F492274

General Info

Members Datasets Scaffolds Average Seq Length
1258 338 1258 71

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10461921|Ga0207671_104619212
Length 86
Sequence LRQQGHARRPGGVLVMENRLRVLRAERNWSQGDLAERLEVSRQSVNAIETGKYDPSLPLAFRIAELFDLSIEQVFVSPSRDTSQTA

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
122 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
193 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
194 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
195 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
228 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
229 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
230 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
233 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
234 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
235 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
236 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
237 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
278 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
304 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
305 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
306 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
307 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
308 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
309 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
310 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
311 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
312 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
313 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
314 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
315 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
319 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
320 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
321 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
330 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
333 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 3.18
Rhizosphere 95.79
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1041341 3300001976 Bacteria 618
2 JGI24740J21852_10031784 3300001979 Bacteria 1697
3 JGI24739J22299_10004910 3300001989 Bacteria 5093
4 JGI24739J22299_10011675 3300001989 Bacteria 3239
5 JGI24737J22298_10002269 3300001990 Bacteria 6848
6 JGI24737J22298_10006441 3300001990 Bacteria 4010
7 JGI24737J22298_10061630 3300001990 Bacteria 1128
8 JGI24743J22301_10004677 3300001991 Bacteria 2243
9 JGI24743J22301_10020903 3300001991 Bacteria 1248
10 JGI24743J22301_10023416 3300001991 Bacteria 1189
11 JGI24735J21928_10138376 3300002067 Bacteria 702
12 JGI24735J21928_10180733 3300002067 Bacteria 611
13 JGI24738J21930_10056125 3300002075 Bacteria 806
14 JGI24738J21930_10091567 3300002075 Bacteria 643
15 JGI24744J21845_10000087 3300002077 Bacteria 12007
16 JGI24034J26672_10044209 3300002239 Bacteria 754
17 rootH2_10079461 3300003320 Bacteria 2126
18 Ga0058862_12767607 3300004803 Bacteria 854
19 Ga0065712_10077034 3300005290 Bacteria 3561
20 Ga0065712_10823327 3300005290 Bacteria 505
21 Ga0065712_10825305 3300005290 Bacteria 505
22 Ga0065715_10117758 3300005293 Bacteria 2324
23 Ga0065715_10322600 3300005293 Bacteria 999
24 Ga0065715_10469900 3300005293 Bacteria 807
25 Ga0065715_11091879 3300005293 Bacteria 507
26 Ga0070658_10006725 3300005327 Bacteria 9314
27 Ga0070658_10016331 3300005327 Bacteria 5941
28 Ga0070658_10086977 3300005327 Bacteria 2571
29 Ga0070658_10094600 3300005327 Bacteria 2465
30 Ga0070658_10140523 3300005327 Bacteria 2017
31 Ga0070658_10188570 3300005327 Bacteria 1737
32 Ga0070658_10202829 3300005327 Bacteria 1674
33 Ga0070658_10239086 3300005327 Bacteria 1539
34 Ga0070658_10250185 3300005327 Bacteria 1503
35 Ga0070658_10554731 3300005327 Bacteria 994
36 Ga0070658_10622607 3300005327 Bacteria 936
37 Ga0070658_10776017 3300005327 Bacteria 832
38 Ga0070676_10296333 3300005328 Bacteria 1095
39 Ga0070676_10408267 3300005328 Bacteria 946
40 Ga0070676_10487684 3300005328 Bacteria 873
41 Ga0070676_10755808 3300005328 Bacteria 714
42 Ga0070683_100421659 3300005329 Bacteria 1273
43 Ga0070683_100523245 3300005329 Bacteria 1133
44 Ga0070683_100560931 3300005329 Bacteria 1092
45 Ga0070683_101602869 3300005329 Bacteria 626
46 Ga0070683_101760148 3300005329 Bacteria 596
47 Ga0070690_100031729 3300005330 Bacteria 3294
48 Ga0070690_101530271 3300005330 Bacteria 539
49 Ga0070670_100010583 3300005331 Bacteria 7876
50 Ga0070670_100013288 3300005331 Bacteria 7053
51 Ga0070670_100059044 3300005331 Bacteria 3293
52 Ga0070670_100098904 3300005331 Bacteria 2510
53 Ga0070670_100372673 3300005331 Bacteria 1257
54 Ga0070670_100651589 3300005331 Bacteria 945
55 Ga0070670_100780385 3300005331 Bacteria 862
56 Ga0070670_101288067 3300005331 Bacteria 669
57 Ga0070670_101316083 3300005331 Bacteria 662
58 Ga0070670_101360573 3300005331 Bacteria 650
59 Ga0068869_100017638 3300005334 Bacteria 4843
60 Ga0070666_10007976 3300005335 Bacteria 6547
61 Ga0070666_10021968 3300005335 Bacteria 4140
62 Ga0070666_10074454 3300005335 Bacteria 2314
63 Ga0070666_10122691 3300005335 Bacteria 1802
64 Ga0070680_100002487 3300005336 Bacteria 13653
65 Ga0070680_100005700 3300005336 Bacteria 9442
66 Ga0070680_100015150 3300005336 Bacteria 6038
67 Ga0070680_100207521 3300005336 Bacteria 1652
68 Ga0070680_100511525 3300005336 Bacteria 1028
69 Ga0070680_100542631 3300005336 Bacteria 996
70 Ga0070680_100881351 3300005336 Bacteria 772
71 Ga0070682_100387045 3300005337 Bacteria 1054
72 Ga0070682_100426866 3300005337 Bacteria 1009
73 Ga0068868_100095117 3300005338 Bacteria 2404
74 Ga0068868_100542981 3300005338 Bacteria 1023
75 Ga0068868_100584740 3300005338 Bacteria 987
76 Ga0068868_100789992 3300005338 Bacteria 856
77 Ga0068868_101203605 3300005338 Bacteria 701
78 Ga0070660_100008889 3300005339 Bacteria 7044
79 Ga0070660_100019740 3300005339 Bacteria 4943
80 Ga0070660_100052961 3300005339 Bacteria 3130
81 Ga0070660_100080389 3300005339 Bacteria 2558
82 Ga0070660_100111059 3300005339 Bacteria 2181
83 Ga0070660_100114493 3300005339 Bacteria 2148
84 Ga0070660_100168710 3300005339 Unclassified 1767
85 Ga0070660_100179712 3300005339 Bacteria 1712
86 Ga0070660_100197132 3300005339 Bacteria 1633
87 Ga0070660_100232272 3300005339 Bacteria 1501
88 Ga0070660_100236701 3300005339 Bacteria 1486
89 Ga0070660_100322372 3300005339 Bacteria 1269
90 Ga0070660_100632308 3300005339 Bacteria 896
91 Ga0070660_100635338 3300005339 Bacteria 894
92 Ga0070660_100898069 3300005339 Bacteria 747
93 Ga0070689_101238570 3300005340 Bacteria 671
94 Ga0070691_10772704 3300005341 Bacteria 583
95 Ga0070687_100631028 3300005343 Bacteria 740
96 Ga0070687_100952599 3300005343 Bacteria 619
97 Ga0070661_100043226 3300005344 Bacteria 3291
98 Ga0070661_100053318 3300005344 Bacteria 2959
99 Ga0070661_100154741 3300005344 Bacteria 1734
100 Ga0070661_100363049 3300005344 Bacteria 1138
101 Ga0070661_100823986 3300005344 Bacteria 762
102 Ga0070661_101195276 3300005344 Bacteria 636
103 Ga0070692_10061213 3300005345 Bacteria 1983
104 Ga0070692_10121549 3300005345 Bacteria 1457
105 Ga0070668_100025208 3300005347 Bacteria 4508
106 Ga0070668_100543885 3300005347 Bacteria 1010
107 Ga0070668_100781314 3300005347 Bacteria 847
108 Ga0070668_101790926 3300005347 Bacteria 565
109 Ga0070669_100075622 3300005353 Bacteria 2498
110 Ga0070669_100234386 3300005353 Bacteria 1456
111 Ga0070669_100449787 3300005353 Bacteria 1061
112 Ga0070669_101646752 3300005353 Bacteria 559
113 Ga0070675_100032255 3300005354 Bacteria 4238
114 Ga0070675_100037831 3300005354 Bacteria 3933
115 Ga0070675_100038284 3300005354 Bacteria 3907
116 Ga0070675_100387128 3300005354 Bacteria 1245
117 Ga0070675_100393008 3300005354 Bacteria 1236
118 Ga0070675_101245918 3300005354 Bacteria 685
119 Ga0070675_101318839 3300005354 Unclassified 665
120 Ga0070671_100001153 3300005355 Bacteria 19660
121 Ga0070671_100042899 3300005355 Bacteria 3761
122 Ga0070671_100179642 3300005355 Bacteria 1791
123 Ga0070671_100274703 3300005355 Bacteria 1432
124 Ga0070671_100951039 3300005355 Bacteria 752
125 Ga0070671_101014010 3300005355 Bacteria 728
126 Ga0070674_100093447 3300005356 Bacteria 2176
127 Ga0070674_100152339 3300005356 Bacteria 1746
128 Ga0070674_100642910 3300005356 Bacteria 901
129 Ga0070674_100959579 3300005356 Bacteria 748
130 Ga0070673_100066358 3300005364 Bacteria 2882
131 Ga0070673_100262580 3300005364 Bacteria 1509
132 Ga0070673_100287322 3300005364 Bacteria 1444
133 Ga0070673_100316579 3300005364 Bacteria 1377
134 Ga0070673_100391619 3300005364 Bacteria 1241
135 Ga0070673_100452240 3300005364 Bacteria 1155
136 Ga0070673_100458048 3300005364 Bacteria 1148
137 Ga0070673_100839998 3300005364 Bacteria 849
138 Ga0070659_100004455 3300005366 Bacteria 10005
139 Ga0070659_100004654 3300005366 Bacteria 9801
140 Ga0070659_100005251 3300005366 Bacteria 9293
141 Ga0070659_100014684 3300005366 Bacteria 5856
142 Ga0070659_100020613 3300005366 Bacteria 5011
143 Ga0070659_100021887 3300005366 Bacteria 4876
144 Ga0070659_100029848 3300005366 Bacteria 4216
145 Ga0070659_100034052 3300005366 Bacteria 3961
146 Ga0070659_100048977 3300005366 Bacteria 3321
147 Ga0070659_100064921 3300005366 Bacteria 2890
148 Ga0070659_100070020 3300005366 Bacteria 2786
149 Ga0070659_100070098 3300005366 Bacteria 2784
150 Ga0070659_100156877 3300005366 Bacteria 1859
151 Ga0070659_100164806 3300005366 Bacteria 1813
152 Ga0070659_100278415 3300005366 Bacteria 1391
153 Ga0070659_100419144 3300005366 Bacteria 1132
154 Ga0070659_100430464 3300005366 Bacteria 1117
155 Ga0070659_100696018 3300005366 Bacteria 878
156 Ga0070659_100750306 3300005366 Bacteria 846
157 Ga0070659_100980522 3300005366 Bacteria 741
158 Ga0070659_101513882 3300005366 Bacteria 598
159 Ga0070659_101574052 3300005366 Bacteria 586
160 Ga0070659_101631542 3300005366 Bacteria 576
161 Ga0070659_101826584 3300005366 Bacteria 544
162 Ga0070667_100007684 3300005367 Bacteria 8942
163 Ga0070667_100041106 3300005367 Bacteria 3879
164 Ga0070667_100350823 3300005367 Bacteria 1336
165 Ga0070667_100512222 3300005367 Bacteria 1100
166 Ga0070667_100548412 3300005367 Bacteria 1062
167 Ga0070667_101455760 3300005367 Bacteria 643
168 Ga0070709_10460787 3300005434 Bacteria 959
169 Ga0070714_100068611 3300005435 Bacteria 3060
170 Ga0070714_101091631 3300005435 Bacteria 777
171 Ga0070713_100079243 3300005436 Bacteria 2798
172 Ga0070701_10172915 3300005438 Bacteria 1259
173 Ga0070694_100038036 3300005444 Bacteria 3195
174 Ga0070663_100008628 3300005455 Bacteria 6282
175 Ga0070663_100073842 3300005455 Bacteria 2489
176 Ga0070663_100101372 3300005455 Bacteria 2148
177 Ga0070663_100135816 3300005455 Bacteria 1872
178 Ga0070663_100313197 3300005455 Bacteria 1260
179 Ga0070663_100337999 3300005455 Bacteria 1216
180 Ga0070663_100394814 3300005455 Bacteria 1129
181 Ga0070663_100667727 3300005455 Bacteria 881
182 Ga0070663_101167232 3300005455 Bacteria 675
183 Ga0070678_100112791 3300005456 Bacteria 2130
184 Ga0070678_100240079 3300005456 Bacteria 1515
185 Ga0070678_100968566 3300005456 Bacteria 781
186 Ga0070678_101193939 3300005456 Bacteria 705
187 Ga0070662_100006323 3300005457 Bacteria 7629
188 Ga0070662_100019424 3300005457 Bacteria 4613
189 Ga0070662_100056943 3300005457 Bacteria 2839
190 Ga0070662_100070374 3300005457 Bacteria 2578
191 Ga0070662_100091889 3300005457 Bacteria 2280
192 Ga0070662_100113338 3300005457 Bacteria 2069
193 Ga0070662_100115618 3300005457 Bacteria 2049
194 Ga0070662_100118385 3300005457 Bacteria 2027
195 Ga0070662_100148358 3300005457 Bacteria 1823
196 Ga0070662_100233401 3300005457 Bacteria 1473
197 Ga0070662_100578726 3300005457 Bacteria 943
198 Ga0070662_100761220 3300005457 Bacteria 822
199 Ga0070662_101300169 3300005457 Bacteria 626
200 Ga0070681_10010659 3300005458 Bacteria 9085
201 Ga0070681_10316716 3300005458 Bacteria 1469
202 Ga0070681_10919283 3300005458 Bacteria 794
203 Ga0070681_11421456 3300005458 Bacteria 617
204 Ga0068867_100012499 3300005459 Bacteria 6009
205 Ga0068867_100367189 3300005459 Bacteria 1205
206 Ga0068867_102014150 3300005459 Bacteria 546
207 Ga0070679_100008460 3300005530 Bacteria 9687
208 Ga0070679_100030956 3300005530 Bacteria 5285
209 Ga0070679_100263683 3300005530 Bacteria 1678
210 Ga0070679_100294356 3300005530 Bacteria 1574
211 Ga0070679_100417730 3300005530 Bacteria 1287
212 Ga0070679_101032138 3300005530 Bacteria 766
213 Ga0068853_100020764 3300005539 Bacteria 5463
214 Ga0068853_100035886 3300005539 Bacteria 4213
215 Ga0068853_100110530 3300005539 Bacteria 2441
216 Ga0068853_100206660 3300005539 Bacteria 1788
217 Ga0068853_100300250 3300005539 Bacteria 1484
218 Ga0068853_100387693 3300005539 Bacteria 1306
219 Ga0070672_100061095 3300005543 Bacteria 2969
220 Ga0070672_100128122 3300005543 Bacteria 2084
221 Ga0070672_100287947 3300005543 Bacteria 1390
222 Ga0070672_100311534 3300005543 Bacteria 1336
223 Ga0070672_100447343 3300005543 Bacteria 1112
224 Ga0070672_101044707 3300005543 Bacteria 725
225 Ga0070672_101138225 3300005543 Bacteria 694
226 Ga0070672_101262491 3300005543 Bacteria 659
227 Ga0070672_101269775 3300005543 Bacteria 657
228 Ga0070686_101458122 3300005544 Bacteria 576
229 Ga0070695_100181507 3300005545 Bacteria 1491
230 Ga0070695_100476950 3300005545 Bacteria 961
231 Ga0070696_100260569 3300005546 Bacteria 1314
232 Ga0070696_100350470 3300005546 Bacteria 1143
233 Ga0070693_100232002 3300005547 Bacteria 1215
234 Ga0070693_100541852 3300005547 Bacteria 832
235 Ga0070665_100018073 3300005548 Bacteria 7077
236 Ga0070665_100020398 3300005548 Bacteria 6657
237 Ga0070665_100213924 3300005548 Bacteria 1928
238 Ga0070665_100285026 3300005548 Bacteria 1654
239 Ga0070665_100337484 3300005548 Bacteria 1512
240 Ga0070665_102317838 3300005548 Bacteria 540
241 Ga0070704_100174703 3300005549 Bacteria 1712
242 Ga0070704_100753309 3300005549 Bacteria 867
243 Ga0068855_100053841 3300005563 Bacteria 4733
244 Ga0068855_100164277 3300005563 Bacteria 2518
245 Ga0068855_100186507 3300005563 Bacteria 2342
246 Ga0068855_100281782 3300005563 Bacteria 1845
247 Ga0068855_100284017 3300005563 Bacteria 1837
248 Ga0068855_100587348 3300005563 Bacteria 1202
249 Ga0068855_100826559 3300005563 Bacteria 983
250 Ga0070664_100019497 3300005564 Bacteria 5581
251 Ga0070664_100051422 3300005564 Bacteria 3489
252 Ga0070664_100414823 3300005564 Bacteria 1232
253 Ga0070664_100773561 3300005564 Bacteria 897
254 Ga0070664_101569364 3300005564 Bacteria 623
255 Ga0068857_100006686 3300005577 Bacteria 9911
256 Ga0068857_100123307 3300005577 Bacteria 2334
257 Ga0068857_101131626 3300005577 Bacteria 757
258 Ga0068854_100063884 3300005578 Bacteria 2673
259 Ga0068854_100199678 3300005578 Bacteria 1571
260 Ga0068854_100251725 3300005578 Bacteria 1411
261 Ga0068854_100390765 3300005578 Bacteria 1149
262 Ga0068854_100629572 3300005578 Bacteria 919
263 Ga0068854_100959723 3300005578 Bacteria 755
264 Ga0068854_102202230 3300005578 Bacteria 510
265 Ga0068856_100062897 3300005614 Bacteria 3666
266 Ga0068856_100081122 3300005614 Bacteria 3218
267 Ga0068856_100173068 3300005614 Bacteria 2171
268 Ga0068856_100420872 3300005614 Bacteria 1356
269 Ga0068856_100520659 3300005614 Bacteria 1210
270 Ga0068856_100576942 3300005614 Bacteria 1146
271 Ga0068852_100001683 3300005616 Bacteria 15057
272 Ga0068852_100003961 3300005616 Bacteria 10406
273 Ga0068852_100048353 3300005616 Bacteria 3633
274 Ga0068852_100112412 3300005616 Bacteria 2478
275 Ga0068852_100118212 3300005616 Bacteria 2422
276 Ga0068852_100157103 3300005616 Bacteria 2120
277 Ga0068852_100434607 3300005616 Bacteria 1297
278 Ga0068852_100450433 3300005616 Bacteria 1274
279 Ga0068852_100552651 3300005616 Bacteria 1152
280 Ga0068852_100759856 3300005616 Bacteria 982
281 Ga0068852_100861452 3300005616 Bacteria 922
282 Ga0068852_101150429 3300005616 Bacteria 797
283 Ga0068852_101325103 3300005616 Bacteria 742
284 Ga0068852_101507521 3300005616 Bacteria 695
285 Ga0068852_102369577 3300005616 Bacteria 552
286 Ga0068852_102424199 3300005616 Bacteria 545
287 Ga0068859_100103540 3300005617 Bacteria 2904
288 Ga0068859_100302971 3300005617 Bacteria 1691
289 Ga0068859_101224022 3300005617 Bacteria 827
290 Ga0068859_102356268 3300005617 Bacteria 587
291 Ga0068864_100003892 3300005618 Bacteria 12290
292 Ga0068864_100006964 3300005618 Bacteria 9272
293 Ga0068864_100104628 3300005618 Bacteria 2515
294 Ga0068864_100147512 3300005618 Bacteria 2128
295 Ga0068864_100253493 3300005618 Bacteria 1635
296 Ga0068864_100472777 3300005618 Bacteria 1202
297 Ga0068864_102631126 3300005618 Bacteria 509
298 Ga0068866_10032784 3300005718 Bacteria 2514
299 Ga0068866_10396745 3300005718 Bacteria 889
300 Ga0068866_10436822 3300005718 Bacteria 853
301 Ga0068861_100241524 3300005719 Bacteria 1536
302 Ga0068861_100602915 3300005719 Bacteria 1008
303 Ga0068861_102363751 3300005719 Bacteria 534
304 Ga0068851_10041206 3300005834 Bacteria 2321
305 Ga0068851_10252513 3300005834 Bacteria 1001
306 Ga0068870_10020264 3300005840 Bacteria 3235
307 Ga0068863_100017219 3300005841 Bacteria 6930
308 Ga0068863_100019578 3300005841 Bacteria 6473
309 Ga0068863_100068479 3300005841 Bacteria 3357
310 Ga0068863_101731580 3300005841 Bacteria 635
311 Ga0068863_102499302 3300005841 Bacteria 526
312 Ga0068858_100057665 3300005842 Bacteria 3589
313 Ga0068858_100123919 3300005842 Bacteria 2418
314 Ga0068858_100285624 3300005842 Bacteria 1572
315 Ga0068858_100425630 3300005842 Bacteria 1277
316 Ga0068858_100602248 3300005842 Bacteria 1066
317 Ga0068860_100004855 3300005843 Bacteria 13707
318 Ga0068860_100204706 3300005843 Bacteria 1913
319 Ga0068860_100809219 3300005843 Bacteria 950
320 Ga0068860_101420615 3300005843 Bacteria 715
321 Ga0068862_100085609 3300005844 Bacteria 2739
322 Ga0068862_100282557 3300005844 Bacteria 1521
323 Ga0068862_100308013 3300005844 Bacteria 1459
324 Ga0068862_101780324 3300005844 Bacteria 625
325 Ga0068862_101893393 3300005844 Bacteria 606
326 Ga0068862_102686477 3300005844 Bacteria 509
327 Ga0081539_10009840 3300005985 Bacteria 7895
328 Ga0070717_10008955 3300006028 Bacteria 7503
329 Ga0070717_10382590 3300006028 Bacteria 1262
330 Ga0070716_100267273 3300006173 Bacteria 1173
331 Ga0075366_10269456 3300006195 Bacteria 1040
332 Ga0075366_10447774 3300006195 Bacteria 797
333 Ga0097621_100099081 3300006237 Bacteria 2449
334 Ga0068871_100143112 3300006358 Bacteria 2034
335 Ga0068871_100281119 3300006358 Bacteria 1456
336 Ga0068871_100580778 3300006358 Bacteria 1017
337 Ga0068871_101604575 3300006358 Bacteria 616
338 Ga0075428_100703050 3300006844 Bacteria 1077
339 Ga0075428_101036055 3300006844 Bacteria 868
340 Ga0075431_101447251 3300006847 Bacteria 646
341 Ga0075433_10401208 3300006852 Bacteria 1210
342 Ga0075433_10662056 3300006852 Bacteria 915
343 Ga0075434_101005592 3300006871 Bacteria 848
344 Ga0068865_100039406 3300006881 Bacteria 3205
345 Ga0068865_100643074 3300006881 Bacteria 901
346 Ga0075436_100360608 3300006914 Bacteria 1049
347 Ga0097620_100103537 3300006931 Bacteria 2904
348 Ga0097620_100302994 3300006931 Bacteria 1691
349 Ga0097620_101224140 3300006931 Bacteria 827
350 Ga0097620_102355511 3300006931 Bacteria 587
351 Ga0075435_100215952 3300007076 Bacteria 1628
352 Ga0105244_10152633 3300009036 Bacteria 1106
353 Ga0105250_10293854 3300009092 Bacteria 701
354 Ga0105240_10090604 3300009093 Bacteria 3737
355 Ga0105240_10104097 3300009093 Bacteria 3447
356 Ga0105240_11127909 3300009093 Bacteria 833
357 Ga0105240_11192091 3300009093 Bacteria 807
358 Ga0111539_10010849 3300009094 Bacteria 11468
359 Ga0105245_10073088 3300009098 Bacteria 3117
360 Ga0105245_10106799 3300009098 Bacteria 2598
361 Ga0105245_10143507 3300009098 Bacteria 2251
362 Ga0105245_10203025 3300009098 Bacteria 1904
363 Ga0105247_10105862 3300009101 Bacteria 1804
364 Ga0114129_11113278 3300009147 Bacteria 988
365 Ga0105243_10971779 3300009148 Bacteria 850
366 Ga0105243_11242770 3300009148 Bacteria 760
367 Ga0105241_10157434 3300009174 Bacteria 1864
368 Ga0105241_10385695 3300009174 Bacteria 1225
369 Ga0105242_10158501 3300009176 Bacteria 1979
370 Ga0105242_10283484 3300009176 Bacteria 1506
371 Ga0105242_10349630 3300009176 Bacteria 1365
372 Ga0105248_10000660 3300009177 Bacteria 39185
373 Ga0105248_10025331 3300009177 Bacteria 6595
374 Ga0105248_10045390 3300009177 Bacteria 4928
375 Ga0105248_10086790 3300009177 Bacteria 3521
376 Ga0105248_10711001 3300009177 Bacteria 1134
377 Ga0105248_10912102 3300009177 Bacteria 992
378 Ga0105248_10947027 3300009177 Bacteria 972
379 Ga0105248_11985644 3300009177 Bacteria 661
380 Ga0105248_13049804 3300009177 Bacteria 533
381 Ga0105237_10838629 3300009545 Bacteria 926
382 Ga0105238_10066506 3300009551 Bacteria 3606
383 Ga0105238_10156150 3300009551 Bacteria 2257
384 Ga0105238_11316653 3300009551 Bacteria 749
385 Ga0105249_10126929 3300009553 Bacteria 2430
386 Ga0105249_11205544 3300009553 Bacteria 828
