F492291

General Info

Members Datasets Scaffolds Average Seq Length
1260 333 2520 218

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10076279|rootL2_100762795
Length 252
Sequence MHFTAPLKFAKGTGYSQFLFLKPYICFPPNQLPPMIEAVLIVLAYLIGSIPTSVWISRYFFEIDIRDYGSGNAGATNTFRVLGSKWGTIVMICDVLKGIIATSLYIMVSFYVVKDHDVDRTKLMIGLGLAAVIGHVFPIWAGFRGGKGVATLFGMIIAMQPAVAACCVLVFLLVLYLTRFVSLSSILAGVAFAILILFIFDDNVTLYRIFSVLVALLVILTHQKNINRLLNGTESKVPILKYRDRRRERRRG

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
118 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
205 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
206 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
207 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
208 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
209 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
212 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
213 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
214 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
215 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
255 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
256 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
257 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
280 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
281 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
282 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
283 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
284 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
285 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
286 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
287 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
288 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
289 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
290 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
291 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
292 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
293 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
294 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
295 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
300 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
301 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
302 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
303 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
314 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
315 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
316 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
317 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
318 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
319 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
320 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
321 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
324 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
325 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
329 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
331 2818991444 Filimonas endophytica 3197 Isolate Unclassified
332 2914759650 Rhizosphaericola mali Isolate Rhizosphere
333 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 1.19
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 0.71
Rhizosphere 95.71
Stem 0
Stem Tuber 0
Unclassified 15.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10076279 3300003322 Bacteria 5022
2 MRS1b_contig_1168309 2162886011 Bacteria 856
3 MBSR1b_contig_4379216 2162886012 Unclassified 1163
4 MBSR1b_contig_7995764 2162886012 Unclassified 1163
5 JGI24751J29686_10061188 3300002459 Bacteria 775
6 rootH1_10109167 3300003316 Bacteria 1140
7 rootH1_10125848 3300003316 Bacteria 3347
8 rootH2_10162769 3300003320 Bacteria 4159
9 rootH2_10197471 3300003320 Bacteria 2933
10 rootH2_10205626 3300003320 Bacteria 2737
11 rootL2_10097124 3300003322 Unclassified 2320
12 rootL2_10135684 3300003322 Bacteria 4544
13 rootH1_10227879 3300003323 Unclassified 1569
14 JGI25160J50197_1003126 3300003354 Bacteria 7532
15 Ga0058861_12043672 3300004800 Bacteria 744
16 Ga0058862_12478465 3300004803 Bacteria 1575
17 Ga0065714_10079249 3300005288 Bacteria 2531
18 Ga0065714_10226543 3300005288 Unclassified 827
19 Ga0065704_10121850 3300005289 Bacteria 1759
20 Ga0065704_10182402 3300005289 Bacteria 1230
21 Ga0065712_10073224 3300005290 Bacteria 4461
22 Ga0065712_10089634 3300005290 Bacteria 2446
23 Ga0065712_10154453 3300005290 Bacteria 1321
24 Ga0065712_10170127 3300005290 Bacteria 1248
25 Ga0065712_10225270 3300005290 Bacteria 1028
26 Ga0065715_10013993 3300005293 Unclassified 1980
27 Ga0065715_10323297 3300005293 Bacteria 998
28 Ga0070658_10001461 3300005327 Bacteria 20135
29 Ga0070658_10045017 3300005327 Bacteria 3567
30 Ga0070658_10045140 3300005327 Bacteria 3562
31 Ga0070658_10100597 3300005327 Bacteria 2390
32 Ga0070658_10182071 3300005327 Bacteria 1768
33 Ga0070658_10824846 3300005327 Bacteria 806
34 Ga0070676_10000153 3300005328 Bacteria 27368
35 Ga0070676_10005303 3300005328 Bacteria 6859
36 Ga0070676_10033838 3300005328 Unclassified 2932
37 Ga0070683_100000329 3300005329 Bacteria 32745
38 Ga0070683_100018651 3300005329 Bacteria 6149
39 Ga0070683_100023520 3300005329 Bacteria 5511
40 Ga0070683_100053673 3300005329 Bacteria 3735
41 Ga0070683_100081163 3300005329 Bacteria 3036
42 Ga0070690_100051558 3300005330 Unclassified 2627
43 Ga0070690_100177737 3300005330 Unclassified 1469
44 Ga0070670_100032449 3300005331 Bacteria 4498
45 Ga0070670_100053200 3300005331 Bacteria 3477
46 Ga0070670_100149986 3300005331 Bacteria 2018
47 Ga0070670_100150728 3300005331 Bacteria 2012
48 Ga0070670_100174216 3300005331 Unclassified 1867
49 Ga0070670_100264373 3300005331 Bacteria 1500
50 Ga0070670_100358496 3300005331 Bacteria 1282
51 Ga0070670_100360560 3300005331 Bacteria 1278
52 Ga0070670_100522309 3300005331 Bacteria 1057
53 Ga0070670_100630214 3300005331 Bacteria 961
54 Ga0070670_100981754 3300005331 Bacteria 768
55 Ga0070677_10002116 3300005333 Bacteria 6336
56 Ga0070677_10042997 3300005333 Bacteria 1792
57 Ga0070677_10115552 3300005333 Bacteria 1204
58 Ga0070677_10153182 3300005333 Unclassified 1075
59 Ga0068869_100007813 3300005334 Bacteria 6860
60 Ga0068869_100012388 3300005334 Bacteria 5634
61 Ga0068869_100024126 3300005334 Bacteria 4211
62 Ga0068869_100031526 3300005334 Bacteria 3729
63 Ga0068869_100118166 3300005334 Unclassified 2025
64 Ga0068869_100162297 3300005334 Bacteria 1740
65 Ga0068869_100401576 3300005334 Bacteria 1127
66 Ga0070666_10000043 3300005335 Bacteria 111402
67 Ga0070666_10000209 3300005335 Bacteria 40151
68 Ga0070666_10031000 3300005335 Bacteria 3528
69 Ga0070666_10031370 3300005335 Bacteria 3508
70 Ga0070666_10119646 3300005335 Unclassified 1826
71 Ga0070666_10144826 3300005335 Bacteria 1656
72 Ga0070666_10292921 3300005335 Bacteria 1158
73 Ga0070680_100000076 3300005336 Bacteria 53273
74 Ga0070680_100012535 3300005336 Bacteria 6588
75 Ga0070680_100021326 3300005336 Bacteria 5147
76 Ga0070680_100024075 3300005336 Bacteria 4860
77 Ga0070680_100045972 3300005336 Bacteria 3550
78 Ga0070682_100000717 3300005337 Bacteria 19844
79 Ga0070682_100086673 3300005337 Bacteria 2039
80 Ga0070682_100155207 3300005337 Bacteria 1575
81 Ga0070682_100169628 3300005337 Unclassified 1515
82 Ga0070682_100243568 3300005337 Bacteria 1292
83 Ga0068868_100000726 3300005338 Bacteria 22242
84 Ga0068868_100001336 3300005338 Bacteria 17019
85 Ga0068868_100022584 3300005338 Bacteria 4750
86 Ga0068868_100078450 3300005338 Bacteria 2644
87 Ga0068868_100097530 3300005338 Bacteria 2375
88 Ga0068868_100172352 3300005338 Bacteria 1792
89 Ga0068868_100180291 3300005338 Bacteria 1752
90 Ga0068868_100247821 3300005338 Unclassified 1498
91 Ga0068868_100595379 3300005338 Bacteria 979
92 Ga0068868_100811708 3300005338 Bacteria 845
93 Ga0070660_100034772 3300005339 Bacteria 3810
94 Ga0070660_100043591 3300005339 Bacteria 3429
95 Ga0070660_100057089 3300005339 Bacteria 3023
96 Ga0070660_100083945 3300005339 Bacteria 2503
97 Ga0070660_100133622 3300005339 Bacteria 1987
98 Ga0070660_100147379 3300005339 Bacteria 1891
99 Ga0070660_100421503 3300005339 Unclassified 1105
100 Ga0070660_100551128 3300005339 Unclassified 962
101 Ga0070689_100019751 3300005340 Bacteria 4985
102 Ga0070689_100503540 3300005340 Bacteria 1038
103 Ga0070691_10001594 3300005341 Bacteria 9806
104 Ga0070691_10007717 3300005341 Bacteria 4928
105 Ga0070691_10041025 3300005341 Bacteria 2188
106 Ga0070687_100014051 3300005343 Unclassified 3587
107 Ga0070687_100125092 3300005343 Bacteria 1476
108 Ga0070687_100147780 3300005343 Bacteria 1376
109 Ga0070687_100356811 3300005343 Bacteria 945
110 Ga0070661_100004831 3300005344 Bacteria 9277
111 Ga0070661_100009444 3300005344 Bacteria 6751
112 Ga0070661_100064706 3300005344 Bacteria 2687
113 Ga0070661_100104590 3300005344 Unclassified 2109
114 Ga0070661_100168713 3300005344 Bacteria 1661
115 Ga0070668_100000556 3300005347 Bacteria 24937
116 Ga0070668_100012182 3300005347 Bacteria 6404
117 Ga0070668_100073785 3300005347 Bacteria 2660
118 Ga0070668_100138846 3300005347 Bacteria 1957
119 Ga0070668_100485189 3300005347 Unclassified 1068
120 Ga0070669_100009249 3300005353 Bacteria 7020
121 Ga0070669_100035738 3300005353 Bacteria 3600
122 Ga0070675_100010042 3300005354 Bacteria 7381
123 Ga0070675_100026514 3300005354 Bacteria 4652
124 Ga0070675_100043632 3300005354 Bacteria 3665
125 Ga0070675_100050419 3300005354 Bacteria 3418
126 Ga0070675_100611183 3300005354 Unclassified 989
127 Ga0070675_100638424 3300005354 Bacteria 967
128 Ga0070671_100001985 3300005355 Bacteria 15713
129 Ga0070671_100013745 3300005355 Bacteria 6530
130 Ga0070671_100069303 3300005355 Bacteria 2942
131 Ga0070671_100115887 3300005355 Unclassified 2253
132 Ga0070671_100585517 3300005355 Unclassified 964
133 Ga0070674_100029455 3300005356 Bacteria 3617
134 Ga0070674_100030959 3300005356 Bacteria 3541
135 Ga0070674_100753954 3300005356 Bacteria 837
136 Ga0070673_100000867 3300005364 Bacteria 17013
137 Ga0070673_100006375 3300005364 Bacteria 7667
138 Ga0070673_100037568 3300005364 Unclassified 3691
139 Ga0070673_100042687 3300005364 Unclassified 3498
140 Ga0070673_100059928 3300005364 Unclassified 3014
141 Ga0070673_100098764 3300005364 Bacteria 2400
142 Ga0070673_100206169 3300005364 Bacteria 1695
143 Ga0070673_100217525 3300005364 Unclassified 1652
144 Ga0070673_100219615 3300005364 Unclassified 1644
145 Ga0070673_100281591 3300005364 Bacteria 1459
146 Ga0070688_100004476 3300005365 Bacteria 7279
147 Ga0070688_100089412 3300005365 Bacteria 2009
148 Ga0070688_100169991 3300005365 Bacteria 1503
149 Ga0070688_100234589 3300005365 Bacteria 1299
150 Ga0070688_100262084 3300005365 Bacteria 1235
151 Ga0070659_100007187 3300005366 Bacteria 8080
152 Ga0070659_100014833 3300005366 Bacteria 5827
153 Ga0070659_100061370 3300005366 Bacteria 2971
154 Ga0070659_100191534 3300005366 Unclassified 1681
155 Ga0070659_100228816 3300005366 Bacteria 1536
156 Ga0070659_100542459 3300005366 Unclassified 995
157 Ga0070667_100000812 3300005367 Bacteria 29157
158 Ga0070667_100008930 3300005367 Bacteria 8297
159 Ga0070667_100020249 3300005367 Bacteria 5523
160 Ga0070667_100028595 3300005367 Bacteria 4642
161 Ga0070667_100057396 3300005367 Unclassified 3290
162 Ga0070667_100220075 3300005367 Bacteria 1690
163 Ga0070667_100250684 3300005367 Bacteria 1583
164 Ga0070667_100282103 3300005367 Bacteria 1492
165 Ga0070667_100299953 3300005367 Bacteria 1446
166 Ga0070667_100353261 3300005367 Bacteria 1331
