F492280
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1259 | 422 | 2518 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_101259025|Ga0070694_1012590252 |
| Length | 138 |
| Sequence | MSETYDLYQQGRAHLKKGRAAQATVALEKAKRREPEKASIREALGIAYLRIQRYDEAEREFRAMLELSPADHYAHYGLGRALEKQGKQLEANGHYKLASSLRPQNEHYASRILDLDQEGDEPNEXXXXDMPSADPSGN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 117 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 118 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 119 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 120 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 121 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 204 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 226 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 229 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 231 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 257 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 258 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 259 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 260 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 266 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 267 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 268 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 269 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 270 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 271 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 272 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 273 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 274 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 275 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 276 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 277 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 278 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 279 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 280 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 281 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 282 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 283 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 284 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 285 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 286 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 289 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 358 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 359 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 360 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 361 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 362 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 365 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 366 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 367 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 368 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 369 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 370 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 371 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 397 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 405 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 407 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.11 |
| Nodule | 0 |
| Rhizoplane | 9.93 |
| Rhizosphere | 88.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070694_101259025 | 3300005444 | Bacteria | 621 |
| 2 | JGI24747J21853_1005505 | 3300001978 | Bacteria | 1171 |
| 3 | JGI24742J22300_10035200 | 3300002244 | Unclassified | 883 |
| 4 | rootH1_10180613 | 3300003323 | Bacteria | 1703 |
| 5 | JGI25407J50210_10104694 | 3300003373 | Unclassified | 699 |
| 6 | JGI25404J52841_10116289 | 3300003659 | Unclassified | 563 |
| 7 | Ga0070676_10178831 | 3300005328 | Bacteria | 1377 |
| 8 | Ga0070676_10393816 | 3300005328 | Unclassified | 962 |
| 9 | Ga0070676_10921128 | 3300005328 | Unclassified | 652 |
| 10 | Ga0070683_100215821 | 3300005329 | Bacteria | 1823 |
| 11 | Ga0070683_101158499 | 3300005329 | Bacteria | 743 |
| 12 | Ga0070690_100098768 | 3300005330 | Bacteria | 1933 |
| 13 | Ga0070690_100532047 | 3300005330 | Unclassified | 884 |
| 14 | Ga0070670_100640206 | 3300005331 | Bacteria | 953 |
| 15 | Ga0068869_101233409 | 3300005334 | Bacteria | 658 |
| 16 | Ga0070666_10456690 | 3300005335 | Bacteria | 923 |
| 17 | Ga0070680_100054919 | 3300005336 | Bacteria | 3253 |
| 18 | Ga0070680_100061421 | 3300005336 | Bacteria | 3076 |
| 19 | Ga0070680_100073044 | 3300005336 | Bacteria | 2820 |
| 20 | Ga0070680_100122015 | 3300005336 | Bacteria | 2176 |
| 21 | Ga0070680_100283460 | 3300005336 | Bacteria | 1404 |
| 22 | Ga0070680_100299486 | 3300005336 | Bacteria | 1363 |
| 23 | Ga0070680_100800568 | 3300005336 | Unclassified | 812 |
| 24 | Ga0070682_100010187 | 3300005337 | Bacteria | 5331 |
| 25 | Ga0070682_100016617 | 3300005337 | Bacteria | 4282 |
| 26 | Ga0070682_100025720 | 3300005337 | Bacteria | 3515 |
| 27 | Ga0070682_100139914 | 3300005337 | Bacteria | 1648 |
| 28 | Ga0070682_101717468 | 3300005337 | Unclassified | 546 |
| 29 | Ga0070682_102006562 | 3300005337 | Unclassified | 509 |
| 30 | Ga0068868_100181754 | 3300005338 | Unclassified | 1745 |
| 31 | Ga0068868_100199916 | 3300005338 | Unclassified | 1666 |
| 32 | Ga0068868_100727468 | 3300005338 | Unclassified | 890 |
| 33 | Ga0070660_100004242 | 3300005339 | Bacteria | 9898 |
| 34 | Ga0070660_100399872 | 3300005339 | Unclassified | 1136 |
| 35 | Ga0070660_100492403 | 3300005339 | Bacteria | 1019 |
| 36 | Ga0070689_100050989 | 3300005340 | Bacteria | 3197 |
| 37 | Ga0070689_100473441 | 3300005340 | Bacteria | 1069 |
| 38 | Ga0070691_10041828 | 3300005341 | Unclassified | 2168 |
| 39 | Ga0070691_10328053 | 3300005341 | Unclassified | 844 |
| 40 | Ga0070691_10346416 | 3300005341 | Bacteria | 824 |
| 41 | Ga0070687_100164235 | 3300005343 | Bacteria | 1316 |
| 42 | Ga0070687_100218697 | 3300005343 | Archaea | 1165 |
| 43 | Ga0070692_10018114 | 3300005345 | Bacteria | 3380 |
| 44 | Ga0070692_10027130 | 3300005345 | Unclassified | 2836 |
| 45 | Ga0070692_10264906 | 3300005345 | Bacteria | 1035 |
| 46 | Ga0070668_100028197 | 3300005347 | Bacteria | 4264 |
| 47 | Ga0070668_100043709 | 3300005347 | Bacteria | 3436 |
| 48 | Ga0070668_100809151 | 3300005347 | Bacteria | 833 |
| 49 | Ga0070669_100599557 | 3300005353 | Bacteria | 923 |
| 50 | Ga0070675_100199637 | 3300005354 | Unclassified | 1736 |
| 51 | Ga0070671_100044605 | 3300005355 | Bacteria | 3685 |
| 52 | Ga0070671_100202461 | 3300005355 | Bacteria | 1684 |
| 53 | Ga0070674_100029154 | 3300005356 | Bacteria | 3631 |
| 54 | Ga0070674_101597854 | 3300005356 | Unclassified | 588 |
| 55 | Ga0070673_100513618 | 3300005364 | Bacteria | 1085 |
| 56 | Ga0070673_101629932 | 3300005364 | Unclassified | 610 |
| 57 | Ga0070688_100748218 | 3300005365 | Unclassified | 761 |
| 58 | Ga0070659_100051807 | 3300005366 | Bacteria | 3228 |
| 59 | Ga0070659_100054809 | 3300005366 | Bacteria | 3141 |
| 60 | Ga0070659_100076202 | 3300005366 | Bacteria | 2675 |
| 61 | Ga0070667_101102988 | 3300005367 | Unclassified | 742 |
| 62 | Ga0070703_10094506 | 3300005406 | Unclassified | 1043 |
| 63 | Ga0070709_10003184 | 3300005434 | Bacteria | 8803 |
| 64 | Ga0070709_10005180 | 3300005434 | Bacteria | 7052 |
| 65 | Ga0070709_10105187 | 3300005434 | Bacteria | 1887 |
| 66 | Ga0070709_10494934 | 3300005434 | Unclassified | 928 |
| 67 | Ga0070709_10646933 | 3300005434 | Bacteria | 818 |
| 68 | Ga0070714_100069345 | 3300005435 | Bacteria | 3044 |
| 69 | Ga0070714_100146920 | 3300005435 | Bacteria | 2122 |
| 70 | Ga0070714_100756442 | 3300005435 | Unclassified | 940 |
| 71 | Ga0070714_102295716 | 3300005435 | Unclassified | 525 |
| 72 | Ga0070713_100020617 | 3300005436 | Bacteria | 5057 |
| 73 | Ga0070713_100028644 | 3300005436 | Bacteria | 4399 |
| 74 | Ga0070713_100033831 | 3300005436 | Bacteria | 4099 |
| 75 | Ga0070713_101275822 | 3300005436 | Unclassified | 712 |
| 76 | Ga0070713_101430404 | 3300005436 | Unclassified | 671 |
| 77 | Ga0070710_10008830 | 3300005437 | Bacteria | 4915 |
| 78 | Ga0070710_10009792 | 3300005437 | Bacteria | 4695 |
| 79 | Ga0070710_10105706 | 3300005437 | Unclassified | 1683 |
| 80 | Ga0070710_10157061 | 3300005437 | Bacteria | 1407 |
| 81 | Ga0070710_10539948 | 3300005437 | Bacteria | 804 |
| 82 | Ga0070701_10005031 | 3300005438 | Bacteria | 5422 |
| 83 | Ga0070701_10072129 | 3300005438 | Unclassified | 1849 |
| 84 | Ga0070711_100040241 | 3300005439 | Unclassified | 3151 |
| 85 | Ga0070711_100317250 | 3300005439 | Bacteria | 1244 |
| 86 | Ga0070711_100501895 | 3300005439 | Bacteria | 1000 |
| 87 | Ga0070711_101045766 | 3300005439 | Unclassified | 702 |
| 88 | Ga0070711_101833081 | 3300005439 | Bacteria | 532 |
| 89 | Ga0070711_101872423 | 3300005439 | Unclassified | 527 |
| 90 | Ga0070705_100021079 | 3300005440 | Bacteria | 3461 |
| 91 | Ga0070705_100085009 | 3300005440 | Bacteria | 1954 |
| 92 | Ga0070705_100272875 | 3300005440 | Bacteria | 1198 |
| 93 | Ga0070705_100822646 | 3300005440 | Unclassified | 741 |
| 94 | Ga0070705_100924399 | 3300005440 | Unclassified | 703 |
| 95 | Ga0070705_101016456 | 3300005440 | Bacteria | 674 |
| 96 | Ga0070700_100005511 | 3300005441 | Bacteria | 6715 |
| 97 | Ga0070700_100085339 | 3300005441 | Bacteria | 2048 |
| 98 | Ga0070700_100098297 | 3300005441 | Bacteria | 1924 |
| 99 | Ga0070700_100348146 | 3300005441 | Bacteria | 1097 |
| 100 | Ga0070700_100470213 | 3300005441 | Bacteria | 961 |
| 101 | Ga0070700_101251011 | 3300005441 | Bacteria | 622 |
| 102 | Ga0070694_100053589 | 3300005444 | Bacteria | 2730 |
| 103 | Ga0070694_100694611 | 3300005444 | Bacteria | 827 |
| 104 | Ga0070694_100815549 | 3300005444 | Unclassified | 766 |
| 105 | Ga0070708_100030742 | 3300005445 | Bacteria | 4644 |
| 106 | Ga0070708_100056504 | 3300005445 | Bacteria | 3492 |
| 107 | Ga0070708_100405402 | 3300005445 | Bacteria | 1286 |
| 108 | Ga0070708_100550825 | 3300005445 | Bacteria | 1088 |
| 109 | Ga0070708_100611550 | 3300005445 | Bacteria | 1027 |
| 110 | Ga0070708_100740001 | 3300005445 | Unclassified | 925 |
| 111 | Ga0070708_101803594 | 3300005445 | Unclassified | 568 |
| 112 | Ga0070663_100159948 | 3300005455 | Unclassified | 1733 |
| 113 | Ga0070678_100052207 | 3300005456 | Bacteria | 2967 |
| 114 | Ga0070678_100056955 | 3300005456 | Bacteria | 2861 |
| 115 | Ga0070678_100077657 | 3300005456 | Bacteria | 2506 |
| 116 | Ga0070678_100124972 | 3300005456 | Bacteria | 2035 |
| 117 | Ga0070678_101165375 | 3300005456 | Bacteria | 713 |
| 118 | Ga0070662_100099246 | 3300005457 | Bacteria | 2201 |
| 119 | Ga0070662_100407090 | 3300005457 | Bacteria | 1123 |
| 120 | Ga0070681_10021802 | 3300005458 | Bacteria | 6423 |
| 121 | Ga0070681_10183392 | 3300005458 | Bacteria | 2014 |
| 122 | Ga0070681_10292751 | 3300005458 | Bacteria | 1538 |
| 123 | Ga0068867_100000419 | 3300005459 | Bacteria | 28327 |
| 124 | Ga0068867_100049346 | 3300005459 | Bacteria | 3098 |
| 125 | Ga0068867_100136134 | 3300005459 | Bacteria | 1915 |
| 126 | Ga0068867_100381674 | 3300005459 | Bacteria | 1184 |
| 127 | Ga0068867_100859855 | 3300005459 | Bacteria | 813 |
| 128 | Ga0070685_10289436 | 3300005466 | Bacteria | 1100 |
| 129 | Ga0070706_100007268 | 3300005467 | Bacteria | 10401 |
| 130 | Ga0070706_100032743 | 3300005467 | Bacteria | 4796 |
| 131 | Ga0070706_100081840 | 3300005467 | Bacteria | 2990 |
| 132 | Ga0070707_100000635 | 3300005468 | Bacteria | 35108 |
| 133 | Ga0070707_100365915 | 3300005468 | Bacteria | 1401 |
| 134 | Ga0070707_100650586 | 3300005468 | Unclassified | 1017 |
| 135 | Ga0070707_102282240 | 3300005468 | Unclassified | 508 |
| 136 | Ga0070698_100027034 | 3300005471 | Bacteria | 5967 |
| 137 | Ga0070698_100049053 | 3300005471 | Bacteria | 4312 |
| 138 | Ga0070698_100100305 | 3300005471 | Bacteria | 2868 |
| 139 | Ga0070698_100790151 | 3300005471 | Unclassified | 893 |
| 140 | Ga0070699_100018354 | 3300005518 | Bacteria | 6010 |
| 141 | Ga0070699_100027752 | 3300005518 | Bacteria | 4881 |
| 142 | Ga0070699_100124045 | 3300005518 | Bacteria | 2273 |
| 143 | Ga0070679_100029502 | 3300005530 | Bacteria | 5412 |
| 144 | Ga0070679_100162724 | 3300005530 | Bacteria | 2205 |
| 145 | Ga0070679_100664535 | 3300005530 | Unclassified | 985 |
| 146 | Ga0070679_100698637 | 3300005530 | Bacteria | 957 |
| 147 | Ga0070684_100181636 | 3300005535 | Bacteria | 1913 |
| 148 | Ga0070684_100351475 | 3300005535 | Bacteria | 1356 |
| 149 | Ga0070684_101550298 | 3300005535 | Bacteria | 625 |
| 150 | Ga0070697_100132791 | 3300005536 | Bacteria | 2089 |
| 151 | Ga0070697_101512982 | 3300005536 | Unclassified | 600 |
| 152 | Ga0070697_101934461 | 3300005536 | Unclassified | 528 |
| 153 | Ga0068853_100399154 | 3300005539 | Unclassified | 1287 |
| 154 | Ga0070672_100139115 | 3300005543 | Unclassified | 2001 |
| 155 | Ga0070686_100026947 | 3300005544 | Bacteria | 3473 |
| 156 | Ga0070686_100040663 | 3300005544 | Bacteria | 2901 |
| 157 | Ga0070686_100047337 | 3300005544 | Bacteria | 2719 |
| 158 | Ga0070686_100428539 | 3300005544 | Bacteria | 1012 |
| 159 | Ga0070695_100027640 | 3300005545 | Bacteria | 3516 |
| 160 | Ga0070695_100036995 | 3300005545 | Bacteria | 3074 |
| 161 | Ga0070695_100081782 | 3300005545 | Bacteria | 2138 |
| 162 | Ga0070695_101742512 | 3300005545 | Unclassified | 522 |
| 163 | Ga0070696_100038424 | 3300005546 | Bacteria | 3303 |
| 164 | Ga0070696_100114527 | 3300005546 | Bacteria | 1945 |
| 165 | Ga0070693_100059408 | 3300005547 | Bacteria | 2216 |
| 166 | Ga0070693_100120499 | 3300005547 | Bacteria | 1626 |
| 167 | Ga0070693_100146495 | 3300005547 | Bacteria | 1492 |
| 168 | Ga0070693_100377379 | 3300005547 | Unclassified | 977 |
| 169 | Ga0070693_100432369 | 3300005547 | Unclassified | 920 |
| 170 | Ga0070693_101457298 | 3300005547 | Unclassified | 534 |
| 171 | Ga0070665_100875971 | 3300005548 | Unclassified | 911 |
| 172 | Ga0070704_100074208 | 3300005549 | Bacteria | 2480 |
| 173 | Ga0070704_100081912 | 3300005549 | Bacteria | 2378 |
| 174 | Ga0070704_100148504 | 3300005549 | Bacteria | 1840 |
| 175 | Ga0070704_100242203 | 3300005549 | Bacteria | 1476 |
| 176 | Ga0070704_100993488 | 3300005549 | Bacteria | 759 |
| 177 | Ga0070704_101039668 | 3300005549 | Bacteria | 742 |
| 178 | Ga0070704_101256338 | 3300005549 | Bacteria | 677 |
| 179 | Ga0068855_100263595 | 3300005563 | Bacteria | 1919 |
| 180 | Ga0068855_100492064 | 3300005563 | Unclassified | 1334 |
| 181 | Ga0070664_101317734 | 3300005564 | Unclassified | 682 |
| 182 | Ga0068857_100961502 | 3300005577 | Bacteria | 821 |
| 183 | Ga0068854_100060846 | 3300005578 | Bacteria | 2733 |
| 184 | Ga0068854_100166684 | 3300005578 | Bacteria | 1711 |
| 185 | Ga0068854_100464466 | 3300005578 | Unclassified | 1060 |
| 186 | Ga0068856_100006365 | 3300005614 | Bacteria | 11589 |
| 187 | Ga0068856_100006515 | 3300005614 | Bacteria | 11449 |
| 188 | Ga0068856_100076025 | 3300005614 | Bacteria | 3327 |
| 189 | Ga0068856_100330568 | 3300005614 | Bacteria | 1542 |
| 190 | Ga0068856_100388280 | 3300005614 | Bacteria | 1416 |
| 191 | Ga0068856_100428476 | 3300005614 | Bacteria | 1343 |
| 192 | Ga0068856_100484970 | 3300005614 | Unclassified | 1257 |
| 193 | Ga0068856_101200171 | 3300005614 | Bacteria | 775 |
| 194 | Ga0070702_100174880 | 3300005615 | Bacteria | 1400 |
| 195 | Ga0070702_101398782 | 3300005615 | Unclassified | 572 |
| 196 | Ga0068852_100056374 | 3300005616 | Bacteria | 3396 |
| 197 | Ga0068852_100130492 | 3300005616 | Bacteria | 2314 |
| 198 | Ga0068852_100744861 | 3300005616 | Unclassified | 992 |