387 Ga0105249_11967939 3300009553 Bacteria 657
388 Ga0105239_10122079 3300010375 Bacteria 2894
389 Ga0105239_10533321 3300010375 Bacteria 1336
390 Ga0105239_11678206 3300010375 Bacteria 735
391 Ga0105239_11891652 3300010375 Bacteria 692
392 Ga0105246_10038843 3300011119 Bacteria 3203
393 Ga0105246_11056400 3300011119 Bacteria 739
394 Ga0157373_10016504 3300013100 Bacteria 5385
395 Ga0157373_10019454 3300013100 Bacteria 4940
396 Ga0157373_10053919 3300013100 Bacteria 2858
397 Ga0157373_10117797 3300013100 Bacteria 1867
398 Ga0157373_10124874 3300013100 Bacteria 1810
399 Ga0157373_10149016 3300013100 Bacteria 1646
400 Ga0157373_10162230 3300013100 Bacteria 1573
401 Ga0157373_10386032 3300013100 Bacteria 1002
402 Ga0157373_10435616 3300013100 Unclassified 942
403 Ga0157373_10798530 3300013100 Bacteria 696
404 Ga0157373_10871722 3300013100 Bacteria 667
405 Ga0157373_11118314 3300013100 Bacteria 591
406 Ga0157373_11225380 3300013100 Bacteria 566
407 Ga0157373_11316979 3300013100 Bacteria 547
408 Ga0157371_10034998 3300013102 Bacteria 3600
409 Ga0157371_10045480 3300013102 Bacteria 3123
410 Ga0157371_10079143 3300013102 Bacteria 2328
411 Ga0157371_10080544 3300013102 Bacteria 2306
412 Ga0157371_10086284 3300013102 Bacteria 2223
413 Ga0157371_10096033 3300013102 Bacteria 2100
414 Ga0157371_10099998 3300013102 Bacteria 2057
415 Ga0157371_10127697 3300013102 Bacteria 1808
416 Ga0157371_10179782 3300013102 Bacteria 1513
417 Ga0157371_10183631 3300013102 Bacteria 1496
418 Ga0157371_10231519 3300013102 Bacteria 1328
419 Ga0157371_10384545 3300013102 Bacteria 1025
420 Ga0157371_10642570 3300013102 Bacteria 791
421 Ga0157371_10670711 3300013102 Bacteria 775
422 Ga0157371_10766178 3300013102 Bacteria 725
423 Ga0157370_10033272 3300013104 Bacteria 5026
424 Ga0157370_10037156 3300013104 Bacteria 4722
425 Ga0157370_10356065 3300013104 Bacteria 1349
426 Ga0157370_10387559 3300013104 Bacteria 1287
427 Ga0157370_10684941 3300013104 Bacteria 936
428 Ga0157370_10743535 3300013104 Bacteria 894
429 Ga0157370_10988149 3300013104 Bacteria 762
430 Ga0157369_10005909 3300013105 Bacteria 14216
431 Ga0157369_10082841 3300013105 Bacteria 3432
432 Ga0157369_10434869 3300013105 Bacteria 1359
433 Ga0157369_10678398 3300013105 Bacteria 1062
434 Ga0157369_11171087 3300013105 Bacteria 785
435 Ga0157369_12481470 3300013105 Bacteria 525
436 Ga0157374_10003253 3300013296 Bacteria 13645
437 Ga0157374_10210622 3300013296 Bacteria 1906
438 Ga0157374_10886619 3300013296 Bacteria 909
439 Ga0157374_11320735 3300013296 Bacteria 743
440 Ga0157374_11863627 3300013296 Bacteria 627
441 Ga0157374_12045918 3300013296 Bacteria 599
442 Ga0157374_12486981 3300013296 Bacteria 545
443 Ga0157374_12857405 3300013296 Bacteria 510
444 Ga0157378_10072817 3300013297 Bacteria 3088
445 Ga0157378_10226881 3300013297 Bacteria 1778
446 Ga0157378_10351594 3300013297 Bacteria 1440
447 Ga0157378_10648454 3300013297 Bacteria 1071
448 Ga0157378_10748863 3300013297 Bacteria 1000
449 Ga0157378_11400184 3300013297 Bacteria 742
450 Ga0157378_12147829 3300013297 Bacteria 609
451 Ga0163162_10010838 3300013306 Bacteria 8870
452 Ga0163162_10034039 3300013306 Bacteria 5068
453 Ga0163162_10180332 3300013306 Bacteria 2238
454 Ga0163162_10577786 3300013306 Bacteria 1251
455 Ga0163162_11264950 3300013306 Bacteria 838
456 Ga0163162_11776614 3300013306 Bacteria 705
457 Ga0163162_12892209 3300013306 Bacteria 552
458 Ga0157372_10041199 3300013307 Bacteria 5105
459 Ga0157372_10105309 3300013307 Bacteria 3226
460 Ga0157372_10169113 3300013307 Bacteria 2529
461 Ga0157372_10208959 3300013307 Bacteria 2262
462 Ga0157372_10294174 3300013307 Bacteria 1888
463 Ga0157372_10370395 3300013307 Bacteria 1669
464 Ga0157372_10675155 3300013307 Bacteria 1203
465 Ga0157372_10959711 3300013307 Bacteria 991
466 Ga0157372_11029943 3300013307 Bacteria 953
467 Ga0157375_10166856 3300013308 Bacteria 2347
468 Ga0157375_10337121 3300013308 Bacteria 1673
469 Ga0157375_10430163 3300013308 Bacteria 1486
470 Ga0163163_10033987 3300014325 Bacteria 4935
471 Ga0163163_10188909 3300014325 Bacteria 2108
472 Ga0163163_10517654 3300014325 Bacteria 1255
473 Ga0157380_10780533 3300014326 Bacteria 970
474 Ga0182008_10939305 3300014497 Bacteria 512
475 Ga0157377_10014489 3300014745 Bacteria 4013
476 Ga0157377_10109292 3300014745 Bacteria 1660
477 Ga0157377_10208064 3300014745 Bacteria 1246
478 Ga0157377_10720386 3300014745 Bacteria 727
479 Ga0157379_10281987 3300014968 Bacteria 1512
480 Ga0157379_10321885 3300014968 Bacteria 1412
481 Ga0157379_11350338 3300014968 Bacteria 690
482 Ga0157379_11403357 3300014968 Bacteria 677
483 Ga0157376_10108918 3300014969 Bacteria 2434
484 Ga0157376_10328453 3300014969 Bacteria 1456
485 Ga0182007_10323846 3300015262 Bacteria 572
486 Ga0197907_11287558 3300020069 Bacteria 2754
487 Ga0206349_1411556 3300020075 Bacteria 1131
488 Ga0206355_1106287 3300020076 Bacteria 1614
489 Ga0206351_10733585 3300020077 Bacteria 674
490 Ga0206350_10334419 3300020080 Bacteria 1128
491 Ga0206354_10801876 3300020081 Bacteria 1046
492 Ga0206354_10855847 3300020081 Bacteria 744
493 Ga0206353_11371573 3300020082 Bacteria 1113
494 Ga0206353_11530823 3300020082 Bacteria 1878
495 Ga0206353_11964301 3300020082 Bacteria 1438
496 Ga0206353_12041288 3300020082 Bacteria 660
497 Ga0154015_1141618 3300020610 Bacteria 563
498 Ga0224712_10301845 3300022467 Bacteria 749
499 Ga0207697_10002198 3300025315 Bacteria 10202
500 Ga0207697_10019446 3300025315 Bacteria 2782
501 Ga0207697_10058146 3300025315 Bacteria 1605
502 Ga0207697_10293835 3300025315 Bacteria 720
503 Ga0207697_10416741 3300025315 Unclassified 596
504 Ga0207656_10104433 3300025321 Bacteria 1302
505 Ga0207656_10161383 3300025321 Bacteria 1067
506 Ga0207655_1165709 3300025728 Bacteria 687
507 Ga0207682_10011777 3300025893 Bacteria 3416
508 Ga0207682_10600774 3300025893 Bacteria 519
509 Ga0207642_10016251 3300025899 Bacteria 2798
510 Ga0207642_10050630 3300025899 Bacteria 1874
511 Ga0207710_10078831 3300025900 Bacteria 1524
512 Ga0207710_10155287 3300025900 Bacteria 1112
513 Ga0207688_10009422 3300025901 Bacteria 5316
514 Ga0207688_10030882 3300025901 Bacteria 2956
515 Ga0207688_10337055 3300025901 Bacteria 927
516 Ga0207688_10345340 3300025901 Bacteria 916
517 Ga0207680_10163350 3300025903 Bacteria 1495
518 Ga0207680_10167100 3300025903 Bacteria 1479
519 Ga0207647_10002633 3300025904 Bacteria 13570
520 Ga0207647_10024599 3300025904 Bacteria 3970
521 Ga0207647_10029015 3300025904 Bacteria 3585
522 Ga0207647_10142593 3300025904 Bacteria 1404
523 Ga0207647_10290513 3300025904 Bacteria 932
524 Ga0207645_10061899 3300025907 Bacteria 2391
525 Ga0207645_10336630 3300025907 Bacteria 1008
526 Ga0207645_10347716 3300025907 Bacteria 992
527 Ga0207645_10550085 3300025907 Bacteria 783
528 Ga0207645_10578605 3300025907 Bacteria 762
529 Ga0207645_10597177 3300025907 Bacteria 749
530 Ga0207643_10038094 3300025908 Bacteria 2700
531 Ga0207705_10018659 3300025909 Bacteria 4961
532 Ga0207705_10031804 3300025909 Bacteria 3769
533 Ga0207705_10062623 3300025909 Bacteria 2687
534 Ga0207705_10063179 3300025909 Bacteria 2675
535 Ga0207705_10294781 3300025909 Bacteria 1243
536 Ga0207705_10312429 3300025909 Bacteria 1206
537 Ga0207705_10312826 3300025909 Bacteria 1206
538 Ga0207705_10411730 3300025909 Bacteria 1046
539 Ga0207705_10974060 3300025909 Bacteria 656
540 Ga0207705_10975464 3300025909 Bacteria 655
541 Ga0207705_11289101 3300025909 Bacteria 558
542 Ga0207705_11516354 3300025909 Bacteria 507
543 Ga0207654_10204310 3300025911 Bacteria 1303
544 Ga0207654_11322473 3300025911 Bacteria 525
545 Ga0207707_10042825 3300025912 Bacteria 3951
546 Ga0207707_10497305 3300025912 Bacteria 1040
547 Ga0207707_10821861 3300025912 Bacteria 773
548 Ga0207707_10859485 3300025912 Bacteria 752
549 Ga0207695_10078395 3300025913 Bacteria 3352
550 Ga0207695_11687208 3300025913 Bacteria 514
551 Ga0207671_10461921 3300025914 Bacteria 1011
552 Ga0207660_10005019 3300025917 Bacteria 8627
553 Ga0207660_10011295 3300025917 Bacteria 5807
554 Ga0207660_10330147 3300025917 Bacteria 1219
555 Ga0207660_10374232 3300025917 Bacteria 1144
556 Ga0207660_10376975 3300025917 Bacteria 1140
557 Ga0207660_10430534 3300025917 Bacteria 1065
558 Ga0207662_10371778 3300025918 Bacteria 964
559 Ga0207662_10409074 3300025918 Bacteria 921
560 Ga0207662_10500832 3300025918 Bacteria 836
561 Ga0207657_10002179 3300025919 Bacteria 21219
562 Ga0207657_10014760 3300025919 Bacteria 7606
563 Ga0207657_10015699 3300025919 Bacteria 7324
564 Ga0207657_10020632 3300025919 Bacteria 6222
565 Ga0207657_10031438 3300025919 Bacteria 4808
566 Ga0207657_10045664 3300025919 Bacteria 3842
567 Ga0207657_10062053 3300025919 Bacteria 3202
568 Ga0207657_10068468 3300025919 Bacteria 3015
569 Ga0207657_10083246 3300025919 Bacteria 2684
570 Ga0207657_10124685 3300025919 Bacteria 2116
571 Ga0207657_10137070 3300025919 Bacteria 2002
572 Ga0207657_10149735 3300025919 Bacteria 1901
573 Ga0207657_10166084 3300025919 Unclassified 1790
574 Ga0207649_10019441 3300025920 Bacteria 3882
575 Ga0207649_10038455 3300025920 Bacteria 2897
576 Ga0207649_10043321 3300025920 Bacteria 2751
577 Ga0207649_10094685 3300025920 Bacteria 1963
578 Ga0207649_10127974 3300025920 Bacteria 1721
579 Ga0207649_10262459 3300025920 Bacteria 1248
580 Ga0207649_10287775 3300025920 Bacteria 1197
581 Ga0207649_10311193 3300025920 Bacteria 1154
582 Ga0207649_10715660 3300025920 Bacteria 777
583 Ga0207649_10992930 3300025920 Bacteria 660
584 Ga0207652_10011538 3300025921 Bacteria 7123
585 Ga0207652_10017787 3300025921 Bacteria 5823
586 Ga0207652_10080707 3300025921 Bacteria 2844
587 Ga0207652_10106943 3300025921 Bacteria 2477
588 Ga0207652_10218264 3300025921 Bacteria 1718
589 Ga0207652_10268927 3300025921 Bacteria 1537
590 Ga0207652_10378562 3300025921 Bacteria 1277
591 Ga0207652_10480076 3300025921 Bacteria 1120
592 Ga0207681_10106940 3300025923 Bacteria 2028
593 Ga0207681_10199184 3300025923 Bacteria 1536
594 Ga0207681_10477972 3300025923 Bacteria 1017
595 Ga0207681_10548209 3300025923 Bacteria 951
596 Ga0207681_11368667 3300025923 Bacteria 594
597 Ga0207694_10124178 3300025924 Bacteria 2063
598 Ga0207694_10782639 3300025924 Bacteria 806
599 Ga0207694_11375407 3300025924 Bacteria 597
600 Ga0207650_10052989 3300025925 Bacteria 3006
601 Ga0207650_10066817 3300025925 Bacteria 2697
602 Ga0207650_10082758 3300025925 Bacteria 2437
603 Ga0207650_10101595 3300025925 Bacteria 2214
604 Ga0207650_10345032 3300025925 Bacteria 1224
605 Ga0207650_10509238 3300025925 Bacteria 1006
606 Ga0207650_10630437 3300025925 Bacteria 903
607 Ga0207650_10703187 3300025925 Bacteria 854
608 Ga0207650_11072842 3300025925 Bacteria 685
609 Ga0207650_11077280 3300025925 Bacteria 684
610 Ga0207650_11266642 3300025925 Bacteria 628
611 Ga0207659_10023658 3300025926 Bacteria 4104
612 Ga0207659_10100473 3300025926 Bacteria 2180
613 Ga0207659_10126379 3300025926 Bacteria 1967
614 Ga0207659_10161321 3300025926 Bacteria 1760
615 Ga0207659_10619891 3300025926 Bacteria 923
616 Ga0207687_10069593 3300025927 Bacteria 2510
617 Ga0207687_10220615 3300025927 Bacteria 1493
618 Ga0207687_10261879 3300025927 Bacteria 1379
619 Ga0207687_11661713 3300025927 Bacteria 548
620 Ga0207700_10590375 3300025928 Bacteria 988
621 Ga0207664_10139058 3300025929 Bacteria 2052
622 Ga0207664_10382532 3300025929 Bacteria 1249
623 Ga0207664_10407777 3300025929 Bacteria 1209
624 Ga0207664_11676426 3300025929 Unclassified 558
625 Ga0207644_10000358 3300025931 Bacteria 29705
626 Ga0207644_10000415 3300025931 Bacteria 27794
627 Ga0207644_10003915 3300025931 Bacteria 9657
628 Ga0207644_10048669 3300025931 Bacteria 3032
629 Ga0207644_10184752 3300025931 Bacteria 1636
630 Ga0207644_10468000 3300025931 Bacteria 1037
631 Ga0207644_11088780 3300025931 Bacteria 671
632 Ga0207644_11472711 3300025931 Bacteria 572
633 Ga0207644_11791932 3300025931 Bacteria 514
634 Ga0207690_10005597 3300025932 Bacteria 7424
635 Ga0207690_10009277 3300025932 Bacteria 5846
636 Ga0207690_10016900 3300025932 Bacteria 4448
637 Ga0207690_10022602 3300025932 Bacteria 3914
638 Ga0207690_10038521 3300025932 Bacteria 3112
639 Ga0207690_10044284 3300025932 Bacteria 2933
640 Ga0207690_10086626 3300025932 Bacteria 2202
641 Ga0207690_10128251 3300025932 Bacteria 1853
642 Ga0207690_10225206 3300025932 Bacteria 1437
643 Ga0207690_10255300 3300025932 Bacteria 1356
644 Ga0207690_10356323 3300025932 Bacteria 1158
645 Ga0207690_10363873 3300025932 Bacteria 1146
646 Ga0207690_10545244 3300025932 Bacteria 942
647 Ga0207690_10578370 3300025932 Bacteria 915
648 Ga0207690_10681369 3300025932 Bacteria 844
649 Ga0207690_10730690 3300025932 Bacteria 815
650 Ga0207690_11335492 3300025932 Bacteria 599
651 Ga0207706_10003298 3300025933 Bacteria 15456
652 Ga0207706_10011160 3300025933 Bacteria 8190
653 Ga0207706_10032025 3300025933 Bacteria 4684
654 Ga0207706_10034511 3300025933 Bacteria 4500
655 Ga0207706_10062759 3300025933 Bacteria 3272
656 Ga0207706_10075560 3300025933 Bacteria 2963
657 Ga0207706_10104621 3300025933 Bacteria 2490
658 Ga0207706_10165875 3300025933 Bacteria 1941
659 Ga0207706_10563052 3300025933 Bacteria 980
660 Ga0207706_10844342 3300025933 Bacteria 776
661 Ga0207706_11671535 3300025933 Bacteria 514
662 Ga0207686_10157965 3300025934 Bacteria 1586
663 Ga0207686_10703627 3300025934 Bacteria 803
664 Ga0207709_11771843 3300025935 Bacteria 514
665 Ga0207669_10048374 3300025937 Bacteria 2526
666 Ga0207669_10082622 3300025937 Bacteria 2063
667 Ga0207669_10149834 3300025937 Bacteria 1632
668 Ga0207669_10502897 3300025937 Bacteria 970
669 Ga0207704_10039312 3300025938 Bacteria 2753
670 Ga0207704_10226361 3300025938 Bacteria 1387
671 Ga0207665_10030997 3300025939 Bacteria 3537
672 Ga0207691_10002039 3300025940 Bacteria 19763
673 Ga0207691_10008814 3300025940 Bacteria 9676
674 Ga0207691_10028711 3300025940 Bacteria 5206
675 Ga0207691_10040667 3300025940 Bacteria 4295
676 Ga0207691_11530883 3300025940 Bacteria 544
677 Ga0207711_10002381 3300025941 Bacteria 16823
678 Ga0207711_10004092 3300025941 Bacteria 12505
679 Ga0207711_10012307 3300025941 Bacteria 7112
680 Ga0207711_10025986 3300025941 Bacteria 4911
681 Ga0207711_10085965 3300025941 Bacteria 2756
682 Ga0207711_10192872 3300025941 Bacteria 1857
683 Ga0207711_10305382 3300025941 Bacteria 1468
684 Ga0207711_10415523 3300025941 Bacteria 1251
685 Ga0207711_10847379 3300025941 Bacteria 851
686 Ga0207689_10073008 3300025942 Bacteria 2819
687 Ga0207689_10073615 3300025942 Bacteria 2806
688 Ga0207661_10074011 3300025944 Bacteria 2792
689 Ga0207661_10305159 3300025944 Bacteria 1428
690 Ga0207661_11249016 3300025944 Bacteria 683
691 Ga0207679_10053217 3300025945 Bacteria 2973
692 Ga0207679_10076401 3300025945 Bacteria 2544
693 Ga0207679_10185494 3300025945 Bacteria 1724
694 Ga0207679_10360790 3300025945 Bacteria 1269
695 Ga0207679_10375991 3300025945 Bacteria 1244
696 Ga0207679_10540745 3300025945 Bacteria 1044
697 Ga0207679_10785935 3300025945 Bacteria 867
698 Ga0207679_11343538 3300025945 Bacteria 656
699 Ga0207679_11401616 3300025945 Bacteria 641
700 Ga0207679_11712322 3300025945 Bacteria 575
701 Ga0207667_10002612 3300025949 Bacteria 22331
702 Ga0207667_10005995 3300025949 Bacteria 14785
703 Ga0207667_10019409 3300025949 Bacteria 7590
704 Ga0207667_10019667 3300025949 Bacteria 7528
705 Ga0207667_10180615 3300025949 Bacteria 2167
706 Ga0207667_10670058 3300025949 Bacteria 1042
707 Ga0207667_10696421 3300025949 Bacteria 1019
708 Ga0207667_11102500 3300025949 Bacteria 777
709 Ga0207667_11715540 3300025949 Bacteria 594
710 Ga0207651_10055211 3300025960 Bacteria 2727
711 Ga0207651_10098848 3300025960 Bacteria 2159
712 Ga0207651_10145031 3300025960 Bacteria 1839
713 Ga0207651_10145930 3300025960 Bacteria 1835
714 Ga0207651_10269846 3300025960 Bacteria 1401
715 Ga0207651_10484649 3300025960 Bacteria 1066
716 Ga0207651_10687455 3300025960 Bacteria 900
717 Ga0207651_10760739 3300025960 Bacteria 857
718 Ga0207651_11350066 3300025960 Bacteria 641
719 Ga0207712_10013315 3300025961 Bacteria 5274
720 Ga0207712_11095604 3300025961 Bacteria 709
721 Ga0207712_11310183 3300025961 Bacteria 647
722 Ga0207668_10025749 3300025972 Bacteria 3811
723 Ga0207668_10085046 3300025972 Bacteria 2307
724 Ga0207668_11404270 3300025972 Bacteria 629
725 Ga0207640_10086017 3300025981 Bacteria 2163
726 Ga0207640_10098720 3300025981 Bacteria 2042
727 Ga0207640_10118614 3300025981 Bacteria 1891
728 Ga0207640_10121884 3300025981 Bacteria 1870
729 Ga0207640_10554053 3300025981 Bacteria 966
730 Ga0207640_11550491 3300025981 Bacteria 596
731 Ga0207640_11857299 3300025981 Archaea 545
732 Ga0207658_10047181 3300025986 Bacteria 3151
733 Ga0207658_10089985 3300025986 Bacteria 2377
734 Ga0207658_10539832 3300025986 Bacteria 1042
735 Ga0207658_10881206 3300025986 Bacteria 814
736 Ga0207658_11445001 3300025986 Bacteria 629
737 Ga0207658_11501247 3300025986 Bacteria 616
738 Ga0207677_10111420 3300026023 Bacteria 2039
739 Ga0207677_10209566 3300026023 Bacteria 1555
740 Ga0207677_10405454 3300026023 Bacteria 1157
741 Ga0207677_10667523 3300026023 Bacteria 919
742 Ga0207677_10708699 3300026023 Bacteria 894
743 Ga0207677_10997508 3300026023 Bacteria 759
744 Ga0207703_10000593 3300026035 Bacteria 36861
745 Ga0207703_10106781 3300026035 Bacteria 2382
746 Ga0207703_10269579 3300026035 Bacteria 1542
747 Ga0207703_10282020 3300026035 Bacteria 1509
748 Ga0207703_10776805 3300026035 Bacteria 914
749 Ga0207639_10047241 3300026041 Bacteria 3252
750 Ga0207639_10093915 3300026041 Bacteria 2407
751 Ga0207639_10341120 3300026041 Bacteria 1336
752 Ga0207639_10403711 3300026041 Bacteria 1231
753 Ga0207639_10936784 3300026041 Bacteria 810
754 Ga0207678_10009013 3300026067 Bacteria 8782
755 Ga0207678_10015421 3300026067 Bacteria 6719
756 Ga0207678_10021391 3300026067 Bacteria 5672
757 Ga0207678_10023390 3300026067 Bacteria 5404
758 Ga0207678_10280135 3300026067 Bacteria 1431
759 Ga0207678_10413599 3300026067 Bacteria 1169
760 Ga0207678_10541212 3300026067 Bacteria 1018
761 Ga0207678_10812438 3300026067 Bacteria 826
762 Ga0207702_10025805 3300026078 Bacteria 4878
763 Ga0207702_11223340 3300026078 Bacteria 745
764 Ga0207702_11231392 3300026078 Bacteria 743
765 Ga0207702_11269948 3300026078 Bacteria 730
766 Ga0207702_11836677 3300026078 Bacteria 598
767 Ga0207641_10014381 3300026088 Bacteria 6485
768 Ga0207641_10107436 3300026088 Bacteria 2468
769 Ga0207641_10134341 3300026088 Bacteria 2225
770 Ga0207648_10018551 3300026089 Bacteria 6297
771 Ga0207648_10144548 3300026089 Bacteria 2098
772 Ga0207676_10000253 3300026095 Bacteria 46261
773 Ga0207676_10002138 3300026095 Bacteria 14289
774 Ga0207676_10013212 3300026095 Bacteria 5930
775 Ga0207676_10372243 3300026095 Bacteria 1327
776 Ga0207676_10434331 3300026095 Bacteria 1234
777 Ga0207676_11031946 3300026095 Bacteria 811
778 Ga0207676_12059379 3300026095 Bacteria 569
779 Ga0207674_10000086 3300026116 Bacteria 100722
780 Ga0207674_10056635 3300026116 Bacteria 3979
781 Ga0207674_10170758 3300026116 Bacteria 2128
782 Ga0207674_10352142 3300026116 Bacteria 1423
783 Ga0207674_12286999 3300026116 Bacteria 503
784 Ga0207675_100176499 3300026118 Bacteria 2044
785 Ga0207675_102532408 3300026118 Bacteria 523
786 Ga0207675_102720569 3300026118 Bacteria 503
787 Ga0207683_10023087 3300026121 Bacteria 5346
788 Ga0207683_10062138 3300026121 Bacteria 3289
789 Ga0207683_10215180 3300026121 Bacteria 1750
790 Ga0207698_10004003 3300026142 Bacteria 8937
791 Ga0207698_10015624 3300026142 Bacteria 5090
792 Ga0207698_10066765 3300026142 Bacteria 2833
793 Ga0207698_10093885 3300026142 Bacteria 2465
794 Ga0207698_10186138 3300026142 Bacteria 1845
795 Ga0207698_10272391 3300026142 Bacteria 1561
796 Ga0207698_10385650 3300026142 Bacteria 1334
797 Ga0207698_10425964 3300026142 Bacteria 1275
798 Ga0207698_10428235 3300026142 Bacteria 1271
799 Ga0207698_11040457 3300026142 Bacteria 830
800 Ga0207698_11189151 3300026142 Bacteria 776
801 Ga0207698_11199699 3300026142 Bacteria 773
802 Ga0207698_11207895 3300026142 Bacteria 770
803 Ga0207698_11796903 3300026142 Bacteria 628
804 Ga0207698_12084935 3300026142 Bacteria 581
805 Ga0207698_12195405 3300026142 Bacteria 565
806 Ga0209974_10014706 3300027876 Bacteria 2601
807 Ga0209974_10060947 3300027876 Bacteria 1277
808 Ga0268266_10006627 3300028379 Bacteria 10571
809 Ga0268266_10097239 3300028379 Bacteria 2589
810 Ga0268266_10158893 3300028379 Bacteria 2043
811 Ga0268266_10348028 3300028379 Bacteria 1392
812 Ga0268266_10914496 3300028379 Bacteria 848
813 Ga0268266_11674690 3300028379 Bacteria 611
814 Ga0268266_11975434 3300028379 Bacteria 557
815 Ga0268265_10068082 3300028380 Bacteria 2759
816 Ga0268265_10156078 3300028380 Bacteria 1931
817 Ga0268265_10250856 3300028380 Bacteria 1567
818 Ga0268265_11216133 3300028380 Bacteria 751
819 Ga0268265_12458134 3300028380 Bacteria 527
820 Ga0268264_10003670 3300028381 Bacteria 13190
821 Ga0268264_10699908 3300028381 Bacteria 1006
822 Ga0268264_11723001 3300028381 Bacteria 637