167 Ga0070667_100547582 3300005367 Bacteria 1063
168 Ga0070701_10030425 3300005438 Bacteria 2671
169 Ga0070701_10042878 3300005438 Unclassified 2312
170 Ga0070700_100027344 3300005441 Unclassified 3381
171 Ga0070700_100206961 3300005441 Unclassified 1382
172 Ga0070663_100161237 3300005455 Bacteria 1726
173 Ga0070663_100370722 3300005455 Bacteria 1164
174 Ga0070663_100577370 3300005455 Bacteria 943
175 Ga0070678_100057003 3300005456 Unclassified 2860
176 Ga0070678_100059231 3300005456 Bacteria 2814
177 Ga0070678_100679540 3300005456 Bacteria 926
178 Ga0070662_100001017 3300005457 Bacteria 17158
179 Ga0070662_100039341 3300005457 Bacteria 3362
180 Ga0070662_100041094 3300005457 Bacteria 3297
181 Ga0070662_100047930 3300005457 Unclassified 3076
182 Ga0070662_100050347 3300005457 Bacteria 3005
183 Ga0070662_100062595 3300005457 Bacteria 2719
184 Ga0070662_100070905 3300005457 Bacteria 2568
185 Ga0070662_100153087 3300005457 Bacteria 1797
186 Ga0070681_10030832 3300005458 Bacteria 5382
187 Ga0070681_10034476 3300005458 Bacteria 5082
188 Ga0070681_10069046 3300005458 Bacteria 3500
189 Ga0070681_10089254 3300005458 Bacteria 3034
190 Ga0070681_10092504 3300005458 Bacteria 2973
191 Ga0070681_10189654 3300005458 Bacteria 1975
192 Ga0070681_10318982 3300005458 Bacteria 1463
193 Ga0070681_10498067 3300005458 Unclassified 1131
194 Ga0068867_100009628 3300005459 Bacteria 6814
195 Ga0068867_100017213 3300005459 Bacteria 5133
196 Ga0068867_100018823 3300005459 Bacteria 4913
197 Ga0068867_100045627 3300005459 Bacteria 3215
198 Ga0068867_100077217 3300005459 Bacteria 2502
199 Ga0068867_100124886 3300005459 Bacteria 1993
200 Ga0068867_100276407 3300005459 Bacteria 1375
201 Ga0068867_100393196 3300005459 Unclassified 1167
202 Ga0068867_100453623 3300005459 Bacteria 1093
203 Ga0068867_100576468 3300005459 Bacteria 978
204 Ga0070685_10023313 3300005466 Unclassified 3388
205 Ga0070685_10030244 3300005466 Bacteria 3015
206 Ga0070685_10162796 3300005466 Unclassified 1423
207 Ga0070685_10482928 3300005466 Bacteria 874
208 Ga0070698_100008720 3300005471 Bacteria 10923
209 Ga0070698_100034419 3300005471 Bacteria 5242
210 Ga0070698_100219385 3300005471 Bacteria 1836
211 Ga0070679_100001661 3300005530 Bacteria 20056
212 Ga0070679_100009375 3300005530 Bacteria 9257
213 Ga0070679_100022898 3300005530 Bacteria 6110
214 Ga0070679_100029983 3300005530 Bacteria 5368
215 Ga0070679_100037881 3300005530 Bacteria 4791
216 Ga0070679_100050468 3300005530 Bacteria 4145
217 Ga0070679_100062160 3300005530 Bacteria 3722
218 Ga0070679_100151851 3300005530 Bacteria 2292
219 Ga0070679_100241274 3300005530 Bacteria 1764
220 Ga0070684_100000768 3300005535 Bacteria 22215
221 Ga0070684_100001060 3300005535 Bacteria 19661
222 Ga0070684_100595267 3300005535 Unclassified 1028
223 Ga0068853_100000520 3300005539 Bacteria 26128
224 Ga0068853_100009389 3300005539 Bacteria 7886
225 Ga0068853_100010204 3300005539 Bacteria 7594
226 Ga0068853_100020753 3300005539 Bacteria 5465
227 Ga0068853_100059557 3300005539 Bacteria 3299
228 Ga0068853_100074904 3300005539 Bacteria 2954
229 Ga0068853_100097777 3300005539 Bacteria 2592
230 Ga0068853_100106099 3300005539 Bacteria 2489
231 Ga0068853_100154878 3300005539 Bacteria 2064
232 Ga0068853_100169030 3300005539 Bacteria 1977
233 Ga0068853_100205813 3300005539 Bacteria 1792
234 Ga0068853_100228366 3300005539 Bacteria 1702
235 Ga0068853_100267326 3300005539 Unclassified 1574
236 Ga0068853_100399359 3300005539 Bacteria 1286
237 Ga0068853_100410303 3300005539 Bacteria 1269
238 Ga0068853_100497853 3300005539 Bacteria 1150
239 Ga0070672_100000738 3300005543 Bacteria 19396
240 Ga0070672_100086295 3300005543 Bacteria 2524
241 Ga0070672_100097907 3300005543 Bacteria 2375
242 Ga0070672_100272233 3300005543 Bacteria 1430
243 Ga0070672_100318410 3300005543 Bacteria 1322
244 Ga0070686_100204799 3300005544 Unclassified 1417
245 Ga0070686_100547308 3300005544 Bacteria 905
246 Ga0070665_100000016 3300005548 Bacteria 451538
247 Ga0070665_100000486 3300005548 Bacteria 57134
248 Ga0070665_100076887 3300005548 Unclassified 3344
249 Ga0070665_100174223 3300005548 Bacteria 2152
250 Ga0070665_100589784 3300005548 Bacteria 1124
251 Ga0070704_100133488 3300005549 Unclassified 1928
252 Ga0068855_100001195 3300005563 Bacteria 32239
253 Ga0068855_100002033 3300005563 Bacteria 25069
254 Ga0068855_100027744 3300005563 Bacteria 6775
255 Ga0068855_100038229 3300005563 Bacteria 5703
256 Ga0068855_100095965 3300005563 Bacteria 3417
257 Ga0068855_100100781 3300005563 Bacteria 3325
258 Ga0068855_100125190 3300005563 Bacteria 2939
259 Ga0068855_100174465 3300005563 Unclassified 2433
260 Ga0068855_101058718 3300005563 Unclassified 850
261 Ga0070664_100007325 3300005564 Bacteria 8896
262 Ga0070664_100017660 3300005564 Bacteria 5858
263 Ga0070664_100101274 3300005564 Unclassified 2505
264 Ga0070664_100190998 3300005564 Bacteria 1825
265 Ga0070664_100252487 3300005564 Bacteria 1585
266 Ga0070664_100413307 3300005564 Bacteria 1235
267 Ga0070664_100501886 3300005564 Bacteria 1118
268 Ga0068857_100008614 3300005577 Bacteria 8827
269 Ga0068857_100032917 3300005577 Bacteria 4583
270 Ga0068857_100115318 3300005577 Bacteria 2416
271 Ga0068857_100132177 3300005577 Bacteria 2251
272 Ga0068857_100190919 3300005577 Bacteria 1866
273 Ga0068857_100499890 3300005577 Bacteria 1141
274 Ga0068857_100556531 3300005577 Bacteria 1081
275 Ga0068854_100003899 3300005578 Bacteria 9349
276 Ga0068854_100043746 3300005578 Bacteria 3176
277 Ga0068854_100061668 3300005578 Bacteria 2716
278 Ga0068854_100064033 3300005578 Unclassified 2670
279 Ga0068854_100068384 3300005578 Bacteria 2590
280 Ga0068854_100329767 3300005578 Bacteria 1243
281 Ga0068854_100505941 3300005578 Bacteria 1018
282 Ga0068856_100028734 3300005614 Bacteria 5433
283 Ga0068856_100062559 3300005614 Bacteria 3677
284 Ga0068856_100074389 3300005614 Bacteria 3363
285 Ga0068856_100113099 3300005614 Bacteria 2713
286 Ga0068856_100289020 3300005614 Bacteria 1656
287 Ga0070702_100453961 3300005615 Unclassified 930
288 Ga0068852_100002161 3300005616 Bacteria 13498
289 Ga0068852_100003948 3300005616 Bacteria 10424
290 Ga0068852_100005616 3300005616 Bacteria 8998
291 Ga0068852_100017743 3300005616 Bacteria 5592
292 Ga0068852_100030471 3300005616 Bacteria 4441
293 Ga0068852_100039278 3300005616 Bacteria 3984
294 Ga0068852_100073856 3300005616 Bacteria 3002
295 Ga0068852_100106272 3300005616 Bacteria 2544
296 Ga0068852_100126231 3300005616 Bacteria 2350
297 Ga0068852_100166256 3300005616 Bacteria 2064
298 Ga0068852_100211024 3300005616 Bacteria 1842
299 Ga0068852_100225934 3300005616 Bacteria 1782
300 Ga0068852_100414732 3300005616 Bacteria 1327
301 Ga0068852_100570823 3300005616 Unclassified 1133
302 Ga0068852_101072624 3300005616 Bacteria 825
303 Ga0068859_100000012 3300005617 Bacteria 300376
304 Ga0068859_100015449 3300005617 Bacteria 7669
305 Ga0068859_100016918 3300005617 Bacteria 7320
306 Ga0068859_100121114 3300005617 Bacteria 2683
307 Ga0068859_100155678 3300005617 Unclassified 2362
308 Ga0068859_100180962 3300005617 Bacteria 2191
309 Ga0068859_100182763 3300005617 Bacteria 2180
310 Ga0068859_100183247 3300005617 Unclassified 2177
311 Ga0068859_100232318 3300005617 Bacteria 1933
312 Ga0068859_100366272 3300005617 Bacteria 1536
313 Ga0068859_100391475 3300005617 Bacteria 1485
314 Ga0068859_100404895 3300005617 Bacteria 1460
315 Ga0068859_100470510 3300005617 Unclassified 1352
316 Ga0068864_100002330 3300005618 Bacteria 15704
317 Ga0068864_100010946 3300005618 Bacteria 7499
318 Ga0068864_100030323 3300005618 Bacteria 4583
319 Ga0068864_100064925 3300005618 Bacteria 3167
320 Ga0068864_100097281 3300005618 Unclassified 2606
321 Ga0068864_100279758 3300005618 Unclassified 1557
322 Ga0068864_100595738 3300005618 Bacteria 1072
323 Ga0068864_101165326 3300005618 Unclassified 768
324 Ga0068866_10010917 3300005718 Bacteria 3912
325 Ga0068866_10027968 3300005718 Bacteria 2682
326 Ga0068866_10043497 3300005718 Bacteria 2242
327 Ga0068866_10056271 3300005718 Unclassified 2023
328 Ga0068861_100049526 3300005719 Bacteria 3181
329 Ga0068861_100070790 3300005719 Bacteria 2702
330 Ga0068861_100073926 3300005719 Bacteria 2649
331 Ga0068861_100253963 3300005719 Bacteria 1501
332 Ga0068861_100406837 3300005719 Viruses 1209
333 Ga0068861_100440434 3300005719 Bacteria 1165
334 Ga0068851_10000423 3300005834 Bacteria 18902
335 Ga0068851_10019508 3300005834 Bacteria 3276
336 Ga0068851_10026913 3300005834 Bacteria 2830
337 Ga0068851_10066130 3300005834 Bacteria 1862
338 Ga0068870_10029291 3300005840 Bacteria 2772
339 Ga0068870_10038929 3300005840 Unclassified 2457
340 Ga0068863_100000858 3300005841 Bacteria 30354
341 Ga0068863_100003359 3300005841 Bacteria 15800
342 Ga0068863_100020445 3300005841 Bacteria 6326
343 Ga0068863_100024297 3300005841 Bacteria 5780
344 Ga0068863_100025383 3300005841 Bacteria 5650
345 Ga0068863_100031774 3300005841 Bacteria 5037
346 Ga0068863_100276818 3300005841 Bacteria 1625
347 Ga0068863_100325825 3300005841 Bacteria 1493
348 Ga0068863_100629581 3300005841 Bacteria 1063
349 Ga0068858_100001362 3300005842 Bacteria 25148
350 Ga0068858_100008022 3300005842 Bacteria 10169
351 Ga0068858_100047034 3300005842 Bacteria 4001
352 Ga0068858_100063752 3300005842 Bacteria 3410
353 Ga0068858_100319751 3300005842 Bacteria 1483
354 Ga0068858_100390710 3300005842 Bacteria 1336
355 Ga0068858_100856449 3300005842 Bacteria 888
356 Ga0068860_100000026 3300005843 Bacteria 270483
357 Ga0068860_100002209 3300005843 Bacteria 20481
358 Ga0068860_100007860 3300005843 Bacteria 10646
359 Ga0068860_100010129 3300005843 Bacteria 9342
360 Ga0068860_100016541 3300005843 Bacteria 7194
361 Ga0068860_100018967 3300005843 Bacteria 6682
362 Ga0068860_100072785 3300005843 Bacteria 3267
363 Ga0068860_100091780 3300005843 Bacteria 2893
364 Ga0068860_100151072 3300005843 Bacteria 2236
365 Ga0068860_100568775 3300005843 Bacteria 1137
366 Ga0068862_100010995 3300005844 Bacteria 7476
367 Ga0068862_100047162 3300005844 Unclassified 3676
368 Ga0068862_100064721 3300005844 Bacteria 3148
369 Ga0068862_100127894 3300005844 Bacteria 2244
370 Ga0068862_100133853 3300005844 Unclassified 2195
371 Ga0068862_100688106 3300005844 Bacteria 990
372 Ga0081539_10007837 3300005985 Bacteria 9546
373 Ga0070715_10006819 3300006163 Bacteria 3899
374 Ga0075366_10009633 3300006195 Bacteria 5399
375 Ga0075366_10076952 3300006195 Bacteria 1991
376 Ga0097621_100000027 3300006237 Bacteria 71873
377 Ga0097621_100007971 3300006237 Bacteria 7603
378 Ga0097621_100008933 3300006237 Bacteria 7244
379 Ga0097621_100078756 3300006237 Bacteria 2738
380 Ga0097621_100099328 3300006237 Bacteria 2446
381 Ga0097621_100117833 3300006237 Bacteria 2250
382 Ga0097621_100126650 3300006237 Bacteria 2170
383 Ga0097621_100139216 3300006237 Unclassified 2073
384 Ga0097621_100160061 3300006237 Bacteria 1935
385 Ga0097621_100576317 3300006237 Bacteria 1026
386 Ga0097621_100879549 3300006237 Unclassified 833
387 Ga0068871_100000107 3300006358 Bacteria 50575
388 Ga0068871_100008378 3300006358 Bacteria 7435
389 Ga0068871_100083065 3300006358 Bacteria 2656
390 Ga0068871_100086792 3300006358 Bacteria 2600
391 Ga0068871_100095306 3300006358 Bacteria 2485
392 Ga0068871_100097165 3300006358 Bacteria 2462
393 Ga0068871_100103213 3300006358 Bacteria 2390
394 Ga0068871_100125649 3300006358 Bacteria 2171
395 Ga0068871_100136715 3300006358 Bacteria 2082
396 Ga0068871_100161295 3300006358 Unclassified 1918
397 Ga0068871_100553333 3300006358 Bacteria 1042
398 Ga0075428_100056891 3300006844 Bacteria 4282