| 199 | Ga0068859_100036891 | 3300005617 | Unclassified | 4907 |
| 200 | Ga0068859_100643929 | 3300005617 | Unclassified | 1152 |
| 201 | Ga0068864_100241998 | 3300005618 | Bacteria | 1672 |
| 202 | Ga0068864_100685267 | 3300005618 | Bacteria | 1000 |
| 203 | Ga0068866_10019844 | 3300005718 | Bacteria | 3068 |
| 204 | Ga0068866_10067588 | 3300005718 | Bacteria | 1877 |
| 205 | Ga0068866_10093506 | 3300005718 | Bacteria | 1643 |
| 206 | Ga0068866_10747958 | 3300005718 | Bacteria | 675 |
| 207 | Ga0068861_100003224 | 3300005719 | Bacteria | 10792 |
| 208 | Ga0068861_100059153 | 3300005719 | Bacteria | 2933 |
| 209 | Ga0068861_100191244 | 3300005719 | Bacteria | 1711 |
| 210 | Ga0068861_101317531 | 3300005719 | Bacteria | 703 |
| 211 | Ga0068870_10071630 | 3300005840 | Bacteria | 1892 |
| 212 | Ga0068870_10164357 | 3300005840 | Bacteria | 1319 |
| 213 | Ga0068858_102402166 | 3300005842 | Unclassified | 521 |
| 214 | Ga0068860_100199642 | 3300005843 | Unclassified | 1938 |
| 215 | Ga0068862_100072629 | 3300005844 | Bacteria | 2972 |
| 216 | Ga0068862_100655970 | 3300005844 | Unclassified | 1012 |
| 217 | Ga0068862_101381619 | 3300005844 | Unclassified | 707 |
| 218 | Ga0081455_10004258 | 3300005937 | Bacteria | 16131 |
| 219 | Ga0081455_10007410 | 3300005937 | Bacteria | 11557 |
| 220 | Ga0081455_10044778 | 3300005937 | Bacteria | 3856 |
| 221 | Ga0081455_10051923 | 3300005937 | Bacteria | 3514 |
| 222 | Ga0081455_10109458 | 3300005937 | Bacteria | 2198 |
| 223 | Ga0081455_10346776 | 3300005937 | Bacteria | 1049 |
| 224 | Ga0081538_10000057 | 3300005981 | Bacteria | 102521 |
| 225 | Ga0081538_10134405 | 3300005981 | Bacteria | 1155 |
| 226 | Ga0081538_10363983 | 3300005981 | Bacteria | 523 |
| 227 | Ga0081540_1001396 | 3300005983 | Bacteria | 20924 |
| 228 | Ga0081540_1013265 | 3300005983 | Bacteria | 5368 |
| 229 | Ga0081539_10006172 | 3300005985 | Bacteria | 11658 |
| 230 | Ga0070717_10028303 | 3300006028 | Bacteria | 4484 |
| 231 | Ga0070717_10038509 | 3300006028 | Bacteria | 3887 |
| 232 | Ga0070717_10243433 | 3300006028 | Unclassified | 1587 |
| 233 | Ga0070717_10261456 | 3300006028 | Bacteria | 1531 |
| 234 | Ga0075365_10004328 | 3300006038 | Bacteria | 7500 |
| 235 | Ga0075365_10080609 | 3300006038 | Bacteria | 2204 |
| 236 | Ga0075365_10281403 | 3300006038 | Archaea | 1170 |
| 237 | Ga0075364_10002546 | 3300006051 | Bacteria | 10209 |
| 238 | Ga0075432_10010355 | 3300006058 | Bacteria | 3163 |
| 239 | Ga0075432_10133154 | 3300006058 | Bacteria | 943 |
| 240 | Ga0075432_10147093 | 3300006058 | Bacteria | 903 |
| 241 | Ga0070715_10025658 | 3300006163 | Bacteria | 2337 |
| 242 | Ga0070715_10038738 | 3300006163 | Bacteria | 1981 |
| 243 | Ga0070715_10427113 | 3300006163 | Unclassified | 743 |
| 244 | Ga0070715_10769232 | 3300006163 | Bacteria | 582 |
| 245 | Ga0070716_100011446 | 3300006173 | Bacteria | 4467 |
| 246 | Ga0070716_100781302 | 3300006173 | Bacteria | 737 |
| 247 | Ga0070716_100893864 | 3300006173 | Bacteria | 695 |
| 248 | Ga0070716_101764083 | 3300006173 | Unclassified | 512 |
| 249 | Ga0070712_100006479 | 3300006175 | Bacteria | 7261 |
| 250 | Ga0070712_100064183 | 3300006175 | Bacteria | 2603 |
| 251 | Ga0070712_100252447 | 3300006175 | Bacteria | 1410 |
| 252 | Ga0070712_100261037 | 3300006175 | Unclassified | 1388 |
| 253 | Ga0070712_101824495 | 3300006175 | Bacteria | 532 |
| 254 | Ga0075362_10097005 | 3300006177 | Bacteria | 1374 |
| 255 | Ga0075367_10384170 | 3300006178 | Bacteria | 887 |
| 256 | Ga0075367_10724726 | 3300006178 | Unclassified | 633 |
| 257 | Ga0075367_10982684 | 3300006178 | Bacteria | 539 |
| 258 | Ga0075427_10021432 | 3300006194 | Bacteria | 1028 |
| 259 | Ga0097621_100039745 | 3300006237 | Bacteria | 3780 |
| 260 | Ga0097621_100098235 | 3300006237 | Unclassified | 2459 |
| 261 | Ga0097621_101617802 | 3300006237 | Unclassified | 616 |
| 262 | Ga0068871_100018185 | 3300006358 | Bacteria | 5337 |
| 263 | Ga0068871_100090324 | 3300006358 | Bacteria | 2551 |
| 264 | Ga0068871_101772237 | 3300006358 | Unclassified | 586 |
| 265 | Ga0075428_100077768 | 3300006844 | Bacteria | 3621 |
| 266 | Ga0075428_100442972 | 3300006844 | Bacteria | 1391 |
| 267 | Ga0075428_100460568 | 3300006844 | Bacteria | 1362 |
| 268 | Ga0075428_100495393 | 3300006844 | Bacteria | 1307 |
| 269 | Ga0075430_100035031 | 3300006846 | Bacteria | 4261 |
| 270 | Ga0075430_100058219 | 3300006846 | Bacteria | 3248 |
| 271 | Ga0075430_100062847 | 3300006846 | Bacteria | 3118 |
| 272 | Ga0075430_100213617 | 3300006846 | Bacteria | 1600 |
| 273 | Ga0075430_100808076 | 3300006846 | Bacteria | 773 |
| 274 | Ga0075431_100131200 | 3300006847 | Bacteria | 2584 |
| 275 | Ga0075431_100189150 | 3300006847 | Bacteria | 2110 |
| 276 | Ga0075431_100285290 | 3300006847 | Bacteria | 1671 |
| 277 | Ga0075431_100317342 | 3300006847 | Unclassified | 1572 |
| 278 | Ga0075431_100519204 | 3300006847 | Bacteria | 1181 |
| 279 | Ga0075431_100868312 | 3300006847 | Unclassified | 873 |
| 280 | Ga0075433_10038382 | 3300006852 | Bacteria | 4136 |
| 281 | Ga0075433_10054797 | 3300006852 | Bacteria | 3479 |
| 282 | Ga0075433_10137893 | 3300006852 | Bacteria | 2168 |
| 283 | Ga0075433_10365672 | 3300006852 | Bacteria | 1274 |
| 284 | Ga0075434_100017725 | 3300006871 | Bacteria | 6865 |
| 285 | Ga0075434_100041379 | 3300006871 | Bacteria | 4566 |
| 286 | Ga0075434_100284326 | 3300006871 | Unclassified | 1674 |
| 287 | Ga0075434_100320132 | 3300006871 | Bacteria | 1571 |
| 288 | Ga0075434_100721668 | 3300006871 | Bacteria | 1014 |
| 289 | Ga0075434_101850712 | 3300006871 | Bacteria | 610 |
| 290 | Ga0075434_102332602 | 3300006871 | Bacteria | 538 |
| 291 | Ga0075429_100095945 | 3300006880 | Bacteria | 2586 |
| 292 | Ga0075429_100262899 | 3300006880 | Bacteria | 1511 |
| 293 | Ga0075429_100423703 | 3300006880 | Bacteria | 1166 |
| 294 | Ga0068865_100029339 | 3300006881 | Bacteria | 3649 |
| 295 | Ga0068865_100106024 | 3300006881 | Unclassified | 2065 |
| 296 | Ga0068865_100225569 | 3300006881 | Bacteria | 1467 |
| 297 | Ga0068865_100490181 | 3300006881 | Bacteria | 1023 |
| 298 | Ga0075436_100001566 | 3300006914 | Bacteria | 15598 |
| 299 | Ga0075436_100026414 | 3300006914 | Bacteria | 3998 |
| 300 | Ga0075436_100059442 | 3300006914 | Bacteria | 2640 |
| 301 | Ga0097620_100036890 | 3300006931 | Unclassified | 4907 |
| 302 | Ga0097620_100643917 | 3300006931 | Unclassified | 1152 |
| 303 | Ga0075435_100007426 | 3300007076 | Bacteria | 7807 |
| 304 | Ga0075435_100070424 | 3300007076 | Bacteria | 2855 |
| 305 | Ga0075435_100384065 | 3300007076 | Bacteria | 1206 |
| 306 | Ga0075435_100812835 | 3300007076 | Bacteria | 814 |
| 307 | Ga0105240_11805153 | 3300009093 | Unclassified | 637 |
| 308 | Ga0111539_10088071 | 3300009094 | Bacteria | 3648 |
| 309 | Ga0111539_10232752 | 3300009094 | Bacteria | 2145 |
| 310 | Ga0111539_10470705 | 3300009094 | Bacteria | 1463 |
| 311 | Ga0111539_10951128 | 3300009094 | Bacteria | 999 |
| 312 | Ga0111539_10951985 | 3300009094 | Bacteria | 998 |
| 313 | Ga0111539_11730428 | 3300009094 | Bacteria | 725 |
| 314 | Ga0105245_10014177 | 3300009098 | Bacteria | 6947 |
| 315 | Ga0105245_10024631 | 3300009098 | Bacteria | 5286 |
| 316 | Ga0105245_10037006 | 3300009098 | Bacteria | 4337 |
| 317 | Ga0105245_10045847 | 3300009098 | Bacteria | 3906 |
| 318 | Ga0105245_10078695 | 3300009098 | Bacteria | 3009 |
| 319 | Ga0105245_10118738 | 3300009098 | Unclassified | 2468 |
| 320 | Ga0105245_10901157 | 3300009098 | Unclassified | 926 |
| 321 | Ga0105245_11819536 | 3300009098 | Bacteria | 662 |
| 322 | Ga0105245_12169368 | 3300009098 | Bacteria | 609 |
| 323 | Ga0105245_12250188 | 3300009098 | Bacteria | 599 |
| 324 | Ga0105247_10097098 | 3300009101 | Unclassified | 1879 |
| 325 | Ga0114129_10001278 | 3300009147 | Bacteria | 33592 |
| 326 | Ga0114129_10168995 | 3300009147 | Bacteria | 2982 |
| 327 | Ga0114129_10256832 | 3300009147 | Bacteria | 2344 |
| 328 | Ga0114129_10320296 | 3300009147 | Unclassified | 2061 |
| 329 | Ga0114129_10520765 | 3300009147 | Bacteria | 1550 |
| 330 | Ga0114129_10543515 | 3300009147 | Bacteria | 1512 |
| 331 | Ga0114129_10932760 | 3300009147 | Bacteria | 1098 |
| 332 | Ga0114129_11104098 | 3300009147 | Bacteria | 993 |
| 333 | Ga0114129_11271890 | 3300009147 | Bacteria | 913 |
| 334 | Ga0114129_11471938 | 3300009147 | Unclassified | 838 |
| 335 | Ga0114129_12555992 | 3300009147 | Unclassified | 610 |
| 336 | Ga0114129_12877371 | 3300009147 | Archaea | 570 |
| 337 | Ga0114129_13335835 | 3300009147 | Unclassified | 518 |
| 338 | Ga0105243_10034552 | 3300009148 | Bacteria | 3915 |
| 339 | Ga0105243_10247183 | 3300009148 | Unclassified | 1591 |
| 340 | Ga0105243_10489794 | 3300009148 | Bacteria | 1162 |
| 341 | Ga0105243_11373770 | 3300009148 | Unclassified | 726 |
| 342 | Ga0105241_10034117 | 3300009174 | Unclassified | 3822 |
| 343 | Ga0105241_10052450 | 3300009174 | Bacteria | 3114 |
| 344 | Ga0105241_10096894 | 3300009174 | Bacteria | 2338 |
| 345 | Ga0105242_10271065 | 3300009176 | Unclassified | 1537 |
| 346 | Ga0105242_10474990 | 3300009176 | Bacteria | 1184 |
| 347 | Ga0105242_10597664 | 3300009176 | Bacteria | 1065 |
| 348 | Ga0105242_11132223 | 3300009176 | Unclassified | 798 |
| 349 | Ga0105242_11279325 | 3300009176 | Unclassified | 756 |
| 350 | Ga0105242_11634610 | 3300009176 | Bacteria | 679 |
| 351 | Ga0105248_10023775 | 3300009177 | Bacteria | 6810 |
| 352 | Ga0105248_10127716 | 3300009177 | Bacteria | 2868 |
| 353 | Ga0105248_11509767 | 3300009177 | Bacteria | 761 |
| 354 | Ga0105248_11604440 | 3300009177 | Bacteria | 737 |
| 355 | Ga0105237_10098689 | 3300009545 | Bacteria | 2912 |
| 356 | Ga0105238_11144179 | 3300009551 | Bacteria | 802 |
| 357 | Ga0105249_10017488 | 3300009553 | Bacteria | 6366 |
| 358 | Ga0105249_10235733 | 3300009553 | Unclassified | 1807 |
| 359 | Ga0105249_10915231 | 3300009553 | Bacteria | 944 |
| 360 | Ga0105239_10038225 | 3300010375 | Bacteria | 5260 |
| 361 | Ga0105239_10288655 | 3300010375 | Bacteria | 1847 |
| 362 | Ga0105239_11111631 | 3300010375 | Unclassified | 910 |
| 363 | Ga0105239_11351357 | 3300010375 | Bacteria | 822 |
| 364 | Ga0105239_11501648 | 3300010375 | Bacteria | 779 |
| 365 | Ga0105246_10162536 | 3300011119 | Unclassified | 1702 |
| 366 | Ga0105246_10396601 | 3300011119 | Bacteria | 1145 |
| 367 | Ga0157320_1000974 | 3300012481 | Bacteria | 1334 |
| 368 | Ga0157337_1007770 | 3300012483 | Bacteria | 775 |
| 369 | Ga0157337_1033296 | 3300012483 | Bacteria | 538 |
| 370 | Ga0157323_1001732 | 3300012495 | Bacteria | 1134 |
| 371 | Ga0157347_1005231 | 3300012502 | Bacteria | 1233 |
| 372 | Ga0157339_1035087 | 3300012505 | Bacteria | 605 |
| 373 | Ga0157338_1010725 | 3300012515 | Bacteria | 930 |
| 374 | Ga0157338_1029510 | 3300012515 | Unclassified | 691 |
| 375 | Ga0157371_10132892 | 3300013102 | Bacteria | 1771 |
| 376 | Ga0157369_10332260 | 3300013105 | Bacteria | 1579 |
| 377 | Ga0157374_10007016 | 3300013296 | Bacteria | 9591 |
| 378 | Ga0157374_10152576 | 3300013296 | Unclassified | 2247 |
| 379 | Ga0157374_10365706 | 3300013296 | Bacteria | 1435 |
| 380 | Ga0157374_11147706 | 3300013296 | Unclassified | 798 |
| 381 | Ga0157378_10022053 | 3300013297 | Bacteria | 5602 |
| 382 | Ga0157378_10232155 | 3300013297 | Bacteria | 1759 |
| 383 | Ga0163162_10011880 | 3300013306 | Bacteria | 8494 |
| 384 | Ga0163162_10070969 | 3300013306 | Bacteria | 3535 |
| 385 | Ga0163162_10481248 | 3300013306 | Bacteria | 1373 |
| 386 | Ga0163162_10654046 | 3300013306 | Bacteria | 1174 |
| 387 | Ga0163162_11847514 | 3300013306 | Unclassified | 691 |
| 388 | Ga0157372_10449848 | 3300013307 | Bacteria | 1501 |
| 389 | Ga0157372_10751467 | 3300013307 | Bacteria | 1134 |
| 390 | Ga0157372_10829027 | 3300013307 | Bacteria | 1074 |
| 391 | Ga0157372_12236989 | 3300013307 | Unclassified | 628 |
| 392 | Ga0157375_10060218 | 3300013308 | Unclassified | 3764 |
| 393 | Ga0157375_10161185 | 3300013308 | Bacteria | 2385 |
| 394 | Ga0157375_10243505 | 3300013308 | Bacteria | 1958 |
| 395 | Ga0157375_11116291 | 3300013308 | Bacteria | 923 |
| 396 | Ga0163163_11489691 | 3300014325 | Bacteria | 738 |
| 397 | Ga0157380_10072838 | 3300014326 | Bacteria | 2784 |
| 398 | Ga0157380_10535411 | 3300014326 | Bacteria | 1146 |
| 399 | Ga0157380_10964766 | 3300014326 | Bacteria | 883 |
| 400 | Ga0182008_10245520 | 3300014497 | Bacteria | 922 |
| 401 | Ga0182008_10409150 | 3300014497 | Bacteria | 730 |
| 402 | Ga0157379_10382744 | 3300014968 | Unclassified | 1291 |
| 403 | Ga0157379_10594784 | 3300014968 | Unclassified | 1032 |
| 404 | Ga0157376_10004722 | 3300014969 | Bacteria | 9493 |
| 405 | Ga0157376_10139219 | 3300014969 | Unclassified | 2175 |
| 406 | Ga0157376_12998806 | 3300014969 | Unclassified | 511 |
| 407 | Ga0163161_10015833 | 3300017792 | Bacteria | 5259 |
| 408 | Ga0163161_10416433 | 3300017792 | Unclassified | 1080 |
| 409 | Ga0163161_10602845 | 3300017792 | Bacteria | 906 |
| 410 | Ga0163161_10692529 | 3300017792 | Bacteria | 848 |
| 411 | Ga0163161_10702811 | 3300017792 | Unclassified | 842 |
| 412 | Ga0206354_10018681 | 3300020081 | Bacteria | 1494 |
| 413 | Ga0206353_11690045 | 3300020082 | Bacteria | 6863 |
| 414 | Ga0207653_10133543 | 3300025885 | Unclassified | 903 |
| 415 | Ga0207682_10076102 | 3300025893 | Bacteria | 1430 |
| 416 | Ga0207692_10138339 | 3300025898 | Unclassified | 1383 |
| 417 | Ga0207692_10138891 | 3300025898 | Bacteria | 1380 |
| 418 | Ga0207692_10148628 | 3300025898 | Bacteria | 1339 |
| 419 | Ga0207692_10376611 | 3300025898 | Unclassified | 880 |
| 420 | Ga0207642_10024149 | 3300025899 | Bacteria | 2440 |
| 421 | Ga0207642_10065797 | 3300025899 | Unclassified | 1704 |
| 422 | Ga0207688_10401513 | 3300025901 | Unclassified | 850 |
| 423 | Ga0207680_10109369 | 3300025903 | Bacteria | 1790 |
| 424 | Ga0207680_10117685 | 3300025903 | Bacteria | 1733 |
| 425 | Ga0207680_10487928 | 3300025903 | Bacteria | 877 |
| 426 | Ga0207647_10205383 | 3300025904 | Bacteria | 1139 |
| 427 | Ga0207685_10001983 | 3300025905 | Bacteria | 4543 |
| 428 | Ga0207685_10020044 | 3300025905 | Bacteria | 2215 |
| 429 | Ga0207685_10028077 | 3300025905 | Unclassified | 1977 |
| 430 | Ga0207685_10301274 | 3300025905 | Unclassified | 793 |
| 431 | Ga0207699_10017934 | 3300025906 | Bacteria | 3740 |
| 432 | Ga0207699_10022637 | 3300025906 | Bacteria | 3408 |
| 433 | Ga0207699_10046321 | 3300025906 | Bacteria | 2543 |
| 434 | Ga0207699_10255830 | 3300025906 | Bacteria | 1208 |
| 435 | Ga0207699_10569005 | 3300025906 | Unclassified | 823 |
| 436 | Ga0207645_10171439 | 3300025907 | Bacteria | 1422 |
| 437 | Ga0207645_10260305 | 3300025907 | Bacteria | 1149 |
| 438 | Ga0207645_10737285 | 3300025907 | Unclassified | 670 |
| 439 | Ga0207643_10012009 | 3300025908 | Bacteria | 4677 |
| 440 | Ga0207684_10007664 | 3300025910 | Bacteria | 9683 |
| 441 | Ga0207684_10049764 | 3300025910 | Bacteria | 3554 |
| 442 | Ga0207684_10154703 | 3300025910 | Bacteria | 1973 |
| 443 | Ga0207684_10449911 | 3300025910 | Bacteria | 1106 |
| 444 | Ga0207684_11299070 | 3300025910 | Unclassified | 599 |
| 445 | Ga0207654_10078509 | 3300025911 | Bacteria | 1981 |
| 446 | Ga0207654_10624486 | 3300025911 | Unclassified | 770 |
| 447 | Ga0207707_10007237 | 3300025912 | Bacteria | 9658 |
| 448 | Ga0207707_10226288 | 3300025912 | Bacteria | 1628 |
| 449 | Ga0207707_10346580 | 3300025912 | Bacteria | 1280 |
| 450 | Ga0207707_11233812 | 3300025912 | Bacteria | 604 |
| 451 | Ga0207671_10502481 | 3300025914 | Bacteria | 967 |
| 452 | Ga0207693_10001049 | 3300025915 | Bacteria | 24711 |
| 453 | Ga0207693_10006129 | 3300025915 | Bacteria | 9966 |