823 Ga0307515_10276095 3300028794 Bacteria 1394
824 Ga0307512_10379751 3300030522 Bacteria 605
825 Ga0316178_1146043 3300030735 Bacteria 911
826 Ga0316183_1175925 3300030742 Bacteria 1257
827 Ga0316182_1007628 3300030745 Bacteria 1076
828 Ga0316182_1158440 3300030745 Bacteria 784
829 Ga0307513_10335593 3300031456 Bacteria 1264
830 Ga0307408_100003350 3300031548 Bacteria 11002
831 Ga0307408_100022223 3300031548 Bacteria 4307
832 Ga0307408_100098065 3300031548 Bacteria 2227
833 Ga0307408_100313957 3300031548 Bacteria 1318
834 Ga0307408_100492278 3300031548 Unclassified 1072
835 Ga0307408_100504885 3300031548 Bacteria 1059
836 Ga0307408_100510975 3300031548 Bacteria 1053
837 Ga0307408_100775106 3300031548 Bacteria 868
838 Ga0307405_10002088 3300031731 Bacteria 8710
839 Ga0307405_10003714 3300031731 Bacteria 7084
840 Ga0307405_10125688 3300031731 Bacteria 1763
841 Ga0307405_10224308 3300031731 Bacteria 1381
842 Ga0307405_10538742 3300031731 Bacteria 942
843 Ga0307405_10841415 3300031731 Bacteria 772
844 Ga0307405_11116431 3300031731 Bacteria 678
845 Ga0307413_10000292 3300031824 Bacteria 15426
846 Ga0307413_10007028 3300031824 Bacteria 5189
847 Ga0307413_10023501 3300031824 Bacteria 3341
848 Ga0307413_10443662 3300031824 Bacteria 1028
849 Ga0307413_11925158 3300031824 Bacteria 531
850 Ga0307410_10000652 3300031852 Bacteria 14303
851 Ga0307410_10002064 3300031852 Bacteria 9499
852 Ga0307410_10004898 3300031852 Bacteria 7008
853 Ga0307410_10009431 3300031852 Bacteria 5473
854 Ga0307410_10149451 3300031852 Bacteria 1737
855 Ga0307410_10334473 3300031852 Bacteria 1205
856 Ga0307410_10711956 3300031852 Bacteria 847
857 Ga0307410_11122974 3300031852 Bacteria 682
858 Ga0307406_10013035 3300031901 Bacteria 4752
859 Ga0307406_10021311 3300031901 Bacteria 3831
860 Ga0307406_10260752 3300031901 Bacteria 1311
861 Ga0307406_11465758 3300031901 Bacteria 600
862 Ga0307406_11537438 3300031901 Bacteria 586
863 Ga0307407_10001061 3300031903 Bacteria 9518
864 Ga0307407_10054848 3300031903 Bacteria 2300
865 Ga0307407_10478454 3300031903 Bacteria 909
866 Ga0307407_10619267 3300031903 Bacteria 808
867 Ga0307407_10899838 3300031903 Bacteria 679
868 Ga0307407_10918381 3300031903 Bacteria 672
869 Ga0307412_10000248 3300031911 Bacteria 35008
870 Ga0307412_10015741 3300031911 Bacteria 4489
871 Ga0307412_10024386 3300031911 Bacteria 3733
872 Ga0307412_10076520 3300031911 Bacteria 2299
873 Ga0307412_10277426 3300031911 Bacteria 1314
874 Ga0307409_100001918 3300031995 Bacteria 10617
875 Ga0307409_100008269 3300031995 Bacteria 6303
876 Ga0307409_100016302 3300031995 Bacteria 4911
877 Ga0307409_100033607 3300031995 Bacteria 3734
878 Ga0307409_100353438 3300031995 Bacteria 1388
879 Ga0307409_100386207 3300031995 Bacteria 1333
880 Ga0307409_100972384 3300031995 Bacteria 866
881 Ga0307409_101159634 3300031995 Bacteria 795
882 Ga0307409_101428688 3300031995 Bacteria 718
883 Ga0307409_101468712 3300031995 Bacteria 709
884 Ga0307409_101858789 3300031995 Bacteria 631
885 Ga0307409_102254000 3300031995 Bacteria 574
886 Ga0307416_100000366 3300032002 Bacteria 23527
887 Ga0307416_100004414 3300032002 Bacteria 8476
888 Ga0307416_100031319 3300032002 Bacteria 4002
889 Ga0307416_100059570 3300032002 Bacteria 3103
890 Ga0307416_101334855 3300032002 Bacteria 823
891 Ga0307416_101643088 3300032002 Bacteria 747
892 Ga0307416_101684733 3300032002 Bacteria 739
893 Ga0307416_101863556 3300032002 Bacteria 705
894 Ga0307416_102301647 3300032002 Bacteria 639
895 Ga0307416_102905091 3300032002 Bacteria 573
896 Ga0307416_103191715 3300032002 Bacteria 548
897 Ga0307416_103677914 3300032002 Bacteria 513
898 Ga0307414_10001973 3300032004 Bacteria 10628
899 Ga0307414_10031755 3300032004 Bacteria 3468
900 Ga0307414_10035399 3300032004 Bacteria 3322
901 Ga0307414_10040212 3300032004 Bacteria 3156
902 Ga0307414_10349806 3300032004 Bacteria 1268
903 Ga0307414_10375350 3300032004 Bacteria 1228
904 Ga0307414_10408860 3300032004 Bacteria 1181
905 Ga0307414_10506226 3300032004 Bacteria 1069
906 Ga0307414_11920635 3300032004 Bacteria 552
907 Ga0307414_12195756 3300032004 Bacteria 515
908 Ga0307414_12248660 3300032004 Bacteria 509
909 Ga0307411_10005103 3300032005 Bacteria 6404
910 Ga0307411_10017878 3300032005 Bacteria 4054
911 Ga0307411_10027320 3300032005 Bacteria 3451
912 Ga0307411_10253104 3300032005 Bacteria 1386
913 Ga0307411_10283559 3300032005 Bacteria 1319
914 Ga0307411_10370297 3300032005 Bacteria 1175
915 Ga0307411_10447155 3300032005 Bacteria 1080
916 Ga0307411_10719351 3300032005 Bacteria 871
917 Ga0307411_11166504 3300032005 Bacteria 697
918 Ga0307411_11225315 3300032005 Bacteria 681
919 Ga0307411_11467211 3300032005 Bacteria 626
920 Ga0307411_11709456 3300032005 Bacteria 582
921 Ga0307415_100000909 3300032126 Bacteria 13563
922 Ga0307415_100003550 3300032126 Bacteria 7957
923 Ga0307415_100006114 3300032126 Bacteria 6458
924 Ga0307415_100025925 3300032126 Bacteria 3689
925 Ga0307415_100026424 3300032126 Bacteria 3661
926 Ga0307415_100614844 3300032126 Bacteria 969
927 Ga0307415_100709070 3300032126 Bacteria 909
928 Ga0307415_100862737 3300032126 Bacteria 831
929 Ga0307415_101593134 3300032126 Bacteria 627
930 Ga0307415_102141504 3300032126 Bacteria 546
931 Ga0307510_10037783 3300033180 Bacteria 5352
932 Ga0373929_0268380 3300035085 Bacteria 500
933 Ga0373936_0323372 3300035113 Bacteria 699
934 Ga0373939_0298294 3300035114 Bacteria 642
935 Ga0373943_0036995 3300035170 Bacteria 2341
936 Ga0373946_0147448 3300035171 Bacteria 1095
937 Ga0373955_0698063 3300035172 Bacteria 623
938 Ga0373962_0132219 3300035242 Bacteria 804
939 Ga0373931_0871600 3300035691 Bacteria 604
940 Ga0373931_1146033 3300035691 Bacteria 531
941 Ga0373927_0062157 3300035695 Bacteria 2415
942 Ga0373947_0128573 3300035725 Bacteria 1615
943 Ga0373947_1028497 3300035725 Bacteria 562
944 Ga0373925_0003304 3300037068 Bacteria 12536
945 Ga0395899_0035436 3300037312 Bacteria 3746
946 Ga0395899_0088857 3300037312 Bacteria 2241
947 Ga0395899_0093762 3300037312 Bacteria 2173
948 Ga0395899_0093985 3300037312 Bacteria 2170
949 Ga0395899_0111186 3300037312 Bacteria 1969
950 Ga0395899_0122242 3300037312 Bacteria 1863
951 Ga0395899_0146922 3300037312 Bacteria 1673
952 Ga0395899_0177583 3300037312 Bacteria 1496
953 Ga0395899_0209374 3300037312 Bacteria 1356
954 Ga0395899_0264116 3300037312 Bacteria 1176
955 Ga0395899_0328894 3300037312 Bacteria 1027
956 Ga0395899_0334855 3300037312 Unclassified 1016
957 Ga0395899_0373184 3300037312 Bacteria 949
958 Ga0395899_0379768 3300037312 Bacteria 939
959 Ga0395899_0421723 3300037312 Bacteria 879
960 Ga0395900_0002700 3300037418 Bacteria 19400
961 Ga0395900_0003041 3300037418 Bacteria 18271
962 Ga0395900_0006151 3300037418 Bacteria 12530
963 Ga0395900_0006393 3300037418 Bacteria 12283
964 Ga0395900_0014124 3300037418 Bacteria 8155
965 Ga0395900_0015350 3300037418 Bacteria 7808
966 Ga0395900_0016814 3300037418 Bacteria 7461
967 Ga0395900_0053670 3300037418 Bacteria 4148
968 Ga0395900_0055842 3300037418 Bacteria 4066
969 Ga0395900_0082848 3300037418 Bacteria 3295
970 Ga0395900_0099913 3300037418 Bacteria 2980
971 Ga0395900_0104002 3300037418 Bacteria 2917
972 Ga0395900_0125132 3300037418 Bacteria 2636
973 Ga0395900_0132914 3300037418 Bacteria 2549
974 Ga0395900_0205192 3300037418 Bacteria 1992
975 Ga0395900_0257841 3300037418 Bacteria 1742
976 Ga0395900_0269161 3300037418 Bacteria 1699
977 Ga0395900_0371165 3300037418 Bacteria 1400
978 Ga0395900_0384959 3300037418 Bacteria 1370
979 Ga0395900_0386731 3300037418 Bacteria 1366
980 Ga0395900_0463214 3300037418 Bacteria 1222
981 Ga0395900_0526276 3300037418 Bacteria 1129
982 Ga0395900_0604491 3300037418 Bacteria 1037
983 Ga0395900_0628252 3300037418 Bacteria 1012
984 Ga0395900_1342416 3300037418 Bacteria 628
985 Ga0395898_0023412 3300037466 Bacteria 6242
986 Ga0395898_0028233 3300037466 Bacteria 5626
987 Ga0395898_0045064 3300037466 Bacteria 4336
988 Ga0395898_0050245 3300037466 Bacteria 4082
989 Ga0395898_0108329 3300037466 Bacteria 2664
990 Ga0395898_0154684 3300037466 Bacteria 2194
991 Ga0395898_0157120 3300037466 Bacteria 2175
992 Ga0395898_0308096 3300037466 Bacteria 1510
993 Ga0395898_0427465 3300037466 Bacteria 1262
994 Ga0395898_0479648 3300037466 Bacteria 1183
995 Ga0395898_0497490 3300037466 Bacteria 1159
996 Ga0395898_0560802 3300037466 Bacteria 1084
997 Ga0395898_0881407 3300037466 Bacteria 833
998 Ga0395898_0960307 3300037466 Bacteria 791
999 Ga0395898_1096862 3300037466 Bacteria 729
1000 Ga0395898_1242055 3300037466 Bacteria 675
1001 Ga0395898_1331178 3300037466 Unclassified 647
1002 Ga0395905_0000226 3300037471 Bacteria 85938
1003 Ga0395905_0002055 3300037471 Bacteria 22979
1004 Ga0395905_0002081 3300037471 Bacteria 22761
1005 Ga0395905_0003223 3300037471 Bacteria 17551
1006 Ga0395905_0004472 3300037471 Bacteria 14505
1007 Ga0395905_0008041 3300037471 Bacteria 10420
1008 Ga0395905_0010915 3300037471 Bacteria 8793
1009 Ga0395905_0012965 3300037471 Bacteria 8010
1010 Ga0395905_0022794 3300037471 Bacteria 5920
1011 Ga0395905_0028444 3300037471 Bacteria 5270
1012 Ga0395905_0033598 3300037471 Bacteria 4817
1013 Ga0395905_0040985 3300037471 Bacteria 4344
1014 Ga0395905_0046615 3300037471 Bacteria 4064
1015 Ga0395905_0060052 3300037471 Bacteria 3555
1016 Ga0395905_0066467 3300037471 Bacteria 3376
1017 Ga0395905_0067275 3300037471 Bacteria 3355
1018 Ga0395905_0079251 3300037471 Bacteria 3078
1019 Ga0395905_0109977 3300037471 Bacteria 2588
1020 Ga0395905_0177684 3300037471 Bacteria 1998
1021 Ga0395905_0185695 3300037471 Bacteria 1951
1022 Ga0395905_0265267 3300037471 Bacteria 1603
1023 Ga0395905_0345920 3300037471 Bacteria 1378
1024 Ga0395905_0442242 3300037471 Bacteria 1197
1025 Ga0395905_0550308 3300037471 Bacteria 1055
1026 Ga0395905_0644168 3300037471 Bacteria 961
1027 Ga0395905_0666138 3300037471 Bacteria 943
1028 Ga0395905_0961706 3300037471 Unclassified 757
1029 Ga0395905_0971405 3300037471 Bacteria 752
1030 Ga0395905_1031932 3300037471 Bacteria 725
1031 Ga0395905_1340390 3300037471 Bacteria 619
1032 Ga0395905_1741497 3300037471 Bacteria 528
1033 Ga0395901_0002307 3300038443 Bacteria 19441
1034 Ga0395901_0005438 3300038443 Bacteria 12892
1035 Ga0395901_0027243 3300038443 Bacteria 5871
1036 Ga0395901_0029844 3300038443 Bacteria 5616
1037 Ga0395901_0034041 3300038443 Bacteria 5260
1038 Ga0395901_0071588 3300038443 Bacteria 3613
1039 Ga0395901_0078833 3300038443 Bacteria 3439
1040 Ga0395901_0101121 3300038443 Bacteria 3025
1041 Ga0395901_0190558 3300038443 Bacteria 2150
1042 Ga0395901_0259230 3300038443 Bacteria 1810
1043 Ga0395901_0272672 3300038443 Bacteria 1759
1044 Ga0395901_0335088 3300038443 Bacteria 1563
1045 Ga0395901_0347938 3300038443 Bacteria 1530
1046 Ga0395901_0441822 3300038443 Bacteria 1331
1047 Ga0395901_0489935 3300038443 Bacteria 1253
1048 Ga0395901_0573362 3300038443 Bacteria 1141
1049 Ga0395901_0591328 3300038443 Bacteria 1120
1050 Ga0395901_0617276 3300038443 Bacteria 1091
1051 Ga0395901_0639986 3300038443 Bacteria 1068
1052 Ga0395901_0730601 3300038443 Bacteria 985
1053 Ga0395901_0817557 3300038443 Bacteria 919
1054 Ga0395901_0846330 3300038443 Bacteria 900
1055 Ga0395901_0905693 3300038443 Bacteria 863
1056 Ga0395901_1107519 3300038443 Bacteria 762
1057 Ga0395901_1272783 3300038443 Bacteria 698
1058 Ga0395901_2019702 3300038443 Bacteria 522
1059 Ga0395901_2038699 3300038443 Bacteria 519
1060 Ga0439439_0052616 3300041406 Bacteria 1070
1061 Ga0439465_0055202 3300041413 Bacteria 1308
1062 Ga0451804_0612306 3300041463 Bacteria 543
1063 Ga0451849_0741623 3300041505 Bacteria 1283
1064 Ga0439432_140621 3300042006 Bacteria 710
1065 Ga0439449_0016067 3300042007 Bacteria 2815
1066 Ga0439462_0104184 3300042015 Bacteria 783
1067 Ga0450890_016729 3300042127 Bacteria 973
1068 Ga0450892_026128 3300042130 Bacteria 595
1069 Ga0450898_052658 3300042134 Bacteria 789
1070 Ga0450889_000363 3300042144 Bacteria 5033
1071 Ga0439458_0000109 3300042157 Bacteria 16485
1072 Ga0439458_0117731 3300042157 Bacteria 698
1073 Ga0466972_0113240 3300044658 Bacteria 1281
1074 Ga0466972_0278629 3300044658 Bacteria 781
1075 Ga0466972_0285294 3300044658 Bacteria 771
1076 Ga0466966_0031546 3300044684 Bacteria 3436
1077 Ga0466966_0038794 3300044684 Bacteria 3067
1078 Ga0466966_0088771 3300044684 Bacteria 1921
1079 Ga0466966_0255351 3300044684 Bacteria 1056
1080 Ga0466966_0457666 3300044684 Bacteria 767
1081 Ga0466966_0801459 3300044684 Unclassified 568
1082 Ga0466966_0854787 3300044684 Bacteria 548
1083 Ga0466961_0029959 3300044693 Bacteria 3496
1084 Ga0466961_0036378 3300044693 Bacteria 3160
1085 Ga0466961_0090190 3300044693 Bacteria 1936
1086 Ga0466961_0129893 3300044693 Unclassified 1579
1087 Ga0466961_0823796 3300044693 Bacteria 554
1088 Ga0466963_0052851 3300044694 Bacteria 2696
1089 Ga0466963_0116631 3300044694 Bacteria 1835
1090 Ga0466963_1231389 3300044694 Bacteria 526
1091 Ga0466964_0008959 3300044706 Unclassified 3765
1092 Ga0466964_0040750 3300044706 Bacteria 1876
1093 Ga0453684_0769278 3300044712 Bacteria 1041
1094 Ga0466971_0011770 3300044719 Bacteria 3832
1095 Ga0466971_0047748 3300044719 Bacteria 1925
1096 Ga0466968_0003696 3300044735 Bacteria 5678
1097 Ga0466970_0010711 3300044765 Bacteria 4660
1098 Ga0466970_0020923 3300044765 Bacteria 3405
1099 Ga0466970_0559146 3300044765 Bacteria 661
1100 Ga0466957_0074344 3300044842 Bacteria 2107
1101 Ga0466957_0152063 3300044842 Bacteria 1497
1102 Ga0466957_0266612 3300044842 Unclassified 1142
1103 Ga0466957_0684695 3300044842 Bacteria 723
1104 Ga0466957_1113998 3300044842 Bacteria 569
1105 Ga0466960_0006242 3300044901 Bacteria 4773
1106 Ga0466959_0014316 3300045049 Bacteria 5758
1107 Ga0466959_0032757 3300045049 Bacteria 3847
1108 Ga0466959_0076076 3300045049 Bacteria 2424
1109 Ga0466959_0267104 3300045049 Bacteria 1177
1110 Ga0466958_0030281 3300045836 Bacteria 3213
1111 Ga0466958_0043033 3300045836 Bacteria 2719
1112 Ga0466958_0132253 3300045836 Bacteria 1567
1113 Ga0466958_0234579 3300045836 Bacteria 1172
1114 Ga0466967_0094534 3300045976 Bacteria 2722
1115 Ga0466967_0107074 3300045976 Bacteria 2564
1116 Ga0466967_0841788 3300045976 Bacteria 911
1117 Ga0466967_1106686 3300045976 Bacteria 789
1118 Ga0495629_0793220 3300046459 Bacteria 625
1119 Ga0495638_0000414 3300046460 Bacteria 51945
1120 Ga0495638_0640814 3300046460 Bacteria 517
1121 Ga0495584_0306754 3300046491 Bacteria 806
1122 Ga0495585_0068810 3300046492 Bacteria 1933
1123 Ga0495583_0039381 3300046506 Bacteria 2227
1124 Ga0495606_0275530 3300046507 Bacteria 922
1125 Ga0495616_0125890 3300046513 Bacteria 1178
1126 Ga0495631_0208071 3300046518 Bacteria 836
1127 Ga0495632_0185176 3300046519 Bacteria 953
1128 Ga0495643_0394341 3300046522 Bacteria 612
1129 Ga0495644_0163645 3300046523 Bacteria 853
1130 Ga0495663_0014797 3300046525 Bacteria 2191
1131 Ga0495663_0017558 3300046525 Bacteria 2032
1132 Ga0495663_0208793 3300046525 Bacteria 683
1133 Ga0495663_0271318 3300046525 Bacteria 606
1134 Ga0495642_0027521 3300046528 Bacteria 2263
1135 Ga0495642_0245749 3300046528 Bacteria 782
1136 Ga0495654_0287451 3300046530 Bacteria 675
1137 Ga0495621_0000572 3300046539 Bacteria 9176
1138 Ga0495621_0027614 3300046539 Bacteria 1923
1139 Ga0495621_0216800 3300046539 Bacteria 774
1140 Ga0495597_0224296 3300046542 Bacteria 745
1141 Ga0495633_0003479 3300046558 Bacteria 10471
1142 Ga0495633_0134415 3300046558 Bacteria 1144
1143 Ga0495668_0036250 3300046616 Bacteria 2763
1144 Ga0495668_0189735 3300046616 Bacteria 1126
1145 Ga0495668_0416051 3300046616 Bacteria 739
1146 Ga0495668_0654013 3300046616 Bacteria 581
1147 Ga0495625_0000492 3300046660 Bacteria 59211
1148 Ga0495625_0033466 3300046660 Bacteria 3801
1149 Ga0495625_0422342 3300046660 Bacteria 829
1150 Ga0495659_0192372 3300046664 Bacteria 834
1151 Ga0495661_0179032 3300046665 Bacteria 1125
1152 Ga0495669_0000089 3300046684 Bacteria 60373
1153 Ga0495669_0000774 3300046684 Bacteria 13678
1154 Ga0495669_0009907 3300046684 Bacteria 4028
1155 Ga0495669_0032669 3300046684 Bacteria 2288
1156 Ga0495669_0543205 3300046684 Bacteria 565
1157 Ga0495670_0697577 3300046691 Bacteria 554
1158 Ga0495600_0893008 3300046809 Bacteria 525
1159 Ga0495683_0263568 3300047323 Bacteria 752
1160 Ga0495683_0304414 3300047323 Bacteria 684
1161 Ga0495677_0008344 3300047445 Bacteria 3851
1162 Ga0495677_0010499 3300047445 Bacteria 3399
1163 Ga0495677_0442256 3300047445 Bacteria 515
1164 Ga0495685_031991 3300047447 Bacteria 1808
1165 Ga0496100_0008265 3300048903 Bacteria 5798
1166 Ga0496100_0036550 3300048903 Bacteria 3099
1167 Ga0496101_0012014 3300048904 Bacteria 5771
1168 Ga0496101_0114186 3300048904 Bacteria 2036
1169 Ga0496101_0259583 3300048904 Bacteria 1355
1170 Ga0496102_0189683 3300048905 Bacteria 1937
1171 Ga0496103_0152524 3300048906 Bacteria 1480
1172 Ga0496103_0374618 3300048906 Bacteria 915
1173 Ga0496104_0102305 3300048907 Bacteria 2744
1174 Ga0496104_0235499 3300048907 Bacteria 1743
1175 Ga0496105_0465532 3300048908 Bacteria 996
1176 Ga0496105_0854876 3300048908 Bacteria 688
1177 Ga0496106_0033725 3300048909 Bacteria 3821
1178 Ga0496106_0210288 3300048909 Bacteria 1550
1179 Ga0496106_0942115 3300048909 Bacteria 681
1180 Ga0496106_1095845 3300048909 Bacteria 624
1181 Ga0496107_0012597 3300048910 Bacteria 5904
1182 Ga0496107_0028631 3300048910 Bacteria 3960
1183 Ga0496107_0216666 3300048910 Bacteria 1424
1184 Ga0496107_0703464 3300048910 Bacteria 743
1185 Ga0496108_0000297 3300048911 Bacteria 42741
1186 Ga0496108_0019987 3300048911 Bacteria 5502
1187 Ga0496108_0020041 3300048911 Bacteria 5496
1188 Ga0496108_0084419 3300048911 Bacteria 2695
1189 Ga0496109_0090892 3300048912 Bacteria 2823
1190 Ga0496109_0699248 3300048912 Bacteria 951
1191 Ga0496109_0894493 3300048912 Bacteria 826
1192 Ga0496110_0001178 3300048913 Bacteria 18586
1193 Ga0496110_0010023 3300048913 Bacteria 7688
1194 Ga0496111_0000420 3300048914 Bacteria 21379
1195 Ga0496111_0013922 3300048914 Bacteria 5484
1196 Ga0496112_0000950 3300048915 Bacteria 21045
1197 Ga0496112_0003824 3300048915 Bacteria 12577
1198 Ga0496112_0016452 3300048915 Bacteria 6929
1199 Ga0496112_0383577 3300048915 Bacteria 1346
1200 Ga0496113_0000977 3300048916 Bacteria 15240
1201 Ga0496113_0008494 3300048916 Bacteria 6695
1202 Ga0496113_0644144 3300048916 Bacteria 847
1203 Ga0496114_0539718 3300048917 Bacteria 1031
1204 Ga0501292_069994 3300049515 Bacteria 651
1205 Ga0501034_0287763 3300049571 Bacteria 1582
1206 Ga0501067_0176356 3300049583 Bacteria 1190
1207 Ga0501069_0284271 3300049585 Bacteria 968
1208 Ga0501069_0517108 3300049585 Bacteria 713
1209 Ga0501071_1112016 3300049587 Bacteria 610
1210 Ga0501072_0391957 3300049588 Bacteria 1102
1211 Ga0501074_1051458 3300049590 Bacteria 572
1212 Ga0501075_0345485 3300049591 Bacteria 1134
1213 Ga0501076_0058509 3300049592 Bacteria 3064
1214 Ga0501199_007709 3300049650 Unclassified 1116
1215 Ga0501201_044894 3300049651 Bacteria 539
1216 Ga0501202_073618 3300049652 Bacteria 792
1217 Ga0501207_060351 3300049654 Bacteria 694
1218 Ga0501207_116395 3300049654 Bacteria 551
1219 Ga0501216_186229 3300049660 Bacteria 508
1220 Ga0501217_271747 3300049661 Bacteria 552
1221 Ga0501233_022419 3300049668 Bacteria 1364
1222 Ga0501242_047442 3300049674 Bacteria 622
1223 Ga0501247_014714 3300049677 Bacteria 972
1224 Ga0501249_053692 3300049679 Bacteria 927
1225 Ga0501257_042440 3300049686 Bacteria 1119
1226 Ga0501257_081862 3300049686 Bacteria 833
1227 Ga0501225_0109004 3300049705 Bacteria 815
1228 Ga0501234_009354 3300049707 Bacteria 1528
1229 Ga0501079_0133294 3300049741 Bacteria 1934
1230 Ga0501080_0339563 3300049742 Bacteria 1357
1231 Ga0501263_007011 3300049760 Bacteria 1316
1232 Ga0501267_032112 3300049764 Bacteria 623
1233 Ga0501268_007619 3300049765 Bacteria 1618
1234 Ga0501268_013292 3300049765 Bacteria 1328
1235 Ga0501268_161148 3300049765 Bacteria 523
1236 Ga0501270_002423 3300049767 Bacteria 1910
1237 Ga0501270_120911 3300049767 Bacteria 570
1238 nmdc:mga05p37_1398406_c1 3300050507 Bacteria 705
1239 nmdc:mga08y16_351005_c1 3300050511 Bacteria 1515
1240 nmdc:mga0n895_279679_c1 3300050512 Bacteria 1692
1241 nmdc:mga0n895_918533_c1 3300050512 Bacteria 860
1242 nmdc:mga0rr50_182010_c1 3300050513 Bacteria 1718
1243 nmdc:mga0rr50_392164_c1 3300050513 Bacteria 1172
1244 nmdc:mga0a205_537128_c1 3300050515 Bacteria 1025
1245 nmdc:mga0a205_7550_c1 3300050515 Bacteria 9853
1246 Ga0495655_0127137 3300053083 Bacteria 781
1247 Ga0500643_003526 3300053087 Bacteria 7474
1248 Ga0500594_0033803 3300053118 Bacteria 1362
1249 Ga0500652_187055 3300053131 Bacteria 846
1250 Ga0500559_0022946 3300053136 Bacteria 2648
1251 Ga0500645_070666 3300053730 Bacteria 1002
1252 Ga0590071_050640 3300059421 Bacteria 1007
1253 Ga0590075_041990 3300059424 Bacteria 1169
1254 Ga0590077_174751 3300059426 Bacteria 517
1255 Ga0501082_0998559 3300060353 Bacteria 732
1256 Ga0466962_0024850 3300061719 Unclassified 2876
1257 Ga0466962_0223015 3300061719 Bacteria 923
1258 Ga0530510_0872073 3300061734 Bacteria 688