399 Ga0075430_100005928 3300006846 Bacteria 10322
400 Ga0075431_100001800 3300006847 Bacteria 20232
401 Ga0075434_100540770 3300006871 Unclassified 1185
402 Ga0075429_100015792 3300006880 Bacteria 6539
403 Ga0075429_100037587 3300006880 Unclassified 4214
404 Ga0075429_100041776 3300006880 Bacteria 3993
405 Ga0075429_100252586 3300006880 Bacteria 1544
406 Ga0075429_100642628 3300006880 Unclassified 929
407 Ga0068865_100002249 3300006881 Bacteria 11354
408 Ga0068865_100125695 3300006881 Unclassified 1914
409 Ga0068865_100128968 3300006881 Unclassified 1892
410 Ga0068865_100131110 3300006881 Unclassified 1878
411 Ga0068865_100197973 3300006881 Bacteria 1558
412 Ga0075436_100290683 3300006914 Unclassified 1170
413 Ga0097620_100000012 3300006931 Bacteria 300376
414 Ga0097620_100015449 3300006931 Bacteria 7669
415 Ga0097620_100016919 3300006931 Bacteria 7320
416 Ga0097620_100121119 3300006931 Bacteria 2683
417 Ga0097620_100155682 3300006931 Unclassified 2362
418 Ga0097620_100180977 3300006931 Bacteria 2191
419 Ga0097620_100182775 3300006931 Bacteria 2180
420 Ga0097620_100183241 3300006931 Unclassified 2177
421 Ga0097620_100232321 3300006931 Bacteria 1933
422 Ga0097620_100366299 3300006931 Bacteria 1536
423 Ga0097620_100391444 3300006931 Bacteria 1485
424 Ga0097620_100404905 3300006931 Bacteria 1460
425 Ga0105251_10095755 3300009011 Bacteria 1360
426 Ga0105240_10000258 3300009093 Bacteria 105011
427 Ga0105240_10000715 3300009093 Bacteria 60725
428 Ga0105240_10002252 3300009093 Bacteria 31329
429 Ga0105240_10004553 3300009093 Bacteria 21043
430 Ga0105240_10004621 3300009093 Bacteria 20878
431 Ga0105240_10016056 3300009093 Bacteria 10147
432 Ga0105240_10023337 3300009093 Bacteria 8185
433 Ga0105240_10039801 3300009093 Bacteria 6017
434 Ga0105240_10054842 3300009093 Bacteria 4993
435 Ga0105240_10060026 3300009093 Bacteria 4742
436 Ga0105240_10203604 3300009093 Unclassified 2318
437 Ga0105240_10212273 3300009093 Bacteria 2261
438 Ga0111539_10162199 3300009094 Unclassified 2614
439 Ga0105245_10507780 3300009098 Bacteria 1222
440 Ga0105247_10001409 3300009101 Bacteria 17436
441 Ga0105247_10008259 3300009101 Bacteria 6354
442 Ga0114129_10015867 3300009147 Bacteria 10712
443 Ga0105241_10000224 3300009174 Bacteria 42685
444 Ga0105241_10000533 3300009174 Bacteria 28600
445 Ga0105241_10069438 3300009174 Bacteria 2732
446 Ga0105241_10097536 3300009174 Bacteria 2331
447 Ga0105241_10139058 3300009174 Bacteria 1975
448 Ga0105241_10259768 3300009174 Unclassified 1476
449 Ga0105241_10332089 3300009174 Bacteria 1314
450 Ga0105241_10769260 3300009174 Bacteria 884
451 Ga0105242_10043542 3300009176 Bacteria 3631
452 Ga0105242_10056582 3300009176 Unclassified 3210
453 Ga0105242_10076969 3300009176 Bacteria 2782
454 Ga0105242_10451632 3300009176 Bacteria 1212
455 Ga0105242_10631368 3300009176 Bacteria 1039
456 Ga0105242_10844261 3300009176 Bacteria 911
457 Ga0105248_10004939 3300009177 Bacteria 14734
458 Ga0105248_10060288 3300009177 Bacteria 4260
459 Ga0105237_10005490 3300009545 Bacteria 14294
460 Ga0105237_10005694 3300009545 Bacteria 14017
461 Ga0105237_10014096 3300009545 Bacteria 8363
462 Ga0105237_10022472 3300009545 Bacteria 6471
463 Ga0105237_10047089 3300009545 Bacteria 4335
464 Ga0105237_10064862 3300009545 Bacteria 3648
465 Ga0105237_10098324 3300009545 Bacteria 2918
466 Ga0105237_10126957 3300009545 Unclassified 2545
467 Ga0105238_10006981 3300009551 Bacteria 11286
468 Ga0105238_10064549 3300009551 Unclassified 3662
469 Ga0105238_10078160 3300009551 Bacteria 3300
470 Ga0105238_10134127 3300009551 Unclassified 2454
471 Ga0105249_10001958 3300009553 Bacteria 17861
472 Ga0105249_10023081 3300009553 Bacteria 5579
473 Ga0105249_10034852 3300009553 Unclassified 4562
474 Ga0105249_10041170 3300009553 Bacteria 4198
475 Ga0105249_10102452 3300009553 Unclassified 2694
476 Ga0105249_10580375 3300009553 Bacteria 1174
477 Ga0105249_10596564 3300009553 Bacteria 1159
478 Ga0105249_10974557 3300009553 Bacteria 916
479 Ga0105239_10001037 3300010375 Bacteria 38729
480 Ga0105239_10011083 3300010375 Bacteria 10062
481 Ga0105239_10017966 3300010375 Bacteria 7820
482 Ga0105239_10043883 3300010375 Bacteria 4903
483 Ga0105239_10066389 3300010375 Bacteria 3963
484 Ga0105239_10127719 3300010375 Bacteria 2826
485 Ga0105239_10192320 3300010375 Bacteria 2284
486 Ga0105239_10371360 3300010375 Bacteria 1616
487 Ga0105239_10386859 3300010375 Unclassified 1582
488 Ga0105239_10411698 3300010375 Bacteria 1531
489 Ga0105246_10005718 3300011119 Bacteria 7591
490 Ga0105246_10094380 3300011119 Bacteria 2164
491 Ga0105246_10145723 3300011119 Bacteria 1786
492 Ga0105246_10215943 3300011119 Bacteria 1500
493 Ga0105246_10425992 3300011119 Bacteria 1109
494 Ga0105246_10767641 3300011119 Bacteria 852
495 Ga0157373_10000275 3300013100 Bacteria 41320
496 Ga0157373_10015282 3300013100 Bacteria 5611
497 Ga0157373_10016691 3300013100 Bacteria 5350
498 Ga0157373_10026324 3300013100 Bacteria 4202
499 Ga0157373_10038389 3300013100 Unclassified 3432
500 Ga0157373_10050702 3300013100 Bacteria 2955
501 Ga0157373_10110592 3300013100 Unclassified 1932
502 Ga0157373_10211189 3300013100 Bacteria 1369
503 Ga0157373_10277050 3300013100 Unclassified 1188
504 Ga0157373_10290340 3300013100 Unclassified 1160
505 Ga0157371_10000596 3300013102 Bacteria 43030
506 Ga0157371_10002078 3300013102 Bacteria 19616
507 Ga0157371_10011331 3300013102 Bacteria 6878
508 Ga0157371_10012915 3300013102 Bacteria 6359
509 Ga0157371_10024481 3300013102 Bacteria 4408
510 Ga0157371_10029505 3300013102 Bacteria 3965
511 Ga0157371_10064707 3300013102 Bacteria 2591
512 Ga0157371_10091472 3300013102 Bacteria 2155
513 Ga0157371_10091597 3300013102 Bacteria 2153
514 Ga0157371_10110867 3300013102 Bacteria 1947
515 Ga0157371_10137041 3300013102 Bacteria 1743
516 Ga0157371_10162979 3300013102 Bacteria 1592
517 Ga0157371_10169831 3300013102 Bacteria 1558
518 Ga0157371_10179070 3300013102 Bacteria 1516
519 Ga0157371_10226367 3300013102 Bacteria 1343
520 Ga0157371_10263919 3300013102 Bacteria 1242
521 Ga0157371_10755418 3300013102 Bacteria 730
522 Ga0157370_10000238 3300013104 Bacteria 70036
523 Ga0157370_10000405 3300013104 Bacteria 54383
524 Ga0157370_10001393 3300013104 Bacteria 29968
525 Ga0157370_10005886 3300013104 Bacteria 13672
526 Ga0157370_10055078 3300013104 Bacteria 3790
527 Ga0157370_10070212 3300013104 Bacteria 3307
528 Ga0157370_10160251 3300013104 Bacteria 2093
529 Ga0157370_10209739 3300013104 Unclassified 1806
530 Ga0157370_10322742 3300013104 Bacteria 1424
531 Ga0157370_10389986 3300013104 Bacteria 1282
532 Ga0157370_10770037 3300013104 Bacteria 876
533 Ga0157369_10023820 3300013105 Bacteria 6816
534 Ga0157369_10040594 3300013105 Bacteria 5079
535 Ga0157369_10059170 3300013105 Bacteria 4132
536 Ga0157369_10067243 3300013105 Bacteria 3853
537 Ga0157369_10068914 3300013105 Bacteria 3801
538 Ga0157369_10100151 3300013105 Unclassified 3089
539 Ga0157369_10161499 3300013105 Bacteria 2365
540 Ga0157369_10185665 3300013105 Bacteria 2187
541 Ga0157369_10188812 3300013105 Unclassified 2166
542 Ga0157369_10279023 3300013105 Bacteria 1740
543 Ga0157369_10366869 3300013105 Bacteria 1495
544 Ga0157369_10485617 3300013105 Bacteria 1278
545 Ga0157369_10583150 3300013105 Bacteria 1155
546 Ga0157369_10997484 3300013105 Bacteria 857
547 Ga0157374_10000841 3300013296 Bacteria 26835
548 Ga0157374_10006478 3300013296 Bacteria 9936
549 Ga0157374_10015281 3300013296 Bacteria 6732
550 Ga0157374_10017671 3300013296 Bacteria 6284
551 Ga0157374_10046728 3300013296 Bacteria 4011
552 Ga0157374_10128112 3300013296 Unclassified 2455
553 Ga0157374_10154491 3300013296 Bacteria 2232
554 Ga0157374_10296805 3300013296 Unclassified 1598
555 Ga0157374_10357898 3300013296 Bacteria 1451
556 Ga0157374_10450174 3300013296 Bacteria 1289
557 Ga0157374_10490250 3300013296 Bacteria 1233
558 Ga0157374_11316718 3300013296 Bacteria 744
559 Ga0157378_10002090 3300013297 Bacteria 17837
560 Ga0157378_10005857 3300013297 Bacteria 10768
561 Ga0157378_10010065 3300013297 Bacteria 8242
562 Ga0157378_10012644 3300013297 Bacteria 7387
563 Ga0157378_10023595 3300013297 Bacteria 5411
564 Ga0157378_10031342 3300013297 Bacteria 4697
565 Ga0157378_10045275 3300013297 Unclassified 3909
566 Ga0157378_10069077 3300013297 Bacteria 3169
567 Ga0157378_10101789 3300013297 Bacteria 2624
568 Ga0157378_10132143 3300013297 Unclassified 2311
569 Ga0157378_10369500 3300013297 Unclassified 1406
570 Ga0157378_10415877 3300013297 Bacteria 1328
571 Ga0157378_11065749 3300013297 Bacteria 844
572 Ga0157378_11356574 3300013297 Bacteria 753
573 Ga0163162_10000100 3300013306 Bacteria 78269
574 Ga0163162_10000279 3300013306 Bacteria 46872
575 Ga0163162_10001517 3300013306 Bacteria 21625
576 Ga0163162_10003820 3300013306 Bacteria 14438
577 Ga0163162_10004813 3300013306 Bacteria 13027
578 Ga0163162_10006228 3300013306 Bacteria 11565
579 Ga0163162_10006285 3300013306 Bacteria 11505
580 Ga0163162_10020346 3300013306 Bacteria 6519
581 Ga0163162_10038399 3300013306 Bacteria 4778
582 Ga0163162_10118184 3300013306 Unclassified 2753
583 Ga0163162_10162009 3300013306 Bacteria 2359
584 Ga0163162_10387958 3300013306 Bacteria 1530
585 Ga0163162_10502404 3300013306 Bacteria 1343
586 Ga0163162_10551733 3300013306 Unclassified 1280
587 Ga0163162_11602752 3300013306 Bacteria 743
588 Ga0157372_10002704 3300013307 Bacteria 19172
589 Ga0157372_10009200 3300013307 Bacteria 10502
590 Ga0157372_10010252 3300013307 Bacteria 9953
591 Ga0157372_10010966 3300013307 Bacteria 9644
592 Ga0157372_10015765 3300013307 Bacteria 8107
593 Ga0157372_10029622 3300013307 Bacteria 5980
594 Ga0157372_10031629 3300013307 Bacteria 5794
595 Ga0157372_10072476 3300013307 Bacteria 3882
596 Ga0157372_10090343 3300013307 Bacteria 3482
597 Ga0157372_10103164 3300013307 Bacteria 3258
598 Ga0157372_10109383 3300013307 Bacteria 3165
599 Ga0157372_10113091 3300013307 Bacteria 3111
600 Ga0157372_10114415 3300013307 Bacteria 3093
601 Ga0157372_10139494 3300013307 Bacteria 2792
602 Ga0157372_10141929 3300013307 Bacteria 2768
603 Ga0157372_10156889 3300013307 Bacteria 2629
604 Ga0157372_10165768 3300013307 Bacteria 2555
605 Ga0157372_10199261 3300013307 Bacteria 2319
606 Ga0157372_10222536 3300013307 Bacteria 2188
607 Ga0157372_10294364 3300013307 Unclassified 1888
608 Ga0157372_10298073 3300013307 Bacteria 1875
609 Ga0157372_10382776 3300013307 Unclassified 1639
610 Ga0157372_10388080 3300013307 Bacteria 1627
611 Ga0157372_10388520 3300013307 Bacteria 1626
612 Ga0157372_10626420 3300013307 Bacteria 1253
613 Ga0157372_10677249 3300013307 Bacteria 1201
614 Ga0157372_10711664 3300013307 Bacteria 1168
615 Ga0157372_10791279 3300013307 Unclassified 1102
616 Ga0157372_11149835 3300013307 Bacteria 897
617 Ga0157372_11462428 3300013307 Bacteria 787
618 Ga0157375_10000057 3300013308 Bacteria 122654
619 Ga0157375_10000336 3300013308 Bacteria 42479
620 Ga0157375_10038477 3300013308 Unclassified 4593
621 Ga0157375_10039491 3300013308 Bacteria 4543
622 Ga0157375_10053145 3300013308 Bacteria 3985
623 Ga0157375_10064756 3300013308 Bacteria 3641
624 Ga0157375_10076446 3300013308 Bacteria 3375
625 Ga0157375_10084012 3300013308 Bacteria 3231
626 Ga0157375_10086998 3300013308 Bacteria 3177
627 Ga0157375_10155431 3300013308 Bacteria 2426
628 Ga0157375_10166926 3300013308 Bacteria 2346
629 Ga0157375_10183454 3300013308 Bacteria 2245
630 Ga0157375_10275825 3300013308 Bacteria 1844
631 Ga0157375_10289583 3300013308 Unclassified 1801
632 Ga0157375_10348648 3300013308 Unclassified 1646