| 454 | Ga0207693_10010088 | 3300025915 | Bacteria | 7673 |
| 455 | Ga0207693_10010248 | 3300025915 | Bacteria | 7609 |
| 456 | Ga0207693_10317184 | 3300025915 | Bacteria | 1220 |
| 457 | Ga0207663_10011392 | 3300025916 | Bacteria | 4775 |
| 458 | Ga0207663_10014333 | 3300025916 | Bacteria | 4335 |
| 459 | Ga0207663_10032888 | 3300025916 | Bacteria | 3083 |
| 460 | Ga0207663_10110539 | 3300025916 | Unclassified | 1864 |
| 461 | Ga0207663_10261398 | 3300025916 | Bacteria | 1278 |
| 462 | Ga0207663_10426303 | 3300025916 | Bacteria | 1019 |
| 463 | Ga0207663_11125080 | 3300025916 | Bacteria | 631 |
| 464 | Ga0207660_10004447 | 3300025917 | Bacteria | 9130 |
| 465 | Ga0207660_10069490 | 3300025917 | Bacteria | 2558 |
| 466 | Ga0207660_10101399 | 3300025917 | Bacteria | 2151 |
| 467 | Ga0207660_10177857 | 3300025917 | Bacteria | 1651 |
| 468 | Ga0207660_10279025 | 3300025917 | Bacteria | 1326 |
| 469 | Ga0207660_10690344 | 3300025917 | Unclassified | 833 |
| 470 | Ga0207662_10041931 | 3300025918 | Bacteria | 2696 |
| 471 | Ga0207662_10107670 | 3300025918 | Bacteria | 1734 |
| 472 | Ga0207662_10254570 | 3300025918 | Bacteria | 1154 |
| 473 | Ga0207662_10366821 | 3300025918 | Archaea | 970 |
| 474 | Ga0207657_10005734 | 3300025919 | Bacteria | 12955 |
| 475 | Ga0207657_10007354 | 3300025919 | Bacteria | 11299 |
| 476 | Ga0207657_10593914 | 3300025919 | Bacteria | 864 |
| 477 | Ga0207652_10021094 | 3300025921 | Bacteria | 5374 |
| 478 | Ga0207652_10344090 | 3300025921 | Bacteria | 1346 |
| 479 | Ga0207646_10002084 | 3300025922 | Bacteria | 24000 |
| 480 | Ga0207646_10156495 | 3300025922 | Bacteria | 2056 |
| 481 | Ga0207681_10698949 | 3300025923 | Unclassified | 843 |
| 482 | Ga0207694_10259556 | 3300025924 | Bacteria | 1423 |
| 483 | Ga0207650_11435689 | 3300025925 | Unclassified | 587 |
| 484 | Ga0207659_10172148 | 3300025926 | Unclassified | 1709 |
| 485 | Ga0207687_10048740 | 3300025927 | Bacteria | 2943 |
| 486 | Ga0207687_10067438 | 3300025927 | Bacteria | 2545 |
| 487 | Ga0207687_10123738 | 3300025927 | Bacteria | 1938 |
| 488 | Ga0207687_10175435 | 3300025927 | Bacteria | 1657 |
| 489 | Ga0207687_10317743 | 3300025927 | Bacteria | 1260 |
| 490 | Ga0207687_11126567 | 3300025927 | Bacteria | 674 |
| 491 | Ga0207700_10000006 | 3300025928 | Bacteria | 348187 |
| 492 | Ga0207700_10135974 | 3300025928 | Unclassified | 2013 |
| 493 | Ga0207700_10952161 | 3300025928 | Bacteria | 768 |
| 494 | Ga0207700_11089613 | 3300025928 | Bacteria | 714 |
| 495 | Ga0207664_10003007 | 3300025929 | Bacteria | 11203 |
| 496 | Ga0207664_10008495 | 3300025929 | Bacteria | 7168 |
| 497 | Ga0207664_10011573 | 3300025929 | Bacteria | 6281 |
| 498 | Ga0207664_10052601 | 3300025929 | Bacteria | 3221 |
| 499 | Ga0207664_10097100 | 3300025929 | Bacteria | 2427 |
| 500 | Ga0207664_10385603 | 3300025929 | Bacteria | 1244 |
| 501 | Ga0207644_10169762 | 3300025931 | Unclassified | 1702 |
| 502 | Ga0207644_10175297 | 3300025931 | Bacteria | 1677 |
| 503 | Ga0207690_10068853 | 3300025932 | Unclassified | 2433 |
| 504 | Ga0207690_10528057 | 3300025932 | Bacteria | 957 |
| 505 | Ga0207706_10006862 | 3300025933 | Bacteria | 10527 |
| 506 | Ga0207706_10046832 | 3300025933 | Bacteria | 3828 |
| 507 | Ga0207706_10233501 | 3300025933 | Unclassified | 1609 |
| 508 | Ga0207706_10424709 | 3300025933 | Bacteria | 1151 |
| 509 | Ga0207706_10593089 | 3300025933 | Unclassified | 952 |
| 510 | Ga0207686_10197174 | 3300025934 | Unclassified | 1439 |
| 511 | Ga0207686_10297075 | 3300025934 | Unclassified | 1198 |
| 512 | Ga0207686_10517177 | 3300025934 | Unclassified | 928 |
| 513 | Ga0207709_10095679 | 3300025935 | Bacteria | 1952 |
| 514 | Ga0207709_10208411 | 3300025935 | Unclassified | 1401 |
| 515 | Ga0207709_10214511 | 3300025935 | Unclassified | 1384 |
| 516 | Ga0207709_10276765 | 3300025935 | Bacteria | 1238 |
| 517 | Ga0207709_10920036 | 3300025935 | Unclassified | 712 |
| 518 | Ga0207670_10915569 | 3300025936 | Unclassified | 735 |
| 519 | Ga0207669_10155966 | 3300025937 | Unclassified | 1606 |
| 520 | Ga0207669_11241776 | 3300025937 | Unclassified | 632 |
| 521 | Ga0207704_10058620 | 3300025938 | Bacteria | 2372 |
| 522 | Ga0207704_10068318 | 3300025938 | Bacteria | 2240 |
| 523 | Ga0207704_10349726 | 3300025938 | Bacteria | 1150 |
| 524 | Ga0207704_10555281 | 3300025938 | Bacteria | 934 |
| 525 | Ga0207665_10001319 | 3300025939 | Bacteria | 16733 |
| 526 | Ga0207665_10004558 | 3300025939 | Bacteria | 9195 |
| 527 | Ga0207665_10785538 | 3300025939 | Bacteria | 752 |
| 528 | Ga0207691_10007187 | 3300025940 | Bacteria | 10741 |
| 529 | Ga0207711_10033326 | 3300025941 | Bacteria | 4358 |
| 530 | Ga0207689_10159169 | 3300025942 | Bacteria | 1861 |
| 531 | Ga0207661_10093965 | 3300025944 | Bacteria | 2504 |
| 532 | Ga0207661_10415617 | 3300025944 | Bacteria | 1221 |
| 533 | Ga0207679_10533966 | 3300025945 | Bacteria | 1051 |
| 534 | Ga0207667_10123250 | 3300025949 | Bacteria | 2670 |
| 535 | Ga0207667_10383219 | 3300025949 | Unclassified | 1432 |
| 536 | Ga0207651_10720965 | 3300025960 | Unclassified | 880 |
| 537 | Ga0207651_10908768 | 3300025960 | Bacteria | 784 |
| 538 | Ga0207712_10010303 | 3300025961 | Bacteria | 5933 |
| 539 | Ga0207712_10180703 | 3300025961 | Bacteria | 1657 |
| 540 | Ga0207712_10238451 | 3300025961 | Unclassified | 1464 |
| 541 | Ga0207712_10994046 | 3300025961 | Bacteria | 744 |
| 542 | Ga0207668_10019546 | 3300025972 | Bacteria | 4286 |
| 543 | Ga0207668_10208709 | 3300025972 | Unclassified | 1561 |
| 544 | Ga0207668_11097117 | 3300025972 | Bacteria | 713 |
| 545 | Ga0207668_12062531 | 3300025972 | Bacteria | 514 |
| 546 | Ga0207640_10077780 | 3300025981 | Bacteria | 2256 |
| 547 | Ga0207640_10291733 | 3300025981 | Bacteria | 1286 |
| 548 | Ga0207640_10705741 | 3300025981 | Bacteria | 865 |
| 549 | Ga0207640_10794114 | 3300025981 | Bacteria | 819 |
| 550 | Ga0207640_11594200 | 3300025981 | Bacteria | 588 |
| 551 | Ga0207677_10010513 | 3300026023 | Bacteria | 5241 |
| 552 | Ga0207677_10218403 | 3300026023 | Unclassified | 1527 |
| 553 | Ga0207677_10632221 | 3300026023 | Unclassified | 943 |
| 554 | Ga0207677_11057909 | 3300026023 | Bacteria | 738 |
| 555 | Ga0207677_11309469 | 3300026023 | Bacteria | 666 |
| 556 | Ga0207703_11403090 | 3300026035 | Unclassified | 672 |
| 557 | Ga0207639_10598912 | 3300026041 | Bacteria | 1016 |
| 558 | Ga0207639_10609404 | 3300026041 | Unclassified | 1007 |
| 559 | Ga0207678_10010343 | 3300026067 | Bacteria | 8189 |
| 560 | Ga0207678_10380641 | 3300026067 | Unclassified | 1220 |
| 561 | Ga0207708_10001288 | 3300026075 | Bacteria | 18839 |
| 562 | Ga0207708_10016596 | 3300026075 | Bacteria | 5539 |
| 563 | Ga0207708_10227071 | 3300026075 | Bacteria | 1498 |
| 564 | Ga0207708_10375693 | 3300026075 | Bacteria | 1171 |
| 565 | Ga0207708_10672640 | 3300026075 | Unclassified | 883 |
| 566 | Ga0207702_10063011 | 3300026078 | Bacteria | 3169 |
| 567 | Ga0207702_10112394 | 3300026078 | Bacteria | 2424 |
| 568 | Ga0207702_10169528 | 3300026078 | Bacteria | 2000 |
| 569 | Ga0207702_10277292 | 3300026078 | Unclassified | 1584 |
| 570 | Ga0207702_10373267 | 3300026078 | Bacteria | 1370 |
| 571 | Ga0207702_10539916 | 3300026078 | Bacteria | 1140 |
| 572 | Ga0207702_11029919 | 3300026078 | Bacteria | 817 |
| 573 | Ga0207702_11591346 | 3300026078 | Bacteria | 647 |
| 574 | Ga0207641_10719864 | 3300026088 | Unclassified | 984 |
| 575 | Ga0207641_10809207 | 3300026088 | Bacteria | 927 |
| 576 | Ga0207648_10000136 | 3300026089 | Bacteria | 73368 |
| 577 | Ga0207648_10016194 | 3300026089 | Bacteria | 6823 |
| 578 | Ga0207648_10143046 | 3300026089 | Bacteria | 2109 |
| 579 | Ga0207648_10207500 | 3300026089 | Bacteria | 1739 |
| 580 | Ga0207648_10331612 | 3300026089 | Bacteria | 1369 |
| 581 | Ga0207648_10557310 | 3300026089 | Bacteria | 1053 |
| 582 | Ga0207676_10300650 | 3300026095 | Bacteria | 1465 |
| 583 | Ga0207674_10048768 | 3300026116 | Bacteria | 4333 |
| 584 | Ga0207674_10920009 | 3300026116 | Bacteria | 843 |
| 585 | Ga0207675_100002156 | 3300026118 | Bacteria | 19554 |
| 586 | Ga0207675_100047295 | 3300026118 | Bacteria | 4017 |
| 587 | Ga0207675_100120263 | 3300026118 | Bacteria | 2484 |
| 588 | Ga0207675_100158197 | 3300026118 | Bacteria | 2160 |
| 589 | Ga0207675_100214209 | 3300026118 | Bacteria | 1854 |
| 590 | Ga0207675_100464184 | 3300026118 | Bacteria | 1256 |
| 591 | Ga0207683_10000371 | 3300026121 | Bacteria | 41225 |
| 592 | Ga0207683_10023388 | 3300026121 | Bacteria | 5315 |
| 593 | Ga0207683_10078987 | 3300026121 | Bacteria | 2917 |
| 594 | Ga0207683_10404279 | 3300026121 | Bacteria | 1256 |
| 595 | Ga0207683_11235838 | 3300026121 | Bacteria | 692 |
| 596 | Ga0207698_10328579 | 3300026142 | Bacteria | 1435 |
| 597 | Ga0207698_10381454 | 3300026142 | Unclassified | 1341 |
| 598 | Ga0207698_10424204 | 3300026142 | Bacteria | 1277 |
| 599 | Ga0207428_10012539 | 3300027907 | Bacteria | 7442 |
| 600 | Ga0207428_10270327 | 3300027907 | Bacteria | 1264 |
| 601 | Ga0207428_10900634 | 3300027907 | Unclassified | 625 |
| 602 | Ga0268265_10109262 | 3300028380 | Bacteria | 2254 |
| 603 | Ga0268265_10384120 | 3300028380 | Unclassified | 1293 |
| 604 | Ga0268264_10131625 | 3300028381 | Bacteria | 2218 |
| 605 | Ga0265319_1006799 | 3300028563 | Bacteria | 5236 |
| 606 | Ga0265318_10000065 | 3300028577 | Bacteria | 102014 |
| 607 | Ga0265323_10081586 | 3300028653 | Bacteria | 1092 |
| 608 | Ga0265322_10010133 | 3300028654 | Bacteria | 2733 |
| 609 | Ga0265336_10252387 | 3300028666 | Bacteria | 524 |
| 610 | Ga0265338_10036113 | 3300028800 | Bacteria | 4736 |
| 611 | Ga0265338_10136613 | 3300028800 | Unclassified | 1926 |
| 612 | Ga0265330_10025276 | 3300031235 | Bacteria | 2692 |
| 613 | Ga0265332_10009147 | 3300031238 | Bacteria | 4429 |
| 614 | Ga0265328_10011187 | 3300031239 | Bacteria | 3591 |
| 615 | Ga0265331_10006020 | 3300031250 | Bacteria | 7228 |
| 616 | Ga0265327_10025102 | 3300031251 | Bacteria | 3482 |
| 617 | Ga0265316_10031060 | 3300031344 | Bacteria | 4371 |
| 618 | Ga0265313_10021226 | 3300031595 | Bacteria | 3556 |
| 619 | Ga0265314_10046228 | 3300031711 | Bacteria | 3072 |
| 620 | Ga0265342_10068629 | 3300031712 | Bacteria | 2071 |
| 621 | Ga0307405_10118421 | 3300031731 | Bacteria | 1808 |
| 622 | Ga0307413_10220229 | 3300031824 | Bacteria | 1386 |
| 623 | Ga0307413_10414673 | 3300031824 | Bacteria | 1059 |
| 624 | Ga0307413_11209548 | 3300031824 | Bacteria | 657 |
| 625 | Ga0307410_10132608 | 3300031852 | Bacteria | 1832 |
| 626 | Ga0307406_10175890 | 3300031901 | Bacteria | 1554 |
| 627 | Ga0307406_10813168 | 3300031901 | Bacteria | 789 |
| 628 | Ga0307407_10215409 | 3300031903 | Unclassified | 1295 |
| 629 | Ga0307407_11086024 | 3300031903 | Bacteria | 621 |
| 630 | Ga0307407_11692345 | 3300031903 | Unclassified | 503 |
| 631 | Ga0307412_10119845 | 3300031911 | Unclassified | 1893 |
| 632 | Ga0307412_10143558 | 3300031911 | Bacteria | 1752 |
| 633 | Ga0307409_100269750 | 3300031995 | Unclassified | 1566 |
| 634 | Ga0307409_100463850 | 3300031995 | Bacteria | 1225 |
| 635 | Ga0307409_100947841 | 3300031995 | Unclassified | 876 |
| 636 | Ga0307409_101270348 | 3300031995 | Bacteria | 761 |
| 637 | Ga0307416_100049031 | 3300032002 | Bacteria | 3355 |
| 638 | Ga0307416_100270402 | 3300032002 | Bacteria | 1668 |
| 639 | Ga0307416_100815668 | 3300032002 | Unclassified | 1029 |
| 640 | Ga0307416_100966999 | 3300032002 | Unclassified | 954 |
| 641 | Ga0307416_101213816 | 3300032002 | Bacteria | 860 |
| 642 | Ga0307411_10068701 | 3300032005 | Bacteria | 2390 |
| 643 | Ga0307411_10483628 | 3300032005 | Unclassified | 1043 |
| 644 | Ga0307411_11789646 | 3300032005 | Unclassified | 570 |
| 645 | Ga0307415_100103963 | 3300032126 | Unclassified | 2091 |
| 646 | Ga0307415_100877060 | 3300032126 | Bacteria | 825 |
| 647 | Ga0307415_101117798 | 3300032126 | Bacteria | 738 |
| 648 | Ga0373930_0061981 | 3300034816 | Bacteria | 836 |
| 649 | Ga0373948_0005295 | 3300034817 | Bacteria | 2084 |
| 650 | Ga0373958_0019981 | 3300034819 | Bacteria | 1229 |
| 651 | Ga0373938_0017911 | 3300034957 | Bacteria | 1399 |
| 652 | Ga0373926_0431260 | 3300035083 | Bacteria | 522 |
| 653 | Ga0373928_0018650 | 3300035084 | Bacteria | 1441 |
| 654 | Ga0373929_0025624 | 3300035085 | Bacteria | 1226 |
| 655 | Ga0373944_0007137 | 3300035089 | Bacteria | 2987 |
| 656 | Ga0373949_0023958 | 3300035090 | Bacteria | 1417 |
| 657 | Ga0373949_0071850 | 3300035090 | Bacteria | 908 |
| 658 | Ga0373951_0045353 | 3300035091 | Bacteria | 1069 |
| 659 | Ga0373952_0111946 | 3300035092 | Bacteria | 731 |
| 660 | Ga0373932_0011874 | 3300035112 | Bacteria | 2136 |
| 661 | Ga0373932_0078606 | 3300035112 | Bacteria | 1038 |
| 662 | Ga0373936_0216295 | 3300035113 | Bacteria | 849 |
| 663 | Ga0373939_0095791 | 3300035114 | Bacteria | 1011 |
| 664 | Ga0373941_0051062 | 3300035115 | Bacteria | 1315 |
| 665 | Ga0373945_0033863 | 3300035116 | Bacteria | 1818 |
| 666 | Ga0373943_0087925 | 3300035170 | Bacteria | 1605 |
| 667 | Ga0373946_0128271 | 3300035171 | Bacteria | 1165 |
| 668 | Ga0373942_0007229 | 3300035207 | Bacteria | 2573 |
| 669 | Ga0373942_0247623 | 3300035207 | Bacteria | 605 |
| 670 | Ga0373962_0123587 | 3300035242 | Bacteria | 827 |
| 671 | Ga0373931_0094747 | 3300035691 | Bacteria | 1669 |
| 672 | Ga0373931_0163988 | 3300035691 | Unclassified | 1305 |
| 673 | Ga0373931_0816443 | 3300035691 | Unclassified | 623 |
| 674 | Ga0373935_0092002 | 3300035692 | Bacteria | 1987 |
| 675 | Ga0373935_0730662 | 3300035692 | Unclassified | 729 |
| 676 | Ga0373927_1158869 | 3300035695 | Bacteria | 510 |
| 677 | Ga0373947_0029070 | 3300035725 | Bacteria | 3241 |
| 678 | Ga0373925_0336696 | 3300037068 | Bacteria | 1223 |
| 679 | Ga0373925_1258855 | 3300037068 | Bacteria | 607 |
| 680 | Ga0395899_0018013 | 3300037312 | Bacteria | 5374 |
| 681 | Ga0395899_0023665 | 3300037312 | Bacteria | 4649 |
| 682 | Ga0395899_0086761 | 3300037312 | Bacteria | 2272 |
| 683 | Ga0395899_0163532 | 3300037312 | Bacteria | 1571 |
| 684 | Ga0395899_0169361 | 3300037312 | Unclassified | 1539 |
| 685 | Ga0395899_0174841 | 3300037312 | Bacteria | 1510 |
| 686 | Ga0395899_0179085 | 3300037312 | Unclassified | 1489 |
| 687 | Ga0395899_0184519 | 3300037312 | Bacteria | 1463 |
| 688 | Ga0395899_0198778 | 3300037312 | Bacteria | 1399 |
| 689 | Ga0395899_0228071 | 3300037312 | Bacteria | 1287 |
| 690 | Ga0395899_0281144 | 3300037312 | Unclassified | 1132 |
| 691 | Ga0395899_0834062 | 3300037312 | Unclassified | 567 |
| 692 | Ga0395900_0007753 | 3300037418 | Bacteria | 11072 |
| 693 | Ga0395900_0016049 | 3300037418 | Bacteria | 7632 |
| 694 | Ga0395900_0026190 | 3300037418 | Bacteria | 5971 |
| 695 | Ga0395900_0038277 | 3300037418 | Bacteria | 4944 |
| 696 | Ga0395900_0051098 | 3300037418 | Bacteria | 4258 |
| 697 | Ga0395900_0081852 | 3300037418 | Bacteria | 3316 |
| 698 | Ga0395900_0130207 | 3300037418 | Bacteria | 2579 |
| 699 | Ga0395900_0354797 | 3300037418 | Bacteria | 1439 |
| 700 | Ga0395900_0398845 | 3300037418 | Bacteria | 1340 |
| 701 | Ga0395900_0788980 | 3300037418 | Bacteria | 878 |
| 702 | Ga0395900_0976707 | 3300037418 | Unclassified | 767 |
| 703 | Ga0395900_1083271 | 3300037418 | Bacteria | 719 |
| 704 | Ga0395900_1272379 | 3300037418 | Unclassified | 650 |
| 705 | Ga0395900_1403111 | 3300037418 | Unclassified | 611 |
| 706 | Ga0395900_1598580 | 3300037418 | Unclassified | 563 |
| 707 | Ga0395900_1816373 | 3300037418 | Bacteria | 520 |
| 708 | Ga0395898_0005873 | 3300037466 | Bacteria | 13198 |
| 709 | Ga0395898_0013193 | 3300037466 | Bacteria | 8512 |
| 710 | Ga0395898_0014409 | 3300037466 | Bacteria | 8123 |