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0287763 Ga0501034_0287763_399_632 63
2 3300049588 Ga0501072_0391957 Ga0501072_0391957_736_951 66
3 3300049591 Ga0501075_0345485 Ga0501075_0345485_131_346 66
4 3300049592 Ga0501076_0058509 Ga0501076_0058509_148_363 66
5 3300049741 Ga0501079_0133294 Ga0501079_0133294_557_772 66
6 3300060353 Ga0501082_0998559 Ga0501082_0998559_138_353 66
7 3300009174 Ga0105241_10157434 Ga0105241_101574342 67
8 3300009545 Ga0105237_10838629 Ga0105237_108386291 67
9 3300009551 Ga0105238_10066506 Ga0105238_100665063 67
10 3300013100 Ga0157373_10117797 Ga0157373_101177972 67
11 3300013104 Ga0157370_10033272 Ga0157370_100332724 67
12 3300013105 Ga0157369_10082841 Ga0157369_100828412 67
13 3300013296 Ga0157374_10003253 Ga0157374_100032533 67
14 3300013307 Ga0157372_10105309 Ga0157372_101053093 67
15 3300037312 Ga0395899_0373184 Ga0395899_0373184_97_306 67
16 3300037418 Ga0395900_0526276 Ga0395900_0526276_646_855 67
17 3300037466 Ga0395898_0560802 Ga0395898_0560802_645_854 67
18 3300038443 Ga0395901_0272672 Ga0395901_0272672_302_511 67
19 3300006852 Ga0075433_10662056 Ga0075433_106620562 68
20 3300050515 nmdc:mga0a205_537128_c1 nmdc:mga0a205_537128_c1_229_453 68
21 3300003320 rootH2_10079461 rootH2_100794613 69
22 3300005330 Ga0070690_101530271 Ga0070690_1015302712 69
23 3300005331 Ga0070670_100651589 Ga0070670_1006515891 69
24 3300005366 Ga0070659_100164806 Ga0070659_1001648062 69
25 3300005548 Ga0070665_102317838 Ga0070665_1023178382 69
26 3300005549 Ga0070704_100174703 Ga0070704_1001747032 69
27 3300005618 Ga0068864_100006964 Ga0068864_1000069648 69
28 3300005618 Ga0068864_102631126 Ga0068864_1026311262 69
29 3300005844 Ga0068862_100085609 Ga0068862_1000856092 69
30 3300005844 Ga0068862_101893393 Ga0068862_1018933932 69
31 3300009177 Ga0105248_10086790 Ga0105248_100867904 69
32 3300013297 Ga0157378_10648454 Ga0157378_106484542 69
33 3300013306 Ga0163162_10010838 Ga0163162_100108388 69
34 3300013307 Ga0157372_10294174 Ga0157372_102941743 69
35 3300014325 Ga0163163_10033987 Ga0163163_100339875 69
36 3300025315 Ga0207697_10019446 Ga0207697_100194464 69
37 3300025921 Ga0207652_10106943 Ga0207652_101069436 69
38 3300025931 Ga0207644_11088780 Ga0207644_110887802 69
39 3300025932 Ga0207690_10255300 Ga0207690_102553002 69
40 3300025941 Ga0207711_10085965 Ga0207711_100859652 69
41 3300025986 Ga0207658_11501247 Ga0207658_115012472 69
42 3300026035 Ga0207703_10000593 Ga0207703_100005937 69
43 3300026095 Ga0207676_10013212 Ga0207676_100132124 69
44 3300028379 Ga0268266_11674690 Ga0268266_116746902 69
45 3300028380 Ga0268265_11216133 Ga0268265_112161332 69
46 3300028794 Ga0307515_10276095 Ga0307515_102760952 69
47 3300030522 Ga0307512_10379751 Ga0307512_103797512 69
48 3300031456 Ga0307513_10335593 Ga0307513_103355932 69
49 3300033180 Ga0307510_10037783 Ga0307510_100377838 69
50 3300046460 Ga0495638_0000414 Ga0495638_0000414_13536_13745 69
51 3300046460 Ga0495638_0640814 Ga0495638_0640814_32_241 69
52 3300046506 Ga0495583_0039381 Ga0495583_0039381_1145_1354 69
53 3300046528 Ga0495642_0245749 Ga0495642_0245749_125_334 69
54 3300046542 Ga0495597_0224296 Ga0495597_0224296_433_642 69
55 3300046616 Ga0495668_0189735 Ga0495668_0189735_532_741 69
56 3300046660 Ga0495625_0000492 Ga0495625_0000492_17778_17987 69
57 3300046660 Ga0495625_0033466 Ga0495625_0033466_957_1166 69
58 3300046691 Ga0495670_0697577 Ga0495670_0697577_259_468 69
59 3300048909 Ga0496106_0942115 Ga0496106_0942115_432_653 69
60 3300049587 Ga0501071_1112016 Ga0501071_1112016_46_255 69
61 3300053087 Ga0500643_003526 Ga0500643_003526_1020_1229 69
62 3300053118 Ga0500594_0033803 Ga0500594_0033803_501_710 69
63 3300053131 Ga0500652_187055 Ga0500652_187055_21_230 69
64 3300053136 Ga0500559_0022946 Ga0500559_0022946_713_922 69
65 3300053730 Ga0500645_070666 Ga0500645_070666_693_902 69
66 3300044712 Ga0453684_0769278 Ga0453684_0769278_725_937 70
67 3300001976 JGI24752J21851_1041341 JGI24752J21851_10413412 71
68 3300001979 JGI24740J21852_10031784 JGI24740J21852_100317842 71
69 3300001989 JGI24739J22299_10004910 JGI24739J22299_100049102 71
70 3300001989 JGI24739J22299_10011675 JGI24739J22299_100116753 71
71 3300001990 JGI24737J22298_10002269 JGI24737J22298_100022696 71
72 3300001990 JGI24737J22298_10006441 JGI24737J22298_100064411 71
73 3300001990 JGI24737J22298_10061630 JGI24737J22298_100616302 71
74 3300001991 JGI24743J22301_10004677 JGI24743J22301_100046773 71
75 3300001991 JGI24743J22301_10020903 JGI24743J22301_100209032 71
76 3300001991 JGI24743J22301_10023416 JGI24743J22301_100234161 71
77 3300002067 JGI24735J21928_10138376 JGI24735J21928_101383762 71
78 3300002067 JGI24735J21928_10180733 JGI24735J21928_101807332 71
79 3300002075 JGI24738J21930_10056125 JGI24738J21930_100561252 71
80 3300002075 JGI24738J21930_10091567 JGI24738J21930_100915672 71
81 3300002077 JGI24744J21845_10000087 JGI24744J21845_100000874 71
82 3300002239 JGI24034J26672_10044209 JGI24034J26672_100442092 71
83 3300004803 Ga0058862_12767607 Ga0058862_127676073 71
84 3300005290 Ga0065712_10077034 Ga0065712_100770343 71
85 3300005290 Ga0065712_10823327 Ga0065712_108233271 71
86 3300005290 Ga0065712_10825305 Ga0065712_108253051 71
87 3300005293 Ga0065715_10117758 Ga0065715_101177582 71
88 3300005293 Ga0065715_10322600 Ga0065715_103226002 71
89 3300005293 Ga0065715_10469900 Ga0065715_104699002 71
90 3300005293 Ga0065715_11091879 Ga0065715_110918791 71
91 3300005327 Ga0070658_10006725 Ga0070658_100067257 71
92 3300005327 Ga0070658_10016331 Ga0070658_100163314 71
93 3300005327 Ga0070658_10086977 Ga0070658_100869772 71
94 3300005327 Ga0070658_10094600 Ga0070658_100946003 71
95 3300005327 Ga0070658_10140523 Ga0070658_101405232 71
96 3300005327 Ga0070658_10188570 Ga0070658_101885702 71
97 3300005327 Ga0070658_10202829 Ga0070658_102028292 71
98 3300005327 Ga0070658_10239086 Ga0070658_102390863 71
99 3300005327 Ga0070658_10250185 Ga0070658_102501851 71
100 3300005327 Ga0070658_10554731 Ga0070658_105547313 71
101 3300005327 Ga0070658_10622607 Ga0070658_106226072 71
102 3300005327 Ga0070658_10776017 Ga0070658_107760172 71
103 3300005328 Ga0070676_10296333 Ga0070676_102963333 71
104 3300005328 Ga0070676_10408267 Ga0070676_104082673 71
105 3300005328 Ga0070676_10487684 Ga0070676_104876842 71
106 3300005328 Ga0070676_10755808 Ga0070676_107558081 71
107 3300005329 Ga0070683_100421659 Ga0070683_1004216591 71
108 3300005329 Ga0070683_100523245 Ga0070683_1005232452 71
109 3300005329 Ga0070683_100560931 Ga0070683_1005609311 71
110 3300005329 Ga0070683_101602869 Ga0070683_1016028691 71
111 3300005329 Ga0070683_101760148 Ga0070683_1017601482 71
112 3300005330 Ga0070690_100031729 Ga0070690_1000317292 71
113 3300005331 Ga0070670_100010583 Ga0070670_10001058310 71
114 3300005331 Ga0070670_100013288 Ga0070670_1000132885 71
115 3300005331 Ga0070670_100059044 Ga0070670_1000590444 71
116 3300005331 Ga0070670_100098904 Ga0070670_1000989043 71
117 3300005331 Ga0070670_100372673 Ga0070670_1003726731 71
118 3300005331 Ga0070670_100780385 Ga0070670_1007803853 71
119 3300005331 Ga0070670_101288067 Ga0070670_1012880672 71
120 3300005331 Ga0070670_101316083 Ga0070670_1013160831 71
121 3300005331 Ga0070670_101360573 Ga0070670_1013605731 71
122 3300005334 Ga0068869_100017638 Ga0068869_1000176383 71
123 3300005335 Ga0070666_10007976 Ga0070666_100079763 71
124 3300005335 Ga0070666_10021968 Ga0070666_100219685 71
125 3300005335 Ga0070666_10074454 Ga0070666_100744542 71
126 3300005335 Ga0070666_10122691 Ga0070666_101226913 71
127 3300005336 Ga0070680_100002487 Ga0070680_10000248715 71
128 3300005336 Ga0070680_100005700 Ga0070680_1000057005 71
129 3300005336 Ga0070680_100015150 Ga0070680_1000151502 71
130 3300005336 Ga0070680_100207521 Ga0070680_1002075213 71
131 3300005336 Ga0070680_100511525 Ga0070680_1005115252 71
132 3300005336 Ga0070680_100542631 Ga0070680_1005426312 71
133 3300005336 Ga0070680_100881351 Ga0070680_1008813512 71
134 3300005337 Ga0070682_100387045 Ga0070682_1003870452 71
135 3300005337 Ga0070682_100426866 Ga0070682_1004268661 71
136 3300005338 Ga0068868_100095117 Ga0068868_1000951173 71
137 3300005338 Ga0068868_100542981 Ga0068868_1005429812 71
138 3300005338 Ga0068868_100584740 Ga0068868_1005847402 71
139 3300005338 Ga0068868_100789992 Ga0068868_1007899922 71
140 3300005338 Ga0068868_101203605 Ga0068868_1012036051 71
141 3300005339 Ga0070660_100008889 Ga0070660_1000088892 71
142 3300005339 Ga0070660_100019740 Ga0070660_1000197406 71
143 3300005339 Ga0070660_100052961 Ga0070660_1000529614 71
144 3300005339 Ga0070660_100080389 Ga0070660_1000803893 71
145 3300005339 Ga0070660_100111059 Ga0070660_1001110593 71
146 3300005339 Ga0070660_100114493 Ga0070660_1001144932 71
147 3300005339 Ga0070660_100168710 Ga0070660_1001687103 71
148 3300005339 Ga0070660_100179712 Ga0070660_1001797122 71
149 3300005339 Ga0070660_100197132 Ga0070660_1001971322 71
150 3300005339 Ga0070660_100232272 Ga0070660_1002322722 71
151 3300005339 Ga0070660_100236701 Ga0070660_1002367012 71
152 3300005339 Ga0070660_100322372 Ga0070660_1003223722 71
153 3300005339 Ga0070660_100632308 Ga0070660_1006323082 71
154 3300005339 Ga0070660_100635338 Ga0070660_1006353381 71
155 3300005339 Ga0070660_100898069 Ga0070660_1008980692 71
156 3300005340 Ga0070689_101238570 Ga0070689_1012385702 71
157 3300005341 Ga0070691_10772704 Ga0070691_107727041 71
158 3300005343 Ga0070687_100631028 Ga0070687_1006310282 71
159 3300005343 Ga0070687_100952599 Ga0070687_1009525992 71
160 3300005344 Ga0070661_100043226 Ga0070661_1000432262 71
161 3300005344 Ga0070661_100053318 Ga0070661_1000533184 71
162 3300005344 Ga0070661_100154741 Ga0070661_1001547412 71
163 3300005344 Ga0070661_100363049 Ga0070661_1003630493 71
164 3300005344 Ga0070661_100823986 Ga0070661_1008239861 71
165 3300005344 Ga0070661_101195276 Ga0070661_1011952761 71
166 3300005345 Ga0070692_10061213 Ga0070692_100612133 71
167 3300005345 Ga0070692_10121549 Ga0070692_101215492 71
168 3300005347 Ga0070668_100025208 Ga0070668_1000252085 71
169 3300005347 Ga0070668_100543885 Ga0070668_1005438852 71
170 3300005347 Ga0070668_100781314 Ga0070668_1007813142 71
171 3300005347 Ga0070668_101790926 Ga0070668_1017909262 71
172 3300005353 Ga0070669_100075622 Ga0070669_1000756223 71
173 3300005353 Ga0070669_100234386 Ga0070669_1002343863 71
174 3300005353 Ga0070669_100449787 Ga0070669_1004497872 71
175 3300005353 Ga0070669_101646752 Ga0070669_1016467522 71
176 3300005354 Ga0070675_100032255 Ga0070675_1000322554 71
177 3300005354 Ga0070675_100037831 Ga0070675_1000378314 71
178 3300005354 Ga0070675_100038284 Ga0070675_1000382843 71
179 3300005354 Ga0070675_100387128 Ga0070675_1003871282 71
180 3300005354 Ga0070675_100393008 Ga0070675_1003930083 71
181 3300005354 Ga0070675_101245918 Ga0070675_1012459182 71
182 3300005354 Ga0070675_101318839 Ga0070675_1013188392 71
183 3300005355 Ga0070671_100001153 Ga0070671_1000011532 71
184 3300005355 Ga0070671_100042899 Ga0070671_1000428993 71
185 3300005355 Ga0070671_100179642 Ga0070671_1001796422 71
186 3300005355 Ga0070671_100274703 Ga0070671_1002747033 71
187 3300005355 Ga0070671_100951039 Ga0070671_1009510391 71
188 3300005355 Ga0070671_101014010 Ga0070671_1010140102 71
189 3300005356 Ga0070674_100093447 Ga0070674_1000934472 71
190 3300005356 Ga0070674_100152339 Ga0070674_1001523392 71
191 3300005356 Ga0070674_100642910 Ga0070674_1006429102 71
192 3300005356 Ga0070674_100959579 Ga0070674_1009595791 71
193 3300005364 Ga0070673_100066358 Ga0070673_1000663583 71
194 3300005364 Ga0070673_100262580 Ga0070673_1002625802 71
195 3300005364 Ga0070673_100287322 Ga0070673_1002873222 71
196 3300005364 Ga0070673_100316579 Ga0070673_1003165792 71
197 3300005364 Ga0070673_100391619 Ga0070673_1003916192 71
198 3300005364 Ga0070673_100452240 Ga0070673_1004522402 71
199 3300005364 Ga0070673_100458048 Ga0070673_1004580481 71
200 3300005364 Ga0070673_100839998 Ga0070673_1008399982 71
201 3300005366 Ga0070659_100004455 Ga0070659_1000044557 71
202 3300005366 Ga0070659_100004654 Ga0070659_1000046544 71
203 3300005366 Ga0070659_100005251 Ga0070659_1000052514 71
204 3300005366 Ga0070659_100014684 Ga0070659_1000146846 71
205 3300005366 Ga0070659_100020613 Ga0070659_1000206134 71
206 3300005366 Ga0070659_100021887 Ga0070659_1000218874 71
207 3300005366 Ga0070659_100029848 Ga0070659_1000298482 71
208 3300005366 Ga0070659_100034052 Ga0070659_1000340523 71
209 3300005366 Ga0070659_100048977 Ga0070659_1000489772 71
210 3300005366 Ga0070659_100064921 Ga0070659_1000649213 71
211 3300005366 Ga0070659_100070020 Ga0070659_1000700203 71
212 3300005366 Ga0070659_100070098 Ga0070659_1000700982 71
213 3300005366 Ga0070659_100156877 Ga0070659_1001568773 71
214 3300005366 Ga0070659_100278415 Ga0070659_1002784153 71
215 3300005366 Ga0070659_100419144 Ga0070659_1004191441 71
216 3300005366 Ga0070659_100430464 Ga0070659_1004304642 71
217 3300005366 Ga0070659_100696018 Ga0070659_1006960182 71
218 3300005366 Ga0070659_100750306 Ga0070659_1007503061 71
219 3300005366 Ga0070659_100980522 Ga0070659_1009805221 71
220 3300005366 Ga0070659_101513882 Ga0070659_1015138822 71
221 3300005366 Ga0070659_101574052 Ga0070659_1015740522 71
222 3300005366 Ga0070659_101631542 Ga0070659_1016315422 71
223 3300005366 Ga0070659_101826584 Ga0070659_1018265842 71
224 3300005367 Ga0070667_100007684 Ga0070667_1000076849 71
225 3300005367 Ga0070667_100041106 Ga0070667_1000411065 71
226 3300005367 Ga0070667_100350823 Ga0070667_1003508234 71
227 3300005367 Ga0070667_100512222 Ga0070667_1005122223 71
228 3300005367 Ga0070667_100548412 Ga0070667_1005484122 71
229 3300005367 Ga0070667_101455760 Ga0070667_1014557602 71
230 3300005434 Ga0070709_10460787 Ga0070709_104607872 71
231 3300005435 Ga0070714_100068611 Ga0070714_1000686113 71
232 3300005435 Ga0070714_101091631 Ga0070714_1010916312 71
233 3300005436 Ga0070713_100079243 Ga0070713_1000792433 71
234 3300005438 Ga0070701_10172915 Ga0070701_101729152 71
235 3300005444 Ga0070694_100038036 Ga0070694_1000380364 71
236 3300005455 Ga0070663_100008628 Ga0070663_1000086286 71
237 3300005455 Ga0070663_100073842 Ga0070663_1000738424 71
238 3300005455 Ga0070663_100101372 Ga0070663_1001013721 71
239 3300005455 Ga0070663_100135816 Ga0070663_1001358163 71
240 3300005455 Ga0070663_100313197 Ga0070663_1003131972 71
241 3300005455 Ga0070663_100337999 Ga0070663_1003379992 71
242 3300005455 Ga0070663_100394814 Ga0070663_1003948143 71
243 3300005455 Ga0070663_100667727 Ga0070663_1006677272 71
244 3300005455 Ga0070663_101167232 Ga0070663_1011672321 71
245 3300005456 Ga0070678_100112791 Ga0070678_1001127912 71
246 3300005456 Ga0070678_100240079 Ga0070678_1002400794 71
247 3300005456 Ga0070678_100968566 Ga0070678_1009685662 71
248 3300005456 Ga0070678_101193939 Ga0070678_1011939392 71
249 3300005457 Ga0070662_100006323 Ga0070662_1000063233 71
250 3300005457 Ga0070662_100019424 Ga0070662_1000194243 71
251 3300005457 Ga0070662_100056943 Ga0070662_1000569433 71
252 3300005457 Ga0070662_100070374 Ga0070662_1000703742 71
253 3300005457 Ga0070662_100091889 Ga0070662_1000918891 71
254 3300005457 Ga0070662_100113338 Ga0070662_1001133382 71
255 3300005457 Ga0070662_100115618 Ga0070662_1001156183 71
256 3300005457 Ga0070662_100118385 Ga0070662_1001183853 71
257 3300005457 Ga0070662_100148358 Ga0070662_1001483582 71
258 3300005457 Ga0070662_100233401 Ga0070662_1002334013 71
259 3300005457 Ga0070662_100578726 Ga0070662_1005787262 71
260 3300005457 Ga0070662_100761220 Ga0070662_1007612202 71
261 3300005457 Ga0070662_101300169 Ga0070662_1013001692 71
262 3300005458 Ga0070681_10010659 Ga0070681_100106597 71
263 3300005458 Ga0070681_10316716 Ga0070681_103167161 71
264 3300005458 Ga0070681_10919283 Ga0070681_109192832 71
265 3300005458 Ga0070681_11421456 Ga0070681_114214562 71
266 3300005459 Ga0068867_100012499 Ga0068867_1000124995 71
267 3300005459 Ga0068867_100367189 Ga0068867_1003671891 71
268 3300005459 Ga0068867_102014150 Ga0068867_1020141501 71
269 3300005530 Ga0070679_100008460 Ga0070679_1000084605 71
270 3300005530 Ga0070679_100030956 Ga0070679_1000309565 71
271 3300005530 Ga0070679_100263683 Ga0070679_1002636832 71
272 3300005530 Ga0070679_100294356 Ga0070679_1002943563 71
273 3300005530 Ga0070679_100417730 Ga0070679_1004177303 71
274 3300005530 Ga0070679_101032138 Ga0070679_1010321382 71
275 3300005539 Ga0068853_100020764 Ga0068853_1000207642 71
276 3300005539 Ga0068853_100035886 Ga0068853_1000358863 71
277 3300005539 Ga0068853_100110530 Ga0068853_1001105304 71
278 3300005539 Ga0068853_100206660 Ga0068853_1002066603 71
279 3300005539 Ga0068853_100300250 Ga0068853_1003002503 71
280 3300005539 Ga0068853_100387693 Ga0068853_1003876932 71
281 3300005543 Ga0070672_100061095 Ga0070672_1000610952 71
282 3300005543 Ga0070672_100128122 Ga0070672_1001281222 71
283 3300005543 Ga0070672_100287947 Ga0070672_1002879472 71
284 3300005543 Ga0070672_100311534 Ga0070672_1003115342 71
285 3300005543 Ga0070672_100447343 Ga0070672_1004473432 71
286 3300005543 Ga0070672_101044707 Ga0070672_1010447072 71
287 3300005543 Ga0070672_101138225 Ga0070672_1011382252 71
288 3300005543 Ga0070672_101262491 Ga0070672_1012624912 71
289 3300005543 Ga0070672_101269775 Ga0070672_1012697752 71
290 3300005544 Ga0070686_101458122 Ga0070686_1014581221 71
291 3300005545 Ga0070695_100181507 Ga0070695_1001815072 71
292 3300005545 Ga0070695_100476950 Ga0070695_1004769502 71
293 3300005546 Ga0070696_100260569 Ga0070696_1002605692 71
294 3300005546 Ga0070696_100350470 Ga0070696_1003504702 71
295 3300005547 Ga0070693_100232002 Ga0070693_1002320023 71
296 3300005547 Ga0070693_100541852 Ga0070693_1005418522 71
297 3300005548 Ga0070665_100018073 Ga0070665_1000180737 71
298 3300005548 Ga0070665_100020398 Ga0070665_1000203983 71
299 3300005548 Ga0070665_100213924 Ga0070665_1002139242 71
300 3300005548 Ga0070665_100285026 Ga0070665_1002850263 71
301 3300005548 Ga0070665_100337484 Ga0070665_1003374842 71
302 3300005549 Ga0070704_100753309 Ga0070704_1007533092 71
303 3300005563 Ga0068855_100053841 Ga0068855_1000538412 71
304 3300005563 Ga0068855_100164277 Ga0068855_1001642774 71
305 3300005563 Ga0068855_100186507 Ga0068855_1001865073 71
306 3300005563 Ga0068855_100281782 Ga0068855_1002817823 71
307 3300005563 Ga0068855_100284017 Ga0068855_1002840173 71
308 3300005563 Ga0068855_100587348 Ga0068855_1005873481 71
309 3300005563 Ga0068855_100826559 Ga0068855_1008265592 71
310 3300005564 Ga0070664_100019497 Ga0070664_1000194972 71
311 3300005564 Ga0070664_100051422 Ga0070664_1000514222 71
312 3300005564 Ga0070664_100414823 Ga0070664_1004148232 71
313 3300005564 Ga0070664_100773561 Ga0070664_1007735612 71
314 3300005564 Ga0070664_101569364 Ga0070664_1015693642 71
315 3300005577 Ga0068857_100006686 Ga0068857_1000066866 71
316 3300005577 Ga0068857_100123307 Ga0068857_1001233074 71
