2424 nmdc:mga09592_288559_c1
2425 nmdc:mga0qj67_520062_c1
2426 nmdc:mga06r32_186776_c1
2427 nmdc:mga08y16_183385_c1
2428 nmdc:mga08y16_62434_c1
2429 nmdc:mga08y16_755306_c1
2430 nmdc:mga0a205_191393_c1
2431 nmdc:mga0sz30_110451_c1
2432 nmdc:mga0sz30_230223_c1
2433 nmdc:mga0sz30_34397_c1
2434 Ga0495601_0018255
2435 Ga0495612_0084174
2436 Ga0495612_0123928
2437 Ga0500610_0003534
2438 Ga0500610_0032538
2439 Ga0495619_0048380
2440 Ga0500643_008391
2441 Ga0500644_0007132
2442 Ga0500583_0049976
2443 Ga0500651_0000289
2444 Ga0500651_0135524
2445 Ga0500566_0078985
2446 Ga0500562_004272
2447 Ga0500562_020605
2448 Ga0500571_000089
2449 Ga0500572_076012
2450 Ga0500592_004261
2451 Ga0500594_0010549
2452 Ga0500607_000942
2453 Ga0500607_012041
2454 Ga0500608_011017
2455 Ga0500608_075230
2456 Ga0500618_027127
2457 Ga0500618_027711
2458 Ga0500628_060006
2459 Ga0500658_0000137
2460 Ga0500658_0000140
2461 Ga0500658_0015270
2462 Ga0500559_0000166
2463 Ga0500564_057811
2464 Ga0500564_066507
2465 Ga0500568_0000735
2466 Ga0500568_0025308
2467 Ga0500574_019578
2468 Ga0500577_0079072
2469 Ga0500586_016719
2470 Ga0500589_010275
2471 Ga0500616_0079167
2472 Ga0500619_069489
2473 Ga0500627_0043809
2474 Ga0500634_0011590
2475 Ga0500634_0018046
2476 Ga0500638_046305
2477 Ga0500636_0044573
2478 Ga0500625_029427
2479 Ga0500587_002063
2480 Ga0501084_0280439
2481 Ga0590071_021025
2482 Ga0466962_0096217
2483 Ga0530510_0390804
2484 2513230589
2485 2599626406
2486 2599676270
2487 2599682108
2488 2599695758
2489 2644328564
2490 2644338858
2491 2644399804
2492 2644465032
2493 2738721379
2494 2738880738
2495 2739249625
2496 2739281048
2497 2819601682
2498 2831272118
2499 2838059281
2500 2885195012
2501 2885202982
2502 2885216621
2503 2899930749
2504 2904456480
2505 2904461462
2506 2904545375
2507 2928040930
2508 2928047772
2509 2928055663
2510 2928069761
2511 2928075381
2512 2928088461
2513 2929165565
2514 2929522996
2515 2945909761
2516 8047673713

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d40-assembly1.cif.gz_C crystal structure of z3393 from escherichia coli o157:h7 0.8775 60 157
5m21-assembly1.cif.gz_C crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound 0.8749 10 174
4zxa-assembly1.cif.gz_B crystal structure of hydroquinone 1,2-dioxygenase pnpcd in complex with cd2+ and 4-hydroxybenzonitrile 0.8706 6 173
3nl1-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with gentisate 0.8676 60 157
5m21-assembly1.cif.gz_D crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound 0.8658 41 156
ID Description Score Start End Superfamily
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8399 56 157 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8338 56 159 2.60.120.10
1zx5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8312 56 159 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8306 52 158 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8269 54 159 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2G4J352-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9839 40 173 GO:0051213
AF-A0A2G4J352-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.955 40 173 GO:0051213
AF-A0A7C5EWE8-F1-model_v4 Cupin domain-containing protein 0.908 45 159
AF-A0A0F0HFM9-F1-model_v4 Cupin 0.9065 43 158
AF-A0A7Y8RJY2-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9046 10 174 GO:0051213

Map