| 711 | Ga0395898_0027509 | 3300037466 | Bacteria | 5707 |
| 712 | Ga0395898_0029925 | 3300037466 | Bacteria | 5451 |
| 713 | Ga0395898_0038275 | 3300037466 | Bacteria | 4755 |
| 714 | Ga0395898_0055263 | 3300037466 | Bacteria | 3872 |
| 715 | Ga0395898_0077132 | 3300037466 | Unclassified | 3217 |
| 716 | Ga0395898_0094673 | 3300037466 | Bacteria | 2870 |
| 717 | Ga0395898_0112499 | 3300037466 | Bacteria | 2609 |
| 718 | Ga0395898_0123439 | 3300037466 | Bacteria | 2481 |
| 719 | Ga0395898_0144942 | 3300037466 | Bacteria | 2273 |
| 720 | Ga0395898_0180519 | 3300037466 | Bacteria | 2017 |
| 721 | Ga0395898_0183209 | 3300037466 | Bacteria | 2001 |
| 722 | Ga0395898_0242978 | 3300037466 | Bacteria | 1717 |
| 723 | Ga0395898_0352820 | 3300037466 | Bacteria | 1403 |
| 724 | Ga0395898_0427347 | 3300037466 | Bacteria | 1262 |
| 725 | Ga0395898_0454001 | 3300037466 | Bacteria | 1220 |
| 726 | Ga0395898_0896540 | 3300037466 | Bacteria | 825 |
| 727 | Ga0395898_1506585 | 3300037466 | Unclassified | 598 |
| 728 | Ga0395898_1687691 | 3300037466 | Bacteria | 556 |
| 729 | Ga0395898_1781040 | 3300037466 | Unclassified | 537 |
| 730 | Ga0395905_0012489 | 3300037471 | Bacteria | 8176 |
| 731 | Ga0395905_0012729 | 3300037471 | Bacteria | 8091 |
| 732 | Ga0395905_0021502 | 3300037471 | Bacteria | 6100 |
| 733 | Ga0395905_0026153 | 3300037471 | Bacteria | 5504 |
| 734 | Ga0395905_0037024 | 3300037471 | Bacteria | 4583 |
| 735 | Ga0395905_0059001 | 3300037471 | Bacteria | 3588 |
| 736 | Ga0395905_0100698 | 3300037471 | Bacteria | 2713 |
| 737 | Ga0395905_0121434 | 3300037471 | Bacteria | 2456 |
| 738 | Ga0395905_0132177 | 3300037471 | Unclassified | 2347 |
| 739 | Ga0395905_0172951 | 3300037471 | Bacteria | 2028 |
| 740 | Ga0395905_0197402 | 3300037471 | Bacteria | 1887 |
| 741 | Ga0395905_0271712 | 3300037471 | Bacteria | 1581 |
| 742 | Ga0395905_0302035 | 3300037471 | Bacteria | 1488 |
| 743 | Ga0395905_0377862 | 3300037471 | Bacteria | 1310 |
| 744 | Ga0395905_0433911 | 3300037471 | Unclassified | 1211 |
| 745 | Ga0395905_0503641 | 3300037471 | Bacteria | 1111 |
| 746 | Ga0395905_0655534 | 3300037471 | Unclassified | 952 |
| 747 | Ga0395901_0001046 | 3300038443 | Bacteria | 29844 |
| 748 | Ga0395901_0006828 | 3300038443 | Bacteria | 11525 |
| 749 | Ga0395901_0009452 | 3300038443 | Bacteria | 9892 |
| 750 | Ga0395901_0009977 | 3300038443 | Bacteria | 9626 |
| 751 | Ga0395901_0014732 | 3300038443 | Bacteria | 7947 |
| 752 | Ga0395901_0017892 | 3300038443 | Bacteria | 7235 |
| 753 | Ga0395901_0019300 | 3300038443 | Bacteria | 6969 |
| 754 | Ga0395901_0053486 | 3300038443 | Bacteria | 4195 |
| 755 | Ga0395901_0067183 | 3300038443 | Bacteria | 3733 |
| 756 | Ga0395901_0080561 | 3300038443 | Bacteria | 3400 |
| 757 | Ga0395901_0102124 | 3300038443 | Unclassified | 3009 |
| 758 | Ga0395901_0114273 | 3300038443 | Unclassified | 2835 |
| 759 | Ga0395901_0132246 | 3300038443 | Bacteria | 2622 |
| 760 | Ga0395901_0141541 | 3300038443 | Bacteria | 2528 |
| 761 | Ga0395901_0165451 | 3300038443 | Bacteria | 2322 |
| 762 | Ga0395901_0203010 | 3300038443 | Bacteria | 2077 |
| 763 | Ga0395901_0208329 | 3300038443 | Unclassified | 2047 |
| 764 | Ga0395901_0297777 | 3300038443 | Bacteria | 1673 |
| 765 | Ga0395901_0373308 | 3300038443 | Bacteria | 1469 |
| 766 | Ga0395901_0375795 | 3300038443 | Bacteria | 1463 |
| 767 | Ga0395901_0381445 | 3300038443 | Unclassified | 1450 |
| 768 | Ga0395901_0718256 | 3300038443 | Bacteria | 995 |
| 769 | Ga0395901_0834276 | 3300038443 | Bacteria | 908 |
| 770 | Ga0395901_0979916 | 3300038443 | Bacteria | 822 |
| 771 | Ga0395901_1006131 | 3300038443 | Bacteria | 809 |
| 772 | Ga0395901_1029099 | 3300038443 | Unclassified | 798 |
| 773 | Ga0395901_1065660 | 3300038443 | Unclassified | 780 |
| 774 | Ga0395901_1279415 | 3300038443 | Unclassified | 696 |
| 775 | Ga0395901_1305401 | 3300038443 | Unclassified | 687 |
| 776 | Ga0395901_1459757 | 3300038443 | Unclassified | 641 |
| 777 | Ga0242420_072653 | 3300038996 | Bacteria | 701 |
| 778 | Ga0439439_0002455 | 3300041406 | Bacteria | 3944 |
| 779 | Ga0439453_0002601 | 3300041408 | Unclassified | 2509 |
| 780 | Ga0439465_0368561 | 3300041413 | Unclassified | 544 |
| 781 | Ga0451793_1261161 | 3300041452 | Bacteria | 813 |
| 782 | Ga0451793_1655625 | 3300041452 | Bacteria | 620 |
| 783 | Ga0451800_0328401 | 3300041459 | Unclassified | 647 |
| 784 | Ga0451806_268292 | 3300041462 | Bacteria | 543 |
| 785 | Ga0451833_1445090 | 3300041491 | Bacteria | 571 |
| 786 | Ga0451853_1987957 | 3300041512 | Bacteria | 770 |
| 787 | Ga0439431_0031705 | 3300041997 | Unclassified | 1315 |
| 788 | Ga0439445_0107057 | 3300042004 | Bacteria | 796 |
| 789 | Ga0439448_0007575 | 3300042005 | Bacteria | 3151 |
| 790 | Ga0439448_0022356 | 3300042005 | Bacteria | 1965 |
| 791 | Ga0439432_155143 | 3300042006 | Bacteria | 671 |
| 792 | Ga0439450_079647 | 3300042008 | Bacteria | 813 |
| 793 | Ga0439454_003564 | 3300042011 | Bacteria | 1742 |
| 794 | Ga0439455_0098903 | 3300042012 | Unclassified | 805 |
| 795 | Ga0439456_008584 | 3300042013 | Bacteria | 2110 |
| 796 | Ga0439456_157829 | 3300042013 | Unclassified | 530 |
| 797 | Ga0439462_0025310 | 3300042015 | Unclassified | 1562 |
| 798 | Ga0450920_067652 | 3300042122 | Bacteria | 725 |
| 799 | Ga0450923_011367 | 3300042125 | Unclassified | 1599 |
| 800 | Ga0450888_077108 | 3300042126 | Unclassified | 508 |
| 801 | Ga0450906_051791 | 3300042145 | Unclassified | 726 |
| 802 | Ga0439458_0006620 | 3300042157 | Bacteria | 2583 |
| 803 | Ga0439434_0011545 | 3300042435 | Bacteria | 2612 |
| 804 | Ga0439435_0264102 | 3300042436 | Unclassified | 582 |
| 805 | Ga0439464_0328047 | 3300042439 | Unclassified | 503 |
| 806 | Ga0439460_0071307 | 3300042461 | Bacteria | 1077 |
| 807 | Ga0450916_080225 | 3300042530 | Unclassified | 556 |
| 808 | Ga0450918_063523 | 3300042531 | Unclassified | 685 |
| 809 | Ga0439440_0283280 | 3300042993 | Unclassified | 512 |
| 810 | Ga0466964_0885934 | 3300044706 | Unclassified | 510 |
| 811 | Ga0466960_0281816 | 3300044901 | Bacteria | 932 |
| 812 | Ga0451576_0009765 | 3300045051 | Bacteria | 11093 |
| 813 | Ga0451576_0337659 | 3300045051 | Bacteria | 1577 |
| 814 | Ga0451576_1477521 | 3300045051 | Bacteria | 706 |
| 815 | Ga0451576_1833341 | 3300045051 | Unclassified | 627 |
| 816 | Ga0495627_141641 | 3300046453 | Bacteria | 673 |
| 817 | Ga0495592_0174434 | 3300046454 | Unclassified | 1470 |
| 818 | Ga0495603_0002966 | 3300046455 | Bacteria | 10037 |
| 819 | Ga0495603_0003598 | 3300046455 | Bacteria | 9218 |
| 820 | Ga0495590_0046160 | 3300046457 | Bacteria | 1520 |
| 821 | Ga0495641_0007685 | 3300046461 | Bacteria | 6690 |
| 822 | Ga0495641_0036653 | 3300046461 | Unclassified | 2304 |
| 823 | Ga0495641_0040634 | 3300046461 | Bacteria | 2162 |
| 824 | Ga0495653_0119308 | 3300046463 | Unclassified | 1883 |
| 825 | Ga0495580_0073795 | 3300046472 | Unclassified | 2382 |
| 826 | Ga0495582_0011076 | 3300046473 | Unclassified | 4965 |
| 827 | Ga0495582_0015210 | 3300046473 | Bacteria | 4231 |
| 828 | Ga0495582_0256364 | 3300046473 | Unclassified | 1003 |
| 829 | Ga0495605_0036714 | 3300046474 | Bacteria | 2469 |
| 830 | Ga0495605_0134617 | 3300046474 | Bacteria | 1112 |
| 831 | Ga0495605_0364854 | 3300046474 | Unclassified | 604 |
| 832 | Ga0495639_0018001 | 3300046475 | Unclassified | 3072 |
| 833 | Ga0495662_0354580 | 3300046476 | Unclassified | 721 |
| 834 | Ga0495584_0023997 | 3300046491 | Bacteria | 3091 |
| 835 | Ga0495584_0113552 | 3300046491 | Unclassified | 1371 |
| 836 | Ga0495584_0134096 | 3300046491 | Bacteria | 1257 |
| 837 | Ga0495584_0512677 | 3300046491 | Unclassified | 611 |
| 838 | Ga0495585_0141700 | 3300046492 | Bacteria | 1259 |
| 839 | Ga0495585_0172909 | 3300046492 | Bacteria | 1115 |
| 840 | Ga0495594_0849549 | 3300046499 | Unclassified | 514 |
| 841 | Ga0495596_0120773 | 3300046500 | Bacteria | 1017 |
| 842 | Ga0495596_0241270 | 3300046500 | Unclassified | 702 |
| 843 | Ga0495596_0364903 | 3300046500 | Unclassified | 562 |
| 844 | Ga0495607_0168035 | 3300046501 | Bacteria | 1110 |
| 845 | Ga0495607_0326193 | 3300046501 | Bacteria | 715 |
| 846 | Ga0495608_0062402 | 3300046511 | Unclassified | 2449 |
| 847 | Ga0495616_0081375 | 3300046513 | Bacteria | 1549 |
| 848 | Ga0495616_0375456 | 3300046513 | Unclassified | 588 |
| 849 | Ga0495618_0032900 | 3300046514 | Bacteria | 3250 |
| 850 | Ga0495628_0134946 | 3300046516 | Bacteria | 1887 |
| 851 | Ga0495630_0004397 | 3300046517 | Bacteria | 9900 |
| 852 | Ga0495630_0337865 | 3300046517 | Bacteria | 1152 |
| 853 | Ga0495631_0061677 | 3300046518 | Bacteria | 1626 |
| 854 | Ga0495632_0317374 | 3300046519 | Bacteria | 689 |
| 855 | Ga0495632_0348201 | 3300046519 | Unclassified | 652 |
| 856 | Ga0495637_0180525 | 3300046520 | Unclassified | 783 |
| 857 | Ga0495637_0235932 | 3300046520 | Unclassified | 662 |
| 858 | Ga0495644_0161999 | 3300046523 | Unclassified | 858 |
| 859 | Ga0495663_0004194 | 3300046525 | Bacteria | 4069 |
| 860 | Ga0495663_0009545 | 3300046525 | Bacteria | 2692 |
| 861 | Ga0495666_0029227 | 3300046526 | Bacteria | 2712 |
| 862 | Ga0495666_0249255 | 3300046526 | Unclassified | 809 |
| 863 | Ga0495642_0107707 | 3300046528 | Bacteria | 1190 |
| 864 | Ga0495642_0260465 | 3300046528 | Bacteria | 758 |
| 865 | Ga0495642_0443551 | 3300046528 | Unclassified | 573 |
| 866 | Ga0495652_0763495 | 3300046529 | Bacteria | 646 |
| 867 | Ga0495640_0648090 | 3300046533 | Bacteria | 636 |
| 868 | Ga0495609_0060422 | 3300046538 | Bacteria | 1676 |
| 869 | Ga0495597_0026708 | 3300046542 | Bacteria | 2652 |
| 870 | Ga0495597_0242205 | 3300046542 | Unclassified | 711 |
| 871 | Ga0495667_0062908 | 3300046559 | Bacteria | 2431 |
| 872 | Ga0495667_0603594 | 3300046559 | Bacteria | 684 |
| 873 | Ga0495656_0024658 | 3300046615 | Bacteria | 2378 |
| 874 | Ga0495656_0123207 | 3300046615 | Bacteria | 1226 |
| 875 | Ga0495656_0434548 | 3300046615 | Bacteria | 690 |
| 876 | Ga0495668_0406275 | 3300046616 | Bacteria | 748 |
| 877 | Ga0495611_0175476 | 3300046648 | Bacteria | 1001 |
| 878 | Ga0495611_0190375 | 3300046648 | Bacteria | 958 |
| 879 | Ga0495611_0382734 | 3300046648 | Bacteria | 644 |
| 880 | Ga0495611_0434746 | 3300046648 | Unclassified | 599 |
| 881 | Ga0495625_0189904 | 3300046660 | Bacteria | 1362 |
| 882 | Ga0495635_0115988 | 3300046663 | Unclassified | 1828 |
| 883 | Ga0495659_0029848 | 3300046664 | Bacteria | 1895 |
| 884 | Ga0495659_0183157 | 3300046664 | Unclassified | 853 |
| 885 | Ga0495659_0203228 | 3300046664 | Bacteria | 813 |
| 886 | Ga0495661_0303604 | 3300046665 | Bacteria | 798 |
| 887 | Ga0495588_0080418 | 3300046674 | Unclassified | 1701 |
| 888 | Ga0495588_0258254 | 3300046674 | Bacteria | 918 |
| 889 | Ga0495588_0380401 | 3300046674 | Unclassified | 741 |
| 890 | Ga0495647_0018840 | 3300046681 | Unclassified | 2463 |
| 891 | Ga0495647_0026351 | 3300046681 | Bacteria | 2129 |
| 892 | Ga0495647_0065333 | 3300046681 | Unclassified | 1444 |
| 893 | Ga0495658_0128633 | 3300046683 | Bacteria | 1539 |
| 894 | Ga0495658_0143880 | 3300046683 | Unclassified | 1460 |
| 895 | Ga0495669_0299380 | 3300046684 | Unclassified | 775 |
| 896 | Ga0495613_0491679 | 3300046689 | Unclassified | 827 |
| 897 | Ga0495624_0503229 | 3300046690 | Bacteria | 725 |
| 898 | Ga0495671_0130128 | 3300046692 | Bacteria | 1227 |
| 899 | Ga0495589_0068642 | 3300046794 | Unclassified | 1734 |
| 900 | Ga0495589_0404216 | 3300046794 | Bacteria | 627 |
| 901 | Ga0495600_0442749 | 3300046809 | Bacteria | 804 |
| 902 | Ga0495660_0250744 | 3300046810 | Bacteria | 821 |
| 903 | Ga0495581_0037141 | 3300047315 | Unclassified | 2818 |
| 904 | Ga0495581_0507341 | 3300047315 | Bacteria | 701 |
| 905 | Ga0495636_0092770 | 3300047318 | Bacteria | 1312 |
| 906 | Ga0495674_0064608 | 3300047319 | Bacteria | 3181 |
| 907 | Ga0495676_0026438 | 3300047321 | Unclassified | 4996 |
| 908 | Ga0495676_0041249 | 3300047321 | Bacteria | 3801 |
| 909 | Ga0495676_0100718 | 3300047321 | Bacteria | 2138 |
| 910 | Ga0495676_0496048 | 3300047321 | Unclassified | 802 |
| 911 | Ga0495680_0033835 | 3300047322 | Bacteria | 4135 |
| 912 | Ga0495683_0435214 | 3300047323 | Unclassified | 540 |
| 913 | Ga0495677_0010865 | 3300047445 | Bacteria | 3337 |
| 914 | Ga0495679_131201 | 3300047446 | Bacteria | 680 |
| 915 | Ga0495673_0213698 | 3300047469 | Bacteria | 717 |
| 916 | Ga0495684_0123265 | 3300047471 | Unclassified | 1951 |
| 917 | Ga0495686_0220338 | 3300047472 | Bacteria | 1080 |
| 918 | Ga0495593_0387330 | 3300047673 | Unclassified | 699 |
| 919 | Ga0495614_0303995 | 3300048089 | Unclassified | 737 |
| 920 | Ga0495615_0011240 | 3300048090 | Bacteria | 1814 |
| 921 | Ga0495626_0080529 | 3300048091 | Unclassified | 1448 |
| 922 | Ga0496100_0024288 | 3300048903 | Bacteria | 3696 |
| 923 | Ga0496100_0024956 | 3300048903 | Bacteria | 3651 |
| 924 | Ga0496100_0128491 | 3300048903 | Bacteria | 1782 |
| 925 | Ga0496100_0376444 | 3300048903 | Unclassified | 1077 |
| 926 | Ga0496100_0486409 | 3300048903 | Bacteria | 949 |
| 927 | Ga0496100_0708842 | 3300048903 | Bacteria | 786 |
| 928 | Ga0496100_0866764 | 3300048903 | Bacteria | 709 |
| 929 | Ga0496100_1313132 | 3300048903 | Unclassified | 571 |
| 930 | Ga0496101_0062188 | 3300048904 | Bacteria | 2714 |
| 931 | Ga0496101_0225567 | 3300048904 | Bacteria | 1455 |
| 932 | Ga0496101_0498975 | 3300048904 | Unclassified | 961 |
| 933 | Ga0496101_0524111 | 3300048904 | Bacteria | 936 |
| 934 | Ga0496101_0525522 | 3300048904 | Bacteria | 935 |
| 935 | Ga0496101_0647866 | 3300048904 | Bacteria | 835 |
| 936 | Ga0496102_0042774 | 3300048905 | Bacteria | 4106 |
| 937 | Ga0496102_0076498 | 3300048905 | Unclassified | 3079 |
| 938 | Ga0496102_0082950 | 3300048905 | Bacteria | 2957 |
| 939 | Ga0496102_0086649 | 3300048905 | Bacteria | 2893 |
| 940 | Ga0496102_0141504 | 3300048905 | Bacteria | 2256 |
| 941 | Ga0496102_0247764 | 3300048905 | Bacteria | 1680 |
| 942 | Ga0496102_0337485 | 3300048905 | Unclassified | 1419 |
| 943 | Ga0496102_1601459 | 3300048905 | Unclassified | 569 |
| 944 | Ga0496102_1786854 | 3300048905 | Unclassified | 532 |
| 945 | Ga0496103_0006330 | 3300048906 | Bacteria | 7076 |
| 946 | Ga0496103_0021226 | 3300048906 | Bacteria | 3906 |
| 947 | Ga0496103_0053940 | 3300048906 | Bacteria | 2492 |
| 948 | Ga0496103_0088025 | 3300048906 | Bacteria | 1958 |
| 949 | Ga0496103_0285623 | 3300048906 | Bacteria | 1061 |
| 950 | Ga0496103_0467737 | 3300048906 | Bacteria | 808 |
| 951 | Ga0496104_0001575 | 3300048907 | Bacteria | 19621 |
| 952 | Ga0496104_0016981 | 3300048907 | Bacteria | 6621 |
| 953 | Ga0496104_0036749 | 3300048907 | Unclassified | 4579 |
| 954 | Ga0496104_0153269 | 3300048907 | Bacteria | 2212 |
| 955 | Ga0496104_0210598 | 3300048907 | Unclassified | 1855 |
| 956 | Ga0496104_0304685 | 3300048907 | Bacteria | 1505 |
| 957 | Ga0496104_0374677 | 3300048907 | Bacteria | 1336 |
| 958 | Ga0496104_0717057 | 3300048907 | Bacteria | 908 |
| 959 | Ga0496105_0001189 | 3300048908 | Bacteria | 18104 |
| 960 | Ga0496105_0019839 | 3300048908 | Bacteria | 5424 |
| 961 | Ga0496105_0061564 | 3300048908 | Bacteria | 3097 |
| 962 | Ga0496105_0088618 | 3300048908 | Unclassified | 2556 |
| 963 | Ga0496105_0124571 | 3300048908 | Bacteria | 2124 |
| 964 | Ga0496105_0196718 | 3300048908 | Bacteria | 1647 |
| 965 | Ga0496105_0212152 | 3300048908 | Bacteria | 1578 |
| 966 | Ga0496105_0698853 | 3300048908 | Unclassified | 779 |
| 967 | Ga0496106_0021406 | 3300048909 | Bacteria | 4802 |
| 968 | Ga0496106_0131448 | 3300048909 | Bacteria | 1963 |
| 969 | Ga0496106_0243451 | 3300048909 | Bacteria | 1437 |