633 Ga0157375_10357986 3300013308 Bacteria 1625
634 Ga0157375_10653920 3300013308 Unclassified 1207
635 Ga0157375_10704417 3300013308 Bacteria 1163
636 Ga0157375_10734074 3300013308 Bacteria 1140
637 Ga0157375_11143710 3300013308 Bacteria 912
638 Ga0163163_10000193 3300014325 Bacteria 62699
639 Ga0163163_10000254 3300014325 Bacteria 54049
640 Ga0163163_10002122 3300014325 Bacteria 16737
641 Ga0163163_10009925 3300014325 Bacteria 8537
642 Ga0163163_10020274 3300014325 Bacteria 6258
643 Ga0163163_10142515 3300014325 Bacteria 2439
644 Ga0163163_10232058 3300014325 Bacteria 1894
645 Ga0163163_10238362 3300014325 Bacteria 1868
646 Ga0163163_10442588 3300014325 Bacteria 1359
647 Ga0163163_10506995 3300014325 Bacteria 1268
648 Ga0157380_10001093 3300014326 Bacteria 17458
649 Ga0157380_10006970 3300014326 Bacteria 7998
650 Ga0157380_10010950 3300014326 Bacteria 6540
651 Ga0157380_10150228 3300014326 Unclassified 2013
652 Ga0157380_10196143 3300014326 Bacteria 1787
653 Ga0157380_10248107 3300014326 Unclassified 1609
654 Ga0157380_10272719 3300014326 Bacteria 1543
655 Ga0157380_10399881 3300014326 Bacteria 1303
656 Ga0157380_10735489 3300014326 Bacteria 996
657 Ga0157380_11066258 3300014326 Bacteria 845
658 Ga0157377_10028251 3300014745 Bacteria 3018
659 Ga0157377_10057265 3300014745 Unclassified 2215
660 Ga0157377_10197146 3300014745 Unclassified 1276
661 Ga0157377_10210314 3300014745 Unclassified 1240
662 Ga0157379_10000367 3300014968 Bacteria 36246
663 Ga0157379_10017665 3300014968 Bacteria 6283
664 Ga0157379_10026404 3300014968 Bacteria 5170
665 Ga0157379_10033384 3300014968 Bacteria 4589
666 Ga0157379_10047182 3300014968 Bacteria 3842
667 Ga0157379_10132198 3300014968 Bacteria 2246
668 Ga0157379_10145105 3300014968 Bacteria 2140
669 Ga0157379_10304482 3300014968 Unclassified 1453
670 Ga0157379_10583198 3300014968 Bacteria 1042
671 Ga0157376_10000135 3300014969 Bacteria 50667
672 Ga0157376_10002989 3300014969 Bacteria 11593
673 Ga0157376_10007359 3300014969 Bacteria 7849
674 Ga0157376_10019024 3300014969 Bacteria 5283
675 Ga0157376_10127764 3300014969 Bacteria 2264
676 Ga0157376_10216996 3300014969 Unclassified 1769
677 Ga0157376_10242873 3300014969 Bacteria 1678
678 Ga0157376_10355273 3300014969 Bacteria 1404
679 Ga0157376_10411918 3300014969 Bacteria 1309
680 Ga0157376_10526796 3300014969 Unclassified 1166
681 Ga0157376_10766548 3300014969 Bacteria 975
682 Ga0163161_10001091 3300017792 Bacteria 20526
683 Ga0163161_10035078 3300017792 Bacteria 3589
684 Ga0163161_10101064 3300017792 Bacteria 2147
685 Ga0163161_10104760 3300017792 Bacteria 2109
686 Ga0163161_10268021 3300017792 Bacteria 1335
687 Ga0163161_10485161 3300017792 Bacteria 1004
688 Ga0197907_10191818 3300020069 Bacteria 1660
689 Ga0197907_10951066 3300020069 Bacteria 1812
690 Ga0206356_11664014 3300020070 Bacteria 1543
691 Ga0206355_1373070 3300020076 Unclassified 1018
692 Ga0206352_10396221 3300020078 Unclassified 965
693 Ga0206352_11083765 3300020078 Bacteria 1973
694 Ga0213876_10001740 3300021384 Bacteria 13213
695 Ga0213876_10010098 3300021384 Bacteria 5073
696 Ga0224712_10165530 3300022467 Unclassified 989
697 Ga0207426_1000104 3300025302 Bacteria 249464
698 Ga0207697_10013979 3300025315 Bacteria 3341
699 Ga0207697_10093496 3300025315 Unclassified 1276
700 Ga0207697_10181130 3300025315 Unclassified 923
701 Ga0207656_10002124 3300025321 Bacteria 6625
702 Ga0207682_10001049 3300025893 Bacteria 12716
703 Ga0207682_10063133 3300025893 Bacteria 1554
704 Ga0207642_10027167 3300025899 Bacteria 2340
705 Ga0207710_10012887 3300025900 Bacteria 3522
706 Ga0207710_10050658 3300025900 Unclassified 1863
707 Ga0207688_10035812 3300025901 Unclassified 2750
708 Ga0207688_10045084 3300025901 Unclassified 2459
709 Ga0207688_10077139 3300025901 Bacteria 1898
710 Ga0207680_10000371 3300025903 Bacteria 21501
711 Ga0207680_10025925 3300025903 Unclassified 3240
712 Ga0207680_10028803 3300025903 Bacteria 3112
713 Ga0207680_10075669 3300025903 Unclassified 2100
714 Ga0207680_10449108 3300025903 Bacteria 915
715 Ga0207647_10004784 3300025904 Bacteria 10024
716 Ga0207647_10012837 3300025904 Bacteria 5819
717 Ga0207647_10019112 3300025904 Bacteria 4613
718 Ga0207685_10010434 3300025905 Bacteria 2743
719 Ga0207645_10000511 3300025907 Bacteria 32164
720 Ga0207645_10004291 3300025907 Bacteria 10577
721 Ga0207645_10017285 3300025907 Unclassified 4765
722 Ga0207645_10297712 3300025907 Unclassified 1074
723 Ga0207645_10507983 3300025907 Bacteria 816
724 Ga0207643_10001735 3300025908 Bacteria 12216
725 Ga0207643_10061009 3300025908 Bacteria 2153
726 Ga0207643_10089852 3300025908 Unclassified 1789
727 Ga0207643_10205166 3300025908 Bacteria 1201
728 Ga0207643_10250150 3300025908 Bacteria 1092
729 Ga0207705_10034312 3300025909 Bacteria 3627
730 Ga0207705_10043425 3300025909 Bacteria 3230
731 Ga0207705_10163048 3300025909 Bacteria 1675
732 Ga0207705_10308121 3300025909 Bacteria 1215
733 Ga0207705_10345656 3300025909 Bacteria 1145
734 Ga0207705_10541303 3300025909 Bacteria 905
735 Ga0207654_10001646 3300025911 Bacteria 11680
736 Ga0207654_10003857 3300025911 Bacteria 7553
737 Ga0207654_10239301 3300025911 Bacteria 1212
738 Ga0207707_10000574 3300025912 Bacteria 37317
739 Ga0207707_10046727 3300025912 Bacteria 3771
740 Ga0207707_10073490 3300025912 Bacteria 2982
741 Ga0207707_10177512 3300025912 Bacteria 1860
742 Ga0207707_10255823 3300025912 Bacteria 1520
743 Ga0207707_10255895 3300025912 Bacteria 1520
744 Ga0207707_10476152 3300025912 Unclassified 1067
745 Ga0207707_10752275 3300025912 Bacteria 815
746 Ga0207695_10000327 3300025913 Bacteria 113436
747 Ga0207695_10000486 3300025913 Bacteria 84856
748 Ga0207695_10003818 3300025913 Bacteria 20882
749 Ga0207695_10008726 3300025913 Bacteria 12639
750 Ga0207695_10008950 3300025913 Bacteria 12463
751 Ga0207695_10012720 3300025913 Bacteria 10076
752 Ga0207695_10038067 3300025913 Bacteria 5184
753 Ga0207695_10043454 3300025913 Bacteria 4789
754 Ga0207695_10099398 3300025913 Unclassified 2907
755 Ga0207695_10152595 3300025913 Unclassified 2248
756 Ga0207671_10001742 3300025914 Bacteria 24460
757 Ga0207671_10004018 3300025914 Bacteria 14291
758 Ga0207671_10006632 3300025914 Bacteria 10262
759 Ga0207671_10059149 3300025914 Bacteria 2841
760 Ga0207671_10071305 3300025914 Unclassified 2591
761 Ga0207671_10166148 3300025914 Bacteria 1711
762 Ga0207671_10214903 3300025914 Bacteria 1505
763 Ga0207671_10384454 3300025914 Bacteria 1115
764 Ga0207660_10010881 3300025917 Bacteria 5915
765 Ga0207660_10135955 3300025917 Bacteria 1876
766 Ga0207662_10033075 3300025918 Bacteria 3012
767 Ga0207662_10327142 3300025918 Bacteria 1024
768 Ga0207657_10004159 3300025919 Bacteria 15337
769 Ga0207657_10018632 3300025919 Bacteria 6618
770 Ga0207657_10029137 3300025919 Bacteria 5029
771 Ga0207657_10136773 3300025919 Bacteria 2004
772 Ga0207657_10400054 3300025919 Bacteria 1080
773 Ga0207649_10006464 3300025920 Bacteria 6364
774 Ga0207649_10022783 3300025920 Bacteria 3619
775 Ga0207649_10082255 3300025920 Unclassified 2087
776 Ga0207649_10206618 3300025920 Bacteria 1390
777 Ga0207652_10000210 3300025921 Bacteria 61797
778 Ga0207652_10001002 3300025921 Bacteria 26045
779 Ga0207652_10002655 3300025921 Bacteria 15013
780 Ga0207652_10007311 3300025921 Bacteria 8898
781 Ga0207652_10028457 3300025921 Bacteria 4662
782 Ga0207652_10045845 3300025921 Bacteria 3728
783 Ga0207652_10058906 3300025921 Bacteria 3309
784 Ga0207652_10135432 3300025921 Bacteria 2199
785 Ga0207652_10175339 3300025921 Bacteria 1925
786 Ga0207652_10331774 3300025921 Bacteria 1373
787 Ga0207681_10027241 3300025923 Unclassified 3694
788 Ga0207681_10068587 3300025923 Bacteria 2464
789 Ga0207681_10330514 3300025923 Unclassified 1215
790 Ga0207694_10057302 3300025924 Unclassified 3029
791 Ga0207694_10061747 3300025924 Bacteria 2917
792 Ga0207694_10262784 3300025924 Bacteria 1414
793 Ga0207650_10009262 3300025925 Bacteria 6729
794 Ga0207650_10025960 3300025925 Unclassified 4176
795 Ga0207650_10041161 3300025925 Unclassified 3384
796 Ga0207650_10097267 3300025925 Bacteria 2260
797 Ga0207650_10117984 3300025925 Bacteria 2062
798 Ga0207650_10134753 3300025925 Bacteria 1936
799 Ga0207650_10313288 3300025925 Bacteria 1284
800 Ga0207650_10911341 3300025925 Bacteria 746
801 Ga0207659_10052816 3300025926 Bacteria 2897
802 Ga0207659_10077944 3300025926 Bacteria 2441
803 Ga0207659_10095451 3300025926 Bacteria 2230
804 Ga0207659_10185262 3300025926 Bacteria 1652
805 Ga0207659_10231083 3300025926 Unclassified 1492
806 Ga0207644_10045467 3300025931 Bacteria 3123
807 Ga0207644_10226122 3300025931 Bacteria 1485
808 Ga0207644_10248240 3300025931 Bacteria 1419
809 Ga0207644_10651355 3300025931 Bacteria 877
810 Ga0207644_10720483 3300025931 Unclassified 832
811 Ga0207644_10742717 3300025931 Bacteria 819
812 Ga0207690_10008207 3300025932 Bacteria 6194
813 Ga0207690_10029723 3300025932 Bacteria 3477
814 Ga0207690_10217383 3300025932 Bacteria 1460
815 Ga0207690_10358006 3300025932 Bacteria 1155
816 Ga0207706_10003803 3300025933 Bacteria 14383
817 Ga0207706_10005368 3300025933 Bacteria 11945
818 Ga0207706_10007905 3300025933 Bacteria 9817
819 Ga0207706_10026061 3300025933 Bacteria 5235
820 Ga0207706_10031025 3300025933 Bacteria 4763
821 Ga0207706_10032502 3300025933 Bacteria 4646
822 Ga0207706_10654384 3300025933 Unclassified 900
823 Ga0207686_10010535 3300025934 Bacteria 5037
824 Ga0207686_10023055 3300025934 Bacteria 3590
825 Ga0207686_10030121 3300025934 Unclassified 3210
826 Ga0207686_10147518 3300025934 Unclassified 1634
827 Ga0207686_10552608 3300025934 Bacteria 900
828 Ga0207670_10012704 3300025936 Bacteria 4936
829 Ga0207670_10113038 3300025936 Bacteria 1960
830 Ga0207670_10321076 3300025936 Bacteria 1218
831 Ga0207670_10797940 3300025936 Bacteria 786
832 Ga0207669_10043590 3300025937 Bacteria 2629
833 Ga0207669_10060082 3300025937 Bacteria 2328
834 Ga0207669_10077992 3300025937 Bacteria 2109
835 Ga0207669_10270361 3300025937 Bacteria 1276
836 Ga0207669_10310274 3300025937 Bacteria 1203
837 Ga0207704_10000484 3300025938 Bacteria 17750
838 Ga0207704_10045597 3300025938 Unclassified 2605
839 Ga0207704_10102486 3300025938 Bacteria 1912
840 Ga0207691_10002120 3300025940 Bacteria 19396
841 Ga0207691_10012396 3300025940 Bacteria 8172
842 Ga0207691_10013692 3300025940 Bacteria 7750
843 Ga0207691_10043591 3300025940 Bacteria 4134
844 Ga0207691_10064166 3300025940 Bacteria 3328
845 Ga0207691_10078152 3300025940 Bacteria 2979
846 Ga0207691_10079939 3300025940 Bacteria 2942
847 Ga0207691_10098164 3300025940 Bacteria 2617
848 Ga0207691_10213394 3300025940 Bacteria 1676
849 Ga0207691_10428141 3300025940 Bacteria 1127
850 Ga0207691_10478718 3300025940 Bacteria 1058
851 Ga0207711_10249460 3300025941 Bacteria 1630
852 Ga0207689_10000329 3300025942 Bacteria 44014
853 Ga0207689_10002405 3300025942 Bacteria 17429
854 Ga0207689_10005043 3300025942 Bacteria 11902
855 Ga0207689_10010393 3300025942 Bacteria 8016
856 Ga0207689_10021416 3300025942 Bacteria 5435
857 Ga0207689_10038305 3300025942 Bacteria 3972
858 Ga0207689_10044691 3300025942 Bacteria 3663
859 Ga0207689_10361108 3300025942 Unclassified 1208
860 Ga0207689_10381998 3300025942 Unclassified 1173
861 Ga0207661_10007884 3300025944 Bacteria 7589
862 Ga0207661_10043012 3300025944 Bacteria 3564
863 Ga0207661_10056567 3300025944 Bacteria 3149
864 Ga0207661_10107804 3300025944 Unclassified 2350
865 Ga0207679_10000751 3300025945 Bacteria 21527
866 Ga0207679_10001121 3300025945 Bacteria 17095
867 Ga0207679_10070887 3300025945 Bacteria 2627