317 3300005577 Ga0068857_101131626 Ga0068857_1011316262 71
318 3300005578 Ga0068854_100063884 Ga0068854_1000638842 71
319 3300005578 Ga0068854_100199678 Ga0068854_1001996782 71
320 3300005578 Ga0068854_100251725 Ga0068854_1002517252 71
321 3300005578 Ga0068854_100390765 Ga0068854_1003907652 71
322 3300005578 Ga0068854_100629572 Ga0068854_1006295722 71
323 3300005578 Ga0068854_100959723 Ga0068854_1009597232 71
324 3300005578 Ga0068854_102202230 Ga0068854_1022022302 71
325 3300005614 Ga0068856_100062897 Ga0068856_1000628975 71
326 3300005614 Ga0068856_100081122 Ga0068856_1000811223 71
327 3300005614 Ga0068856_100173068 Ga0068856_1001730684 71
328 3300005614 Ga0068856_100420872 Ga0068856_1004208723 71
329 3300005614 Ga0068856_100520659 Ga0068856_1005206592 71
330 3300005614 Ga0068856_100576942 Ga0068856_1005769422 71
331 3300005616 Ga0068852_100001683 Ga0068852_1000016839 71
332 3300005616 Ga0068852_100003961 Ga0068852_1000039613 71
333 3300005616 Ga0068852_100048353 Ga0068852_1000483533 71
334 3300005616 Ga0068852_100112412 Ga0068852_1001124123 71
335 3300005616 Ga0068852_100118212 Ga0068852_1001182122 71
336 3300005616 Ga0068852_100157103 Ga0068852_1001571033 71
337 3300005616 Ga0068852_100434607 Ga0068852_1004346072 71
338 3300005616 Ga0068852_100450433 Ga0068852_1004504332 71
339 3300005616 Ga0068852_100552651 Ga0068852_1005526512 71
340 3300005616 Ga0068852_100759856 Ga0068852_1007598562 71
341 3300005616 Ga0068852_100861452 Ga0068852_1008614522 71
342 3300005616 Ga0068852_101150429 Ga0068852_1011504292 71
343 3300005616 Ga0068852_101325103 Ga0068852_1013251032 71
344 3300005616 Ga0068852_101507521 Ga0068852_1015075212 71
345 3300005616 Ga0068852_102369577 Ga0068852_1023695772 71
346 3300005616 Ga0068852_102424199 Ga0068852_1024241992 71
347 3300005617 Ga0068859_100103540 Ga0068859_1001035402 71
348 3300005617 Ga0068859_100302971 Ga0068859_1003029712 71
349 3300005617 Ga0068859_101224022 Ga0068859_1012240222 71
350 3300005617 Ga0068859_102356268 Ga0068859_1023562682 71
351 3300005618 Ga0068864_100003892 Ga0068864_1000038928 71
352 3300005618 Ga0068864_100104628 Ga0068864_1001046284 71
353 3300005618 Ga0068864_100147512 Ga0068864_1001475123 71
354 3300005618 Ga0068864_100253493 Ga0068864_1002534933 71
355 3300005618 Ga0068864_100472777 Ga0068864_1004727772 71
356 3300005718 Ga0068866_10032784 Ga0068866_100327843 71
357 3300005718 Ga0068866_10396745 Ga0068866_103967452 71
358 3300005718 Ga0068866_10436822 Ga0068866_104368222 71
359 3300005719 Ga0068861_100241524 Ga0068861_1002415243 71
360 3300005719 Ga0068861_100602915 Ga0068861_1006029152 71
361 3300005719 Ga0068861_102363751 Ga0068861_1023637512 71
362 3300005834 Ga0068851_10041206 Ga0068851_100412063 71
363 3300005834 Ga0068851_10252513 Ga0068851_102525132 71
364 3300005840 Ga0068870_10020264 Ga0068870_100202643 71
365 3300005841 Ga0068863_100017219 Ga0068863_1000172196 71
366 3300005841 Ga0068863_100019578 Ga0068863_1000195786 71
367 3300005841 Ga0068863_100068479 Ga0068863_1000684794 71
368 3300005841 Ga0068863_101731580 Ga0068863_1017315802 71
369 3300005841 Ga0068863_102499302 Ga0068863_1024993022 71
370 3300005842 Ga0068858_100057665 Ga0068858_1000576653 71
371 3300005842 Ga0068858_100123919 Ga0068858_1001239192 71
372 3300005842 Ga0068858_100285624 Ga0068858_1002856242 71
373 3300005842 Ga0068858_100425630 Ga0068858_1004256302 71
374 3300005842 Ga0068858_100602248 Ga0068858_1006022483 71
375 3300005843 Ga0068860_100004855 Ga0068860_1000048559 71
376 3300005843 Ga0068860_100204706 Ga0068860_1002047064 71
377 3300005843 Ga0068860_100809219 Ga0068860_1008092192 71
378 3300005843 Ga0068860_101420615 Ga0068860_1014206152 71
379 3300005844 Ga0068862_100282557 Ga0068862_1002825572 71
380 3300005844 Ga0068862_100308013 Ga0068862_1003080133 71
381 3300005844 Ga0068862_101780324 Ga0068862_1017803242 71
382 3300005844 Ga0068862_102686477 Ga0068862_1026864772 71
383 3300005985 Ga0081539_10009840 Ga0081539_100098407 71
384 3300006028 Ga0070717_10008955 Ga0070717_100089553 71
385 3300006028 Ga0070717_10382590 Ga0070717_103825903 71
386 3300006173 Ga0070716_100267273 Ga0070716_1002672732 71
387 3300006195 Ga0075366_10269456 Ga0075366_102694563 71
388 3300006195 Ga0075366_10447774 Ga0075366_104477743 71
389 3300006237 Ga0097621_100099081 Ga0097621_1000990812 71
390 3300006358 Ga0068871_100143112 Ga0068871_1001431123 71
391 3300006358 Ga0068871_100281119 Ga0068871_1002811192 71
392 3300006358 Ga0068871_100580778 Ga0068871_1005807782 71
393 3300006358 Ga0068871_101604575 Ga0068871_1016045752 71
394 3300006844 Ga0075428_100703050 Ga0075428_1007030502 71
395 3300006844 Ga0075428_101036055 Ga0075428_1010360552 71
396 3300006847 Ga0075431_101447251 Ga0075431_1014472512 71
397 3300006852 Ga0075433_10401208 Ga0075433_104012082 71
398 3300006871 Ga0075434_101005592 Ga0075434_1010055922 71
399 3300006881 Ga0068865_100039406 Ga0068865_1000394062 71
400 3300006881 Ga0068865_100643074 Ga0068865_1006430742 71
401 3300006914 Ga0075436_100360608 Ga0075436_1003606082 71
402 3300006931 Ga0097620_100103537 Ga0097620_1001035372 71
403 3300006931 Ga0097620_100302994 Ga0097620_1003029943 71
404 3300006931 Ga0097620_101224140 Ga0097620_1012241402 71
405 3300006931 Ga0097620_102355511 Ga0097620_1023555112 71
406 3300007076 Ga0075435_100215952 Ga0075435_1002159522 71
407 3300009036 Ga0105244_10152633 Ga0105244_101526332 71
408 3300009092 Ga0105250_10293854 Ga0105250_102938542 71
409 3300009093 Ga0105240_10090604 Ga0105240_100906044 71
410 3300009093 Ga0105240_10104097 Ga0105240_101040975 71
411 3300009093 Ga0105240_11127909 Ga0105240_111279092 71
412 3300009093 Ga0105240_11192091 Ga0105240_111920912 71
413 3300009094 Ga0111539_10010849 Ga0111539_100108491 71
414 3300009098 Ga0105245_10073088 Ga0105245_100730883 71
415 3300009098 Ga0105245_10106799 Ga0105245_101067992 71
416 3300009098 Ga0105245_10143507 Ga0105245_101435074 71
417 3300009098 Ga0105245_10203025 Ga0105245_102030252 71
418 3300009101 Ga0105247_10105862 Ga0105247_101058624 71
419 3300009147 Ga0114129_11113278 Ga0114129_111132782 71
420 3300009148 Ga0105243_10971779 Ga0105243_109717793 71
421 3300009148 Ga0105243_11242770 Ga0105243_112427702 71
422 3300009174 Ga0105241_10385695 Ga0105241_103856952 71
423 3300009176 Ga0105242_10158501 Ga0105242_101585014 71
424 3300009176 Ga0105242_10283484 Ga0105242_102834842 71
425 3300009176 Ga0105242_10349630 Ga0105242_103496302 71
426 3300009177 Ga0105248_10000660 Ga0105248_100006604 71
427 3300009177 Ga0105248_10025331 Ga0105248_100253319 71
428 3300009177 Ga0105248_10045390 Ga0105248_100453902 71
429 3300009177 Ga0105248_10711001 Ga0105248_107110012 71
430 3300009177 Ga0105248_10912102 Ga0105248_109121022 71
431 3300009177 Ga0105248_10947027 Ga0105248_109470272 71
432 3300009177 Ga0105248_11985644 Ga0105248_119856441 71
433 3300009177 Ga0105248_13049804 Ga0105248_130498042 71
434 3300009551 Ga0105238_10156150 Ga0105238_101561504 71
435 3300009551 Ga0105238_11316653 Ga0105238_113166532 71
436 3300009553 Ga0105249_10126929 Ga0105249_101269292 71
437 3300009553 Ga0105249_11205544 Ga0105249_112055442 71
438 3300009553 Ga0105249_11967939 Ga0105249_119679391 71
439 3300010375 Ga0105239_10122079 Ga0105239_101220794 71
440 3300010375 Ga0105239_10533321 Ga0105239_105333214 71
441 3300010375 Ga0105239_11678206 Ga0105239_116782062 71
442 3300010375 Ga0105239_11891652 Ga0105239_118916522 71
443 3300011119 Ga0105246_10038843 Ga0105246_100388433 71
444 3300011119 Ga0105246_11056400 Ga0105246_110564002 71
445 3300013100 Ga0157373_10016504 Ga0157373_100165042 71
446 3300013100 Ga0157373_10019454 Ga0157373_100194546 71
447 3300013100 Ga0157373_10053919 Ga0157373_100539192 71
448 3300013100 Ga0157373_10124874 Ga0157373_101248742 71
449 3300013100 Ga0157373_10149016 Ga0157373_101490163 71
450 3300013100 Ga0157373_10162230 Ga0157373_101622303 71
451 3300013100 Ga0157373_10386032 Ga0157373_103860323 71
452 3300013100 Ga0157373_10435616 Ga0157373_104356162 71
453 3300013100 Ga0157373_10798530 Ga0157373_107985302 71
454 3300013100 Ga0157373_10871722 Ga0157373_108717222 71
455 3300013100 Ga0157373_11118314 Ga0157373_111183142 71
456 3300013100 Ga0157373_11225380 Ga0157373_112253801 71
457 3300013100 Ga0157373_11316979 Ga0157373_113169792 71
458 3300013102 Ga0157371_10034998 Ga0157371_100349984 71
459 3300013102 Ga0157371_10045480 Ga0157371_100454804 71
460 3300013102 Ga0157371_10079143 Ga0157371_100791433 71
461 3300013102 Ga0157371_10080544 Ga0157371_100805443 71
462 3300013102 Ga0157371_10086284 Ga0157371_100862843 71
463 3300013102 Ga0157371_10096033 Ga0157371_100960333 71
464 3300013102 Ga0157371_10099998 Ga0157371_100999981 71
465 3300013102 Ga0157371_10127697 Ga0157371_101276972 71
466 3300013102 Ga0157371_10179782 Ga0157371_101797823 71
467 3300013102 Ga0157371_10183631 Ga0157371_101836312 71
468 3300013102 Ga0157371_10231519 Ga0157371_102315192 71
469 3300013102 Ga0157371_10384545 Ga0157371_103845451 71
470 3300013102 Ga0157371_10642570 Ga0157371_106425702 71
471 3300013102 Ga0157371_10670711 Ga0157371_106707111 71
472 3300013102 Ga0157371_10766178 Ga0157371_107661782 71
473 3300013104 Ga0157370_10037156 Ga0157370_100371562 71
474 3300013104 Ga0157370_10356065 Ga0157370_103560652 71
475 3300013104 Ga0157370_10387559 Ga0157370_103875592 71
476 3300013104 Ga0157370_10684941 Ga0157370_106849412 71
477 3300013104 Ga0157370_10743535 Ga0157370_107435352 71
478 3300013104 Ga0157370_10988149 Ga0157370_109881491 71
479 3300013105 Ga0157369_10005909 Ga0157369_100059095 71
480 3300013105 Ga0157369_10434869 Ga0157369_104348693 71
481 3300013105 Ga0157369_10678398 Ga0157369_106783981 71
482 3300013105 Ga0157369_11171087 Ga0157369_111710872 71
483 3300013105 Ga0157369_12481470 Ga0157369_124814702 71
484 3300013296 Ga0157374_10210622 Ga0157374_102106222 71
485 3300013296 Ga0157374_10886619 Ga0157374_108866191 71
486 3300013296 Ga0157374_11320735 Ga0157374_113207351 71
487 3300013296 Ga0157374_11863627 Ga0157374_118636272 71
488 3300013296 Ga0157374_12045918 Ga0157374_120459181 71
489 3300013296 Ga0157374_12486981 Ga0157374_124869811 71
490 3300013296 Ga0157374_12857405 Ga0157374_128574051 71
491 3300013297 Ga0157378_10072817 Ga0157378_100728172 71
492 3300013297 Ga0157378_10226881 Ga0157378_102268813 71
493 3300013297 Ga0157378_10351594 Ga0157378_103515943 71
494 3300013297 Ga0157378_10748863 Ga0157378_107488632 71
495 3300013297 Ga0157378_11400184 Ga0157378_114001842 71
496 3300013297 Ga0157378_12147829 Ga0157378_121478292 71
497 3300013306 Ga0163162_10034039 Ga0163162_100340392 71
498 3300013306 Ga0163162_10180332 Ga0163162_101803323 71
499 3300013306 Ga0163162_10577786 Ga0163162_105777862 71
500 3300013306 Ga0163162_11264950 Ga0163162_112649502 71
501 3300013306 Ga0163162_11776614 Ga0163162_117766142 71
502 3300013306 Ga0163162_12892209 Ga0163162_128922091 71
503 3300013307 Ga0157372_10041199 Ga0157372_100411993 71
504 3300013307 Ga0157372_10169113 Ga0157372_101691133 71
505 3300013307 Ga0157372_10208959 Ga0157372_102089593 71
506 3300013307 Ga0157372_10370395 Ga0157372_103703952 71
507 3300013307 Ga0157372_10675155 Ga0157372_106751552 71
508 3300013307 Ga0157372_10959711 Ga0157372_109597112 71
509 3300013307 Ga0157372_11029943 Ga0157372_110299432 71
510 3300013308 Ga0157375_10166856 Ga0157375_101668562 71
511 3300013308 Ga0157375_10337121 Ga0157375_103371212 71
512 3300013308 Ga0157375_10430163 Ga0157375_104301633 71
513 3300014325 Ga0163163_10188909 Ga0163163_101889093 71
514 3300014325 Ga0163163_10517654 Ga0163163_105176541 71
515 3300014326 Ga0157380_10780533 Ga0157380_107805333 71
516 3300014497 Ga0182008_10939305 Ga0182008_109393052 71
517 3300014745 Ga0157377_10014489 Ga0157377_100144892 71
518 3300014745 Ga0157377_10109292 Ga0157377_101092922 71
519 3300014745 Ga0157377_10208064 Ga0157377_102080643 71
520 3300014745 Ga0157377_10720386 Ga0157377_107203861 71
521 3300014968 Ga0157379_10281987 Ga0157379_102819872 71
522 3300014968 Ga0157379_10321885 Ga0157379_103218852 71
523 3300014968 Ga0157379_11350338 Ga0157379_113503382 71
524 3300014968 Ga0157379_11403357 Ga0157379_114033572 71
525 3300014969 Ga0157376_10108918 Ga0157376_101089183 71
526 3300014969 Ga0157376_10328453 Ga0157376_103284533 71
527 3300015262 Ga0182007_10323846 Ga0182007_103238462 71
528 3300020069 Ga0197907_11287558 Ga0197907_112875583 71
529 3300020075 Ga0206349_1411556 Ga0206349_14115562 71
530 3300020076 Ga0206355_1106287 Ga0206355_11062872 71
531 3300020077 Ga0206351_10733585 Ga0206351_107335852 71
532 3300020080 Ga0206350_10334419 Ga0206350_103344192 71
533 3300020081 Ga0206354_10801876 Ga0206354_108018762 71
534 3300020081 Ga0206354_10855847 Ga0206354_108558472 71
535 3300020082 Ga0206353_11371573 Ga0206353_113715732 71
536 3300020082 Ga0206353_11530823 Ga0206353_115308232 71
537 3300020082 Ga0206353_11964301 Ga0206353_119643012 71
538 3300020082 Ga0206353_12041288 Ga0206353_120412882 71
539 3300020610 Ga0154015_1141618 Ga0154015_11416182 71
540 3300022467 Ga0224712_10301845 Ga0224712_103018452 71
541 3300025315 Ga0207697_10002198 Ga0207697_1000219811 71
542 3300025315 Ga0207697_10058146 Ga0207697_100581463 71
543 3300025315 Ga0207697_10293835 Ga0207697_102938352 71
544 3300025315 Ga0207697_10416741 Ga0207697_104167412 71
545 3300025321 Ga0207656_10104433 Ga0207656_101044332 71
546 3300025321 Ga0207656_10161383 Ga0207656_101613832 71
547 3300025728 Ga0207655_1165709 Ga0207655_11657092 71
548 3300025893 Ga0207682_10011777 Ga0207682_100117772 71
549 3300025893 Ga0207682_10600774 Ga0207682_106007742 71
550 3300025899 Ga0207642_10016251 Ga0207642_100162513 71
551 3300025899 Ga0207642_10050630 Ga0207642_100506302 71
552 3300025900 Ga0207710_10078831 Ga0207710_100788313 71
553 3300025900 Ga0207710_10155287 Ga0207710_101552873 71
554 3300025901 Ga0207688_10009422 Ga0207688_100094224 71
555 3300025901 Ga0207688_10030882 Ga0207688_100308825 71
556 3300025901 Ga0207688_10337055 Ga0207688_103370552 71
557 3300025901 Ga0207688_10345340 Ga0207688_103453402 71
558 3300025903 Ga0207680_10163350 Ga0207680_101633502 71
559 3300025903 Ga0207680_10167100 Ga0207680_101671002 71
560 3300025904 Ga0207647_10002633 Ga0207647_100026339 71
561 3300025904 Ga0207647_10024599 Ga0207647_100245993 71
562 3300025904 Ga0207647_10029015 Ga0207647_100290153 71
563 3300025904 Ga0207647_10142593 Ga0207647_101425933 71
564 3300025904 Ga0207647_10290513 Ga0207647_102905132 71
565 3300025907 Ga0207645_10061899 Ga0207645_100618993 71
566 3300025907 Ga0207645_10336630 Ga0207645_103366302 71
567 3300025907 Ga0207645_10347716 Ga0207645_103477162 71
568 3300025907 Ga0207645_10550085 Ga0207645_105500852 71
569 3300025907 Ga0207645_10578605 Ga0207645_105786051 71
570 3300025907 Ga0207645_10597177 Ga0207645_105971771 71
571 3300025908 Ga0207643_10038094 Ga0207643_100380942 71
572 3300025909 Ga0207705_10018659 Ga0207705_100186592 71
573 3300025909 Ga0207705_10031804 Ga0207705_100318046 71
574 3300025909 Ga0207705_10062623 Ga0207705_100626232 71
575 3300025909 Ga0207705_10063179 Ga0207705_100631793 71
576 3300025909 Ga0207705_10294781 Ga0207705_102947812 71
577 3300025909 Ga0207705_10312429 Ga0207705_103124292 71
578 3300025909 Ga0207705_10312826 Ga0207705_103128262 71
579 3300025909 Ga0207705_10411730 Ga0207705_104117302 71
580 3300025909 Ga0207705_10974060 Ga0207705_109740602 71
581 3300025909 Ga0207705_10975464 Ga0207705_109754641 71
582 3300025909 Ga0207705_11289101 Ga0207705_112891011 71
583 3300025909 Ga0207705_11516354 Ga0207705_115163541 71
584 3300025911 Ga0207654_10204310 Ga0207654_102043101 71
585 3300025911 Ga0207654_11322473 Ga0207654_113224732 71
586 3300025912 Ga0207707_10042825 Ga0207707_100428252 71
587 3300025912 Ga0207707_10497305 Ga0207707_104973052 71
588 3300025912 Ga0207707_10821861 Ga0207707_108218612 71
589 3300025912 Ga0207707_10859485 Ga0207707_108594852 71
590 3300025913 Ga0207695_10078395 Ga0207695_100783954 71
591 3300025913 Ga0207695_11687208 Ga0207695_116872082 71
592 3300025914 Ga0207671_10461921 Ga0207671_104619212 71
593 3300025917 Ga0207660_10005019 Ga0207660_1000501911 71
594 3300025917 Ga0207660_10011295 Ga0207660_100112952 71
595 3300025917 Ga0207660_10330147 Ga0207660_103301472 71
596 3300025917 Ga0207660_10374232 Ga0207660_103742322 71
597 3300025917 Ga0207660_10376975 Ga0207660_103769752 71
598 3300025917 Ga0207660_10430534 Ga0207660_104305342 71
599 3300025918 Ga0207662_10371778 Ga0207662_103717782 71
600 3300025918 Ga0207662_10409074 Ga0207662_104090742 71
601 3300025918 Ga0207662_10500832 Ga0207662_105008322 71
602 3300025919 Ga0207657_10002179 Ga0207657_1000217911 71
603 3300025919 Ga0207657_10014760 Ga0207657_100147607 71
604 3300025919 Ga0207657_10015699 Ga0207657_100156994 71
605 3300025919 Ga0207657_10020632 Ga0207657_100206323 71
606 3300025919 Ga0207657_10031438 Ga0207657_100314383 71
607 3300025919 Ga0207657_10045664 Ga0207657_100456643 71
608 3300025919 Ga0207657_10062053 Ga0207657_100620534 71
609 3300025919 Ga0207657_10068468 Ga0207657_100684683 71
610 3300025919 Ga0207657_10083246 Ga0207657_100832463 71
611 3300025919 Ga0207657_10124685 Ga0207657_101246853 71
612 3300025919 Ga0207657_10137070 Ga0207657_101370703 71
613 3300025919 Ga0207657_10149735 Ga0207657_101497353 71
614 3300025919 Ga0207657_10166084 Ga0207657_101660842 71
615 3300025920 Ga0207649_10019441 Ga0207649_100194414 71
616 3300025920 Ga0207649_10038455 Ga0207649_100384554 71
617 3300025920 Ga0207649_10043321 Ga0207649_100433212 71
618 3300025920 Ga0207649_10094685 Ga0207649_100946854 71
619 3300025920 Ga0207649_10127974 Ga0207649_101279743 71
620 3300025920 Ga0207649_10262459 Ga0207649_102624592 71
621 3300025920 Ga0207649_10287775 Ga0207649_102877751 71
622 3300025920 Ga0207649_10311193 Ga0207649_103111932 71
623 3300025920 Ga0207649_10715660 Ga0207649_107156602 71
624 3300025920 Ga0207649_10992930 Ga0207649_109929302 71
625 3300025921 Ga0207652_10011538 Ga0207652_100115385 71
626 3300025921 Ga0207652_10017787 Ga0207652_100177876 71
627 3300025921 Ga0207652_10080707 Ga0207652_100807074 71
628 3300025921 Ga0207652_10218264 Ga0207652_102182642 71
629 3300025921 Ga0207652_10268927 Ga0207652_102689272 71
630 3300025921 Ga0207652_10378562 Ga0207652_103785622 71
631 3300025921 Ga0207652_10480076 Ga0207652_104800761 71
632 3300025923 Ga0207681_10106940 Ga0207681_101069403 71
633 3300025923 Ga0207681_10199184 Ga0207681_101991842 71
634 3300025923 Ga0207681_10477972 Ga0207681_104779722 71
635 3300025923 Ga0207681_10548209 Ga0207681_105482092 71
636 3300025923 Ga0207681_11368667 Ga0207681_113686672 71
637 3300025924 Ga0207694_10124178 Ga0207694_101241782 71
638 3300025924 Ga0207694_10782639 Ga0207694_107826392 71
639 3300025924 Ga0207694_11375407 Ga0207694_113754072 71
640 3300025925 Ga0207650_10052989 Ga0207650_100529894 71