| 970 | Ga0496106_0300531 | 3300048909 | Unclassified | 1287 |
| 971 | Ga0496106_0403824 | 3300048909 | Bacteria | 1098 |
| 972 | Ga0496106_0601076 | 3300048909 | Bacteria | 881 |
| 973 | Ga0496106_1171899 | 3300048909 | Bacteria | 600 |
| 974 | Ga0496106_1491255 | 3300048909 | Unclassified | 520 |
| 975 | Ga0496107_0038969 | 3300048910 | Bacteria | 3409 |
| 976 | Ga0496107_0047060 | 3300048910 | Bacteria | 3105 |
| 977 | Ga0496107_0296158 | 3300048910 | Unclassified | 1204 |
| 978 | Ga0496107_0321651 | 3300048910 | Bacteria | 1151 |
| 979 | Ga0496107_0779076 | 3300048910 | Bacteria | 701 |
| 980 | Ga0496108_0006577 | 3300048911 | Bacteria | 9429 |
| 981 | Ga0496108_0010896 | 3300048911 | Bacteria | 7380 |
| 982 | Ga0496108_0017968 | 3300048911 | Bacteria | 5786 |
| 983 | Ga0496108_0058251 | 3300048911 | Bacteria | 3246 |
| 984 | Ga0496108_0100123 | 3300048911 | Bacteria | 2471 |
| 985 | Ga0496108_0196617 | 3300048911 | Bacteria | 1749 |
| 986 | Ga0496108_0232996 | 3300048911 | Bacteria | 1601 |
| 987 | Ga0496108_0772668 | 3300048911 | Bacteria | 830 |
| 988 | Ga0496109_0000579 | 3300048912 | Bacteria | 30650 |
| 989 | Ga0496109_0001424 | 3300048912 | Bacteria | 19854 |
| 990 | Ga0496109_0006229 | 3300048912 | Bacteria | 10032 |
| 991 | Ga0496109_0007519 | 3300048912 | Bacteria | 9229 |
| 992 | Ga0496109_0027467 | 3300048912 | Bacteria | 5081 |
| 993 | Ga0496109_0089825 | 3300048912 | Bacteria | 2841 |
| 994 | Ga0496109_0094520 | 3300048912 | Bacteria | 2767 |
| 995 | Ga0496109_0256920 | 3300048912 | Bacteria | 1645 |
| 996 | Ga0496109_0648452 | 3300048912 | Bacteria | 993 |
| 997 | Ga0496109_0782176 | 3300048912 | Unclassified | 892 |
| 998 | Ga0496110_0000833 | 3300048913 | Bacteria | 21672 |
| 999 | Ga0496110_0005683 | 3300048913 | Bacteria | 9793 |
| 1000 | Ga0496110_0032078 | 3300048913 | Bacteria | 4534 |
| 1001 | Ga0496110_0097468 | 3300048913 | Bacteria | 2635 |
| 1002 | Ga0496110_0144389 | 3300048913 | Bacteria | 2152 |
| 1003 | Ga0496110_0254674 | 3300048913 | Bacteria | 1598 |
| 1004 | Ga0496110_0273486 | 3300048913 | Bacteria | 1538 |
| 1005 | Ga0496110_0369828 | 3300048913 | Unclassified | 1306 |
| 1006 | Ga0496111_0000437 | 3300048914 | Bacteria | 21122 |
| 1007 | Ga0496111_0000740 | 3300048914 | Bacteria | 17415 |
| 1008 | Ga0496111_0002075 | 3300048914 | Bacteria | 11944 |
| 1009 | Ga0496111_0038962 | 3300048914 | Bacteria | 3406 |
| 1010 | Ga0496111_0042006 | 3300048914 | Bacteria | 3282 |
| 1011 | Ga0496111_0100683 | 3300048914 | Bacteria | 2122 |
| 1012 | Ga0496111_0122264 | 3300048914 | Bacteria | 1923 |
| 1013 | Ga0496111_0697712 | 3300048914 | Unclassified | 738 |
| 1014 | Ga0496111_0895239 | 3300048914 | Bacteria | 639 |
| 1015 | Ga0496112_0001299 | 3300048915 | Bacteria | 18983 |
| 1016 | Ga0496112_0014630 | 3300048915 | Bacteria | 7291 |
| 1017 | Ga0496112_0016908 | 3300048915 | Bacteria | 6844 |
| 1018 | Ga0496112_0017658 | 3300048915 | Bacteria | 6711 |
| 1019 | Ga0496112_0216075 | 3300048915 | Bacteria | 1874 |
| 1020 | Ga0496112_0218618 | 3300048915 | Bacteria | 1861 |
| 1021 | Ga0496112_0235377 | 3300048915 | Bacteria | 1785 |
| 1022 | Ga0496112_0336809 | 3300048915 | Bacteria | 1452 |
| 1023 | Ga0496112_0388530 | 3300048915 | Bacteria | 1336 |
| 1024 | Ga0496113_0000174 | 3300048916 | Bacteria | 28582 |
| 1025 | Ga0496113_0001819 | 3300048916 | Bacteria | 12122 |
| 1026 | Ga0496113_0002956 | 3300048916 | Bacteria | 10046 |
| 1027 | Ga0496113_0235046 | 3300048916 | Unclassified | 1462 |
| 1028 | Ga0496113_0519317 | 3300048916 | Unclassified | 956 |
| 1029 | Ga0496114_0049413 | 3300048917 | Bacteria | 3500 |
| 1030 | Ga0496114_0130641 | 3300048917 | Bacteria | 2168 |
| 1031 | Ga0496114_0184547 | 3300048917 | Bacteria | 1823 |
| 1032 | Ga0496114_0185723 | 3300048917 | Bacteria | 1817 |
| 1033 | Ga0496114_0329753 | 3300048917 | Bacteria | 1349 |
| 1034 | Ga0496114_0343694 | 3300048917 | Bacteria | 1319 |
| 1035 | Ga0496114_1084193 | 3300048917 | Bacteria | 685 |
| 1036 | Ga0496115_0008914 | 3300048918 | Bacteria | 7438 |
| 1037 | Ga0496115_0010212 | 3300048918 | Bacteria | 7005 |
| 1038 | Ga0496115_0038890 | 3300048918 | Bacteria | 3777 |
| 1039 | Ga0496115_0221021 | 3300048918 | Bacteria | 1563 |
| 1040 | Ga0496115_0339679 | 3300048918 | Bacteria | 1226 |
| 1041 | Ga0496115_0410954 | 3300048918 | Unclassified | 1097 |
| 1042 | Ga0496115_1282391 | 3300048918 | Unclassified | 546 |
| 1043 | Ga0496126_1149422 | 3300048929 | Bacteria | 574 |
| 1044 | Ga0501031_0002166 | 3300049568 | Bacteria | 12396 |
| 1045 | Ga0501031_1075160 | 3300049568 | Bacteria | 513 |
| 1046 | Ga0501032_0002389 | 3300049569 | Bacteria | 14647 |
| 1047 | Ga0501032_0104595 | 3300049569 | Bacteria | 1875 |
| 1048 | Ga0501033_0000267 | 3300049570 | Bacteria | 50176 |
| 1049 | Ga0501033_0001810 | 3300049570 | Bacteria | 18675 |
| 1050 | Ga0501033_0705538 | 3300049570 | Bacteria | 686 |
| 1051 | Ga0501033_0966026 | 3300049570 | Bacteria | 570 |
| 1052 | Ga0501034_0029144 | 3300049571 | Bacteria | 5612 |
| 1053 | Ga0501036_0000053 | 3300049572 | Bacteria | 74418 |
| 1054 | Ga0501036_0033938 | 3300049572 | Unclassified | 4316 |
| 1055 | Ga0501036_0088587 | 3300049572 | Bacteria | 2615 |
| 1056 | Ga0501037_0000410 | 3300049573 | Bacteria | 35757 |
| 1057 | Ga0501037_0006760 | 3300049573 | Bacteria | 8387 |
| 1058 | Ga0501038_0020916 | 3300049574 | Bacteria | 5880 |
| 1059 | Ga0501038_0070900 | 3300049574 | Bacteria | 2957 |
| 1060 | Ga0501038_0104826 | 3300049574 | Bacteria | 2349 |
| 1061 | Ga0501038_0299855 | 3300049574 | Unclassified | 1261 |
| 1062 | Ga0501039_0000102 | 3300049575 | Bacteria | 59043 |
| 1063 | Ga0501039_0012368 | 3300049575 | Bacteria | 6513 |
| 1064 | Ga0501039_0212677 | 3300049575 | Bacteria | 1520 |
| 1065 | Ga0501039_0459982 | 3300049575 | Bacteria | 999 |
| 1066 | Ga0501040_0000927 | 3300049576 | Bacteria | 18428 |
| 1067 | Ga0501040_0001135 | 3300049576 | Bacteria | 16892 |
| 1068 | Ga0501040_0084304 | 3300049576 | Unclassified | 2204 |
| 1069 | Ga0501040_0092937 | 3300049576 | Bacteria | 2098 |
| 1070 | Ga0501040_0244844 | 3300049576 | Unclassified | 1278 |
| 1071 | Ga0501041_0000009 | 3300049577 | Bacteria | 62594 |
| 1072 | Ga0501041_0052571 | 3300049577 | Bacteria | 2483 |
| 1073 | Ga0501041_0075091 | 3300049577 | Bacteria | 2078 |
| 1074 | Ga0501042_0000190 | 3300049578 | Bacteria | 28780 |
| 1075 | Ga0501042_0054088 | 3300049578 | Unclassified | 2863 |
| 1076 | Ga0501042_0054647 | 3300049578 | Bacteria | 2848 |
| 1077 | Ga0501042_0063292 | 3300049578 | Bacteria | 2643 |
| 1078 | Ga0501042_0477170 | 3300049578 | Bacteria | 905 |
| 1079 | Ga0501042_1114530 | 3300049578 | Bacteria | 575 |
| 1080 | Ga0501043_0000252 | 3300049579 | Bacteria | 48597 |
| 1081 | Ga0501043_0003871 | 3300049579 | Bacteria | 12297 |
| 1082 | Ga0501043_0009705 | 3300049579 | Bacteria | 7542 |
| 1083 | Ga0501046_0000332 | 3300049580 | Bacteria | 47567 |
| 1084 | Ga0501046_0002907 | 3300049580 | Bacteria | 15880 |
| 1085 | Ga0501046_0060712 | 3300049580 | Bacteria | 2957 |
| 1086 | Ga0501046_0600335 | 3300049580 | Unclassified | 781 |
| 1087 | Ga0501047_0000215 | 3300049581 | Bacteria | 69314 |
| 1088 | Ga0501047_0028489 | 3300049581 | Bacteria | 5385 |
| 1089 | Ga0501047_0924983 | 3300049581 | Bacteria | 685 |
| 1090 | Ga0501048_0001833 | 3300049582 | Bacteria | 16124 |
| 1091 | Ga0501048_0002707 | 3300049582 | Bacteria | 13520 |
| 1092 | Ga0501048_0008032 | 3300049582 | Bacteria | 7992 |
| 1093 | Ga0501068_0000054 | 3300049584 | Bacteria | 45281 |
| 1094 | Ga0501068_0002625 | 3300049584 | Bacteria | 9515 |
| 1095 | Ga0501068_0123482 | 3300049584 | Bacteria | 1616 |
| 1096 | Ga0501068_0193889 | 3300049584 | Bacteria | 1287 |
| 1097 | Ga0501069_0002812 | 3300049585 | Bacteria | 8902 |
| 1098 | Ga0501069_0003794 | 3300049585 | Bacteria | 7774 |
| 1099 | Ga0501069_0017249 | 3300049585 | Bacteria | 3884 |
| 1100 | Ga0501069_0065181 | 3300049585 | Bacteria | 2036 |
| 1101 | Ga0501069_0904711 | 3300049585 | Unclassified | 537 |
| 1102 | Ga0501070_0015918 | 3300049586 | Bacteria | 6322 |
| 1103 | Ga0501070_0019034 | 3300049586 | Bacteria | 5758 |
| 1104 | Ga0501070_0032341 | 3300049586 | Unclassified | 4377 |
| 1105 | Ga0501070_0138423 | 3300049586 | Bacteria | 2010 |
| 1106 | Ga0501070_0573746 | 3300049586 | Bacteria | 901 |
| 1107 | Ga0501070_1524088 | 3300049586 | Unclassified | 505 |
| 1108 | Ga0501071_0000572 | 3300049587 | Bacteria | 19051 |
| 1109 | Ga0501071_0006495 | 3300049587 | Bacteria | 7588 |
| 1110 | Ga0501071_0064192 | 3300049587 | Bacteria | 2664 |
| 1111 | Ga0501071_0108526 | 3300049587 | Bacteria | 2050 |
| 1112 | Ga0501071_0140888 | 3300049587 | Bacteria | 1795 |
| 1113 | Ga0501071_0849129 | 3300049587 | Unclassified | 704 |
| 1114 | Ga0501072_0000075 | 3300049588 | Bacteria | 72364 |
| 1115 | Ga0501072_0083608 | 3300049588 | Unclassified | 2530 |
| 1116 | Ga0501072_0150613 | 3300049588 | Bacteria | 1855 |
| 1117 | Ga0501072_0462896 | 3300049588 | Bacteria | 1004 |
| 1118 | Ga0501072_0606721 | 3300049588 | Bacteria | 863 |
| 1119 | Ga0501073_0000389 | 3300049589 | Bacteria | 29761 |
| 1120 | Ga0501073_0009024 | 3300049589 | Bacteria | 7361 |
| 1121 | Ga0501073_0053122 | 3300049589 | Bacteria | 2836 |
| 1122 | Ga0501074_0001003 | 3300049590 | Bacteria | 18327 |
| 1123 | Ga0501074_0171442 | 3300049590 | Bacteria | 1549 |
| 1124 | Ga0501074_0404957 | 3300049590 | Unclassified | 967 |
| 1125 | Ga0501074_0617259 | 3300049590 | Bacteria | 766 |
| 1126 | Ga0501074_0858377 | 3300049590 | Unclassified | 639 |
| 1127 | Ga0501075_0000131 | 3300049591 | Bacteria | 37171 |
| 1128 | Ga0501075_0008820 | 3300049591 | Bacteria | 7029 |
| 1129 | Ga0501075_0049574 | 3300049591 | Bacteria | 3156 |
| 1130 | Ga0501075_0065458 | 3300049591 | Bacteria | 2742 |
| 1131 | Ga0501075_0736259 | 3300049591 | Bacteria | 751 |
| 1132 | Ga0501075_1094020 | 3300049591 | Bacteria | 605 |
| 1133 | Ga0501075_1205284 | 3300049591 | Unclassified | 574 |
| 1134 | Ga0501076_0000041 | 3300049592 | Bacteria | 62992 |
| 1135 | Ga0501076_0058594 | 3300049592 | Bacteria | 3061 |
| 1136 | Ga0501076_0196979 | 3300049592 | Bacteria | 1644 |
| 1137 | Ga0501076_0311353 | 3300049592 | Bacteria | 1291 |
| 1138 | Ga0501076_0389017 | 3300049592 | Bacteria | 1146 |
| 1139 | Ga0501076_0883886 | 3300049592 | Bacteria | 737 |
| 1140 | Ga0501076_0986687 | 3300049592 | Bacteria | 694 |
| 1141 | Ga0501077_0001079 | 3300049593 | Bacteria | 16457 |
| 1142 | Ga0501077_0008249 | 3300049593 | Bacteria | 6444 |
| 1143 | Ga0501077_0039556 | 3300049593 | Bacteria | 3004 |
| 1144 | Ga0501077_0060329 | 3300049593 | Bacteria | 2407 |
| 1145 | Ga0501077_0428259 | 3300049593 | Unclassified | 847 |
| 1146 | Ga0501217_095847 | 3300049661 | Bacteria | 838 |
| 1147 | Ga0501079_0000155 | 3300049741 | Bacteria | 37452 |
| 1148 | Ga0501079_0009327 | 3300049741 | Bacteria | 7436 |
| 1149 | Ga0501079_0034569 | 3300049741 | Unclassified | 3889 |
| 1150 | Ga0501079_0044428 | 3300049741 | Bacteria | 3429 |
| 1151 | Ga0501079_0153944 | 3300049741 | Bacteria | 1792 |
| 1152 | Ga0501079_0167888 | 3300049741 | Bacteria | 1711 |
| 1153 | Ga0501079_0601852 | 3300049741 | Unclassified | 865 |
| 1154 | Ga0501079_1135531 | 3300049741 | Unclassified | 616 |
| 1155 | Ga0501080_0003115 | 3300049742 | Bacteria | 14635 |
| 1156 | Ga0501080_0058509 | 3300049742 | Bacteria | 3587 |
| 1157 | Ga0501080_0108916 | 3300049742 | Bacteria | 2567 |
| 1158 | Ga0501080_0564828 | 3300049742 | Unclassified | 1012 |
| 1159 | Ga0501080_1031087 | 3300049742 | Bacteria | 712 |
| 1160 | Ga0501081_0000581 | 3300049743 | Bacteria | 20779 |
| 1161 | Ga0501081_0001472 | 3300049743 | Bacteria | 14434 |
| 1162 | Ga0501081_0057481 | 3300049743 | Bacteria | 2689 |
| 1163 | Ga0501081_0206810 | 3300049743 | Unclassified | 1424 |
| 1164 | Ga0501081_0310704 | 3300049743 | Bacteria | 1157 |
| 1165 | Ga0501081_0939640 | 3300049743 | Unclassified | 652 |
| 1166 | Ga0501083_0001895 | 3300049744 | Bacteria | 14358 |
| 1167 | Ga0501083_0011774 | 3300049744 | Bacteria | 6131 |
| 1168 | Ga0501083_0163269 | 3300049744 | Bacteria | 1457 |
| 1169 | Ga0501083_0192927 | 3300049744 | Bacteria | 1329 |
| 1170 | Ga0501035_0012470 | 3300049822 | Bacteria | 7854 |
| 1171 | Ga0501035_0018106 | 3300049822 | Bacteria | 6491 |
| 1172 | Ga0501035_0045915 | 3300049822 | Bacteria | 3929 |
| 1173 | Ga0501035_1274606 | 3300049822 | Bacteria | 567 |
| 1174 | Ga0501044_0028270 | 3300049823 | Bacteria | 5918 |
| 1175 | Ga0501044_0047735 | 3300049823 | Bacteria | 4428 |
| 1176 | Ga0501044_0061906 | 3300049823 | Bacteria | 3828 |
| 1177 | Ga0501044_1173240 | 3300049823 | Bacteria | 636 |
| 1178 | Ga0501045_0001153 | 3300049824 | Bacteria | 17499 |
| 1179 | Ga0501045_0039760 | 3300049824 | Bacteria | 3422 |
| 1180 | Ga0501045_0065995 | 3300049824 | Bacteria | 2657 |
| 1181 | Ga0501045_0083511 | 3300049824 | Bacteria | 2356 |
| 1182 | Ga0501045_0115172 | 3300049824 | Bacteria | 1994 |
| 1183 | nmdc:mga00v17_38829_c1 | 3300050491 | Bacteria | 2849 |
| 1184 | nmdc:mga0yw44_206435_c1 | 3300050492 | Archaea | 1299 |
| 1185 | nmdc:mga0yw44_233740_c1 | 3300050492 | Bacteria | 1220 |
| 1186 | nmdc:mga0yw44_67431_c1 | 3300050492 | Bacteria | 2212 |
| 1187 | nmdc:mga06z11_347762_c1 | 3300050494 | Bacteria | 887 |
| 1188 | nmdc:mga06z11_558839_c1 | 3300050494 | Unclassified | 695 |
| 1189 | nmdc:mga05p37_1075048_c1 | 3300050507 | Bacteria | 846 |
| 1190 | nmdc:mga05p37_1088718_c1 | 3300050507 | Unclassified | 838 |
| 1191 | nmdc:mga05p37_122277_c1 | 3300050507 | Bacteria | 3197 |
| 1192 | nmdc:mga05p37_135289_c1 | 3300050507 | Bacteria | 3023 |
| 1193 | nmdc:mga05p37_26954_c1 | 3300050507 | Bacteria | 6992 |
| 1194 | nmdc:mga05p37_35861_c1 | 3300050507 | Bacteria | 6084 |
| 1195 | nmdc:mga05p37_3682_c1 | 3300050507 | Bacteria | 17924 |
| 1196 | nmdc:mga05p37_599389_c1 | 3300050507 | Bacteria | 1244 |
| 1197 | nmdc:mga05p37_670198_c1 | 3300050507 | Bacteria | 1158 |
| 1198 | nmdc:mga09592_12388_c1 | 3300050508 | Bacteria | 6946 |
| 1199 | nmdc:mga09592_23387_c1 | 3300050508 | Bacteria | 5105 |
| 1200 | nmdc:mga09592_308675_c1 | 3300050508 | Bacteria | 1371 |
| 1201 | nmdc:mga09592_327734_c1 | 3300050508 | Bacteria | 1326 |
| 1202 | nmdc:mga0qj67_15425_c1 | 3300050509 | Bacteria | 5785 |
| 1203 | nmdc:mga0qj67_234873_c1 | 3300050509 | Bacteria | 1488 |
| 1204 | nmdc:mga0qj67_466312_c1 | 3300050509 | Unclassified | 1017 |
| 1205 | nmdc:mga0qj67_58700_c1 | 3300050509 | Bacteria | 3051 |
| 1206 | nmdc:mga0qj67_679273_c1 | 3300050509 | Bacteria | 820 |
| 1207 | nmdc:mga06r32_137462_c1 | 3300050510 | Bacteria | 2418 |
| 1208 | nmdc:mga06r32_1621663_c1 | 3300050510 | Unclassified | 585 |
| 1209 | nmdc:mga06r32_241566_c1 | 3300050510 | Bacteria | 1794 |
| 1210 | nmdc:mga06r32_451434_c1 | 3300050510 | Bacteria | 1265 |
| 1211 | nmdc:mga08y16_13401_c1 | 3300050511 | Bacteria | 8624 |
| 1212 | nmdc:mga08y16_14654_c1 | 3300050511 | Bacteria | 8244 |
| 1213 | nmdc:mga08y16_192065_c1 | 3300050511 | Bacteria | 2118 |
| 1214 | nmdc:mga08y16_553042_c1 | 3300050511 | Bacteria | 1165 |
| 1215 | nmdc:mga08y16_832306_c1 | 3300050511 | Bacteria | 913 |
| 1216 | nmdc:mga0n895_106661_c1 | 3300050512 | Unclassified | 2814 |
| 1217 | nmdc:mga0n895_128501_c1 | 3300050512 | Bacteria | 2559 |
| 1218 | nmdc:mga0n895_1699189_c1 | 3300050512 | Bacteria | 594 |
| 1219 | nmdc:mga0n895_190985_c1 | 3300050512 | Bacteria | 2079 |
| 1220 | nmdc:mga0n895_260278_c1 | 3300050512 | Bacteria | 1761 |
| 1221 | nmdc:mga0n895_38763_c1 | 3300050512 | Bacteria | 4618 |
| 1222 | nmdc:mga0n895_509066_c1 | 3300050512 | Bacteria | 1212 |