868 Ga0207679_10113802 3300025945 Unclassified 2141
869 Ga0207679_10181918 3300025945 Bacteria 1740
870 Ga0207679_10191868 3300025945 Bacteria 1699
871 Ga0207679_10287659 3300025945 Bacteria 1412
872 Ga0207679_10470098 3300025945 Bacteria 1118
873 Ga0207667_10000340 3300025949 Bacteria 63904
874 Ga0207667_10009409 3300025949 Bacteria 11510
875 Ga0207667_10058269 3300025949 Bacteria 4052
876 Ga0207667_10061201 3300025949 Bacteria 3939
877 Ga0207667_10089071 3300025949 Bacteria 3190
878 Ga0207667_10109580 3300025949 Bacteria 2848
879 Ga0207667_10167573 3300025949 Bacteria 2258
880 Ga0207667_10235251 3300025949 Bacteria 1875
881 Ga0207667_10272676 3300025949 Bacteria 1729
882 Ga0207651_10002824 3300025960 Bacteria 8358
883 Ga0207651_10043146 3300025960 Bacteria 3008
884 Ga0207651_10069071 3300025960 Bacteria 2494
885 Ga0207651_10108025 3300025960 Bacteria 2081
886 Ga0207651_10119421 3300025960 Bacteria 1996
887 Ga0207651_10127715 3300025960 Unclassified 1940
888 Ga0207651_10297261 3300025960 Bacteria 1341
889 Ga0207651_10514420 3300025960 Bacteria 1036
890 Ga0207712_10001475 3300025961 Bacteria 16057
891 Ga0207712_10011683 3300025961 Bacteria 5598
892 Ga0207712_10012015 3300025961 Bacteria 5526
893 Ga0207712_10013170 3300025961 Bacteria 5301
894 Ga0207712_10031288 3300025961 Bacteria 3583
895 Ga0207712_10395825 3300025961 Bacteria 1160
896 Ga0207712_11050023 3300025961 Bacteria 724
897 Ga0207668_10034958 3300025972 Bacteria 3342
898 Ga0207668_10251892 3300025972 Bacteria 1434
899 Ga0207668_10328437 3300025972 Bacteria 1272
900 Ga0207640_10017218 3300025981 Bacteria 4223
901 Ga0207640_10155426 3300025981 Unclassified 1685
902 Ga0207640_10270452 3300025981 Unclassified 1329
903 Ga0207640_10639296 3300025981 Bacteria 905
904 Ga0207658_10000847 3300025986 Bacteria 25559
905 Ga0207658_10039539 3300025986 Bacteria 3403
906 Ga0207658_10051028 3300025986 Bacteria 3047
907 Ga0207658_10090037 3300025986 Bacteria 2377
908 Ga0207658_10260123 3300025986 Bacteria 1479
909 Ga0207658_10303514 3300025986 Unclassified 1376
910 Ga0207658_10591277 3300025986 Bacteria 996
911 Ga0207677_10001136 3300026023 Bacteria 14521
912 Ga0207677_10007895 3300026023 Bacteria 5915
913 Ga0207677_10018452 3300026023 Bacteria 4186
914 Ga0207677_10062805 3300026023 Unclassified 2578
915 Ga0207677_10067033 3300026023 Bacteria 2513
916 Ga0207677_10256846 3300026023 Unclassified 1422
917 Ga0207677_10369311 3300026023 Bacteria 1208
918 Ga0207677_10764604 3300026023 Bacteria 862
919 Ga0207703_10010768 3300026035 Bacteria 7135
920 Ga0207703_10040034 3300026035 Bacteria 3749
921 Ga0207703_10091248 3300026035 Bacteria 2562
922 Ga0207703_10276170 3300026035 Bacteria 1524
923 Ga0207703_10459619 3300026035 Bacteria 1190
924 Ga0207703_10790010 3300026035 Bacteria 906
925 Ga0207703_10827590 3300026035 Bacteria 885
926 Ga0207639_10010003 3300026041 Bacteria 6556
927 Ga0207639_10016589 3300026041 Bacteria 5213
928 Ga0207639_10019883 3300026041 Bacteria 4798
929 Ga0207639_10026659 3300026041 Bacteria 4200
930 Ga0207639_10123392 3300026041 Bacteria 2132
931 Ga0207639_10138006 3300026041 Unclassified 2028
932 Ga0207639_10149936 3300026041 Bacteria 1952
933 Ga0207639_10196223 3300026041 Unclassified 1728
934 Ga0207639_10200336 3300026041 Bacteria 1712
935 Ga0207639_10280880 3300026041 Bacteria 1464
936 Ga0207639_10289581 3300026041 Bacteria 1443
937 Ga0207639_10323026 3300026041 Unclassified 1371
938 Ga0207639_10379437 3300026041 Bacteria 1269
939 Ga0207639_10607474 3300026041 Bacteria 1009
940 Ga0207639_10655436 3300026041 Bacteria 971
941 Ga0207639_10723978 3300026041 Unclassified 924
942 Ga0207678_10013940 3300026067 Bacteria 7065
943 Ga0207678_10108296 3300026067 Bacteria 2370
944 Ga0207678_10171337 3300026067 Bacteria 1853
945 Ga0207708_10049982 3300026075 Bacteria 3183
946 Ga0207708_10132051 3300026075 Bacteria 1953
947 Ga0207708_10507710 3300026075 Unclassified 1011
948 Ga0207702_10093619 3300026078 Bacteria 2635
949 Ga0207702_10138992 3300026078 Bacteria 2195
950 Ga0207702_10643854 3300026078 Bacteria 1042
951 Ga0207641_10000152 3300026088 Bacteria 98311
952 Ga0207641_10000418 3300026088 Bacteria 49680
953 Ga0207641_10004489 3300026088 Bacteria 12072
954 Ga0207641_10051955 3300026088 Bacteria 3470
955 Ga0207641_10087159 3300026088 Bacteria 2724
956 Ga0207641_10115859 3300026088 Bacteria 2383
957 Ga0207641_10365245 3300026088 Bacteria 1379
958 Ga0207648_10001186 3300026089 Bacteria 29157
959 Ga0207648_10031158 3300026089 Bacteria 4715
960 Ga0207648_10045600 3300026089 Bacteria 3845
961 Ga0207648_10055669 3300026089 Bacteria 3452
962 Ga0207648_10063825 3300026089 Bacteria 3210
963 Ga0207648_10097621 3300026089 Bacteria 2571
964 Ga0207648_10101771 3300026089 Unclassified 2517
965 Ga0207648_10146808 3300026089 Unclassified 2080
966 Ga0207648_10148765 3300026089 Bacteria 2066
967 Ga0207648_10238101 3300026089 Bacteria 1620
968 Ga0207648_10643040 3300026089 Unclassified 980
969 Ga0207648_10733062 3300026089 Unclassified 917
970 Ga0207648_11067979 3300026089 Bacteria 757
971 Ga0207676_10006216 3300026095 Bacteria 8433
972 Ga0207676_10098522 3300026095 Unclassified 2417
973 Ga0207676_10367815 3300026095 Bacteria 1335
974 Ga0207676_10389956 3300026095 Unclassified 1299
975 Ga0207676_10586540 3300026095 Bacteria 1069
976 Ga0207676_11199633 3300026095 Bacteria 752
977 Ga0207674_10006492 3300026116 Bacteria 13755
978 Ga0207674_10012911 3300026116 Bacteria 9316
979 Ga0207674_10030052 3300026116 Bacteria 5715
980 Ga0207674_10081980 3300026116 Bacteria 3227
981 Ga0207674_10184496 3300026116 Bacteria 2037
982 Ga0207674_10254963 3300026116 Bacteria 1701
983 Ga0207674_10516949 3300026116 Bacteria 1153
984 Ga0207674_10754037 3300026116 Bacteria 940
985 Ga0207675_100062346 3300026118 Bacteria 3482
986 Ga0207675_100062529 3300026118 Bacteria 3477
987 Ga0207675_100075735 3300026118 Bacteria 3150
988 Ga0207675_100099250 3300026118 Bacteria 2743
989 Ga0207675_100103587 3300026118 Bacteria 2682
990 Ga0207675_100217452 3300026118 Unclassified 1840
991 Ga0207675_100233673 3300026118 Bacteria 1774
992 Ga0207675_100239542 3300026118 Bacteria 1753
993 Ga0207675_100337059 3300026118 Bacteria 1475
994 Ga0207683_10057040 3300026121 Unclassified 3428
995 Ga0207683_10141863 3300026121 Bacteria 2165
996 Ga0207683_10149980 3300026121 Bacteria 2104
997 Ga0207683_10178411 3300026121 Bacteria 1925
998 Ga0207683_10222892 3300026121 Unclassified 1718
999 Ga0207683_10259266 3300026121 Bacteria 1588
1000 Ga0207698_10008700 3300026142 Bacteria 6434
1001 Ga0207698_10023196 3300026142 Bacteria 4330
1002 Ga0207698_10024494 3300026142 Bacteria 4237
1003 Ga0207698_10025309 3300026142 Bacteria 4178
1004 Ga0207698_10033415 3300026142 Bacteria 3738
1005 Ga0207698_10049762 3300026142 Bacteria 3192
1006 Ga0207698_10065551 3300026142 Bacteria 2853
1007 Ga0207698_10080035 3300026142 Unclassified 2630
1008 Ga0207698_10140634 3300026142 Bacteria 2079
1009 Ga0207698_10156315 3300026142 Bacteria 1987
1010 Ga0207698_10308193 3300026142 Bacteria 1477
1011 Ga0209984_1016211 3300027424 Bacteria 994
1012 Ga0209995_1025689 3300027471 Unclassified 982
1013 Ga0268266_10000034 3300028379 Bacteria 354251
1014 Ga0268266_10002645 3300028379 Bacteria 18878
1015 Ga0268266_10028759 3300028379 Bacteria 4725
1016 Ga0268266_10960939 3300028379 Bacteria 827
1017 Ga0268265_10044613 3300028380 Bacteria 3302
1018 Ga0268265_10045980 3300028380 Bacteria 3261
1019 Ga0268265_10472459 3300028380 Unclassified 1176
1020 Ga0268265_11386286 3300028380 Bacteria 705
1021 Ga0268264_10000117 3300028381 Bacteria 195037
1022 Ga0268264_10005355 3300028381 Bacteria 10876
1023 Ga0268264_10007632 3300028381 Bacteria 9016
1024 Ga0268264_10024882 3300028381 Bacteria 4892
1025 Ga0268264_10090261 3300028381 Bacteria 2640
1026 Ga0268264_10103812 3300028381 Unclassified 2476
1027 Ga0268264_10234265 3300028381 Bacteria 1697
1028 Ga0268264_10328300 3300028381 Unclassified 1449
1029 Ga0268264_10709918 3300028381 Bacteria 999
1030 Ga0307517_10030353 3300028786 Bacteria 6340
1031 Ga0307515_10000039 3300028794 Bacteria 323229
1032 Ga0307511_10000153 3300030521 Bacteria 65598
1033 Ga0265327_10000030 3300031251 Bacteria 333531
1034 Ga0307513_10029047 3300031456 Bacteria 6311
1035 Ga0307408_100275715 3300031548 Bacteria 1398
1036 Ga0307508_10000937 3300031616 Bacteria 33974
1037 Ga0307518_10263568 3300031838 Bacteria 1083
1038 Ga0307410_10230324 3300031852 Bacteria 1430
1039 Ga0307414_10024549 3300032004 Bacteria 3847
1040 Ga0307414_10334306 3300032004 Bacteria 1294
1041 Ga0307415_100058480 3300032126 Bacteria 2654
1042 Ga0373955_0126666 3300035172 Bacteria 1488
1043 Ga0373924_0101236 3300035410 Bacteria 1240
1044 Ga0373933_0270802 3300035724 Bacteria 1096
1045 Ga0373933_0447585 3300035724 Bacteria 845
1046 Ga0373937_0261971 3300036401 Bacteria 1630
1047 Ga0373937_0423600 3300036401 Bacteria 1263
1048 Ga0395899_0004650 3300037312 Bacteria 10707
1049 Ga0395899_0014385 3300037312 Bacteria 6040
1050 Ga0395899_0017265 3300037312 Bacteria 5499
1051 Ga0395899_0344742 3300037312 Bacteria 998
1052 Ga0395900_0000594 3300037418 Bacteria 49651
1053 Ga0395900_0026735 3300037418 Bacteria 5907
1054 Ga0395900_0038159 3300037418 Bacteria 4952
1055 Ga0395900_0113079 3300037418 Bacteria 2787
1056 Ga0395900_0492261 3300037418 Bacteria 1177
1057 Ga0395900_0506480 3300037418 Bacteria 1157
1058 Ga0395898_0001271 3300037466 Bacteria 37310
1059 Ga0395898_0019396 3300037466 Bacteria 6921
1060 Ga0395898_0031929 3300037466 Bacteria 5258
1061 Ga0395898_0084334 3300037466 Bacteria 3063
1062 Ga0395898_0294244 3300037466 Bacteria 1549
1063 Ga0395905_0000527 3300037471 Bacteria 52435
1064 Ga0395905_0045277 3300037471 Bacteria 4127
1065 Ga0395905_0050843 3300037471 Bacteria 3882
1066 Ga0395901_0014247 3300038443 Bacteria 8095
1067 Ga0395901_0017770 3300038443 Bacteria 7260
1068 Ga0395901_0087877 3300038443 Bacteria 3250
1069 Ga0395901_0105083 3300038443 Bacteria 2964
1070 Ga0395901_0179498 3300038443 Bacteria 2220
1071 Ga0395901_0581778 3300038443 Bacteria 1131
1072 Ga0436365_1161343 3300039437 Bacteria 9975
1073 Ga0436365_1876803 3300039437 Bacteria 22992
1074 Ga0439465_0057582 3300041413 Bacteria 1283
1075 Ga0451849_0457641 3300041505 Bacteria 1154
1076 Ga0451851_0698711 3300041507 Bacteria 834
1077 Ga0439441_005719 3300042001 Bacteria 1945
1078 Ga0439443_030000 3300042003 Bacteria 893
1079 Ga0439445_0023729 3300042004 Unclassified 1555
1080 Ga0439449_0012045 3300042007 Unclassified 3251
1081 Ga0439449_0015551 3300042007 Bacteria 2860
1082 Ga0439454_020763 3300042011 Bacteria 966
1083 Ga0439457_010574 3300042014 Bacteria 2119
1084 Ga0439457_060182 3300042014 Bacteria 859
1085 Ga0450895_009516 3300042132 Bacteria 823
1086 Ga0450896_028602 3300042133 Bacteria 838
1087 Ga0450898_001510 3300042134 Bacteria 3081
1088 Ga0439460_0022853 3300042461 Bacteria 1719
1089 Ga0451577_0107026 3300042876 Bacteria 2500
1090 Ga0451577_0222244 3300042876 Bacteria 1707
1091 Ga0466972_0000175 3300044658 Bacteria 49585
1092 Ga0466972_0000782 3300044658 Bacteria 15085
1093 Ga0466966_0335187 3300044684 Bacteria 909
1094 Ga0466964_0052419 3300044706 Unclassified 1677
1095 Ga0453684_0038732 3300044712 Bacteria 6509
1096 Ga0453684_0054306 3300044712 Bacteria 5219
1097 Ga0453684_0077553 3300044712 Bacteria 4163
1098 Ga0466968_0038156 3300044735 Bacteria 2018
1099 Ga0466968_0125093 3300044735 Unclassified 1166
1100 Ga0466970_0001012 3300044765 Bacteria 13547
1101 Ga0466960_0091924 3300044901 Bacteria 1548
1102 Ga0466959_0503167 3300045049 Bacteria 819
1103 Ga0451576_0077826 3300045051 Bacteria 3452