641 3300025925 Ga0207650_10066817 Ga0207650_100668172 71
642 3300025925 Ga0207650_10082758 Ga0207650_100827584 71
643 3300025925 Ga0207650_10101595 Ga0207650_101015953 71
644 3300025925 Ga0207650_10345032 Ga0207650_103450322 71
645 3300025925 Ga0207650_10509238 Ga0207650_105092382 71
646 3300025925 Ga0207650_10630437 Ga0207650_106304373 71
647 3300025925 Ga0207650_10703187 Ga0207650_107031872 71
648 3300025925 Ga0207650_11072842 Ga0207650_110728421 71
649 3300025925 Ga0207650_11077280 Ga0207650_110772802 71
650 3300025925 Ga0207650_11266642 Ga0207650_112666422 71
651 3300025926 Ga0207659_10023658 Ga0207659_100236583 71
652 3300025926 Ga0207659_10100473 Ga0207659_101004733 71
653 3300025926 Ga0207659_10126379 Ga0207659_101263793 71
654 3300025926 Ga0207659_10161321 Ga0207659_101613214 71
655 3300025926 Ga0207659_10619891 Ga0207659_106198912 71
656 3300025927 Ga0207687_10069593 Ga0207687_100695933 71
657 3300025927 Ga0207687_10220615 Ga0207687_102206152 71
658 3300025927 Ga0207687_10261879 Ga0207687_102618792 71
659 3300025927 Ga0207687_11661713 Ga0207687_116617132 71
660 3300025928 Ga0207700_10590375 Ga0207700_105903752 71
661 3300025929 Ga0207664_10139058 Ga0207664_101390582 71
662 3300025929 Ga0207664_10382532 Ga0207664_103825322 71
663 3300025929 Ga0207664_10407777 Ga0207664_104077772 71
664 3300025929 Ga0207664_11676426 Ga0207664_116764261 71
665 3300025931 Ga0207644_10000358 Ga0207644_1000035815 71
666 3300025931 Ga0207644_10000415 Ga0207644_1000041517 71
667 3300025931 Ga0207644_10003915 Ga0207644_100039155 71
668 3300025931 Ga0207644_10048669 Ga0207644_100486693 71
669 3300025931 Ga0207644_10184752 Ga0207644_101847522 71
670 3300025931 Ga0207644_10468000 Ga0207644_104680001 71
671 3300025931 Ga0207644_11472711 Ga0207644_114727112 71
672 3300025931 Ga0207644_11791932 Ga0207644_117919322 71
673 3300025932 Ga0207690_10005597 Ga0207690_100055976 71
674 3300025932 Ga0207690_10009277 Ga0207690_100092772 71
675 3300025932 Ga0207690_10016900 Ga0207690_100169005 71
676 3300025932 Ga0207690_10022602 Ga0207690_100226024 71
677 3300025932 Ga0207690_10038521 Ga0207690_100385213 71
678 3300025932 Ga0207690_10044284 Ga0207690_100442842 71
679 3300025932 Ga0207690_10086626 Ga0207690_100866262 71
680 3300025932 Ga0207690_10128251 Ga0207690_101282511 71
681 3300025932 Ga0207690_10225206 Ga0207690_102252062 71
682 3300025932 Ga0207690_10356323 Ga0207690_103563232 71
683 3300025932 Ga0207690_10363873 Ga0207690_103638732 71
684 3300025932 Ga0207690_10545244 Ga0207690_105452443 71
685 3300025932 Ga0207690_10578370 Ga0207690_105783702 71
686 3300025932 Ga0207690_10681369 Ga0207690_106813692 71
687 3300025932 Ga0207690_10730690 Ga0207690_107306902 71
688 3300025932 Ga0207690_11335492 Ga0207690_113354922 71
689 3300025933 Ga0207706_10003298 Ga0207706_100032986 71
690 3300025933 Ga0207706_10011160 Ga0207706_100111606 71
691 3300025933 Ga0207706_10032025 Ga0207706_100320256 71
692 3300025933 Ga0207706_10034511 Ga0207706_100345116 71
693 3300025933 Ga0207706_10062759 Ga0207706_100627593 71
694 3300025933 Ga0207706_10075560 Ga0207706_100755602 71
695 3300025933 Ga0207706_10104621 Ga0207706_101046211 71
696 3300025933 Ga0207706_10165875 Ga0207706_101658752 71
697 3300025933 Ga0207706_10563052 Ga0207706_105630522 71
698 3300025933 Ga0207706_10844342 Ga0207706_108443422 71
699 3300025933 Ga0207706_11671535 Ga0207706_116715352 71
700 3300025934 Ga0207686_10157965 Ga0207686_101579653 71
701 3300025934 Ga0207686_10703627 Ga0207686_107036272 71
702 3300025935 Ga0207709_11771843 Ga0207709_117718431 71
703 3300025937 Ga0207669_10048374 Ga0207669_100483742 71
704 3300025937 Ga0207669_10082622 Ga0207669_100826223 71
705 3300025937 Ga0207669_10149834 Ga0207669_101498342 71
706 3300025937 Ga0207669_10502897 Ga0207669_105028972 71
707 3300025938 Ga0207704_10039312 Ga0207704_100393123 71
708 3300025938 Ga0207704_10226361 Ga0207704_102263613 71
709 3300025939 Ga0207665_10030997 Ga0207665_100309973 71
710 3300025940 Ga0207691_10002039 Ga0207691_100020393 71
711 3300025940 Ga0207691_10008814 Ga0207691_100088148 71
712 3300025940 Ga0207691_10028711 Ga0207691_100287118 71
713 3300025940 Ga0207691_10040667 Ga0207691_100406672 71
714 3300025940 Ga0207691_11530883 Ga0207691_115308831 71
715 3300025941 Ga0207711_10002381 Ga0207711_100023819 71
716 3300025941 Ga0207711_10004092 Ga0207711_100040923 71
717 3300025941 Ga0207711_10012307 Ga0207711_100123075 71
718 3300025941 Ga0207711_10025986 Ga0207711_100259863 71
719 3300025941 Ga0207711_10192872 Ga0207711_101928723 71
720 3300025941 Ga0207711_10305382 Ga0207711_103053823 71
721 3300025941 Ga0207711_10415523 Ga0207711_104155232 71
722 3300025941 Ga0207711_10847379 Ga0207711_108473792 71
723 3300025942 Ga0207689_10073008 Ga0207689_100730082 71
724 3300025942 Ga0207689_10073615 Ga0207689_100736154 71
725 3300025944 Ga0207661_10074011 Ga0207661_100740113 71
726 3300025944 Ga0207661_10305159 Ga0207661_103051592 71
727 3300025944 Ga0207661_11249016 Ga0207661_112490161 71
728 3300025945 Ga0207679_10053217 Ga0207679_100532172 71
729 3300025945 Ga0207679_10076401 Ga0207679_100764012 71
730 3300025945 Ga0207679_10185494 Ga0207679_101854943 71
731 3300025945 Ga0207679_10360790 Ga0207679_103607902 71
732 3300025945 Ga0207679_10375991 Ga0207679_103759912 71
733 3300025945 Ga0207679_10540745 Ga0207679_105407452 71
734 3300025945 Ga0207679_10785935 Ga0207679_107859353 71
735 3300025945 Ga0207679_11343538 Ga0207679_113435382 71
736 3300025945 Ga0207679_11401616 Ga0207679_114016162 71
737 3300025945 Ga0207679_11712322 Ga0207679_117123222 71
738 3300025949 Ga0207667_10002612 Ga0207667_1000261215 71
739 3300025949 Ga0207667_10005995 Ga0207667_1000599512 71
740 3300025949 Ga0207667_10019409 Ga0207667_100194095 71
741 3300025949 Ga0207667_10019667 Ga0207667_100196675 71
742 3300025949 Ga0207667_10180615 Ga0207667_101806151 71
743 3300025949 Ga0207667_10670058 Ga0207667_106700582 71
744 3300025949 Ga0207667_10696421 Ga0207667_106964212 71
745 3300025949 Ga0207667_11102500 Ga0207667_111025002 71
746 3300025949 Ga0207667_11715540 Ga0207667_117155402 71
747 3300025960 Ga0207651_10055211 Ga0207651_100552112 71
748 3300025960 Ga0207651_10098848 Ga0207651_100988482 71
749 3300025960 Ga0207651_10145031 Ga0207651_101450312 71
750 3300025960 Ga0207651_10145930 Ga0207651_101459302 71
751 3300025960 Ga0207651_10269846 Ga0207651_102698462 71
752 3300025960 Ga0207651_10484649 Ga0207651_104846492 71
753 3300025960 Ga0207651_10687455 Ga0207651_106874552 71
754 3300025960 Ga0207651_10760739 Ga0207651_107607392 71
755 3300025960 Ga0207651_11350066 Ga0207651_113500662 71
756 3300025961 Ga0207712_10013315 Ga0207712_100133157 71
757 3300025961 Ga0207712_11095604 Ga0207712_110956042 71
758 3300025961 Ga0207712_11310183 Ga0207712_113101832 71
759 3300025972 Ga0207668_10025749 Ga0207668_100257495 71
760 3300025972 Ga0207668_10085046 Ga0207668_100850463 71
761 3300025972 Ga0207668_11404270 Ga0207668_114042702 71
762 3300025981 Ga0207640_10086017 Ga0207640_100860173 71
763 3300025981 Ga0207640_10098720 Ga0207640_100987203 71
764 3300025981 Ga0207640_10118614 Ga0207640_101186143 71
765 3300025981 Ga0207640_10121884 Ga0207640_101218841 71
766 3300025981 Ga0207640_10554053 Ga0207640_105540533 71
767 3300025981 Ga0207640_11550491 Ga0207640_115504912 71
768 3300025981 Ga0207640_11857299 Ga0207640_118572991 71
769 3300025986 Ga0207658_10047181 Ga0207658_100471815 71
770 3300025986 Ga0207658_10089985 Ga0207658_100899852 71
771 3300025986 Ga0207658_10539832 Ga0207658_105398322 71
772 3300025986 Ga0207658_10881206 Ga0207658_108812062 71
773 3300025986 Ga0207658_11445001 Ga0207658_114450012 71
774 3300026023 Ga0207677_10111420 Ga0207677_101114202 71
775 3300026023 Ga0207677_10209566 Ga0207677_102095662 71
776 3300026023 Ga0207677_10405454 Ga0207677_104054542 71
777 3300026023 Ga0207677_10667523 Ga0207677_106675232 71
778 3300026023 Ga0207677_10708699 Ga0207677_107086992 71
779 3300026023 Ga0207677_10997508 Ga0207677_109975081 71
780 3300026035 Ga0207703_10106781 Ga0207703_101067812 71
781 3300026035 Ga0207703_10269579 Ga0207703_102695791 71
782 3300026035 Ga0207703_10282020 Ga0207703_102820202 71
783 3300026035 Ga0207703_10776805 Ga0207703_107768053 71
784 3300026041 Ga0207639_10047241 Ga0207639_100472412 71
785 3300026041 Ga0207639_10093915 Ga0207639_100939153 71
786 3300026041 Ga0207639_10341120 Ga0207639_103411202 71
787 3300026041 Ga0207639_10403711 Ga0207639_104037112 71
788 3300026041 Ga0207639_10936784 Ga0207639_109367842 71
789 3300026067 Ga0207678_10009013 Ga0207678_100090135 71
790 3300026067 Ga0207678_10015421 Ga0207678_100154214 71
791 3300026067 Ga0207678_10021391 Ga0207678_100213916 71
792 3300026067 Ga0207678_10023390 Ga0207678_100233907 71
793 3300026067 Ga0207678_10280135 Ga0207678_102801353 71
794 3300026067 Ga0207678_10413599 Ga0207678_104135993 71
795 3300026067 Ga0207678_10541212 Ga0207678_105412122 71
796 3300026067 Ga0207678_10812438 Ga0207678_108124382 71
797 3300026078 Ga0207702_10025805 Ga0207702_100258052 71
798 3300026078 Ga0207702_11223340 Ga0207702_112233402 71
799 3300026078 Ga0207702_11231392 Ga0207702_112313922 71
800 3300026078 Ga0207702_11269948 Ga0207702_112699482 71
801 3300026078 Ga0207702_11836677 Ga0207702_118366772 71
802 3300026088 Ga0207641_10014381 Ga0207641_100143816 71
803 3300026088 Ga0207641_10107436 Ga0207641_101074363 71
804 3300026088 Ga0207641_10134341 Ga0207641_101343411 71
805 3300026089 Ga0207648_10018551 Ga0207648_100185513 71
806 3300026089 Ga0207648_10144548 Ga0207648_101445483 71
807 3300026095 Ga0207676_10000253 Ga0207676_1000025311 71
808 3300026095 Ga0207676_10002138 Ga0207676_1000213814 71
809 3300026095 Ga0207676_10372243 Ga0207676_103722432 71
810 3300026095 Ga0207676_10434331 Ga0207676_104343313 71
811 3300026095 Ga0207676_11031946 Ga0207676_110319462 71
812 3300026095 Ga0207676_12059379 Ga0207676_120593792 71
813 3300026116 Ga0207674_10000086 Ga0207674_1000008685 71
814 3300026116 Ga0207674_10056635 Ga0207674_100566352 71
815 3300026116 Ga0207674_10170758 Ga0207674_101707582 71
816 3300026116 Ga0207674_10352142 Ga0207674_103521422 71
817 3300026116 Ga0207674_12286999 Ga0207674_122869992 71
818 3300026118 Ga0207675_100176499 Ga0207675_1001764993 71
819 3300026118 Ga0207675_102532408 Ga0207675_1025324082 71
820 3300026118 Ga0207675_102720569 Ga0207675_1027205692 71
821 3300026121 Ga0207683_10023087 Ga0207683_100230874 71
822 3300026121 Ga0207683_10062138 Ga0207683_100621384 71
823 3300026121 Ga0207683_10215180 Ga0207683_102151803 71
824 3300026142 Ga0207698_10004003 Ga0207698_100040034 71
825 3300026142 Ga0207698_10015624 Ga0207698_100156245 71
826 3300026142 Ga0207698_10066765 Ga0207698_100667654 71
827 3300026142 Ga0207698_10093885 Ga0207698_100938853 71
828 3300026142 Ga0207698_10186138 Ga0207698_101861384 71
829 3300026142 Ga0207698_10272391 Ga0207698_102723913 71
830 3300026142 Ga0207698_10385650 Ga0207698_103856501 71
831 3300026142 Ga0207698_10425964 Ga0207698_104259641 71
832 3300026142 Ga0207698_10428235 Ga0207698_104282351 71
833 3300026142 Ga0207698_11040457 Ga0207698_110404571 71
834 3300026142 Ga0207698_11189151 Ga0207698_111891512 71
835 3300026142 Ga0207698_11199699 Ga0207698_111996992 71
836 3300026142 Ga0207698_11207895 Ga0207698_112078952 71
837 3300026142 Ga0207698_11796903 Ga0207698_117969032 71
838 3300026142 Ga0207698_12084935 Ga0207698_120849352 71
839 3300026142 Ga0207698_12195405 Ga0207698_121954052 71
840 3300027876 Ga0209974_10014706 Ga0209974_100147064 71
841 3300027876 Ga0209974_10060947 Ga0209974_100609472 71
842 3300028379 Ga0268266_10006627 Ga0268266_100066276 71
843 3300028379 Ga0268266_10097239 Ga0268266_100972391 71
844 3300028379 Ga0268266_10158893 Ga0268266_101588932 71
845 3300028379 Ga0268266_10348028 Ga0268266_103480282 71
846 3300028379 Ga0268266_10914496 Ga0268266_109144962 71
847 3300028379 Ga0268266_11975434 Ga0268266_119754341 71
848 3300028380 Ga0268265_10068082 Ga0268265_100680824 71
849 3300028380 Ga0268265_10156078 Ga0268265_101560783 71
850 3300028380 Ga0268265_10250856 Ga0268265_102508562 71
851 3300028380 Ga0268265_12458134 Ga0268265_124581341 71
852 3300028381 Ga0268264_10003670 Ga0268264_100036705 71
853 3300028381 Ga0268264_10699908 Ga0268264_106999082 71
854 3300028381 Ga0268264_11723001 Ga0268264_117230011 71
855 3300030735 Ga0316178_1146043 Ga0316178_11460432 71
856 3300030742 Ga0316183_1175925 Ga0316183_11759252 71
857 3300030745 Ga0316182_1007628 Ga0316182_10076282 71
858 3300030745 Ga0316182_1158440 Ga0316182_11584402 71
859 3300031548 Ga0307408_100003350 Ga0307408_1000033508 71
860 3300031548 Ga0307408_100022223 Ga0307408_1000222232 71
861 3300031548 Ga0307408_100098065 Ga0307408_1000980653 71
862 3300031548 Ga0307408_100313957 Ga0307408_1003139572 71
863 3300031548 Ga0307408_100492278 Ga0307408_1004922781 71
864 3300031548 Ga0307408_100504885 Ga0307408_1005048852 71
865 3300031548 Ga0307408_100510975 Ga0307408_1005109752 71
866 3300031548 Ga0307408_100775106 Ga0307408_1007751062 71
867 3300031731 Ga0307405_10002088 Ga0307405_100020884 71
868 3300031731 Ga0307405_10003714 Ga0307405_100037148 71
869 3300031731 Ga0307405_10125688 Ga0307405_101256882 71
870 3300031731 Ga0307405_10224308 Ga0307405_102243083 71
871 3300031731 Ga0307405_10538742 Ga0307405_105387421 71
872 3300031731 Ga0307405_10841415 Ga0307405_108414152 71
873 3300031731 Ga0307405_11116431 Ga0307405_111164312 71
874 3300031824 Ga0307413_10000292 Ga0307413_1000029212 71
875 3300031824 Ga0307413_10007028 Ga0307413_100070288 71
876 3300031824 Ga0307413_10023501 Ga0307413_100235017 71
877 3300031824 Ga0307413_10443662 Ga0307413_104436622 71
878 3300031824 Ga0307413_11925158 Ga0307413_119251581 71
879 3300031852 Ga0307410_10000652 Ga0307410_100006524 71
880 3300031852 Ga0307410_10002064 Ga0307410_100020647 71
881 3300031852 Ga0307410_10004898 Ga0307410_100048981 71
882 3300031852 Ga0307410_10009431 Ga0307410_100094315 71
883 3300031852 Ga0307410_10149451 Ga0307410_101494513 71
884 3300031852 Ga0307410_10334473 Ga0307410_103344732 71
885 3300031852 Ga0307410_10711956 Ga0307410_107119562 71
886 3300031852 Ga0307410_11122974 Ga0307410_111229742 71
887 3300031901 Ga0307406_10013035 Ga0307406_100130355 71
888 3300031901 Ga0307406_10021311 Ga0307406_100213111 71
889 3300031901 Ga0307406_10260752 Ga0307406_102607522 71
890 3300031901 Ga0307406_11465758 Ga0307406_114657581 71
891 3300031901 Ga0307406_11537438 Ga0307406_115374381 71
892 3300031903 Ga0307407_10001061 Ga0307407_100010612 71
893 3300031903 Ga0307407_10054848 Ga0307407_100548483 71
894 3300031903 Ga0307407_10478454 Ga0307407_104784542 71
895 3300031903 Ga0307407_10619267 Ga0307407_106192672 71
896 3300031903 Ga0307407_10899838 Ga0307407_108998382 71
897 3300031903 Ga0307407_10918381 Ga0307407_109183812 71
898 3300031911 Ga0307412_10000248 Ga0307412_1000024836 71
899 3300031911 Ga0307412_10015741 Ga0307412_100157411 71
900 3300031911 Ga0307412_10024386 Ga0307412_100243863 71
901 3300031911 Ga0307412_10076520 Ga0307412_100765203 71
902 3300031911 Ga0307412_10277426 Ga0307412_102774262 71
903 3300031995 Ga0307409_100001918 Ga0307409_1000019185 71
904 3300031995 Ga0307409_100008269 Ga0307409_10000826910 71
905 3300031995 Ga0307409_100016302 Ga0307409_1000163023 71
906 3300031995 Ga0307409_100033607 Ga0307409_1000336072 71
907 3300031995 Ga0307409_100353438 Ga0307409_1003534381 71
908 3300031995 Ga0307409_100386207 Ga0307409_1003862072 71
909 3300031995 Ga0307409_100972384 Ga0307409_1009723842 71
910 3300031995 Ga0307409_101159634 Ga0307409_1011596342 71
911 3300031995 Ga0307409_101428688 Ga0307409_1014286882 71
912 3300031995 Ga0307409_101468712 Ga0307409_1014687122 71
913 3300031995 Ga0307409_101858789 Ga0307409_1018587892 71
914 3300031995 Ga0307409_102254000 Ga0307409_1022540001 71
915 3300032002 Ga0307416_100000366 Ga0307416_10000036619 71
916 3300032002 Ga0307416_100004414 Ga0307416_1000044148 71
917 3300032002 Ga0307416_100031319 Ga0307416_1000313193 71
918 3300032002 Ga0307416_100059570 Ga0307416_1000595703 71
919 3300032002 Ga0307416_101334855 Ga0307416_1013348552 71
920 3300032002 Ga0307416_101643088 Ga0307416_1016430881 71
921 3300032002 Ga0307416_101684733 Ga0307416_1016847331 71
922 3300032002 Ga0307416_101863556 Ga0307416_1018635562 71
923 3300032002 Ga0307416_102301647 Ga0307416_1023016471 71
924 3300032002 Ga0307416_102905091 Ga0307416_1029050911 71
925 3300032002 Ga0307416_103191715 Ga0307416_1031917152 71
926 3300032002 Ga0307416_103677914 Ga0307416_1036779142 71
927 3300032004 Ga0307414_10001973 Ga0307414_100019738 71
928 3300032004 Ga0307414_10031755 Ga0307414_100317558 71
929 3300032004 Ga0307414_10035399 Ga0307414_100353993 71
930 3300032004 Ga0307414_10040212 Ga0307414_100402123 71
931 3300032004 Ga0307414_10349806 Ga0307414_103498062 71
932 3300032004 Ga0307414_10375350 Ga0307414_103753502 71
933 3300032004 Ga0307414_10408860 Ga0307414_104088602 71
934 3300032004 Ga0307414_10506226 Ga0307414_105062262 71
935 3300032004 Ga0307414_11920635 Ga0307414_119206352 71
936 3300032004 Ga0307414_12195756 Ga0307414_121957561 71
937 3300032004 Ga0307414_12248660 Ga0307414_122486601 71
938 3300032005 Ga0307411_10005103 Ga0307411_100051033 71
939 3300032005 Ga0307411_10017878 Ga0307411_100178788 71
940 3300032005 Ga0307411_10027320 Ga0307411_100273202 71
941 3300032005 Ga0307411_10253104 Ga0307411_102531042 71
942 3300032005 Ga0307411_10283559 Ga0307411_102835592 71
943 3300032005 Ga0307411_10370297 Ga0307411_103702972 71
944 3300032005 Ga0307411_10447155 Ga0307411_104471552 71
945 3300032005 Ga0307411_10719351 Ga0307411_107193512 71
946 3300032005 Ga0307411_11166504 Ga0307411_111665042 71
947 3300032005 Ga0307411_11225315 Ga0307411_112253152 71
948 3300032005 Ga0307411_11467211 Ga0307411_114672112 71
949 3300032005 Ga0307411_11709456 Ga0307411_117094561 71
950 3300032126 Ga0307415_100000909 Ga0307415_1000009097 71
951 3300032126 Ga0307415_100003550 Ga0307415_1000035508 71
952 3300032126 Ga0307415_100006114 Ga0307415_1000061146 71
953 3300032126 Ga0307415_100025925 Ga0307415_1000259253 71
954 3300032126 Ga0307415_100026424 Ga0307415_1000264248 71
955 3300032126 Ga0307415_100614844 Ga0307415_1006148441 71
956 3300032126 Ga0307415_100709070 Ga0307415_1007090702 71
957 3300032126 Ga0307415_100862737 Ga0307415_1008627372 71
958 3300032126 Ga0307415_101593134 Ga0307415_1015931342 71
959 3300032126 Ga0307415_102141504 Ga0307415_1021415042 71
960 3300035085 Ga0373929_0268380 Ga0373929_0268380_74_289 71
961 3300035113 Ga0373936_0323372 Ga0373936_0323372_71_286 71
962 3300035114 Ga0373939_0298294 Ga0373939_0298294_238_453 71
963 3300035170 Ga0373943_0036995 Ga0373943_0036995_421_636 71
964 3300035171 Ga0373946_0147448 Ga0373946_0147448_215_430 71
965 3300035172 Ga0373955_0698063 Ga0373955_0698063_240_455 71