| 1223 | nmdc:mga0rr50_1439089_c1 | 3300050513 | Bacteria | 583 |
| 1224 | nmdc:mga0rr50_17516_c1 | 3300050513 | Bacteria | 4786 |
| 1225 | nmdc:mga0rr50_183198_c1 | 3300050513 | Bacteria | 1713 |
| 1226 | nmdc:mga0rr50_262279_c1 | 3300050513 | Bacteria | 1438 |
| 1227 | nmdc:mga0rr50_399031_c1 | 3300050513 | Unclassified | 1161 |
| 1228 | nmdc:mga0rr50_591177_c1 | 3300050513 | Bacteria | 946 |
| 1229 | nmdc:mga0rr50_943525_c1 | 3300050513 | Unclassified | 735 |
| 1230 | nmdc:mga08x19_103404_c1 | 3300050514 | Bacteria | 1892 |
| 1231 | nmdc:mga08x19_53907_c1 | 3300050514 | Bacteria | 2588 |
| 1232 | nmdc:mga08x19_56080_c1 | 3300050514 | Bacteria | 2542 |
| 1233 | nmdc:mga0a205_1026217_c1 | 3300050515 | Bacteria | 672 |
| 1234 | nmdc:mga0a205_119313_c1 | 3300050515 | Bacteria | 2537 |
| 1235 | nmdc:mga0a205_122116_c1 | 3300050515 | Bacteria | 2505 |
| 1236 | nmdc:mga0a205_221032_c1 | 3300050515 | Bacteria | 1779 |
| 1237 | nmdc:mga0a205_635759_c1 | 3300050515 | Bacteria | 919 |
| 1238 | nmdc:mga0a205_998614_c1 | 3300050515 | Bacteria | 684 |
| 1239 | Ga0495655_0054689 | 3300053083 | Bacteria | 1069 |
| 1240 | Ga0495655_0113048 | 3300053083 | Bacteria | 818 |
| 1241 | Ga0495595_0361838 | 3300053084 | Bacteria | 733 |
| 1242 | Ga0495619_0067893 | 3300053085 | Bacteria | 2381 |
| 1243 | Ga0501084_0006129 | 3300054114 | Bacteria | 9883 |
| 1244 | Ga0501084_0011056 | 3300054114 | Bacteria | 7473 |
| 1245 | Ga0501084_0087428 | 3300054114 | Bacteria | 2617 |
| 1246 | Ga0501084_0242422 | 3300054114 | Bacteria | 1521 |
| 1247 | Ga0501084_1607071 | 3300054114 | Bacteria | 543 |
| 1248 | Ga0501084_1802690 | 3300054114 | Bacteria | 511 |
| 1249 | Ga0587076_106182 | 3300059645 | Bacteria | 633 |
| 1250 | Ga0501082_0000480 | 3300060353 | Bacteria | 35259 |
| 1251 | Ga0501082_0009255 | 3300060353 | Bacteria | 8490 |
| 1252 | Ga0501082_0088343 | 3300060353 | Bacteria | 2674 |
| 1253 | Ga0501082_0205481 | 3300060353 | Unclassified | 1713 |
| 1254 | Ga0501082_0341674 | 3300060353 | Bacteria | 1305 |
| 1255 | Ga0530510_0000230 | 3300061734 | Bacteria | 34995 |
| 1256 | Ga0530510_0005655 | 3300061734 | Bacteria | 8664 |
| 1257 | Ga0530510_0075674 | 3300061734 | Bacteria | 2445 |
| 1258 | Ga0530510_0215470 | 3300061734 | Bacteria | 1427 |
| 1259 | Ga0530510_0245528 | 3300061734 | Unclassified | 1333 |
| 1260 | Ga0070694_101259025 | |||
| 1261 | JGI24747J21853_1005505 | |||
| 1262 | JGI24742J22300_10035200 | |||
| 1263 | rootH1_10180613 | |||
| 1264 | JGI25407J50210_10104694 | |||
| 1265 | JGI25404J52841_10116289 | |||
| 1266 | Ga0070676_10178831 | |||
| 1267 | Ga0070676_10393816 | |||
| 1268 | Ga0070676_10921128 | |||
| 1269 | Ga0070683_100215821 | |||
| 1270 | Ga0070683_101158499 | |||
| 1271 | Ga0070690_100098768 | |||
| 1272 | Ga0070690_100532047 | |||
| 1273 | Ga0070670_100640206 | |||
| 1274 | Ga0068869_101233409 | |||
| 1275 | Ga0070666_10456690 | |||
| 1276 | Ga0070680_100054919 | |||
| 1277 | Ga0070680_100061421 | |||
| 1278 | Ga0070680_100073044 | |||
| 1279 | Ga0070680_100122015 | |||
| 1280 | Ga0070680_100283460 | |||
| 1281 | Ga0070680_100299486 | |||
| 1282 | Ga0070680_100800568 | |||
| 1283 | Ga0070682_100010187 | |||
| 1284 | Ga0070682_100016617 | |||
| 1285 | Ga0070682_100025720 | |||
| 1286 | Ga0070682_100139914 | |||
| 1287 | Ga0070682_101717468 | |||
| 1288 | Ga0070682_102006562 | |||
| 1289 | Ga0068868_100181754 | |||
| 1290 | Ga0068868_100199916 | |||
| 1291 | Ga0068868_100727468 | |||
| 1292 | Ga0070660_100004242 | |||
| 1293 | Ga0070660_100399872 | |||
| 1294 | Ga0070660_100492403 | |||
| 1295 | Ga0070689_100050989 | |||
| 1296 | Ga0070689_100473441 | |||
| 1297 | Ga0070691_10041828 | |||
| 1298 | Ga0070691_10328053 | |||
| 1299 | Ga0070691_10346416 | |||
| 1300 | Ga0070687_100164235 | |||
| 1301 | Ga0070687_100218697 | |||
| 1302 | Ga0070692_10018114 | |||
| 1303 | Ga0070692_10027130 | |||
| 1304 | Ga0070692_10264906 | |||
| 1305 | Ga0070668_100028197 | |||
| 1306 | Ga0070668_100043709 | |||
| 1307 | Ga0070668_100809151 | |||
| 1308 | Ga0070669_100599557 | |||
| 1309 | Ga0070675_100199637 | |||
| 1310 | Ga0070671_100044605 | |||
| 1311 | Ga0070671_100202461 | |||
| 1312 | Ga0070674_100029154 | |||
| 1313 | Ga0070674_101597854 | |||
| 1314 | Ga0070673_100513618 | |||
| 1315 | Ga0070673_101629932 | |||
| 1316 | Ga0070688_100748218 | |||
| 1317 | Ga0070659_100051807 | |||
| 1318 | Ga0070659_100054809 | |||
| 1319 | Ga0070659_100076202 | |||
| 1320 | Ga0070667_101102988 | |||
| 1321 | Ga0070703_10094506 | |||
| 1322 | Ga0070709_10003184 | |||
| 1323 | Ga0070709_10005180 | |||
| 1324 | Ga0070709_10105187 | |||
| 1325 | Ga0070709_10494934 | |||
| 1326 | Ga0070709_10646933 | |||
| 1327 | Ga0070714_100069345 | |||
| 1328 | Ga0070714_100146920 | |||
| 1329 | Ga0070714_100756442 | |||
| 1330 | Ga0070714_102295716 | |||
| 1331 | Ga0070713_100020617 | |||
| 1332 | Ga0070713_100028644 | |||
| 1333 | Ga0070713_100033831 | |||
| 1334 | Ga0070713_101275822 | |||
| 1335 | Ga0070713_101430404 | |||
| 1336 | Ga0070710_10008830 | |||
| 1337 | Ga0070710_10009792 | |||
| 1338 | Ga0070710_10105706 | |||
| 1339 | Ga0070710_10157061 | |||
| 1340 | Ga0070710_10539948 | |||
| 1341 | Ga0070701_10005031 | |||
| 1342 | Ga0070701_10072129 | |||
| 1343 | Ga0070711_100040241 | |||
| 1344 | Ga0070711_100317250 | |||
| 1345 | Ga0070711_100501895 | |||
| 1346 | Ga0070711_101045766 | |||
| 1347 | Ga0070711_101833081 | |||
| 1348 | Ga0070711_101872423 | |||
| 1349 | Ga0070705_100021079 | |||
| 1350 | Ga0070705_100085009 | |||
| 1351 | Ga0070705_100272875 | |||
| 1352 | Ga0070705_100822646 | |||
| 1353 | Ga0070705_100924399 | |||
| 1354 | Ga0070705_101016456 | |||
| 1355 | Ga0070700_100005511 | |||
| 1356 | Ga0070700_100085339 | |||
| 1357 | Ga0070700_100098297 | |||
| 1358 | Ga0070700_100348146 | |||
| 1359 | Ga0070700_100470213 | |||
| 1360 | Ga0070700_101251011 | |||
| 1361 | Ga0070694_100053589 | |||
| 1362 | Ga0070694_100694611 | |||
| 1363 | Ga0070694_100815549 | |||
| 1364 | Ga0070708_100030742 | |||
| 1365 | Ga0070708_100056504 | |||
| 1366 | Ga0070708_100405402 | |||
| 1367 | Ga0070708_100550825 | |||
| 1368 | Ga0070708_100611550 | |||
| 1369 | Ga0070708_100740001 | |||
| 1370 | Ga0070708_101803594 | |||
| 1371 | Ga0070663_100159948 | |||
| 1372 | Ga0070678_100052207 | |||
| 1373 | Ga0070678_100056955 | |||
| 1374 | Ga0070678_100077657 | |||
| 1375 | Ga0070678_100124972 | |||
| 1376 | Ga0070678_101165375 | |||
| 1377 | Ga0070662_100099246 | |||
| 1378 | Ga0070662_100407090 | |||
| 1379 | Ga0070681_10021802 | |||
| 1380 | Ga0070681_10183392 | |||
| 1381 | Ga0070681_10292751 | |||
| 1382 | Ga0068867_100000419 | |||
| 1383 | Ga0068867_100049346 | |||
| 1384 | Ga0068867_100136134 | |||
| 1385 | Ga0068867_100381674 | |||
| 1386 | Ga0068867_100859855 | |||
| 1387 | Ga0070685_10289436 | |||
| 1388 | Ga0070706_100007268 | |||
| 1389 | Ga0070706_100032743 | |||
| 1390 | Ga0070706_100081840 | |||
| 1391 | Ga0070707_100000635 | |||
| 1392 | Ga0070707_100365915 | |||
| 1393 | Ga0070707_100650586 | |||
| 1394 | Ga0070707_102282240 | |||
| 1395 | Ga0070698_100027034 | |||
| 1396 | Ga0070698_100049053 | |||
| 1397 | Ga0070698_100100305 | |||
| 1398 | Ga0070698_100790151 | |||
| 1399 | Ga0070699_100018354 | |||
| 1400 | Ga0070699_100027752 | |||
| 1401 | Ga0070699_100124045 | |||
| 1402 | Ga0070679_100029502 | |||
| 1403 | Ga0070679_100162724 | |||
| 1404 | Ga0070679_100664535 | |||
| 1405 | Ga0070679_100698637 | |||
| 1406 | Ga0070684_100181636 | |||
| 1407 | Ga0070684_100351475 | |||
| 1408 | Ga0070684_101550298 | |||
| 1409 | Ga0070697_100132791 | |||
| 1410 | Ga0070697_101512982 | |||
| 1411 | Ga0070697_101934461 | |||
| 1412 | Ga0068853_100399154 | |||
| 1413 | Ga0070672_100139115 | |||
| 1414 | Ga0070686_100026947 | |||
| 1415 | Ga0070686_100040663 | |||
| 1416 | Ga0070686_100047337 | |||
| 1417 | Ga0070686_100428539 | |||
| 1418 | Ga0070695_100027640 | |||
| 1419 | Ga0070695_100036995 | |||
| 1420 | Ga0070695_100081782 | |||
| 1421 | Ga0070695_101742512 | |||
| 1422 | Ga0070696_100038424 | |||
| 1423 | Ga0070696_100114527 | |||
| 1424 | Ga0070693_100059408 | |||
| 1425 | Ga0070693_100120499 | |||
| 1426 | Ga0070693_100146495 | |||
| 1427 | Ga0070693_100377379 | |||
| 1428 | Ga0070693_100432369 | |||
| 1429 | Ga0070693_101457298 | |||
| 1430 | Ga0070665_100875971 | |||
| 1431 | Ga0070704_100074208 | |||
| 1432 | Ga0070704_100081912 | |||
| 1433 | Ga0070704_100148504 | |||
| 1434 | Ga0070704_100242203 | |||
| 1435 | Ga0070704_100993488 | |||
| 1436 | Ga0070704_101039668 | |||
| 1437 | Ga0070704_101256338 | |||
| 1438 | Ga0068855_100263595 | |||
| 1439 | Ga0068855_100492064 | |||
| 1440 | Ga0070664_101317734 | |||
| 1441 | Ga0068857_100961502 | |||
| 1442 | Ga0068854_100060846 | |||
| 1443 | Ga0068854_100166684 | |||
| 1444 | Ga0068854_100464466 | |||
| 1445 | Ga0068856_100006365 | |||
| 1446 | Ga0068856_100006515 | |||
| 1447 | Ga0068856_100076025 | |||
| 1448 | Ga0068856_100330568 | |||
| 1449 | Ga0068856_100388280 | |||
| 1450 | Ga0068856_100428476 | |||
| 1451 | Ga0068856_100484970 | |||
| 1452 | Ga0068856_101200171 | |||
| 1453 | Ga0070702_100174880 | |||
| 1454 | Ga0070702_101398782 | |||
| 1455 | Ga0068852_100056374 | |||
| 1456 | Ga0068852_100130492 | |||
| 1457 | Ga0068852_100744861 | |||
| 1458 | Ga0068859_100036891 | |||
| 1459 | Ga0068859_100643929 | |||
| 1460 | Ga0068864_100241998 | |||
| 1461 | Ga0068864_100685267 | |||
| 1462 | Ga0068866_10019844 | |||
| 1463 | Ga0068866_10067588 | |||
| 1464 | Ga0068866_10093506 | |||
| 1465 | Ga0068866_10747958 | |||
| 1466 | Ga0068861_100003224 | |||
| 1467 | Ga0068861_100059153 | |||
| 1468 | Ga0068861_100191244 | |||
| 1469 | Ga0068861_101317531 | |||
| 1470 | Ga0068870_10071630 | |||
| 1471 | Ga0068870_10164357 | |||
| 1472 | Ga0068858_102402166 | |||
| 1473 | Ga0068860_100199642 | |||
| 1474 | Ga0068862_100072629 | |||
| 1475 | Ga0068862_100655970 | |||
| 1476 | Ga0068862_101381619 | |||
| 1477 | Ga0081455_10004258 | |||
| 1478 | Ga0081455_10007410 | |||
| 1479 | Ga0081455_10044778 | |||
| 1480 | Ga0081455_10051923 | |||
| 1481 | Ga0081455_10109458 | |||
| 1482 | Ga0081455_10346776 | |||
| 1483 | Ga0081538_10000057 | |||
| 1484 | Ga0081538_10134405 | |||
| 1485 | Ga0081538_10363983 | |||
| 1486 | Ga0081540_1001396 | |||
| 1487 | Ga0081540_1013265 | |||
| 1488 | Ga0081539_10006172 | |||
| 1489 | Ga0070717_10028303 | |||
| 1490 | Ga0070717_10038509 | |||
| 1491 | Ga0070717_10243433 | |||
| 1492 | Ga0070717_10261456 | |||
| 1493 | Ga0075365_10004328 | |||
| 1494 | Ga0075365_10080609 | |||
| 1495 | Ga0075365_10281403 | |||
| 1496 | Ga0075364_10002546 | |||
| 1497 | Ga0075432_10010355 | |||
| 1498 | Ga0075432_10133154 | |||
| 1499 | Ga0075432_10147093 | |||
| 1500 | Ga0070715_10025658 | |||
| 1501 | Ga0070715_10038738 | |||
| 1502 | Ga0070715_10427113 | |||
| 1503 | Ga0070715_10769232 | |||
| 1504 | Ga0070716_100011446 | |||
| 1505 | Ga0070716_100781302 | |||
| 1506 | Ga0070716_100893864 | |||
| 1507 | Ga0070716_101764083 | |||
| 1508 | Ga0070712_100006479 | |||
| 1509 | Ga0070712_100064183 | |||
| 1510 | Ga0070712_100252447 | |||
| 1511 | Ga0070712_100261037 | |||
| 1512 | Ga0070712_101824495 | |||
| 1513 | Ga0075362_10097005 | |||
| 1514 | Ga0075367_10384170 | |||
| 1515 | Ga0075367_10724726 | |||
| 1516 | Ga0075367_10982684 | |||
| 1517 | Ga0075427_10021432 | |||
| 1518 | Ga0097621_100039745 | |||
| 1519 | Ga0097621_100098235 | |||
| 1520 | Ga0097621_101617802 | |||
| 1521 | Ga0068871_100018185 | |||
| 1522 | Ga0068871_100090324 | |||
| 1523 | Ga0068871_101772237 | |||
| 1524 | Ga0075428_100077768 | |||
| 1525 | Ga0075428_100442972 | |||
| 1526 | Ga0075428_100460568 | |||
| 1527 | Ga0075428_100495393 | |||
| 1528 | Ga0075430_100035031 | |||
| 1529 | Ga0075430_100058219 | |||
| 1530 | Ga0075430_100062847 | |||
| 1531 | Ga0075430_100213617 | |||
| 1532 | Ga0075430_100808076 | |||
| 1533 | Ga0075431_100131200 | |||
| 1534 | Ga0075431_100189150 | |||
| 1535 | Ga0075431_100285290 | |||
| 1536 | Ga0075431_100317342 | |||
| 1537 | Ga0075431_100519204 | |||
| 1538 | Ga0075431_100868312 | |||
| 1539 | Ga0075433_10038382 | |||
| 1540 | Ga0075433_10054797 | |||
| 1541 | Ga0075433_10137893 | |||
| 1542 | Ga0075433_10365672 | |||
| 1543 | Ga0075434_100017725 | |||
| 1544 | Ga0075434_100041379 | |||
| 1545 | Ga0075434_100284326 | |||
| 1546 | Ga0075434_100320132 | |||
| 1547 | Ga0075434_100721668 | |||
| 1548 | Ga0075434_101850712 | |||
| 1549 | Ga0075434_102332602 | |||
| 1550 | Ga0075429_100095945 | |||
| 1551 | Ga0075429_100262899 | |||
| 1552 | Ga0075429_100423703 | |||
| 1553 | Ga0068865_100029339 | |||
| 1554 | Ga0068865_100106024 | |||
| 1555 | Ga0068865_100225569 | |||
| 1556 | Ga0068865_100490181 | |||
| 1557 | Ga0075436_100001566 | |||
| 1558 | Ga0075436_100026414 | |||
| 1559 | Ga0075436_100059442 | |||
| 1560 | Ga0097620_100036890 | |||
| 1561 | Ga0097620_100643917 | |||
| 1562 | Ga0075435_100007426 | |||
| 1563 | Ga0075435_100070424 | |||
| 1564 | Ga0075435_100384065 | |||
| 1565 | Ga0075435_100812835 | |||
| 1566 | Ga0105240_11805153 | |||
| 1567 | Ga0111539_10088071 | |||
| 1568 | Ga0111539_10232752 | |||
| 1569 | Ga0111539_10470705 | |||
| 1570 | Ga0111539_10951128 | |||
| 1571 | Ga0111539_10951985 | |||
| 1572 | Ga0111539_11730428 | |||
| 1573 | Ga0105245_10014177 | |||
| 1574 | Ga0105245_10024631 | |||
| 1575 | Ga0105245_10037006 | |||
| 1576 | Ga0105245_10045847 | |||
| 1577 | Ga0105245_10078695 | |||
| 1578 | Ga0105245_10118738 | |||
| 1579 | Ga0105245_10901157 | |||
| 1580 | Ga0105245_11819536 | |||
| 1581 | Ga0105245_12169368 | |||
| 1582 | Ga0105245_12250188 | |||
| 1583 | Ga0105247_10097098 | |||
| 1584 | Ga0114129_10001278 | |||
| 1585 | Ga0114129_10168995 | |||
| 1586 | Ga0114129_10256832 | |||
| 1587 | Ga0114129_10320296 | |||
| 1588 | Ga0114129_10520765 | |||
| 1589 | Ga0114129_10543515 | |||
| 1590 | Ga0114129_10932760 | |||
| 1591 | Ga0114129_11104098 | |||
| 1592 | Ga0114129_11271890 | |||
| 1593 | Ga0114129_11471938 | |||
| 1594 | Ga0114129_12555992 | |||
| 1595 | Ga0114129_12877371 | |||
| 1596 | Ga0114129_13335835 | |||
| 1597 | Ga0105243_10034552 | |||
| 1598 | Ga0105243_10247183 | |||
| 1599 | Ga0105243_10489794 | |||
| 1600 | Ga0105243_11373770 | |||
| 1601 | Ga0105241_10034117 | |||
| 1602 | Ga0105241_10052450 | |||
| 1603 | Ga0105241_10096894 | |||
| 1604 | Ga0105242_10271065 | |||
| 1605 | Ga0105242_10474990 | |||
| 1606 | Ga0105242_10597664 | |||
| 1607 | Ga0105242_11132223 | |||
| 1608 | Ga0105242_11279325 | |||
| 1609 | Ga0105242_11634610 | |||
| 1610 | Ga0105248_10023775 | |||
| 1611 | Ga0105248_10127716 | |||
| 1612 | Ga0105248_11509767 | |||
| 1613 | Ga0105248_11604440 | |||
| 1614 | Ga0105237_10098689 | |||
| 1615 | Ga0105238_11144179 | |||
| 1616 | Ga0105249_10017488 | |||
| 1617 | Ga0105249_10235733 | |||
| 1618 | Ga0105249_10915231 | |||
| 1619 | Ga0105239_10038225 | |||
| 1620 | Ga0105239_10288655 | |||
| 1621 | Ga0105239_11111631 | |||
| 1622 | Ga0105239_11351357 | |||
| 1623 | Ga0105239_11501648 | |||
| 1624 | Ga0105246_10162536 | |||
| 1625 | Ga0105246_10396601 | |||
| 1626 | Ga0157320_1000974 | |||
| 1627 | Ga0157337_1007770 | |||
| 1628 | Ga0157337_1033296 | |||
| 1629 | Ga0157323_1001732 | |||
| 1630 | Ga0157347_1005231 | |||
| 1631 | Ga0157339_1035087 | |||
| 1632 | Ga0157338_1010725 | |||
| 1633 | Ga0157338_1029510 | |||
| 1634 | Ga0157371_10132892 | |||
| 1635 | Ga0157369_10332260 | |||
| 1636 | Ga0157374_10007016 | |||
| 1637 | Ga0157374_10152576 | |||
| 1638 | Ga0157374_10365706 | |||
| 1639 | Ga0157374_11147706 | |||
| 1640 | Ga0157378_10022053 | |||
| 1641 | Ga0157378_10232155 | |||