1104 Ga0451576_0305980 3300045051 Bacteria 1663
1105 Ga0466967_0501574 3300045976 Bacteria 1191
1106 Ga0495638_0072586 3300046460 Unclassified 2103
1107 Ga0495638_0141913 3300046460 Unclassified 1401
1108 Ga0495653_0078610 3300046463 Bacteria 2446
1109 Ga0495580_0033076 3300046472 Bacteria 3727
1110 Ga0495628_0338979 3300046516 Bacteria 1107
1111 Ga0495648_0002156 3300046524 Bacteria 18542
1112 Ga0495587_0033786 3300046536 Bacteria 3086
1113 Ga0495587_0097319 3300046536 Bacteria 1697
1114 Ga0495621_0072455 3300046539 Bacteria 1271
1115 Ga0495621_0116141 3300046539 Bacteria 1031
1116 Ga0495645_0285819 3300046543 Bacteria 1083
1117 Ga0495633_0187636 3300046558 Unclassified 951
1118 Ga0495668_0050185 3300046616 Bacteria 2312
1119 Ga0495634_0097080 3300046642 Bacteria 1908
1120 Ga0495657_0025035 3300046675 Bacteria 4241
1121 Ga0495599_0413026 3300046678 Bacteria 803
1122 Ga0495658_0003503 3300046683 Bacteria 7765
1123 Ga0495658_0478832 3300046683 Unclassified 796
1124 Ga0495680_0447408 3300047322 Bacteria 885
1125 Ga0495684_0096239 3300047471 Bacteria 2241
1126 Ga0495686_0000041 3300047472 Bacteria 297599
1127 Ga0495686_0045508 3300047472 Bacteria 2776
1128 Ga0496101_0051249 3300048904 Bacteria 2974
1129 Ga0496105_0214858 3300048908 Bacteria 1567
1130 Ga0496107_0251565 3300048910 Bacteria 1315
1131 Ga0496108_0867115 3300048911 Bacteria 776
1132 Ga0496109_0172869 3300048912 Unclassified 2027
1133 Ga0496111_0017833 3300048914 Unclassified 4910
1134 Ga0496114_0448181 3300048917 Unclassified 1143
1135 Ga0496114_0582472 3300048917 Unclassified 987
1136 Ga0496115_0371094 3300048918 Bacteria 1165
1137 Ga0501305_051632 3300049161 Bacteria 691
1138 Ga0501292_010651 3300049515 Unclassified 1379
1139 Ga0501298_004827 3300049521 Bacteria 2143
1140 Ga0501299_002352 3300049522 Bacteria 2609
1141 Ga0501313_003594 3300049529 Bacteria 1552
1142 Ga0501313_003720 3300049529 Bacteria 1532
1143 Ga0501315_004296 3300049531 Unclassified 1483
1144 Ga0501340_000795 3300049556 Bacteria 1534
1145 Ga0501031_0030645 3300049568 Bacteria 3509
1146 Ga0501032_0011446 3300049569 Bacteria 6373
1147 Ga0501032_0259844 3300049569 Bacteria 1126
1148 Ga0501033_0197232 3300049570 Bacteria 1439
1149 Ga0501034_0013066 3300049571 Bacteria 8557
1150 Ga0501034_0016139 3300049571 Bacteria 7661
1151 Ga0501034_0066443 3300049571 Bacteria 3619
1152 Ga0501034_0070588 3300049571 Bacteria 3504
1153 Ga0501034_0217761 3300049571 Bacteria 1863
1154 Ga0501036_0055928 3300049572 Bacteria 3343
1155 Ga0501036_0078561 3300049572 Bacteria 2791
1156 Ga0501037_0003876 3300049573 Bacteria 10850
1157 Ga0501037_0052301 3300049573 Bacteria 2988
1158 Ga0501037_0098003 3300049573 Bacteria 2118
1159 Ga0501037_0225536 3300049573 Bacteria 1317
1160 Ga0501038_0007909 3300049574 Bacteria 9802
1161 Ga0501038_0320503 3300049574 Bacteria 1213
1162 Ga0501039_0016596 3300049575 Bacteria 5640
1163 Ga0501039_0202355 3300049575 Bacteria 1561
1164 Ga0501040_0183156 3300049576 Unclassified 1485
1165 Ga0501043_0007741 3300049579 Bacteria 8502
1166 Ga0501043_0052196 3300049579 Bacteria 3212
1167 Ga0501043_0068317 3300049579 Unclassified 2790
1168 Ga0501043_0096161 3300049579 Bacteria 2328
1169 Ga0501043_0155234 3300049579 Bacteria 1790
1170 Ga0501046_0010893 3300049580 Bacteria 7792
1171 Ga0501047_0002262 3300049581 Bacteria 18429
1172 Ga0501047_0142055 3300049581 Bacteria 2279
1173 Ga0501047_0326279 3300049581 Bacteria 1374
1174 Ga0501047_0378910 3300049581 Bacteria 1249
1175 Ga0501047_0778165 3300049581 Unclassified 772
1176 Ga0501067_0030643 3300049583 Bacteria 2983
1177 Ga0501068_0036486 3300049584 Bacteria 2940
1178 Ga0501069_0133656 3300049585 Bacteria 1421
1179 Ga0501070_0014912 3300049586 Bacteria 6537
1180 Ga0501070_0063339 3300049586 Bacteria 3063
1181 Ga0501070_0073982 3300049586 Bacteria 2820
1182 Ga0501070_0418080 3300049586 Bacteria 1083
1183 Ga0501072_0462128 3300049588 Bacteria 1005
1184 Ga0501073_0058616 3300049589 Bacteria 2690
1185 Ga0501074_0057085 3300049590 Bacteria 2812
1186 Ga0501198_007808 3300049649 Bacteria 1543
1187 Ga0501201_000258 3300049651 Bacteria 4759
1188 Ga0501202_004058 3300049652 Bacteria 2546
1189 Ga0501202_031722 3300049652 Bacteria 1106
1190 Ga0501216_040980 3300049660 Unclassified 886
1191 Ga0501217_001890 3300049661 Bacteria 4016
1192 Ga0501222_003740 3300049662 Bacteria 2069
1193 Ga0501223_007746 3300049663 Bacteria 2193
1194 Ga0501223_019582 3300049663 Bacteria 1329
1195 Ga0501233_001139 3300049668 Bacteria 4515
1196 Ga0501235_000140 3300049669 Bacteria 12163
1197 Ga0501235_013210 3300049669 Bacteria 1817
1198 Ga0501235_063768 3300049669 Unclassified 865
1199 Ga0501250_004483 3300049680 Bacteria 1392
1200 Ga0501255_011737 3300049684 Bacteria 1016
1201 Ga0501257_075834 3300049686 Bacteria 863
1202 Ga0501259_001544 3300049688 Bacteria 3831
1203 Ga0501259_025579 3300049688 Bacteria 1082
1204 Ga0501261_001807 3300049690 Bacteria 2636
1205 Ga0501221_001525 3300049704 Bacteria 3834
1206 Ga0501221_060809 3300049704 Bacteria 873
1207 Ga0501225_0021105 3300049705 Bacteria 1799
1208 Ga0501225_0022094 3300049705 Unclassified 1757
1209 Ga0501245_000855 3300049708 Bacteria 3855
1210 Ga0501245_010713 3300049708 Unclassified 1327
1211 Ga0501079_0444552 3300049741 Unclassified 1018
1212 Ga0501080_0064884 3300049742 Bacteria 3396
1213 Ga0501083_0050487 3300049744 Bacteria 2799
1214 Ga0501263_044221 3300049760 Bacteria 662
1215 Ga0501266_011754 3300049763 Bacteria 1124
1216 Ga0501268_018834 3300049765 Bacteria 1165
1217 Ga0501270_002470 3300049767 Bacteria 1898
1218 Ga0501279_012781 3300049775 Unclassified 1144
1219 Ga0501035_0018008 3300049822 Bacteria 6512
1220 Ga0501035_0025624 3300049822 Bacteria 5405
1221 Ga0501035_0206525 3300049822 Bacteria 1682
1222 Ga0501035_0721628 3300049822 Unclassified 802
1223 Ga0501044_0065549 3300049823 Bacteria 3704
1224 Ga0501044_0116849 3300049823 Bacteria 2672
1225 Ga0501044_0303018 3300049823 Bacteria 1526
1226 Ga0501044_0576252 3300049823 Bacteria 1020
1227 Ga0501045_0126116 3300049824 Bacteria 1902
1228 nmdc:mga0k408_120615_c1 3300050493 Bacteria 1553
1229 nmdc:mga05p37_145085_c1 3300050507 Unclassified 2907
1230 nmdc:mga09592_11480_c1 3300050508 Bacteria 7209
1231 nmdc:mga09592_27033_c1 3300050508 Bacteria 4758
1232 nmdc:mga09592_42061_c1 3300050508 Unclassified 3844
1233 nmdc:mga06r32_51640_c1 3300050510 Bacteria 3935
1234 nmdc:mga08y16_104126_c1 3300050511 Unclassified 2954
1235 nmdc:mga08y16_178907_c1 3300050511 Bacteria 2202
1236 Ga0495619_0050828 3300053085 Bacteria 2738
1237 Ga0500643_026965 3300053087 Unclassified 1792
1238 Ga0500643_084142 3300053087 Unclassified 871
1239 Ga0500644_0028808 3300053088 Bacteria 1740
1240 Ga0500646_0007425 3300053090 Bacteria 2802
1241 Ga0500562_000036 3300053108 Bacteria 78006
1242 Ga0500594_0014966 3300053118 Bacteria 1865
1243 Ga0500655_012414 3300053133 Unclassified 1549
1244 Ga0500568_0037481 3300053139 Bacteria 1966
1245 Ga0500588_0004743 3300053146 Bacteria 2965
1246 Ga0500604_0001825 3300053151 Bacteria 5927
1247 Ga0500616_0019418 3300053153 Bacteria 3831
1248 Ga0500622_0000484 3300053156 Bacteria 37287
1249 Ga0500622_0001151 3300053156 Bacteria 22018
1250 Ga0500637_0166241 3300053178 Bacteria 1270
1251 Ga0500611_000018 3300053727 Bacteria 111023
1252 Ga0500645_009647 3300053730 Bacteria 3234
1253 Ga0501084_0058664 3300054114 Bacteria 3220
1254 Ga0501084_0267362 3300054114 Bacteria 1444
1255 Ga0500661_015042 3300055283 Bacteria 1389
1256 Ga0587109_039515 3300059624 Bacteria 930
1257 Ga0501082_0112373 3300060353 Bacteria 2358
1258 2819589611 2818991444 Bacteria 6968812
1259 2914763341 2914759650 Bacteria 4701441
1260 2929156201 2929154850 Bacteria 6753285
1261 rootL2_10076279
1262 MRS1b_contig_1168309
1263 MBSR1b_contig_4379216
1264 MBSR1b_contig_7995764
1265 JGI24751J29686_10061188
1266 rootH1_10109167
1267 rootH1_10125848
1268 rootH2_10162769
1269 rootH2_10197471
1270 rootH2_10205626
1271 rootL2_10097124
1272 rootL2_10135684
1273 rootH1_10227879
1274 JGI25160J50197_1003126
1275 Ga0058861_12043672
1276 Ga0058862_12478465
1277 Ga0065714_10079249
1278 Ga0065714_10226543
1279 Ga0065704_10121850
1280 Ga0065704_10182402
1281 Ga0065712_10073224
1282 Ga0065712_10089634
1283 Ga0065712_10154453
1284 Ga0065712_10170127
1285 Ga0065712_10225270
1286 Ga0065715_10013993
1287 Ga0065715_10323297
1288 Ga0070658_10001461
1289 Ga0070658_10045017
1290 Ga0070658_10045140
1291 Ga0070658_10100597
1292 Ga0070658_10182071
1293 Ga0070658_10824846
1294 Ga0070676_10000153
1295 Ga0070676_10005303
1296 Ga0070676_10033838
1297 Ga0070683_100000329
1298 Ga0070683_100018651
1299 Ga0070683_100023520
1300 Ga0070683_100053673
1301 Ga0070683_100081163
1302 Ga0070690_100051558
1303 Ga0070690_100177737
1304 Ga0070670_100032449
1305 Ga0070670_100053200
1306 Ga0070670_100149986
1307 Ga0070670_100150728
1308 Ga0070670_100174216
1309 Ga0070670_100264373
1310 Ga0070670_100358496
1311 Ga0070670_100360560
1312 Ga0070670_100522309
1313 Ga0070670_100630214
1314 Ga0070670_100981754
1315 Ga0070677_10002116
1316 Ga0070677_10042997
1317 Ga0070677_10115552
1318 Ga0070677_10153182
1319 Ga0068869_100007813
1320 Ga0068869_100012388
1321 Ga0068869_100024126
1322 Ga0068869_100031526
1323 Ga0068869_100118166
1324 Ga0068869_100162297
1325 Ga0068869_100401576
1326 Ga0070666_10000043
1327 Ga0070666_10000209
1328 Ga0070666_10031000
1329 Ga0070666_10031370
1330 Ga0070666_10119646
1331 Ga0070666_10144826
1332 Ga0070666_10292921
1333 Ga0070680_100000076
1334 Ga0070680_100012535
1335 Ga0070680_100021326
1336 Ga0070680_100024075
1337 Ga0070680_100045972
1338 Ga0070682_100000717
1339 Ga0070682_100086673
1340 Ga0070682_100155207
1341 Ga0070682_100169628
1342 Ga0070682_100243568
1343 Ga0068868_100000726
1344 Ga0068868_100001336
1345 Ga0068868_100022584
1346 Ga0068868_100078450
1347 Ga0068868_100097530
1348 Ga0068868_100172352
1349 Ga0068868_100180291
1350 Ga0068868_100247821
1351 Ga0068868_100595379
1352 Ga0068868_100811708
1353 Ga0070660_100034772
1354 Ga0070660_100043591
1355 Ga0070660_100057089
1356 Ga0070660_100083945
1357 Ga0070660_100133622
1358 Ga0070660_100147379
1359 Ga0070660_100421503
1360 Ga0070660_100551128
1361 Ga0070689_100019751
1362 Ga0070689_100503540
1363 Ga0070691_10001594
1364 Ga0070691_10007717
1365 Ga0070691_10041025
1366 Ga0070687_100014051
1367 Ga0070687_100125092
1368 Ga0070687_100147780
1369 Ga0070687_100356811
1370 Ga0070661_100004831
1371 Ga0070661_100009444
1372 Ga0070661_100064706
1373 Ga0070661_100104590
1374 Ga0070661_100168713
1375 Ga0070668_100000556
1376 Ga0070668_100012182
1377 Ga0070668_100073785
1378 Ga0070668_100138846
1379 Ga0070668_100485189
1380 Ga0070669_100009249
1381 Ga0070669_100035738
1382 Ga0070675_100010042
1383 Ga0070675_100026514
1384 Ga0070675_100043632
1385 Ga0070675_100050419
1386 Ga0070675_100611183
1387 Ga0070675_100638424
1388 Ga0070671_100001985
1389 Ga0070671_100013745
1390 Ga0070671_100069303
1391 Ga0070671_100115887
1392 Ga0070671_100585517
1393 Ga0070674_100029455
1394 Ga0070674_100030959
1395 Ga0070674_100753954
1396 Ga0070673_100000867
1397 Ga0070673_100006375
1398 Ga0070673_100037568
1399 Ga0070673_100042687
1400 Ga0070673_100059928
1401 Ga0070673_100098764
1402 Ga0070673_100206169
1403 Ga0070673_100217525
1404 Ga0070673_100219615
1405 Ga0070673_100281591
1406 Ga0070688_100004476
1407 Ga0070688_100089412
1408 Ga0070688_100169991
1409 Ga0070688_100234589
1410 Ga0070688_100262084
1411 Ga0070659_100007187
1412 Ga0070659_100014833
1413 Ga0070659_100061370
1414 Ga0070659_100191534
1415 Ga0070659_100228816
1416 Ga0070659_100542459