966 3300035242 Ga0373962_0132219 Ga0373962_0132219_460_681 71
967 3300035691 Ga0373931_0871600 Ga0373931_0871600_264_479 71
968 3300035691 Ga0373931_1146033 Ga0373931_1146033_208_423 71
969 3300035695 Ga0373927_0062157 Ga0373927_0062157_2051_2266 71
970 3300035725 Ga0373947_0128573 Ga0373947_0128573_196_411 71
971 3300035725 Ga0373947_1028497 Ga0373947_1028497_125_340 71
972 3300037068 Ga0373925_0003304 Ga0373925_0003304_2585_2800 71
973 3300037312 Ga0395899_0035436 Ga0395899_0035436_1385_1600 71
974 3300037312 Ga0395899_0088857 Ga0395899_0088857_95_310 71
975 3300037312 Ga0395899_0093762 Ga0395899_0093762_1735_1956 71
976 3300037312 Ga0395899_0093985 Ga0395899_0093985_1624_1839 71
977 3300037312 Ga0395899_0111186 Ga0395899_0111186_1280_1495 71
978 3300037312 Ga0395899_0122242 Ga0395899_0122242_1179_1394 71
979 3300037312 Ga0395899_0146922 Ga0395899_0146922_450_665 71
980 3300037312 Ga0395899_0177583 Ga0395899_0177583_693_908 71
981 3300037312 Ga0395899_0209374 Ga0395899_0209374_44_259 71
982 3300037312 Ga0395899_0264116 Ga0395899_0264116_366_581 71
983 3300037312 Ga0395899_0328894 Ga0395899_0328894_644_871 71
984 3300037312 Ga0395899_0334855 Ga0395899_0334855_511_732 71
985 3300037312 Ga0395899_0379768 Ga0395899_0379768_660_881 71
986 3300037312 Ga0395899_0421723 Ga0395899_0421723_396_611 71
987 3300037418 Ga0395900_0002700 Ga0395900_0002700_13744_13959 71
988 3300037418 Ga0395900_0003041 Ga0395900_0003041_15488_15703 71
989 3300037418 Ga0395900_0006151 Ga0395900_0006151_10430_10651 71
990 3300037418 Ga0395900_0006393 Ga0395900_0006393_1532_1747 71
991 3300037418 Ga0395900_0014124 Ga0395900_0014124_784_999 71
992 3300037418 Ga0395900_0015350 Ga0395900_0015350_1725_1940 71
993 3300037418 Ga0395900_0016814 Ga0395900_0016814_1853_2074 71
994 3300037418 Ga0395900_0053670 Ga0395900_0053670_3341_3562 71
995 3300037418 Ga0395900_0055842 Ga0395900_0055842_1607_1822 71
996 3300037418 Ga0395900_0082848 Ga0395900_0082848_2804_3019 71
997 3300037418 Ga0395900_0099913 Ga0395900_0099913_2256_2471 71
998 3300037418 Ga0395900_0104002 Ga0395900_0104002_2376_2591 71
999 3300037418 Ga0395900_0125132 Ga0395900_0125132_2282_2497 71
1000 3300037418 Ga0395900_0132914 Ga0395900_0132914_1009_1224 71
1001 3300037418 Ga0395900_0205192 Ga0395900_0205192_1106_1321 71
1002 3300037418 Ga0395900_0257841 Ga0395900_0257841_445_660 71
1003 3300037418 Ga0395900_0269161 Ga0395900_0269161_1369_1584 71
1004 3300037418 Ga0395900_0371165 Ga0395900_0371165_833_1048 71
1005 3300037418 Ga0395900_0384959 Ga0395900_0384959_730_945 71
1006 3300037418 Ga0395900_0386731 Ga0395900_0386731_178_393 71
1007 3300037418 Ga0395900_0463214 Ga0395900_0463214_761_976 71
1008 3300037418 Ga0395900_0604491 Ga0395900_0604491_210_425 71
1009 3300037418 Ga0395900_0628252 Ga0395900_0628252_76_291 71
1010 3300037418 Ga0395900_1342416 Ga0395900_1342416_403_618 71
1011 3300037466 Ga0395898_0023412 Ga0395898_0023412_1571_1786 71
1012 3300037466 Ga0395898_0028233 Ga0395898_0028233_2482_2697 71
1013 3300037466 Ga0395898_0045064 Ga0395898_0045064_1798_2013 71
1014 3300037466 Ga0395898_0050245 Ga0395898_0050245_2469_2690 71
1015 3300037466 Ga0395898_0108329 Ga0395898_0108329_1273_1494 71
1016 3300037466 Ga0395898_0154684 Ga0395898_0154684_1842_2057 71
1017 3300037466 Ga0395898_0157120 Ga0395898_0157120_475_690 71
1018 3300037466 Ga0395898_0308096 Ga0395898_0308096_252_467 71
1019 3300037466 Ga0395898_0427465 Ga0395898_0427465_182_397 71
1020 3300037466 Ga0395898_0479648 Ga0395898_0479648_883_1098 71
1021 3300037466 Ga0395898_0497490 Ga0395898_0497490_242_457 71
1022 3300037466 Ga0395898_0881407 Ga0395898_0881407_133_348 71
1023 3300037466 Ga0395898_0960307 Ga0395898_0960307_124_339 71
1024 3300037466 Ga0395898_1096862 Ga0395898_1096862_428_643 71
1025 3300037466 Ga0395898_1242055 Ga0395898_1242055_234_449 71
1026 3300037466 Ga0395898_1331178 Ga0395898_1331178_45_260 71
1027 3300037471 Ga0395905_0000226 Ga0395905_0000226_65745_65960 71
1028 3300037471 Ga0395905_0002055 Ga0395905_0002055_19000_19215 71
1029 3300037471 Ga0395905_0002081 Ga0395905_0002081_20082_20303 71
1030 3300037471 Ga0395905_0003223 Ga0395905_0003223_240_455 71
1031 3300037471 Ga0395905_0004472 Ga0395905_0004472_6348_6563 71
1032 3300037471 Ga0395905_0008041 Ga0395905_0008041_6031_6246 71
1033 3300037471 Ga0395905_0010915 Ga0395905_0010915_5758_5973 71
1034 3300037471 Ga0395905_0012965 Ga0395905_0012965_1005_1226 71
1035 3300037471 Ga0395905_0022794 Ga0395905_0022794_4055_4270 71
1036 3300037471 Ga0395905_0028444 Ga0395905_0028444_4584_4805 71
1037 3300037471 Ga0395905_0033598 Ga0395905_0033598_3296_3511 71
1038 3300037471 Ga0395905_0040985 Ga0395905_0040985_2103_2318 71
1039 3300037471 Ga0395905_0046615 Ga0395905_0046615_2917_3132 71
1040 3300037471 Ga0395905_0060052 Ga0395905_0060052_2931_3146 71
1041 3300037471 Ga0395905_0066467 Ga0395905_0066467_1946_2161 71
1042 3300037471 Ga0395905_0067275 Ga0395905_0067275_1564_1779 71
1043 3300037471 Ga0395905_0079251 Ga0395905_0079251_24_245 71
1044 3300037471 Ga0395905_0109977 Ga0395905_0109977_278_499 71
1045 3300037471 Ga0395905_0177684 Ga0395905_0177684_906_1121 71
1046 3300037471 Ga0395905_0185695 Ga0395905_0185695_1019_1234 71
1047 3300037471 Ga0395905_0265267 Ga0395905_0265267_324_545 71
1048 3300037471 Ga0395905_0345920 Ga0395905_0345920_904_1119 71
1049 3300037471 Ga0395905_0442242 Ga0395905_0442242_337_552 71
1050 3300037471 Ga0395905_0550308 Ga0395905_0550308_812_1033 71
1051 3300037471 Ga0395905_0644168 Ga0395905_0644168_619_834 71
1052 3300037471 Ga0395905_0666138 Ga0395905_0666138_143_358 71
1053 3300037471 Ga0395905_0961706 Ga0395905_0961706_20_235 71
1054 3300037471 Ga0395905_0971405 Ga0395905_0971405_508_723 71
1055 3300037471 Ga0395905_1031932 Ga0395905_1031932_357_572 71
1056 3300037471 Ga0395905_1340390 Ga0395905_1340390_142_357 71
1057 3300037471 Ga0395905_1741497 Ga0395905_1741497_64_279 71
1058 3300038443 Ga0395901_0002307 Ga0395901_0002307_6616_6831 71
1059 3300038443 Ga0395901_0005438 Ga0395901_0005438_10716_10937 71
1060 3300038443 Ga0395901_0027243 Ga0395901_0027243_3449_3670 71
1061 3300038443 Ga0395901_0029844 Ga0395901_0029844_3219_3434 71
1062 3300038443 Ga0395901_0034041 Ga0395901_0034041_2769_2984 71
1063 3300038443 Ga0395901_0071588 Ga0395901_0071588_37_258 71
1064 3300038443 Ga0395901_0078833 Ga0395901_0078833_961_1176 71
1065 3300038443 Ga0395901_0101121 Ga0395901_0101121_1320_1541 71
1066 3300038443 Ga0395901_0190558 Ga0395901_0190558_1825_2040 71
1067 3300038443 Ga0395901_0259230 Ga0395901_0259230_389_604 71
1068 3300038443 Ga0395901_0335088 Ga0395901_0335088_209_424 71
1069 3300038443 Ga0395901_0347938 Ga0395901_0347938_622_837 71
1070 3300038443 Ga0395901_0441822 Ga0395901_0441822_761_976 71
1071 3300038443 Ga0395901_0489935 Ga0395901_0489935_509_724 71
1072 3300038443 Ga0395901_0573362 Ga0395901_0573362_617_832 71
1073 3300038443 Ga0395901_0591328 Ga0395901_0591328_493_708 71
1074 3300038443 Ga0395901_0617276 Ga0395901_0617276_782_997 71
1075 3300038443 Ga0395901_0639986 Ga0395901_0639986_588_803 71
1076 3300038443 Ga0395901_0730601 Ga0395901_0730601_545_760 71
1077 3300038443 Ga0395901_0817557 Ga0395901_0817557_295_510 71
1078 3300038443 Ga0395901_0846330 Ga0395901_0846330_31_246 71
1079 3300038443 Ga0395901_0905693 Ga0395901_0905693_378_593 71
1080 3300038443 Ga0395901_1107519 Ga0395901_1107519_61_276 71
1081 3300038443 Ga0395901_1272783 Ga0395901_1272783_427_642 71
1082 3300038443 Ga0395901_2019702 Ga0395901_2019702_164_379 71
1083 3300038443 Ga0395901_2038699 Ga0395901_2038699_194_409 71
1084 3300041406 Ga0439439_0052616 Ga0439439_0052616_459_674 71
1085 3300041413 Ga0439465_0055202 Ga0439465_0055202_1012_1227 71
1086 3300041463 Ga0451804_0612306 Ga0451804_0612306_130_345 71
1087 3300041505 Ga0451849_0741623 Ga0451849_0741623_528_743 71
1088 3300042006 Ga0439432_140621 Ga0439432_140621_92_307 71
1089 3300042007 Ga0439449_0016067 Ga0439449_0016067_694_909 71
1090 3300042015 Ga0439462_0104184 Ga0439462_0104184_441_656 71
1091 3300042127 Ga0450890_016729 Ga0450890_016729_269_484 71
1092 3300042130 Ga0450892_026128 Ga0450892_026128_119_334 71
1093 3300042134 Ga0450898_052658 Ga0450898_052658_310_525 71
1094 3300042144 Ga0450889_000363 Ga0450889_000363_765_980 71
1095 3300042157 Ga0439458_0000109 Ga0439458_0000109_9815_10030 71
1096 3300042157 Ga0439458_0117731 Ga0439458_0117731_23_238 71
1097 3300044658 Ga0466972_0113240 Ga0466972_0113240_153_368 71
1098 3300044658 Ga0466972_0278629 Ga0466972_0278629_196_411 71
1099 3300044658 Ga0466972_0285294 Ga0466972_0285294_72_287 71
1100 3300044684 Ga0466966_0031546 Ga0466966_0031546_3046_3261 71
1101 3300044684 Ga0466966_0038794 Ga0466966_0038794_750_971 71
1102 3300044684 Ga0466966_0088771 Ga0466966_0088771_192_407 71
1103 3300044684 Ga0466966_0255351 Ga0466966_0255351_811_1026 71
1104 3300044684 Ga0466966_0457666 Ga0466966_0457666_77_292 71
1105 3300044684 Ga0466966_0801459 Ga0466966_0801459_338_553 71
1106 3300044684 Ga0466966_0854787 Ga0466966_0854787_233_454 71
1107 3300044693 Ga0466961_0029959 Ga0466961_0029959_1564_1779 71
1108 3300044693 Ga0466961_0036378 Ga0466961_0036378_2603_2824 71
1109 3300044693 Ga0466961_0090190 Ga0466961_0090190_1456_1671 71
1110 3300044693 Ga0466961_0129893 Ga0466961_0129893_396_617 71
1111 3300044693 Ga0466961_0823796 Ga0466961_0823796_219_440 71
1112 3300044694 Ga0466963_0052851 Ga0466963_0052851_1531_1746 71
1113 3300044694 Ga0466963_0116631 Ga0466963_0116631_1390_1611 71
1114 3300044694 Ga0466963_1231389 Ga0466963_1231389_156_377 71
1115 3300044706 Ga0466964_0008959 Ga0466964_0008959_3470_3691 71
1116 3300044706 Ga0466964_0040750 Ga0466964_0040750_905_1120 71
1117 3300044719 Ga0466971_0011770 Ga0466971_0011770_3230_3451 71
1118 3300044719 Ga0466971_0047748 Ga0466971_0047748_624_839 71
1119 3300044735 Ga0466968_0003696 Ga0466968_0003696_2910_3125 71
1120 3300044765 Ga0466970_0010711 Ga0466970_0010711_3001_3216 71
1121 3300044765 Ga0466970_0020923 Ga0466970_0020923_2538_2753 71
1122 3300044765 Ga0466970_0559146 Ga0466970_0559146_60_281 71
1123 3300044842 Ga0466957_0074344 Ga0466957_0074344_882_1097 71
1124 3300044842 Ga0466957_0152063 Ga0466957_0152063_191_406 71
1125 3300044842 Ga0466957_0266612 Ga0466957_0266612_224_445 71
1126 3300044842 Ga0466957_0684695 Ga0466957_0684695_484_699 71
1127 3300044842 Ga0466957_1113998 Ga0466957_1113998_260_475 71
1128 3300044901 Ga0466960_0006242 Ga0466960_0006242_3947_4162 71
1129 3300045049 Ga0466959_0014316 Ga0466959_0014316_1140_1355 71
1130 3300045049 Ga0466959_0032757 Ga0466959_0032757_959_1174 71
1131 3300045049 Ga0466959_0076076 Ga0466959_0076076_14_235 71
1132 3300045049 Ga0466959_0267104 Ga0466959_0267104_610_825 71
1133 3300045836 Ga0466958_0030281 Ga0466958_0030281_2842_3063 71
1134 3300045836 Ga0466958_0043033 Ga0466958_0043033_972_1187 71
1135 3300045836 Ga0466958_0132253 Ga0466958_0132253_1304_1519 71
1136 3300045836 Ga0466958_0234579 Ga0466958_0234579_212_427 71
1137 3300045976 Ga0466967_0094534 Ga0466967_0094534_2395_2610 71
1138 3300045976 Ga0466967_0107074 Ga0466967_0107074_1045_1260 71
1139 3300045976 Ga0466967_0841788 Ga0466967_0841788_189_410 71
1140 3300045976 Ga0466967_1106686 Ga0466967_1106686_523_738 71
1141 3300046459 Ga0495629_0793220 Ga0495629_0793220_19_234 71
1142 3300046491 Ga0495584_0306754 Ga0495584_0306754_308_523 71
1143 3300046492 Ga0495585_0068810 Ga0495585_0068810_956_1171 71
1144 3300046507 Ga0495606_0275530 Ga0495606_0275530_550_765 71
1145 3300046513 Ga0495616_0125890 Ga0495616_0125890_647_862 71
1146 3300046518 Ga0495631_0208071 Ga0495631_0208071_549_764 71
1147 3300046519 Ga0495632_0185176 Ga0495632_0185176_427_642 71
1148 3300046522 Ga0495643_0394341 Ga0495643_0394341_328_543 71
1149 3300046523 Ga0495644_0163645 Ga0495644_0163645_116_331 71
1150 3300046525 Ga0495663_0014797 Ga0495663_0014797_264_479 71
1151 3300046525 Ga0495663_0017558 Ga0495663_0017558_79_294 71
1152 3300046525 Ga0495663_0208793 Ga0495663_0208793_216_431 71
1153 3300046525 Ga0495663_0271318 Ga0495663_0271318_27_242 71
1154 3300046528 Ga0495642_0027521 Ga0495642_0027521_982_1197 71
1155 3300046530 Ga0495654_0287451 Ga0495654_0287451_174_389 71
1156 3300046539 Ga0495621_0000572 Ga0495621_0000572_248_463 71
1157 3300046539 Ga0495621_0027614 Ga0495621_0027614_737_952 71
1158 3300046539 Ga0495621_0216800 Ga0495621_0216800_98_319 71
1159 3300046558 Ga0495633_0003479 Ga0495633_0003479_9572_9787 71
1160 3300046558 Ga0495633_0134415 Ga0495633_0134415_130_345 71
1161 3300046616 Ga0495668_0036250 Ga0495668_0036250_1702_1917 71
1162 3300046616 Ga0495668_0416051 Ga0495668_0416051_226_441 71
1163 3300046616 Ga0495668_0654013 Ga0495668_0654013_335_550 71
1164 3300046660 Ga0495625_0422342 Ga0495625_0422342_307_522 71
1165 3300046664 Ga0495659_0192372 Ga0495659_0192372_22_237 71
1166 3300046665 Ga0495661_0179032 Ga0495661_0179032_835_1050 71
1167 3300046684 Ga0495669_0000089 Ga0495669_0000089_965_1180 71
1168 3300046684 Ga0495669_0000774 Ga0495669_0000774_3685_3900 71
1169 3300046684 Ga0495669_0009907 Ga0495669_0009907_2457_2672 71
1170 3300046684 Ga0495669_0032669 Ga0495669_0032669_654_869 71
1171 3300046684 Ga0495669_0543205 Ga0495669_0543205_333_548 71
1172 3300046809 Ga0495600_0893008 Ga0495600_0893008_156_371 71
1173 3300047323 Ga0495683_0263568 Ga0495683_0263568_100_315 71
1174 3300047323 Ga0495683_0304414 Ga0495683_0304414_100_315 71
1175 3300047445 Ga0495677_0008344 Ga0495677_0008344_3356_3571 71
1176 3300047445 Ga0495677_0010499 Ga0495677_0010499_957_1172 71
1177 3300047445 Ga0495677_0442256 Ga0495677_0442256_184_399 71
1178 3300047447 Ga0495685_031991 Ga0495685_031991_957_1172 71
1179 3300048903 Ga0496100_0008265 Ga0496100_0008265_1411_1626 71
1180 3300048903 Ga0496100_0036550 Ga0496100_0036550_1530_1745 71
1181 3300048904 Ga0496101_0012014 Ga0496101_0012014_4739_4954 71
1182 3300048904 Ga0496101_0114186 Ga0496101_0114186_822_1037 71
1183 3300048904 Ga0496101_0259583 Ga0496101_0259583_1105_1320 71
1184 3300048905 Ga0496102_0189683 Ga0496102_0189683_297_512 71
1185 3300048906 Ga0496103_0152524 Ga0496103_0152524_439_654 71
1186 3300048906 Ga0496103_0374618 Ga0496103_0374618_64_279 71
1187 3300048907 Ga0496104_0102305 Ga0496104_0102305_250_465 71
1188 3300048907 Ga0496104_0235499 Ga0496104_0235499_128_343 71
1189 3300048908 Ga0496105_0465532 Ga0496105_0465532_181_396 71
1190 3300048908 Ga0496105_0854876 Ga0496105_0854876_134_349 71
1191 3300048909 Ga0496106_0033725 Ga0496106_0033725_384_599 71
1192 3300048909 Ga0496106_0210288 Ga0496106_0210288_319_534 71
1193 3300048909 Ga0496106_1095845 Ga0496106_1095845_42_257 71
1194 3300048910 Ga0496107_0012597 Ga0496107_0012597_3011_3226 71
1195 3300048910 Ga0496107_0028631 Ga0496107_0028631_3125_3340 71
1196 3300048910 Ga0496107_0216666 Ga0496107_0216666_208_423 71
1197 3300048910 Ga0496107_0703464 Ga0496107_0703464_363_578 71
1198 3300048911 Ga0496108_0000297 Ga0496108_0000297_31997_32212 71
1199 3300048911 Ga0496108_0019987 Ga0496108_0019987_1629_1844 71
1200 3300048911 Ga0496108_0020041 Ga0496108_0020041_2327_2542 71
1201 3300048911 Ga0496108_0084419 Ga0496108_0084419_712_927 71
1202 3300048912 Ga0496109_0090892 Ga0496109_0090892_1573_1788 71
1203 3300048912 Ga0496109_0699248 Ga0496109_0699248_710_931 71
1204 3300048912 Ga0496109_0894493 Ga0496109_0894493_160_375 71
1205 3300048913 Ga0496110_0001178 Ga0496110_0001178_790_1005 71
1206 3300048913 Ga0496110_0010023 Ga0496110_0010023_4312_4527 71
1207 3300048914 Ga0496111_0000420 Ga0496111_0000420_146_361 71
1208 3300048914 Ga0496111_0013922 Ga0496111_0013922_1578_1793 71
1209 3300048915 Ga0496112_0000950 Ga0496112_0000950_13203_13424 71
1210 3300048915 Ga0496112_0003824 Ga0496112_0003824_2851_3066 71
1211 3300048915 Ga0496112_0016452 Ga0496112_0016452_3925_4140 71
1212 3300048915 Ga0496112_0383577 Ga0496112_0383577_1016_1231 71
1213 3300048916 Ga0496113_0000977 Ga0496113_0000977_10227_10448 71
1214 3300048916 Ga0496113_0008494 Ga0496113_0008494_5807_6022 71
1215 3300048916 Ga0496113_0644144 Ga0496113_0644144_582_797 71
1216 3300048917 Ga0496114_0539718 Ga0496114_0539718_680_895 71
1217 3300049515 Ga0501292_069994 Ga0501292_069994_372_587 71
1218 3300049583 Ga0501067_0176356 Ga0501067_0176356_421_636 71
1219 3300049585 Ga0501069_0284271 Ga0501069_0284271_225_440 71
1220 3300049585 Ga0501069_0517108 Ga0501069_0517108_210_425 71
1221 3300049590 Ga0501074_1051458 Ga0501074_1051458_342_557 71
1222 3300049650 Ga0501199_007709 Ga0501199_007709_55_270 71
1223 3300049651 Ga0501201_044894 Ga0501201_044894_164_379 71
1224 3300049652 Ga0501202_073618 Ga0501202_073618_187_402 71
1225 3300049654 Ga0501207_060351 Ga0501207_060351_309_524 71
1226 3300049654 Ga0501207_116395 Ga0501207_116395_188_403 71
1227 3300049660 Ga0501216_186229 Ga0501216_186229_84_299 71
1228 3300049661 Ga0501217_271747 Ga0501217_271747_184_399 71
1229 3300049668 Ga0501233_022419 Ga0501233_022419_627_842 71
1230 3300049674 Ga0501242_047442 Ga0501242_047442_247_462 71
1231 3300049677 Ga0501247_014714 Ga0501247_014714_642_857 71
1232 3300049679 Ga0501249_053692 Ga0501249_053692_544_759 71
1233 3300049686 Ga0501257_042440 Ga0501257_042440_185_400 71
1234 3300049686 Ga0501257_081862 Ga0501257_081862_182_397 71
1235 3300049705 Ga0501225_0109004 Ga0501225_0109004_40_255 71
1236 3300049707 Ga0501234_009354 Ga0501234_009354_924_1139 71
1237 3300049742 Ga0501080_0339563 Ga0501080_0339563_53_268 71
1238 3300049760 Ga0501263_007011 Ga0501263_007011_355_570 71
1239 3300049764 Ga0501267_032112 Ga0501267_032112_196_411 71
1240 3300049765 Ga0501268_007619 Ga0501268_007619_1282_1497 71
1241 3300049765 Ga0501268_013292 Ga0501268_013292_623_838 71
1242 3300049765 Ga0501268_161148 Ga0501268_161148_36_251 71
1243 3300049767 Ga0501270_002423 Ga0501270_002423_247_462 71
1244 3300049767 Ga0501270_120911 Ga0501270_120911_98_313 71
1245 3300050507 nmdc:mga05p37_1398406_c1 nmdc:mga05p37_1398406_c1_103_318 71
1246 3300050511 nmdc:mga08y16_351005_c1 nmdc:mga08y16_351005_c1_1210_1425 71
1247 3300050512 nmdc:mga0n895_279679_c1 nmdc:mga0n895_279679_c1_511_726 71
1248 3300050512 nmdc:mga0n895_918533_c1 nmdc:mga0n895_918533_c1_415_630 71
1249 3300050513 nmdc:mga0rr50_182010_c1 nmdc:mga0rr50_182010_c1_1099_1314 71
1250 3300050513 nmdc:mga0rr50_392164_c1 nmdc:mga0rr50_392164_c1_924_1139 71
1251 3300050515 nmdc:mga0a205_7550_c1 nmdc:mga0a205_7550_c1_3115_3330 71
1252 3300053083 Ga0495655_0127137 Ga0495655_0127137_472_687 71
1253 3300059421 Ga0590071_050640 Ga0590071_050640_344_565 71
1254 3300059424 Ga0590075_041990 Ga0590075_041990_882_1097 71
1255 3300059426 Ga0590077_174751 Ga0590077_174751_64_285 71
1256 3300061719 Ga0466962_0024850 Ga0466962_0024850_408_629 71
1257 3300061719 Ga0466962_0223015 Ga0466962_0223015_282_497 71
1258 3300061734 Ga0530510_0872073 Ga0530510_0872073_129_344 71