| 1642 | Ga0163162_10011880 | |||
| 1643 | Ga0163162_10070969 | |||
| 1644 | Ga0163162_10481248 | |||
| 1645 | Ga0163162_10654046 | |||
| 1646 | Ga0163162_11847514 | |||
| 1647 | Ga0157372_10449848 | |||
| 1648 | Ga0157372_10751467 | |||
| 1649 | Ga0157372_10829027 | |||
| 1650 | Ga0157372_12236989 | |||
| 1651 | Ga0157375_10060218 | |||
| 1652 | Ga0157375_10161185 | |||
| 1653 | Ga0157375_10243505 | |||
| 1654 | Ga0157375_11116291 | |||
| 1655 | Ga0163163_11489691 | |||
| 1656 | Ga0157380_10072838 | |||
| 1657 | Ga0157380_10535411 | |||
| 1658 | Ga0157380_10964766 | |||
| 1659 | Ga0182008_10245520 | |||
| 1660 | Ga0182008_10409150 | |||
| 1661 | Ga0157379_10382744 | |||
| 1662 | Ga0157379_10594784 | |||
| 1663 | Ga0157376_10004722 | |||
| 1664 | Ga0157376_10139219 | |||
| 1665 | Ga0157376_12998806 | |||
| 1666 | Ga0163161_10015833 | |||
| 1667 | Ga0163161_10416433 | |||
| 1668 | Ga0163161_10602845 | |||
| 1669 | Ga0163161_10692529 | |||
| 1670 | Ga0163161_10702811 | |||
| 1671 | Ga0206354_10018681 | |||
| 1672 | Ga0206353_11690045 | |||
| 1673 | Ga0207653_10133543 | |||
| 1674 | Ga0207682_10076102 | |||
| 1675 | Ga0207692_10138339 | |||
| 1676 | Ga0207692_10138891 | |||
| 1677 | Ga0207692_10148628 | |||
| 1678 | Ga0207692_10376611 | |||
| 1679 | Ga0207642_10024149 | |||
| 1680 | Ga0207642_10065797 | |||
| 1681 | Ga0207688_10401513 | |||
| 1682 | Ga0207680_10109369 | |||
| 1683 | Ga0207680_10117685 | |||
| 1684 | Ga0207680_10487928 | |||
| 1685 | Ga0207647_10205383 | |||
| 1686 | Ga0207685_10001983 | |||
| 1687 | Ga0207685_10020044 | |||
| 1688 | Ga0207685_10028077 | |||
| 1689 | Ga0207685_10301274 | |||
| 1690 | Ga0207699_10017934 | |||
| 1691 | Ga0207699_10022637 | |||
| 1692 | Ga0207699_10046321 | |||
| 1693 | Ga0207699_10255830 | |||
| 1694 | Ga0207699_10569005 | |||
| 1695 | Ga0207645_10171439 | |||
| 1696 | Ga0207645_10260305 | |||
| 1697 | Ga0207645_10737285 | |||
| 1698 | Ga0207643_10012009 | |||
| 1699 | Ga0207684_10007664 | |||
| 1700 | Ga0207684_10049764 | |||
| 1701 | Ga0207684_10154703 | |||
| 1702 | Ga0207684_10449911 | |||
| 1703 | Ga0207684_11299070 | |||
| 1704 | Ga0207654_10078509 | |||
| 1705 | Ga0207654_10624486 | |||
| 1706 | Ga0207707_10007237 | |||
| 1707 | Ga0207707_10226288 | |||
| 1708 | Ga0207707_10346580 | |||
| 1709 | Ga0207707_11233812 | |||
| 1710 | Ga0207671_10502481 | |||
| 1711 | Ga0207693_10001049 | |||
| 1712 | Ga0207693_10006129 | |||
| 1713 | Ga0207693_10010088 | |||
| 1714 | Ga0207693_10010248 | |||
| 1715 | Ga0207693_10317184 | |||
| 1716 | Ga0207663_10011392 | |||
| 1717 | Ga0207663_10014333 | |||
| 1718 | Ga0207663_10032888 | |||
| 1719 | Ga0207663_10110539 | |||
| 1720 | Ga0207663_10261398 | |||
| 1721 | Ga0207663_10426303 | |||
| 1722 | Ga0207663_11125080 | |||
| 1723 | Ga0207660_10004447 | |||
| 1724 | Ga0207660_10069490 | |||
| 1725 | Ga0207660_10101399 | |||
| 1726 | Ga0207660_10177857 | |||
| 1727 | Ga0207660_10279025 | |||
| 1728 | Ga0207660_10690344 | |||
| 1729 | Ga0207662_10041931 | |||
| 1730 | Ga0207662_10107670 | |||
| 1731 | Ga0207662_10254570 | |||
| 1732 | Ga0207662_10366821 | |||
| 1733 | Ga0207657_10005734 | |||
| 1734 | Ga0207657_10007354 | |||
| 1735 | Ga0207657_10593914 | |||
| 1736 | Ga0207652_10021094 | |||
| 1737 | Ga0207652_10344090 | |||
| 1738 | Ga0207646_10002084 | |||
| 1739 | Ga0207646_10156495 | |||
| 1740 | Ga0207681_10698949 | |||
| 1741 | Ga0207694_10259556 | |||
| 1742 | Ga0207650_11435689 | |||
| 1743 | Ga0207659_10172148 | |||
| 1744 | Ga0207687_10048740 | |||
| 1745 | Ga0207687_10067438 | |||
| 1746 | Ga0207687_10123738 | |||
| 1747 | Ga0207687_10175435 | |||
| 1748 | Ga0207687_10317743 | |||
| 1749 | Ga0207687_11126567 | |||
| 1750 | Ga0207700_10000006 | |||
| 1751 | Ga0207700_10135974 | |||
| 1752 | Ga0207700_10952161 | |||
| 1753 | Ga0207700_11089613 | |||
| 1754 | Ga0207664_10003007 | |||
| 1755 | Ga0207664_10008495 | |||
| 1756 | Ga0207664_10011573 | |||
| 1757 | Ga0207664_10052601 | |||
| 1758 | Ga0207664_10097100 | |||
| 1759 | Ga0207664_10385603 | |||
| 1760 | Ga0207644_10169762 | |||
| 1761 | Ga0207644_10175297 | |||
| 1762 | Ga0207690_10068853 | |||
| 1763 | Ga0207690_10528057 | |||
| 1764 | Ga0207706_10006862 | |||
| 1765 | Ga0207706_10046832 | |||
| 1766 | Ga0207706_10233501 | |||
| 1767 | Ga0207706_10424709 | |||
| 1768 | Ga0207706_10593089 | |||
| 1769 | Ga0207686_10197174 | |||
| 1770 | Ga0207686_10297075 | |||
| 1771 | Ga0207686_10517177 | |||
| 1772 | Ga0207709_10095679 | |||
| 1773 | Ga0207709_10208411 | |||
| 1774 | Ga0207709_10214511 | |||
| 1775 | Ga0207709_10276765 | |||
| 1776 | Ga0207709_10920036 | |||
| 1777 | Ga0207670_10915569 | |||
| 1778 | Ga0207669_10155966 | |||
| 1779 | Ga0207669_11241776 | |||
| 1780 | Ga0207704_10058620 | |||
| 1781 | Ga0207704_10068318 | |||
| 1782 | Ga0207704_10349726 | |||
| 1783 | Ga0207704_10555281 | |||
| 1784 | Ga0207665_10001319 | |||
| 1785 | Ga0207665_10004558 | |||
| 1786 | Ga0207665_10785538 | |||
| 1787 | Ga0207691_10007187 | |||
| 1788 | Ga0207711_10033326 | |||
| 1789 | Ga0207689_10159169 | |||
| 1790 | Ga0207661_10093965 | |||
| 1791 | Ga0207661_10415617 | |||
| 1792 | Ga0207679_10533966 | |||
| 1793 | Ga0207667_10123250 | |||
| 1794 | Ga0207667_10383219 | |||
| 1795 | Ga0207651_10720965 | |||
| 1796 | Ga0207651_10908768 | |||
| 1797 | Ga0207712_10010303 | |||
| 1798 | Ga0207712_10180703 | |||
| 1799 | Ga0207712_10238451 | |||
| 1800 | Ga0207712_10994046 | |||
| 1801 | Ga0207668_10019546 | |||
| 1802 | Ga0207668_10208709 | |||
| 1803 | Ga0207668_11097117 | |||
| 1804 | Ga0207668_12062531 | |||
| 1805 | Ga0207640_10077780 | |||
| 1806 | Ga0207640_10291733 | |||
| 1807 | Ga0207640_10705741 | |||
| 1808 | Ga0207640_10794114 | |||
| 1809 | Ga0207640_11594200 | |||
| 1810 | Ga0207677_10010513 | |||
| 1811 | Ga0207677_10218403 | |||
| 1812 | Ga0207677_10632221 | |||
| 1813 | Ga0207677_11057909 | |||
| 1814 | Ga0207677_11309469 | |||
| 1815 | Ga0207703_11403090 | |||
| 1816 | Ga0207639_10598912 | |||
| 1817 | Ga0207639_10609404 | |||
| 1818 | Ga0207678_10010343 | |||
| 1819 | Ga0207678_10380641 | |||
| 1820 | Ga0207708_10001288 | |||
| 1821 | Ga0207708_10016596 | |||
| 1822 | Ga0207708_10227071 | |||
| 1823 | Ga0207708_10375693 | |||
| 1824 | Ga0207708_10672640 | |||
| 1825 | Ga0207702_10063011 | |||
| 1826 | Ga0207702_10112394 | |||
| 1827 | Ga0207702_10169528 | |||
| 1828 | Ga0207702_10277292 | |||
| 1829 | Ga0207702_10373267 | |||
| 1830 | Ga0207702_10539916 | |||
| 1831 | Ga0207702_11029919 | |||
| 1832 | Ga0207702_11591346 | |||
| 1833 | Ga0207641_10719864 | |||
| 1834 | Ga0207641_10809207 | |||
| 1835 | Ga0207648_10000136 | |||
| 1836 | Ga0207648_10016194 | |||
| 1837 | Ga0207648_10143046 | |||
| 1838 | Ga0207648_10207500 | |||
| 1839 | Ga0207648_10331612 | |||
| 1840 | Ga0207648_10557310 | |||
| 1841 | Ga0207676_10300650 | |||
| 1842 | Ga0207674_10048768 | |||
| 1843 | Ga0207674_10920009 | |||
| 1844 | Ga0207675_100002156 | |||
| 1845 | Ga0207675_100047295 | |||
| 1846 | Ga0207675_100120263 | |||
| 1847 | Ga0207675_100158197 | |||
| 1848 | Ga0207675_100214209 | |||
| 1849 | Ga0207675_100464184 | |||
| 1850 | Ga0207683_10000371 | |||
| 1851 | Ga0207683_10023388 | |||
| 1852 | Ga0207683_10078987 | |||
| 1853 | Ga0207683_10404279 | |||
| 1854 | Ga0207683_11235838 | |||
| 1855 | Ga0207698_10328579 | |||
| 1856 | Ga0207698_10381454 | |||
| 1857 | Ga0207698_10424204 | |||
| 1858 | Ga0207428_10012539 | |||
| 1859 | Ga0207428_10270327 | |||
| 1860 | Ga0207428_10900634 | |||
| 1861 | Ga0268265_10109262 | |||
| 1862 | Ga0268265_10384120 | |||
| 1863 | Ga0268264_10131625 | |||
| 1864 | Ga0265319_1006799 | |||
| 1865 | Ga0265318_10000065 | |||
| 1866 | Ga0265323_10081586 | |||
| 1867 | Ga0265322_10010133 | |||
| 1868 | Ga0265336_10252387 | |||
| 1869 | Ga0265338_10036113 | |||
| 1870 | Ga0265338_10136613 | |||
| 1871 | Ga0265330_10025276 | |||
| 1872 | Ga0265332_10009147 | |||
| 1873 | Ga0265328_10011187 | |||
| 1874 | Ga0265331_10006020 | |||
| 1875 | Ga0265327_10025102 | |||
| 1876 | Ga0265316_10031060 | |||
| 1877 | Ga0265313_10021226 | |||
| 1878 | Ga0265314_10046228 | |||
| 1879 | Ga0265342_10068629 | |||
| 1880 | Ga0307405_10118421 | |||
| 1881 | Ga0307413_10220229 | |||
| 1882 | Ga0307413_10414673 | |||
| 1883 | Ga0307413_11209548 | |||
| 1884 | Ga0307410_10132608 | |||
| 1885 | Ga0307406_10175890 | |||
| 1886 | Ga0307406_10813168 | |||
| 1887 | Ga0307407_10215409 | |||
| 1888 | Ga0307407_11086024 | |||
| 1889 | Ga0307407_11692345 | |||
| 1890 | Ga0307412_10119845 | |||
| 1891 | Ga0307412_10143558 | |||
| 1892 | Ga0307409_100269750 | |||
| 1893 | Ga0307409_100463850 | |||
| 1894 | Ga0307409_100947841 | |||
| 1895 | Ga0307409_101270348 | |||
| 1896 | Ga0307416_100049031 | |||
| 1897 | Ga0307416_100270402 | |||
| 1898 | Ga0307416_100815668 | |||
| 1899 | Ga0307416_100966999 | |||
| 1900 | Ga0307416_101213816 | |||
| 1901 | Ga0307411_10068701 | |||
| 1902 | Ga0307411_10483628 | |||
| 1903 | Ga0307411_11789646 | |||
| 1904 | Ga0307415_100103963 | |||
| 1905 | Ga0307415_100877060 | |||
| 1906 | Ga0307415_101117798 | |||
| 1907 | Ga0373930_0061981 | |||
| 1908 | Ga0373948_0005295 | |||
| 1909 | Ga0373958_0019981 | |||
| 1910 | Ga0373938_0017911 | |||
| 1911 | Ga0373926_0431260 | |||
| 1912 | Ga0373928_0018650 | |||
| 1913 | Ga0373929_0025624 | |||
| 1914 | Ga0373944_0007137 | |||
| 1915 | Ga0373949_0023958 | |||
| 1916 | Ga0373949_0071850 | |||
| 1917 | Ga0373951_0045353 | |||
| 1918 | Ga0373952_0111946 | |||
| 1919 | Ga0373932_0011874 | |||
| 1920 | Ga0373932_0078606 | |||
| 1921 | Ga0373936_0216295 | |||
| 1922 | Ga0373939_0095791 | |||
| 1923 | Ga0373941_0051062 | |||
| 1924 | Ga0373945_0033863 | |||
| 1925 | Ga0373943_0087925 | |||
| 1926 | Ga0373946_0128271 | |||
| 1927 | Ga0373942_0007229 | |||
| 1928 | Ga0373942_0247623 | |||
| 1929 | Ga0373962_0123587 | |||
| 1930 | Ga0373931_0094747 | |||
| 1931 | Ga0373931_0163988 | |||
| 1932 | Ga0373931_0816443 | |||
| 1933 | Ga0373935_0092002 | |||
| 1934 | Ga0373935_0730662 | |||
| 1935 | Ga0373927_1158869 | |||
| 1936 | Ga0373947_0029070 | |||
| 1937 | Ga0373925_0336696 | |||
| 1938 | Ga0373925_1258855 | |||
| 1939 | Ga0395899_0018013 | |||
| 1940 | Ga0395899_0023665 | |||
| 1941 | Ga0395899_0086761 | |||
| 1942 | Ga0395899_0163532 | |||
| 1943 | Ga0395899_0169361 | |||
| 1944 | Ga0395899_0174841 | |||
| 1945 | Ga0395899_0179085 | |||
| 1946 | Ga0395899_0184519 | |||
| 1947 | Ga0395899_0198778 | |||
| 1948 | Ga0395899_0228071 | |||
| 1949 | Ga0395899_0281144 | |||
| 1950 | Ga0395899_0834062 | |||
| 1951 | Ga0395900_0007753 | |||
| 1952 | Ga0395900_0016049 | |||
| 1953 | Ga0395900_0026190 | |||
| 1954 | Ga0395900_0038277 | |||
| 1955 | Ga0395900_0051098 | |||
| 1956 | Ga0395900_0081852 | |||
| 1957 | Ga0395900_0130207 | |||
| 1958 | Ga0395900_0354797 | |||
| 1959 | Ga0395900_0398845 | |||
| 1960 | Ga0395900_0788980 | |||
| 1961 | Ga0395900_0976707 | |||
| 1962 | Ga0395900_1083271 | |||
| 1963 | Ga0395900_1272379 | |||
| 1964 | Ga0395900_1403111 | |||
| 1965 | Ga0395900_1598580 | |||
| 1966 | Ga0395900_1816373 | |||
| 1967 | Ga0395898_0005873 | |||
| 1968 | Ga0395898_0013193 | |||
| 1969 | Ga0395898_0014409 | |||
| 1970 | Ga0395898_0027509 | |||
| 1971 | Ga0395898_0029925 | |||
| 1972 | Ga0395898_0038275 | |||
| 1973 | Ga0395898_0055263 | |||
| 1974 | Ga0395898_0077132 | |||
| 1975 | Ga0395898_0094673 | |||
| 1976 | Ga0395898_0112499 | |||
| 1977 | Ga0395898_0123439 | |||
| 1978 | Ga0395898_0144942 | |||
| 1979 | Ga0395898_0180519 | |||
| 1980 | Ga0395898_0183209 | |||
| 1981 | Ga0395898_0242978 | |||
| 1982 | Ga0395898_0352820 | |||
| 1983 | Ga0395898_0427347 | |||
| 1984 | Ga0395898_0454001 | |||
| 1985 | Ga0395898_0896540 | |||
| 1986 | Ga0395898_1506585 | |||
| 1987 | Ga0395898_1687691 | |||
| 1988 | Ga0395898_1781040 | |||
| 1989 | Ga0395905_0012489 | |||
| 1990 | Ga0395905_0012729 | |||
| 1991 | Ga0395905_0021502 | |||
| 1992 | Ga0395905_0026153 | |||
| 1993 | Ga0395905_0037024 | |||
| 1994 | Ga0395905_0059001 | |||
| 1995 | Ga0395905_0100698 | |||
| 1996 | Ga0395905_0121434 | |||
| 1997 | Ga0395905_0132177 | |||
| 1998 | Ga0395905_0172951 | |||
| 1999 | Ga0395905_0197402 | |||
| 2000 | Ga0395905_0271712 | |||
| 2001 | Ga0395905_0302035 | |||
| 2002 | Ga0395905_0377862 | |||
| 2003 | Ga0395905_0433911 | |||
| 2004 | Ga0395905_0503641 | |||
| 2005 | Ga0395905_0655534 | |||
| 2006 | Ga0395901_0001046 | |||
| 2007 | Ga0395901_0006828 | |||
| 2008 | Ga0395901_0009452 | |||
| 2009 | Ga0395901_0009977 | |||
| 2010 | Ga0395901_0014732 | |||
| 2011 | Ga0395901_0017892 | |||
| 2012 | Ga0395901_0019300 | |||
| 2013 | Ga0395901_0053486 | |||
| 2014 | Ga0395901_0067183 | |||
| 2015 | Ga0395901_0080561 | |||
| 2016 | Ga0395901_0102124 | |||
| 2017 | Ga0395901_0114273 | |||
| 2018 | Ga0395901_0132246 | |||
| 2019 | Ga0395901_0141541 | |||
| 2020 | Ga0395901_0165451 | |||
| 2021 | Ga0395901_0203010 | |||
| 2022 | Ga0395901_0208329 | |||
| 2023 | Ga0395901_0297777 | |||
| 2024 | Ga0395901_0373308 | |||
| 2025 | Ga0395901_0375795 | |||
| 2026 | Ga0395901_0381445 | |||
| 2027 | Ga0395901_0718256 | |||
| 2028 | Ga0395901_0834276 | |||
| 2029 | Ga0395901_0979916 | |||
| 2030 | Ga0395901_1006131 | |||
| 2031 | Ga0395901_1029099 | |||
| 2032 | Ga0395901_1065660 | |||
| 2033 | Ga0395901_1279415 | |||
| 2034 | Ga0395901_1305401 | |||
| 2035 | Ga0395901_1459757 | |||
| 2036 | Ga0242420_072653 | |||
| 2037 | Ga0439439_0002455 | |||
| 2038 | Ga0439453_0002601 | |||
| 2039 | Ga0439465_0368561 | |||
| 2040 | Ga0451793_1261161 | |||
| 2041 | Ga0451793_1655625 | |||
| 2042 | Ga0451800_0328401 | |||
| 2043 | Ga0451806_268292 | |||
| 2044 | Ga0451833_1445090 | |||
| 2045 | Ga0451853_1987957 | |||
| 2046 | Ga0439431_0031705 | |||
| 2047 | Ga0439445_0107057 | |||
| 2048 | Ga0439448_0007575 | |||
| 2049 | Ga0439448_0022356 | |||
| 2050 | Ga0439432_155143 | |||
| 2051 | Ga0439450_079647 | |||
| 2052 | Ga0439454_003564 | |||
| 2053 | Ga0439455_0098903 | |||
| 2054 | Ga0439456_008584 | |||
| 2055 | Ga0439456_157829 | |||
| 2056 | Ga0439462_0025310 | |||
| 2057 | Ga0450920_067652 | |||
| 2058 | Ga0450923_011367 | |||
| 2059 | Ga0450888_077108 | |||
| 2060 | Ga0450906_051791 | |||
| 2061 | Ga0439458_0006620 | |||
| 2062 | Ga0439434_0011545 | |||
| 2063 | Ga0439435_0264102 | |||
| 2064 | Ga0439464_0328047 | |||
| 2065 | Ga0439460_0071307 | |||
| 2066 | Ga0450916_080225 | |||
| 2067 | Ga0450918_063523 | |||
| 2068 | Ga0439440_0283280 | |||
| 2069 | Ga0466964_0885934 | |||
| 2070 | Ga0466960_0281816 | |||
| 2071 | Ga0451576_0009765 | |||
| 2072 | Ga0451576_0337659 | |||
| 2073 | Ga0451576_1477521 | |||
| 2074 | Ga0451576_1833341 | |||
| 2075 | Ga0495627_141641 | |||
| 2076 | Ga0495592_0174434 | |||
| 2077 | Ga0495603_0002966 | |||
| 2078 | Ga0495603_0003598 | |||
| 2079 | Ga0495590_0046160 | |||
| 2080 | Ga0495641_0007685 | |||
| 2081 | Ga0495641_0036653 | |||
| 2082 | Ga0495641_0040634 | |||
| 2083 | Ga0495653_0119308 | |||
| 2084 | Ga0495580_0073795 | |||
| 2085 | Ga0495582_0011076 | |||
| 2086 | Ga0495582_0015210 | |||
| 2087 | Ga0495582_0256364 | |||
| 2088 | Ga0495605_0036714 | |||
| 2089 | Ga0495605_0134617 | |||
| 2090 | Ga0495605_0364854 | |||
| 2091 | Ga0495639_0018001 | |||
| 2092 | Ga0495662_0354580 | |||
| 2093 | Ga0495584_0023997 | |||
| 2094 | Ga0495584_0113552 | |||
| 2095 | Ga0495584_0134096 | |||
| 2096 | Ga0495584_0512677 | |||
| 2097 | Ga0495585_0141700 | |||
| 2098 | Ga0495585_0172909 | |||
| 2099 | Ga0495594_0849549 | |||
| 2100 | Ga0495596_0120773 | |||
| 2101 | Ga0495596_0241270 | |||
| 2102 | Ga0495596_0364903 | |||
| 2103 | Ga0495607_0168035 | |||
| 2104 | Ga0495607_0326193 | |||