1417 Ga0070667_100000812
1418 Ga0070667_100008930
1419 Ga0070667_100020249
1420 Ga0070667_100028595
1421 Ga0070667_100057396
1422 Ga0070667_100220075
1423 Ga0070667_100250684
1424 Ga0070667_100282103
1425 Ga0070667_100299953
1426 Ga0070667_100353261
1427 Ga0070667_100547582
1428 Ga0070701_10030425
1429 Ga0070701_10042878
1430 Ga0070700_100027344
1431 Ga0070700_100206961
1432 Ga0070663_100161237
1433 Ga0070663_100370722
1434 Ga0070663_100577370
1435 Ga0070678_100057003
1436 Ga0070678_100059231
1437 Ga0070678_100679540
1438 Ga0070662_100001017
1439 Ga0070662_100039341
1440 Ga0070662_100041094
1441 Ga0070662_100047930
1442 Ga0070662_100050347
1443 Ga0070662_100062595
1444 Ga0070662_100070905
1445 Ga0070662_100153087
1446 Ga0070681_10030832
1447 Ga0070681_10034476
1448 Ga0070681_10069046
1449 Ga0070681_10089254
1450 Ga0070681_10092504
1451 Ga0070681_10189654
1452 Ga0070681_10318982
1453 Ga0070681_10498067
1454 Ga0068867_100009628
1455 Ga0068867_100017213
1456 Ga0068867_100018823
1457 Ga0068867_100045627
1458 Ga0068867_100077217
1459 Ga0068867_100124886
1460 Ga0068867_100276407
1461 Ga0068867_100393196
1462 Ga0068867_100453623
1463 Ga0068867_100576468
1464 Ga0070685_10023313
1465 Ga0070685_10030244
1466 Ga0070685_10162796
1467 Ga0070685_10482928
1468 Ga0070698_100008720
1469 Ga0070698_100034419
1470 Ga0070698_100219385
1471 Ga0070679_100001661
1472 Ga0070679_100009375
1473 Ga0070679_100022898
1474 Ga0070679_100029983
1475 Ga0070679_100037881
1476 Ga0070679_100050468
1477 Ga0070679_100062160
1478 Ga0070679_100151851
1479 Ga0070679_100241274
1480 Ga0070684_100000768
1481 Ga0070684_100001060
1482 Ga0070684_100595267
1483 Ga0068853_100000520
1484 Ga0068853_100009389
1485 Ga0068853_100010204
1486 Ga0068853_100020753
1487 Ga0068853_100059557
1488 Ga0068853_100074904
1489 Ga0068853_100097777
1490 Ga0068853_100106099
1491 Ga0068853_100154878
1492 Ga0068853_100169030
1493 Ga0068853_100205813
1494 Ga0068853_100228366
1495 Ga0068853_100267326
1496 Ga0068853_100399359
1497 Ga0068853_100410303
1498 Ga0068853_100497853
1499 Ga0070672_100000738
1500 Ga0070672_100086295
1501 Ga0070672_100097907
1502 Ga0070672_100272233
1503 Ga0070672_100318410
1504 Ga0070686_100204799
1505 Ga0070686_100547308
1506 Ga0070665_100000016
1507 Ga0070665_100000486
1508 Ga0070665_100076887
1509 Ga0070665_100174223
1510 Ga0070665_100589784
1511 Ga0070704_100133488
1512 Ga0068855_100001195
1513 Ga0068855_100002033
1514 Ga0068855_100027744
1515 Ga0068855_100038229
1516 Ga0068855_100095965
1517 Ga0068855_100100781
1518 Ga0068855_100125190
1519 Ga0068855_100174465
1520 Ga0068855_101058718
1521 Ga0070664_100007325
1522 Ga0070664_100017660
1523 Ga0070664_100101274
1524 Ga0070664_100190998
1525 Ga0070664_100252487
1526 Ga0070664_100413307
1527 Ga0070664_100501886
1528 Ga0068857_100008614
1529 Ga0068857_100032917
1530 Ga0068857_100115318
1531 Ga0068857_100132177
1532 Ga0068857_100190919
1533 Ga0068857_100499890
1534 Ga0068857_100556531
1535 Ga0068854_100003899
1536 Ga0068854_100043746
1537 Ga0068854_100061668
1538 Ga0068854_100064033
1539 Ga0068854_100068384
1540 Ga0068854_100329767
1541 Ga0068854_100505941
1542 Ga0068856_100028734
1543 Ga0068856_100062559
1544 Ga0068856_100074389
1545 Ga0068856_100113099
1546 Ga0068856_100289020
1547 Ga0070702_100453961
1548 Ga0068852_100002161
1549 Ga0068852_100003948
1550 Ga0068852_100005616
1551 Ga0068852_100017743
1552 Ga0068852_100030471
1553 Ga0068852_100039278
1554 Ga0068852_100073856
1555 Ga0068852_100106272
1556 Ga0068852_100126231
1557 Ga0068852_100166256
1558 Ga0068852_100211024
1559 Ga0068852_100225934
1560 Ga0068852_100414732
1561 Ga0068852_100570823
1562 Ga0068852_101072624
1563 Ga0068859_100000012
1564 Ga0068859_100015449
1565 Ga0068859_100016918
1566 Ga0068859_100121114
1567 Ga0068859_100155678
1568 Ga0068859_100180962
1569 Ga0068859_100182763
1570 Ga0068859_100183247
1571 Ga0068859_100232318
1572 Ga0068859_100366272
1573 Ga0068859_100391475
1574 Ga0068859_100404895
1575 Ga0068859_100470510
1576 Ga0068864_100002330
1577 Ga0068864_100010946
1578 Ga0068864_100030323
1579 Ga0068864_100064925
1580 Ga0068864_100097281
1581 Ga0068864_100279758
1582 Ga0068864_100595738
1583 Ga0068864_101165326
1584 Ga0068866_10010917
1585 Ga0068866_10027968
1586 Ga0068866_10043497
1587 Ga0068866_10056271
1588 Ga0068861_100049526
1589 Ga0068861_100070790
1590 Ga0068861_100073926
1591 Ga0068861_100253963
1592 Ga0068861_100406837
1593 Ga0068861_100440434
1594 Ga0068851_10000423
1595 Ga0068851_10019508
1596 Ga0068851_10026913
1597 Ga0068851_10066130
1598 Ga0068870_10029291
1599 Ga0068870_10038929
1600 Ga0068863_100000858
1601 Ga0068863_100003359
1602 Ga0068863_100020445
1603 Ga0068863_100024297
1604 Ga0068863_100025383
1605 Ga0068863_100031774
1606 Ga0068863_100276818
1607 Ga0068863_100325825
1608 Ga0068863_100629581
1609 Ga0068858_100001362
1610 Ga0068858_100008022
1611 Ga0068858_100047034
1612 Ga0068858_100063752
1613 Ga0068858_100319751
1614 Ga0068858_100390710
1615 Ga0068858_100856449
1616 Ga0068860_100000026
1617 Ga0068860_100002209
1618 Ga0068860_100007860
1619 Ga0068860_100010129
1620 Ga0068860_100016541
1621 Ga0068860_100018967
1622 Ga0068860_100072785
1623 Ga0068860_100091780
1624 Ga0068860_100151072
1625 Ga0068860_100568775
1626 Ga0068862_100010995
1627 Ga0068862_100047162
1628 Ga0068862_100064721
1629 Ga0068862_100127894
1630 Ga0068862_100133853
1631 Ga0068862_100688106
1632 Ga0081539_10007837
1633 Ga0070715_10006819
1634 Ga0075366_10009633
1635 Ga0075366_10076952
1636 Ga0097621_100000027
1637 Ga0097621_100007971
1638 Ga0097621_100008933
1639 Ga0097621_100078756
1640 Ga0097621_100099328
1641 Ga0097621_100117833
1642 Ga0097621_100126650
1643 Ga0097621_100139216
1644 Ga0097621_100160061
1645 Ga0097621_100576317
1646 Ga0097621_100879549
1647 Ga0068871_100000107
1648 Ga0068871_100008378
1649 Ga0068871_100083065
1650 Ga0068871_100086792
1651 Ga0068871_100095306
1652 Ga0068871_100097165
1653 Ga0068871_100103213
1654 Ga0068871_100125649
1655 Ga0068871_100136715
1656 Ga0068871_100161295
1657 Ga0068871_100553333
1658 Ga0075428_100056891
1659 Ga0075430_100005928
1660 Ga0075431_100001800
1661 Ga0075434_100540770
1662 Ga0075429_100015792
1663 Ga0075429_100037587
1664 Ga0075429_100041776
1665 Ga0075429_100252586
1666 Ga0075429_100642628
1667 Ga0068865_100002249
1668 Ga0068865_100125695
1669 Ga0068865_100128968
1670 Ga0068865_100131110
1671 Ga0068865_100197973
1672 Ga0075436_100290683
1673 Ga0097620_100000012
1674 Ga0097620_100015449
1675 Ga0097620_100016919
1676 Ga0097620_100121119
1677 Ga0097620_100155682
1678 Ga0097620_100180977
1679 Ga0097620_100182775
1680 Ga0097620_100183241
1681 Ga0097620_100232321
1682 Ga0097620_100366299
1683 Ga0097620_100391444
1684 Ga0097620_100404905
1685 Ga0105251_10095755
1686 Ga0105240_10000258
1687 Ga0105240_10000715
1688 Ga0105240_10002252
1689 Ga0105240_10004553
1690 Ga0105240_10004621
1691 Ga0105240_10016056
1692 Ga0105240_10023337
1693 Ga0105240_10039801
1694 Ga0105240_10054842
1695 Ga0105240_10060026
1696 Ga0105240_10203604
1697 Ga0105240_10212273
1698 Ga0111539_10162199
1699 Ga0105245_10507780
1700 Ga0105247_10001409
1701 Ga0105247_10008259
1702 Ga0114129_10015867
1703 Ga0105241_10000224
1704 Ga0105241_10000533
1705 Ga0105241_10069438
1706 Ga0105241_10097536
1707 Ga0105241_10139058
1708 Ga0105241_10259768
1709 Ga0105241_10332089
1710 Ga0105241_10769260
1711 Ga0105242_10043542
1712 Ga0105242_10056582
1713 Ga0105242_10076969
1714 Ga0105242_10451632
1715 Ga0105242_10631368
1716 Ga0105242_10844261
1717 Ga0105248_10004939
1718 Ga0105248_10060288
1719 Ga0105237_10005490
1720 Ga0105237_10005694
1721 Ga0105237_10014096
1722 Ga0105237_10022472
1723 Ga0105237_10047089
1724 Ga0105237_10064862
1725 Ga0105237_10098324
1726 Ga0105237_10126957
1727 Ga0105238_10006981
1728 Ga0105238_10064549
1729 Ga0105238_10078160
1730 Ga0105238_10134127
1731 Ga0105249_10001958
1732 Ga0105249_10023081
1733 Ga0105249_10034852
1734 Ga0105249_10041170
1735 Ga0105249_10102452
1736 Ga0105249_10580375
1737 Ga0105249_10596564
1738 Ga0105249_10974557
1739 Ga0105239_10001037
1740 Ga0105239_10011083
1741 Ga0105239_10017966
1742 Ga0105239_10043883
1743 Ga0105239_10066389
1744 Ga0105239_10127719
1745 Ga0105239_10192320
1746 Ga0105239_10371360
1747 Ga0105239_10386859
1748 Ga0105239_10411698
1749 Ga0105246_10005718
1750 Ga0105246_10094380
1751 Ga0105246_10145723
1752 Ga0105246_10215943
1753 Ga0105246_10425992
1754 Ga0105246_10767641
1755 Ga0157373_10000275
1756 Ga0157373_10015282
1757 Ga0157373_10016691
1758 Ga0157373_10026324
1759 Ga0157373_10038389
1760 Ga0157373_10050702
1761 Ga0157373_10110592
1762 Ga0157373_10211189
1763 Ga0157373_10277050
1764 Ga0157373_10290340
1765 Ga0157371_10000596
1766 Ga0157371_10002078
1767 Ga0157371_10011331
1768 Ga0157371_10012915
1769 Ga0157371_10024481
1770 Ga0157371_10029505
1771 Ga0157371_10064707
1772 Ga0157371_10091472
1773 Ga0157371_10091597
1774 Ga0157371_10110867
1775 Ga0157371_10137041
1776 Ga0157371_10162979
1777 Ga0157371_10169831
1778 Ga0157371_10179070
1779 Ga0157371_10226367
1780 Ga0157371_10263919
1781 Ga0157371_10755418
1782 Ga0157370_10000238
1783 Ga0157370_10000405
1784 Ga0157370_10001393
1785 Ga0157370_10005886
1786 Ga0157370_10055078
1787 Ga0157370_10070212
1788 Ga0157370_10160251
1789 Ga0157370_10209739
1790 Ga0157370_10322742
1791 Ga0157370_10389986
1792 Ga0157370_10770037
1793 Ga0157369_10023820
1794 Ga0157369_10040594
1795 Ga0157369_10059170
1796 Ga0157369_10067243
1797 Ga0157369_10068914
1798 Ga0157369_10100151
1799 Ga0157369_10161499
1800 Ga0157369_10185665
1801 Ga0157369_10188812
1802 Ga0157369_10279023
1803 Ga0157369_10366869
1804 Ga0157369_10485617
1805 Ga0157369_10583150
1806 Ga0157369_10997484
1807 Ga0157374_10000841
1808 Ga0157374_10006478
1809 Ga0157374_10015281
1810 Ga0157374_10017671
1811 Ga0157374_10046728
1812 Ga0157374_10128112
1813 Ga0157374_10154491
1814 Ga0157374_10296805
1815 Ga0157374_10357898
1816 Ga0157374_10450174
1817 Ga0157374_10490250
1818 Ga0157374_11316718
1819 Ga0157378_10002090
1820 Ga0157378_10005857
1821 Ga0157378_10010065
1822 Ga0157378_10012644
1823 Ga0157378_10023595
1824 Ga0157378_10031342
1825 Ga0157378_10045275
1826 Ga0157378_10069077
1827 Ga0157378_10101789
1828 Ga0157378_10132143
1829 Ga0157378_10369500
1830 Ga0157378_10415877
1831 Ga0157378_11065749
1832 Ga0157378_11356574
1833 Ga0163162_10000100
1834 Ga0163162_10000279
1835 Ga0163162_10001517
1836 Ga0163162_10003820
1837 Ga0163162_10004813
1838 Ga0163162_10006228
1839 Ga0163162_10006285
1840 Ga0163162_10020346
1841 Ga0163162_10038399
1842 Ga0163162_10118184
1843 Ga0163162_10162009
1844 Ga0163162_10387958
1845 Ga0163162_10502404
1846 Ga0163162_10551733
1847 Ga0163162_11602752
1848 Ga0157372_10002704
1849 Ga0157372_10009200
1850 Ga0157372_10010252
1851 Ga0157372_10010966
1852 Ga0157372_10015765
1853 Ga0157372_10029622
1854 Ga0157372_10031629
1855 Ga0157372_10072476
1856 Ga0157372_10090343
1857 Ga0157372_10103164
1858 Ga0157372_10109383
1859 Ga0157372_10113091
1860 Ga0157372_10114415
1861 Ga0157372_10139494
1862 Ga0157372_10141929
1863 Ga0157372_10156889
1864 Ga0157372_10165768
1865 Ga0157372_10199261
1866 Ga0157372_10222536
1867 Ga0157372_10294364
1868 Ga0157372_10298073
1869 Ga0157372_10382776
1870 Ga0157372_10388080
1871 Ga0157372_10388520
1872 Ga0157372_10626420
1873 Ga0157372_10677249
1874 Ga0157372_10711664
1875 Ga0157372_10791279
1876 Ga0157372_11149835
1877 Ga0157372_11462428
1878 Ga0157375_10000057
1879 Ga0157375_10000336
1880 Ga0157375_10038477
1881 Ga0157375_10039491
1882 Ga0157375_10053145
1883 Ga0157375_10064756
1884 Ga0157375_10076446