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

20

74

0.96

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

19

78

0.96

PF12844

HTH_19

Helix-turn-helix domain

18

76

0.95

PF13560

HTH_31

Helix-turn-helix domain

18

74

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.9548 3 62
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.9526 3 62
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.9438 4 57
7nrd-assembly1.cif.gz_Sh structure of the yeast gcn1 bound to a colliding stalled 80s ribosome with mbf1, a/p-trna and p/e-trna 0.9328 5 52
2icp-assembly1.cif.gz_A crystal structure of the bacterial antitoxin higa from escherichia coli at ph 4.0. northeast structural genomics consortium target er390. 0.9247 6 52
ID Description Score Start End Superfamily
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9983 1 62 1.10.260.40
3jxbD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9434 4 57 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9422 4 57 1.10.260.40
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.938 1 62 1.10.260.40
2kpjA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9315 5 58 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A1I2MHZ6-F1-model_v4 Transcriptional regulator, XRE family 1.013 2 61 GO:0003677
AF-A0A1H9H2C8-F1-model_v4 Transcriptional regulator, XRE family 1.013 2 61 GO:0003677
AF-A0A7Y9SW35-F1-model_v4 DNA-binding XRE family transcriptional regulator 1.011 2 60 GO:0003677
AF-A0A519HVH0-F1-model_v4 Transcriptional regulator 1.01 1 62 GO:0003677
AF-A0A0R0AZF8-F1-model_v4 Cro/Cl family transcriptional regulator 1.01 1 62 GO:0003677

Feature Viewer

pLDDT pTM Quality
90.07 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map