| 2105 | Ga0495608_0062402 | |||
| 2106 | Ga0495616_0081375 | |||
| 2107 | Ga0495616_0375456 | |||
| 2108 | Ga0495618_0032900 | |||
| 2109 | Ga0495628_0134946 | |||
| 2110 | Ga0495630_0004397 | |||
| 2111 | Ga0495630_0337865 | |||
| 2112 | Ga0495631_0061677 | |||
| 2113 | Ga0495632_0317374 | |||
| 2114 | Ga0495632_0348201 | |||
| 2115 | Ga0495637_0180525 | |||
| 2116 | Ga0495637_0235932 | |||
| 2117 | Ga0495644_0161999 | |||
| 2118 | Ga0495663_0004194 | |||
| 2119 | Ga0495663_0009545 | |||
| 2120 | Ga0495666_0029227 | |||
| 2121 | Ga0495666_0249255 | |||
| 2122 | Ga0495642_0107707 | |||
| 2123 | Ga0495642_0260465 | |||
| 2124 | Ga0495642_0443551 | |||
| 2125 | Ga0495652_0763495 | |||
| 2126 | Ga0495640_0648090 | |||
| 2127 | Ga0495609_0060422 | |||
| 2128 | Ga0495597_0026708 | |||
| 2129 | Ga0495597_0242205 | |||
| 2130 | Ga0495667_0062908 | |||
| 2131 | Ga0495667_0603594 | |||
| 2132 | Ga0495656_0024658 | |||
| 2133 | Ga0495656_0123207 | |||
| 2134 | Ga0495656_0434548 | |||
| 2135 | Ga0495668_0406275 | |||
| 2136 | Ga0495611_0175476 | |||
| 2137 | Ga0495611_0190375 | |||
| 2138 | Ga0495611_0382734 | |||
| 2139 | Ga0495611_0434746 | |||
| 2140 | Ga0495625_0189904 | |||
| 2141 | Ga0495635_0115988 | |||
| 2142 | Ga0495659_0029848 | |||
| 2143 | Ga0495659_0183157 | |||
| 2144 | Ga0495659_0203228 | |||
| 2145 | Ga0495661_0303604 | |||
| 2146 | Ga0495588_0080418 | |||
| 2147 | Ga0495588_0258254 | |||
| 2148 | Ga0495588_0380401 | |||
| 2149 | Ga0495647_0018840 | |||
| 2150 | Ga0495647_0026351 | |||
| 2151 | Ga0495647_0065333 | |||
| 2152 | Ga0495658_0128633 | |||
| 2153 | Ga0495658_0143880 | |||
| 2154 | Ga0495669_0299380 | |||
| 2155 | Ga0495613_0491679 | |||
| 2156 | Ga0495624_0503229 | |||
| 2157 | Ga0495671_0130128 | |||
| 2158 | Ga0495589_0068642 | |||
| 2159 | Ga0495589_0404216 | |||
| 2160 | Ga0495600_0442749 | |||
| 2161 | Ga0495660_0250744 | |||
| 2162 | Ga0495581_0037141 | |||
| 2163 | Ga0495581_0507341 | |||
| 2164 | Ga0495636_0092770 | |||
| 2165 | Ga0495674_0064608 | |||
| 2166 | Ga0495676_0026438 | |||
| 2167 | Ga0495676_0041249 | |||
| 2168 | Ga0495676_0100718 | |||
| 2169 | Ga0495676_0496048 | |||
| 2170 | Ga0495680_0033835 | |||
| 2171 | Ga0495683_0435214 | |||
| 2172 | Ga0495677_0010865 | |||
| 2173 | Ga0495679_131201 | |||
| 2174 | Ga0495673_0213698 | |||
| 2175 | Ga0495684_0123265 | |||
| 2176 | Ga0495686_0220338 | |||
| 2177 | Ga0495593_0387330 | |||
| 2178 | Ga0495614_0303995 | |||
| 2179 | Ga0495615_0011240 | |||
| 2180 | Ga0495626_0080529 | |||
| 2181 | Ga0496100_0024288 | |||
| 2182 | Ga0496100_0024956 | |||
| 2183 | Ga0496100_0128491 | |||
| 2184 | Ga0496100_0376444 | |||
| 2185 | Ga0496100_0486409 | |||
| 2186 | Ga0496100_0708842 | |||
| 2187 | Ga0496100_0866764 | |||
| 2188 | Ga0496100_1313132 | |||
| 2189 | Ga0496101_0062188 | |||
| 2190 | Ga0496101_0225567 | |||
| 2191 | Ga0496101_0498975 | |||
| 2192 | Ga0496101_0524111 | |||
| 2193 | Ga0496101_0525522 | |||
| 2194 | Ga0496101_0647866 | |||
| 2195 | Ga0496102_0042774 | |||
| 2196 | Ga0496102_0076498 | |||
| 2197 | Ga0496102_0082950 | |||
| 2198 | Ga0496102_0086649 | |||
| 2199 | Ga0496102_0141504 | |||
| 2200 | Ga0496102_0247764 | |||
| 2201 | Ga0496102_0337485 | |||
| 2202 | Ga0496102_1601459 | |||
| 2203 | Ga0496102_1786854 | |||
| 2204 | Ga0496103_0006330 | |||
| 2205 | Ga0496103_0021226 | |||
| 2206 | Ga0496103_0053940 | |||
| 2207 | Ga0496103_0088025 | |||
| 2208 | Ga0496103_0285623 | |||
| 2209 | Ga0496103_0467737 | |||
| 2210 | Ga0496104_0001575 | |||
| 2211 | Ga0496104_0016981 | |||
| 2212 | Ga0496104_0036749 | |||
| 2213 | Ga0496104_0153269 | |||
| 2214 | Ga0496104_0210598 | |||
| 2215 | Ga0496104_0304685 | |||
| 2216 | Ga0496104_0374677 | |||
| 2217 | Ga0496104_0717057 | |||
| 2218 | Ga0496105_0001189 | |||
| 2219 | Ga0496105_0019839 | |||
| 2220 | Ga0496105_0061564 | |||
| 2221 | Ga0496105_0088618 | |||
| 2222 | Ga0496105_0124571 | |||
| 2223 | Ga0496105_0196718 | |||
| 2224 | Ga0496105_0212152 | |||
| 2225 | Ga0496105_0698853 | |||
| 2226 | Ga0496106_0021406 | |||
| 2227 | Ga0496106_0131448 | |||
| 2228 | Ga0496106_0243451 | |||
| 2229 | Ga0496106_0300531 | |||
| 2230 | Ga0496106_0403824 | |||
| 2231 | Ga0496106_0601076 | |||
| 2232 | Ga0496106_1171899 | |||
| 2233 | Ga0496106_1491255 | |||
| 2234 | Ga0496107_0038969 | |||
| 2235 | Ga0496107_0047060 | |||
| 2236 | Ga0496107_0296158 | |||
| 2237 | Ga0496107_0321651 | |||
| 2238 | Ga0496107_0779076 | |||
| 2239 | Ga0496108_0006577 | |||
| 2240 | Ga0496108_0010896 | |||
| 2241 | Ga0496108_0017968 | |||
| 2242 | Ga0496108_0058251 | |||
| 2243 | Ga0496108_0100123 | |||
| 2244 | Ga0496108_0196617 | |||
| 2245 | Ga0496108_0232996 | |||
| 2246 | Ga0496108_0772668 | |||
| 2247 | Ga0496109_0000579 | |||
| 2248 | Ga0496109_0001424 | |||
| 2249 | Ga0496109_0006229 | |||
| 2250 | Ga0496109_0007519 | |||
| 2251 | Ga0496109_0027467 | |||
| 2252 | Ga0496109_0089825 | |||
| 2253 | Ga0496109_0094520 | |||
| 2254 | Ga0496109_0256920 | |||
| 2255 | Ga0496109_0648452 | |||
| 2256 | Ga0496109_0782176 | |||
| 2257 | Ga0496110_0000833 | |||
| 2258 | Ga0496110_0005683 | |||
| 2259 | Ga0496110_0032078 | |||
| 2260 | Ga0496110_0097468 | |||
| 2261 | Ga0496110_0144389 | |||
| 2262 | Ga0496110_0254674 | |||
| 2263 | Ga0496110_0273486 | |||
| 2264 | Ga0496110_0369828 | |||
| 2265 | Ga0496111_0000437 | |||
| 2266 | Ga0496111_0000740 | |||
| 2267 | Ga0496111_0002075 | |||
| 2268 | Ga0496111_0038962 | |||
| 2269 | Ga0496111_0042006 | |||
| 2270 | Ga0496111_0100683 | |||
| 2271 | Ga0496111_0122264 | |||
| 2272 | Ga0496111_0697712 | |||
| 2273 | Ga0496111_0895239 | |||
| 2274 | Ga0496112_0001299 | |||
| 2275 | Ga0496112_0014630 | |||
| 2276 | Ga0496112_0016908 | |||
| 2277 | Ga0496112_0017658 | |||
| 2278 | Ga0496112_0216075 | |||
| 2279 | Ga0496112_0218618 | |||
| 2280 | Ga0496112_0235377 | |||
| 2281 | Ga0496112_0336809 | |||
| 2282 | Ga0496112_0388530 | |||
| 2283 | Ga0496113_0000174 | |||
| 2284 | Ga0496113_0001819 | |||
| 2285 | Ga0496113_0002956 | |||
| 2286 | Ga0496113_0235046 | |||
| 2287 | Ga0496113_0519317 | |||
| 2288 | Ga0496114_0049413 | |||
| 2289 | Ga0496114_0130641 | |||
| 2290 | Ga0496114_0184547 | |||
| 2291 | Ga0496114_0185723 | |||
| 2292 | Ga0496114_0329753 | |||
| 2293 | Ga0496114_0343694 | |||
| 2294 | Ga0496114_1084193 | |||
| 2295 | Ga0496115_0008914 | |||
| 2296 | Ga0496115_0010212 | |||
| 2297 | Ga0496115_0038890 | |||
| 2298 | Ga0496115_0221021 | |||
| 2299 | Ga0496115_0339679 | |||
| 2300 | Ga0496115_0410954 | |||
| 2301 | Ga0496115_1282391 | |||
| 2302 | Ga0496126_1149422 | |||
| 2303 | Ga0501031_0002166 | |||
| 2304 | Ga0501031_1075160 | |||
| 2305 | Ga0501032_0002389 | |||
| 2306 | Ga0501032_0104595 | |||
| 2307 | Ga0501033_0000267 | |||
| 2308 | Ga0501033_0001810 | |||
| 2309 | Ga0501033_0705538 | |||
| 2310 | Ga0501033_0966026 | |||
| 2311 | Ga0501034_0029144 | |||
| 2312 | Ga0501036_0000053 | |||
| 2313 | Ga0501036_0033938 | |||
| 2314 | Ga0501036_0088587 | |||
| 2315 | Ga0501037_0000410 | |||
| 2316 | Ga0501037_0006760 | |||
| 2317 | Ga0501038_0020916 | |||
| 2318 | Ga0501038_0070900 | |||
| 2319 | Ga0501038_0104826 | |||
| 2320 | Ga0501038_0299855 | |||
| 2321 | Ga0501039_0000102 | |||
| 2322 | Ga0501039_0012368 | |||
| 2323 | Ga0501039_0212677 | |||
| 2324 | Ga0501039_0459982 | |||
| 2325 | Ga0501040_0000927 | |||
| 2326 | Ga0501040_0001135 | |||
| 2327 | Ga0501040_0084304 | |||
| 2328 | Ga0501040_0092937 | |||
| 2329 | Ga0501040_0244844 | |||
| 2330 | Ga0501041_0000009 | |||
| 2331 | Ga0501041_0052571 | |||
| 2332 | Ga0501041_0075091 | |||
| 2333 | Ga0501042_0000190 | |||
| 2334 | Ga0501042_0054088 | |||
| 2335 | Ga0501042_0054647 | |||
| 2336 | Ga0501042_0063292 | |||
| 2337 | Ga0501042_0477170 | |||
| 2338 | Ga0501042_1114530 | |||
| 2339 | Ga0501043_0000252 | |||
| 2340 | Ga0501043_0003871 | |||
| 2341 | Ga0501043_0009705 | |||
| 2342 | Ga0501046_0000332 | |||
| 2343 | Ga0501046_0002907 | |||
| 2344 | Ga0501046_0060712 | |||
| 2345 | Ga0501046_0600335 | |||
| 2346 | Ga0501047_0000215 | |||
| 2347 | Ga0501047_0028489 | |||
| 2348 | Ga0501047_0924983 | |||
| 2349 | Ga0501048_0001833 | |||
| 2350 | Ga0501048_0002707 | |||
| 2351 | Ga0501048_0008032 | |||
| 2352 | Ga0501068_0000054 | |||
| 2353 | Ga0501068_0002625 | |||
| 2354 | Ga0501068_0123482 | |||
| 2355 | Ga0501068_0193889 | |||
| 2356 | Ga0501069_0002812 | |||
| 2357 | Ga0501069_0003794 | |||
| 2358 | Ga0501069_0017249 | |||
| 2359 | Ga0501069_0065181 | |||
| 2360 | Ga0501069_0904711 | |||
| 2361 | Ga0501070_0015918 | |||
| 2362 | Ga0501070_0019034 | |||
| 2363 | Ga0501070_0032341 | |||
| 2364 | Ga0501070_0138423 | |||
| 2365 | Ga0501070_0573746 | |||
| 2366 | Ga0501070_1524088 | |||
| 2367 | Ga0501071_0000572 | |||
| 2368 | Ga0501071_0006495 | |||
| 2369 | Ga0501071_0064192 | |||
| 2370 | Ga0501071_0108526 | |||
| 2371 | Ga0501071_0140888 | |||
| 2372 | Ga0501071_0849129 | |||
| 2373 | Ga0501072_0000075 | |||
| 2374 | Ga0501072_0083608 | |||
| 2375 | Ga0501072_0150613 | |||
| 2376 | Ga0501072_0462896 | |||
| 2377 | Ga0501072_0606721 | |||
| 2378 | Ga0501073_0000389 | |||
| 2379 | Ga0501073_0009024 | |||
| 2380 | Ga0501073_0053122 | |||
| 2381 | Ga0501074_0001003 | |||
| 2382 | Ga0501074_0171442 | |||
| 2383 | Ga0501074_0404957 | |||
| 2384 | Ga0501074_0617259 | |||
| 2385 | Ga0501074_0858377 | |||
| 2386 | Ga0501075_0000131 | |||
| 2387 | Ga0501075_0008820 | |||
| 2388 | Ga0501075_0049574 | |||
| 2389 | Ga0501075_0065458 | |||
| 2390 | Ga0501075_0736259 | |||
| 2391 | Ga0501075_1094020 | |||
| 2392 | Ga0501075_1205284 | |||
| 2393 | Ga0501076_0000041 | |||
| 2394 | Ga0501076_0058594 | |||
| 2395 | Ga0501076_0196979 | |||
| 2396 | Ga0501076_0311353 | |||
| 2397 | Ga0501076_0389017 | |||
| 2398 | Ga0501076_0883886 | |||
| 2399 | Ga0501076_0986687 | |||
| 2400 | Ga0501077_0001079 | |||
| 2401 | Ga0501077_0008249 | |||
| 2402 | Ga0501077_0039556 | |||
| 2403 | Ga0501077_0060329 | |||
| 2404 | Ga0501077_0428259 | |||
| 2405 | Ga0501217_095847 | |||
| 2406 | Ga0501079_0000155 | |||
| 2407 | Ga0501079_0009327 | |||
| 2408 | Ga0501079_0034569 | |||
| 2409 | Ga0501079_0044428 | |||
| 2410 | Ga0501079_0153944 | |||
| 2411 | Ga0501079_0167888 | |||
| 2412 | Ga0501079_0601852 | |||
| 2413 | Ga0501079_1135531 | |||
| 2414 | Ga0501080_0003115 | |||
| 2415 | Ga0501080_0058509 | |||
| 2416 | Ga0501080_0108916 | |||
| 2417 | Ga0501080_0564828 | |||
| 2418 | Ga0501080_1031087 | |||
| 2419 | Ga0501081_0000581 | |||
| 2420 | Ga0501081_0001472 | |||
| 2421 | Ga0501081_0057481 | |||
| 2422 | Ga0501081_0206810 | |||
| 2423 | Ga0501081_0310704 | |||
| 2424 | Ga0501081_0939640 | |||
| 2425 | Ga0501083_0001895 | |||
| 2426 | Ga0501083_0011774 | |||
| 2427 | Ga0501083_0163269 | |||
| 2428 | Ga0501083_0192927 | |||
| 2429 | Ga0501035_0012470 | |||
| 2430 | Ga0501035_0018106 | |||
| 2431 | Ga0501035_0045915 | |||
| 2432 | Ga0501035_1274606 | |||
| 2433 | Ga0501044_0028270 | |||
| 2434 | Ga0501044_0047735 | |||
| 2435 | Ga0501044_0061906 | |||
| 2436 | Ga0501044_1173240 | |||
| 2437 | Ga0501045_0001153 | |||
| 2438 | Ga0501045_0039760 | |||
| 2439 | Ga0501045_0065995 | |||
| 2440 | Ga0501045_0083511 | |||
| 2441 | Ga0501045_0115172 | |||
| 2442 | nmdc:mga00v17_38829_c1 | |||
| 2443 | nmdc:mga0yw44_206435_c1 | |||
| 2444 | nmdc:mga0yw44_233740_c1 | |||
| 2445 | nmdc:mga0yw44_67431_c1 | |||
| 2446 | nmdc:mga06z11_347762_c1 | |||
| 2447 | nmdc:mga06z11_558839_c1 | |||
| 2448 | nmdc:mga05p37_1075048_c1 | |||
| 2449 | nmdc:mga05p37_1088718_c1 | |||
| 2450 | nmdc:mga05p37_122277_c1 | |||
| 2451 | nmdc:mga05p37_135289_c1 | |||
| 2452 | nmdc:mga05p37_26954_c1 | |||
| 2453 | nmdc:mga05p37_35861_c1 | |||
| 2454 | nmdc:mga05p37_3682_c1 | |||
| 2455 | nmdc:mga05p37_599389_c1 | |||
| 2456 | nmdc:mga05p37_670198_c1 | |||
| 2457 | nmdc:mga09592_12388_c1 | |||
| 2458 | nmdc:mga09592_23387_c1 | |||
| 2459 | nmdc:mga09592_308675_c1 | |||
| 2460 | nmdc:mga09592_327734_c1 | |||
| 2461 | nmdc:mga0qj67_15425_c1 | |||
| 2462 | nmdc:mga0qj67_234873_c1 | |||
| 2463 | nmdc:mga0qj67_466312_c1 | |||
| 2464 | nmdc:mga0qj67_58700_c1 | |||
| 2465 | nmdc:mga0qj67_679273_c1 | |||
| 2466 | nmdc:mga06r32_137462_c1 | |||
| 2467 | nmdc:mga06r32_1621663_c1 | |||
| 2468 | nmdc:mga06r32_241566_c1 | |||
| 2469 | nmdc:mga06r32_451434_c1 | |||
| 2470 | nmdc:mga08y16_13401_c1 | |||
| 2471 | nmdc:mga08y16_14654_c1 | |||
| 2472 | nmdc:mga08y16_192065_c1 | |||
| 2473 | nmdc:mga08y16_553042_c1 | |||
| 2474 | nmdc:mga08y16_832306_c1 | |||
| 2475 | nmdc:mga0n895_106661_c1 | |||
| 2476 | nmdc:mga0n895_128501_c1 | |||
| 2477 | nmdc:mga0n895_1699189_c1 | |||
| 2478 | nmdc:mga0n895_190985_c1 | |||
| 2479 | nmdc:mga0n895_260278_c1 | |||
| 2480 | nmdc:mga0n895_38763_c1 | |||
| 2481 | nmdc:mga0n895_509066_c1 | |||
| 2482 | nmdc:mga0rr50_1439089_c1 | |||
| 2483 | nmdc:mga0rr50_17516_c1 | |||
| 2484 | nmdc:mga0rr50_183198_c1 | |||
| 2485 | nmdc:mga0rr50_262279_c1 | |||
| 2486 | nmdc:mga0rr50_399031_c1 | |||
| 2487 | nmdc:mga0rr50_591177_c1 | |||
| 2488 | nmdc:mga0rr50_943525_c1 | |||
| 2489 | nmdc:mga08x19_103404_c1 | |||
| 2490 | nmdc:mga08x19_53907_c1 | |||
| 2491 | nmdc:mga08x19_56080_c1 | |||
| 2492 | nmdc:mga0a205_1026217_c1 | |||
| 2493 | nmdc:mga0a205_119313_c1 | |||
| 2494 | nmdc:mga0a205_122116_c1 | |||
| 2495 | nmdc:mga0a205_221032_c1 | |||
| 2496 | nmdc:mga0a205_635759_c1 | |||
| 2497 | nmdc:mga0a205_998614_c1 | |||
| 2498 | Ga0495655_0054689 | |||
| 2499 | Ga0495655_0113048 | |||
| 2500 | Ga0495595_0361838 | |||
| 2501 | Ga0495619_0067893 | |||
| 2502 | Ga0501084_0006129 | |||
| 2503 | Ga0501084_0011056 | |||
| 2504 | Ga0501084_0087428 | |||
| 2505 | Ga0501084_0242422 | |||
| 2506 | Ga0501084_1607071 | |||
| 2507 | Ga0501084_1802690 | |||
| 2508 | Ga0587076_106182 | |||
| 2509 | Ga0501082_0000480 | |||
| 2510 | Ga0501082_0009255 | |||
| 2511 | Ga0501082_0088343 | |||
| 2512 | Ga0501082_0205481 | |||
| 2513 | Ga0501082_0341674 | |||
| 2514 | Ga0530510_0000230 | |||
| 2515 | Ga0530510_0005655 | |||
| 2516 | Ga0530510_0075674 | |||
| 2517 | Ga0530510_0215470 | |||
| 2518 | Ga0530510_0245528 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fwd-assembly1.cif.gz_L | fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock | 0.9693 | 2 | 100 |
| 4xi0-assembly1.cif.gz_E | mama 41-end from desulfovibrio magneticus rs-1 | 0.9693 | 3 | 112 |
| 8fwd-assembly1.cif.gz_P | fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock | 0.968 | 2 | 100 |
| 6b85-assembly1.cif.gz_J | crystal structure of transmembrane protein tmhc4_r | 0.9678 | 4 | 112 |
| 5lfm-assembly6.cif.gz_F | mama rs-1 arstm double mutant | 0.9672 | 3 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q1L5Z9_195_311_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9805 | 2 | 112 | 1.25.40.10 |
| af_D3ZX48_1_106_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9781 | 34 | 112 | 1.25.40.10 |
| af_A0A0R0FZE5_253_335_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9723 | 45 | 112 | 1.25.40.10 |
| af_F1RBN2_267_425_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9723 | 4 | 112 | 1.25.40.10 |
| af_A0A1D6KFP0_116_204_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.972 | 38 | 112 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538MKB9-F1-model_v4 | Tetratricopeptide repeat protein | 1.002 | 1 | 116 |
|
| AF-A0A538EPJ8-F1-model_v4 | Tetratricopeptide repeat protein | 0.9999 | 1 | 116 |
|
| AF-A0A538EPJ8-F1-model_v4 | Tetratricopeptide repeat protein | 0.9914 | 1 | 116 |
|
| AF-A0A3N5UNK9-F1-model_v4 | Uncharacterized protein | 0.9841 | 4 | 112 |
|
| AF-A0A538I782-F1-model_v4 | Tetratricopeptide repeat protein | 0.9837 | 1 | 116 |
|