1885 Ga0157375_10084012
1886 Ga0157375_10086998
1887 Ga0157375_10155431
1888 Ga0157375_10166926
1889 Ga0157375_10183454
1890 Ga0157375_10275825
1891 Ga0157375_10289583
1892 Ga0157375_10348648
1893 Ga0157375_10357986
1894 Ga0157375_10653920
1895 Ga0157375_10704417
1896 Ga0157375_10734074
1897 Ga0157375_11143710
1898 Ga0163163_10000193
1899 Ga0163163_10000254
1900 Ga0163163_10002122
1901 Ga0163163_10009925
1902 Ga0163163_10020274
1903 Ga0163163_10142515
1904 Ga0163163_10232058
1905 Ga0163163_10238362
1906 Ga0163163_10442588
1907 Ga0163163_10506995
1908 Ga0157380_10001093
1909 Ga0157380_10006970
1910 Ga0157380_10010950
1911 Ga0157380_10150228
1912 Ga0157380_10196143
1913 Ga0157380_10248107
1914 Ga0157380_10272719
1915 Ga0157380_10399881
1916 Ga0157380_10735489
1917 Ga0157380_11066258
1918 Ga0157377_10028251
1919 Ga0157377_10057265
1920 Ga0157377_10197146
1921 Ga0157377_10210314
1922 Ga0157379_10000367
1923 Ga0157379_10017665
1924 Ga0157379_10026404
1925 Ga0157379_10033384
1926 Ga0157379_10047182
1927 Ga0157379_10132198
1928 Ga0157379_10145105
1929 Ga0157379_10304482
1930 Ga0157379_10583198
1931 Ga0157376_10000135
1932 Ga0157376_10002989
1933 Ga0157376_10007359
1934 Ga0157376_10019024
1935 Ga0157376_10127764
1936 Ga0157376_10216996
1937 Ga0157376_10242873
1938 Ga0157376_10355273
1939 Ga0157376_10411918
1940 Ga0157376_10526796
1941 Ga0157376_10766548
1942 Ga0163161_10001091
1943 Ga0163161_10035078
1944 Ga0163161_10101064
1945 Ga0163161_10104760
1946 Ga0163161_10268021
1947 Ga0163161_10485161
1948 Ga0197907_10191818
1949 Ga0197907_10951066
1950 Ga0206356_11664014
1951 Ga0206355_1373070
1952 Ga0206352_10396221
1953 Ga0206352_11083765
1954 Ga0213876_10001740
1955 Ga0213876_10010098
1956 Ga0224712_10165530
1957 Ga0207426_1000104
1958 Ga0207697_10013979
1959 Ga0207697_10093496
1960 Ga0207697_10181130
1961 Ga0207656_10002124
1962 Ga0207682_10001049
1963 Ga0207682_10063133
1964 Ga0207642_10027167
1965 Ga0207710_10012887
1966 Ga0207710_10050658
1967 Ga0207688_10035812
1968 Ga0207688_10045084
1969 Ga0207688_10077139
1970 Ga0207680_10000371
1971 Ga0207680_10025925
1972 Ga0207680_10028803
1973 Ga0207680_10075669
1974 Ga0207680_10449108
1975 Ga0207647_10004784
1976 Ga0207647_10012837
1977 Ga0207647_10019112
1978 Ga0207685_10010434
1979 Ga0207645_10000511
1980 Ga0207645_10004291
1981 Ga0207645_10017285
1982 Ga0207645_10297712
1983 Ga0207645_10507983
1984 Ga0207643_10001735
1985 Ga0207643_10061009
1986 Ga0207643_10089852
1987 Ga0207643_10205166
1988 Ga0207643_10250150
1989 Ga0207705_10034312
1990 Ga0207705_10043425
1991 Ga0207705_10163048
1992 Ga0207705_10308121
1993 Ga0207705_10345656
1994 Ga0207705_10541303
1995 Ga0207654_10001646
1996 Ga0207654_10003857
1997 Ga0207654_10239301
1998 Ga0207707_10000574
1999 Ga0207707_10046727
2000 Ga0207707_10073490
2001 Ga0207707_10177512
2002 Ga0207707_10255823
2003 Ga0207707_10255895
2004 Ga0207707_10476152
2005 Ga0207707_10752275
2006 Ga0207695_10000327
2007 Ga0207695_10000486
2008 Ga0207695_10003818
2009 Ga0207695_10008726
2010 Ga0207695_10008950
2011 Ga0207695_10012720
2012 Ga0207695_10038067
2013 Ga0207695_10043454
2014 Ga0207695_10099398
2015 Ga0207695_10152595
2016 Ga0207671_10001742
2017 Ga0207671_10004018
2018 Ga0207671_10006632
2019 Ga0207671_10059149
2020 Ga0207671_10071305
2021 Ga0207671_10166148
2022 Ga0207671_10214903
2023 Ga0207671_10384454
2024 Ga0207660_10010881
2025 Ga0207660_10135955
2026 Ga0207662_10033075
2027 Ga0207662_10327142
2028 Ga0207657_10004159
2029 Ga0207657_10018632
2030 Ga0207657_10029137
2031 Ga0207657_10136773
2032 Ga0207657_10400054
2033 Ga0207649_10006464
2034 Ga0207649_10022783
2035 Ga0207649_10082255
2036 Ga0207649_10206618
2037 Ga0207652_10000210
2038 Ga0207652_10001002
2039 Ga0207652_10002655
2040 Ga0207652_10007311
2041 Ga0207652_10028457
2042 Ga0207652_10045845
2043 Ga0207652_10058906
2044 Ga0207652_10135432
2045 Ga0207652_10175339
2046 Ga0207652_10331774
2047 Ga0207681_10027241
2048 Ga0207681_10068587
2049 Ga0207681_10330514
2050 Ga0207694_10057302
2051 Ga0207694_10061747
2052 Ga0207694_10262784
2053 Ga0207650_10009262
2054 Ga0207650_10025960
2055 Ga0207650_10041161
2056 Ga0207650_10097267
2057 Ga0207650_10117984
2058 Ga0207650_10134753
2059 Ga0207650_10313288
2060 Ga0207650_10911341
2061 Ga0207659_10052816
2062 Ga0207659_10077944
2063 Ga0207659_10095451
2064 Ga0207659_10185262
2065 Ga0207659_10231083
2066 Ga0207644_10045467
2067 Ga0207644_10226122
2068 Ga0207644_10248240
2069 Ga0207644_10651355
2070 Ga0207644_10720483
2071 Ga0207644_10742717
2072 Ga0207690_10008207
2073 Ga0207690_10029723
2074 Ga0207690_10217383
2075 Ga0207690_10358006
2076 Ga0207706_10003803
2077 Ga0207706_10005368
2078 Ga0207706_10007905
2079 Ga0207706_10026061
2080 Ga0207706_10031025
2081 Ga0207706_10032502
2082 Ga0207706_10654384
2083 Ga0207686_10010535
2084 Ga0207686_10023055
2085 Ga0207686_10030121
2086 Ga0207686_10147518
2087 Ga0207686_10552608
2088 Ga0207670_10012704
2089 Ga0207670_10113038
2090 Ga0207670_10321076
2091 Ga0207670_10797940
2092 Ga0207669_10043590
2093 Ga0207669_10060082
2094 Ga0207669_10077992
2095 Ga0207669_10270361
2096 Ga0207669_10310274
2097 Ga0207704_10000484
2098 Ga0207704_10045597
2099 Ga0207704_10102486
2100 Ga0207691_10002120
2101 Ga0207691_10012396
2102 Ga0207691_10013692
2103 Ga0207691_10043591
2104 Ga0207691_10064166
2105 Ga0207691_10078152
2106 Ga0207691_10079939
2107 Ga0207691_10098164
2108 Ga0207691_10213394
2109 Ga0207691_10428141
2110 Ga0207691_10478718
2111 Ga0207711_10249460
2112 Ga0207689_10000329
2113 Ga0207689_10002405
2114 Ga0207689_10005043
2115 Ga0207689_10010393
2116 Ga0207689_10021416
2117 Ga0207689_10038305
2118 Ga0207689_10044691
2119 Ga0207689_10361108
2120 Ga0207689_10381998
2121 Ga0207661_10007884
2122 Ga0207661_10043012
2123 Ga0207661_10056567
2124 Ga0207661_10107804
2125 Ga0207679_10000751
2126 Ga0207679_10001121
2127 Ga0207679_10070887
2128 Ga0207679_10113802
2129 Ga0207679_10181918
2130 Ga0207679_10191868
2131 Ga0207679_10287659
2132 Ga0207679_10470098
2133 Ga0207667_10000340
2134 Ga0207667_10009409
2135 Ga0207667_10058269
2136 Ga0207667_10061201
2137 Ga0207667_10089071
2138 Ga0207667_10109580
2139 Ga0207667_10167573
2140 Ga0207667_10235251
2141 Ga0207667_10272676
2142 Ga0207651_10002824
2143 Ga0207651_10043146
2144 Ga0207651_10069071
2145 Ga0207651_10108025
2146 Ga0207651_10119421
2147 Ga0207651_10127715
2148 Ga0207651_10297261
2149 Ga0207651_10514420
2150 Ga0207712_10001475
2151 Ga0207712_10011683
2152 Ga0207712_10012015
2153 Ga0207712_10013170
2154 Ga0207712_10031288
2155 Ga0207712_10395825
2156 Ga0207712_11050023
2157 Ga0207668_10034958
2158 Ga0207668_10251892
2159 Ga0207668_10328437
2160 Ga0207640_10017218
2161 Ga0207640_10155426
2162 Ga0207640_10270452
2163 Ga0207640_10639296
2164 Ga0207658_10000847
2165 Ga0207658_10039539
2166 Ga0207658_10051028
2167 Ga0207658_10090037
2168 Ga0207658_10260123
2169 Ga0207658_10303514
2170 Ga0207658_10591277
2171 Ga0207677_10001136
2172 Ga0207677_10007895
2173 Ga0207677_10018452
2174 Ga0207677_10062805
2175 Ga0207677_10067033
2176 Ga0207677_10256846
2177 Ga0207677_10369311
2178 Ga0207677_10764604
2179 Ga0207703_10010768
2180 Ga0207703_10040034
2181 Ga0207703_10091248
2182 Ga0207703_10276170
2183 Ga0207703_10459619
2184 Ga0207703_10790010
2185 Ga0207703_10827590
2186 Ga0207639_10010003
2187 Ga0207639_10016589
2188 Ga0207639_10019883
2189 Ga0207639_10026659
2190 Ga0207639_10123392
2191 Ga0207639_10138006
2192 Ga0207639_10149936
2193 Ga0207639_10196223
2194 Ga0207639_10200336
2195 Ga0207639_10280880
2196 Ga0207639_10289581
2197 Ga0207639_10323026
2198 Ga0207639_10379437
2199 Ga0207639_10607474
2200 Ga0207639_10655436
2201 Ga0207639_10723978
2202 Ga0207678_10013940
2203 Ga0207678_10108296
2204 Ga0207678_10171337
2205 Ga0207708_10049982
2206 Ga0207708_10132051
2207 Ga0207708_10507710
2208 Ga0207702_10093619
2209 Ga0207702_10138992
2210 Ga0207702_10643854
2211 Ga0207641_10000152
2212 Ga0207641_10000418
2213 Ga0207641_10004489
2214 Ga0207641_10051955
2215 Ga0207641_10087159
2216 Ga0207641_10115859
2217 Ga0207641_10365245
2218 Ga0207648_10001186
2219 Ga0207648_10031158
2220 Ga0207648_10045600
2221 Ga0207648_10055669
2222 Ga0207648_10063825
2223 Ga0207648_10097621
2224 Ga0207648_10101771
2225 Ga0207648_10146808
2226 Ga0207648_10148765
2227 Ga0207648_10238101
2228 Ga0207648_10643040
2229 Ga0207648_10733062
2230 Ga0207648_11067979
2231 Ga0207676_10006216
2232 Ga0207676_10098522
2233 Ga0207676_10367815
2234 Ga0207676_10389956
2235 Ga0207676_10586540
2236 Ga0207676_11199633
2237 Ga0207674_10006492
2238 Ga0207674_10012911
2239 Ga0207674_10030052
2240 Ga0207674_10081980
2241 Ga0207674_10184496
2242 Ga0207674_10254963
2243 Ga0207674_10516949
2244 Ga0207674_10754037
2245 Ga0207675_100062346
2246 Ga0207675_100062529
2247 Ga0207675_100075735
2248 Ga0207675_100099250
2249 Ga0207675_100103587
2250 Ga0207675_100217452
2251 Ga0207675_100233673
2252 Ga0207675_100239542
2253 Ga0207675_100337059
2254 Ga0207683_10057040
2255 Ga0207683_10141863
2256 Ga0207683_10149980
2257 Ga0207683_10178411
2258 Ga0207683_10222892
2259 Ga0207683_10259266
2260 Ga0207698_10008700
2261 Ga0207698_10023196
2262 Ga0207698_10024494
2263 Ga0207698_10025309
2264 Ga0207698_10033415
2265 Ga0207698_10049762
2266 Ga0207698_10065551
2267 Ga0207698_10080035
2268 Ga0207698_10140634
2269 Ga0207698_10156315
2270 Ga0207698_10308193
2271 Ga0209984_1016211
2272 Ga0209995_1025689
2273 Ga0268266_10000034
2274 Ga0268266_10002645
2275 Ga0268266_10028759
2276 Ga0268266_10960939
2277 Ga0268265_10044613
2278 Ga0268265_10045980
2279 Ga0268265_10472459
2280 Ga0268265_11386286
2281 Ga0268264_10000117
2282 Ga0268264_10005355
2283 Ga0268264_10007632
2284 Ga0268264_10024882
2285 Ga0268264_10090261
2286 Ga0268264_10103812
2287 Ga0268264_10234265
2288 Ga0268264_10328300
2289 Ga0268264_10709918
2290 Ga0307517_10030353
2291 Ga0307515_10000039
2292 Ga0307511_10000153
2293 Ga0265327_10000030
2294 Ga0307513_10029047
2295 Ga0307408_100275715
2296 Ga0307508_10000937
2297 Ga0307518_10263568
2298 Ga0307410_10230324
2299 Ga0307414_10024549
2300 Ga0307414_10334306
2301 Ga0307415_100058480
2302 Ga0373955_0126666
2303 Ga0373924_0101236
2304 Ga0373933_0270802
2305 Ga0373933_0447585
2306 Ga0373937_0261971
2307 Ga0373937_0423600
2308 Ga0395899_0004650
2309 Ga0395899_0014385
2310 Ga0395899_0017265
2311 Ga0395899_0344742
2312 Ga0395900_0000594
2313 Ga0395900_0026735
2314 Ga0395900_0038159
2315 Ga0395900_0113079
2316 Ga0395900_0492261
2317 Ga0395900_0506480
2318 Ga0395898_0001271
2319 Ga0395898_0019396
2320 Ga0395898_0031929
2321 Ga0395898_0084334
2322 Ga0395898_0294244
2323 Ga0395905_0000527
2324 Ga0395905_0045277
2325 Ga0395905_0050843
2326 Ga0395901_0014247
2327 Ga0395901_0017770
2328 Ga0395901_0087877
2329 Ga0395901_0105083
2330 Ga0395901_0179498
2331 Ga0395901_0581778
2332 Ga0436365_1161343
2333 Ga0436365_1876803
2334 Ga0439465_0057582
2335 Ga0451849_0457641
2336 Ga0451851_0698711
2337 Ga0439441_005719
2338 Ga0439443_030000
2339 Ga0439445_0023729
2340 Ga0439449_0012045
2341 Ga0439449_0015551
2342 Ga0439454_020763
2343 Ga0439457_010574
2344 Ga0439457_060182
2345 Ga0450895_009516
2346 Ga0450896_028602
2347 Ga0450898_001510
2348 Ga0439460_0022853
2349 Ga0451577_0107026
2350 Ga0451577_0222244
2351 Ga0466972_0000175
2352 Ga0466972_0000782
2353 Ga0466966_0335187
2354 Ga0466964_0052419
2355 Ga0453684_0038732
2356 Ga0453684_0054306
2357 Ga0453684_0077553
2358 Ga0466968_0038156
2359 Ga0466968_0125093
2360 Ga0466970_0001012
2361 Ga0466960_0091924
2362 Ga0466959_0503167
2363 Ga0451576_0077826
2364 Ga0451576_0305980
2365 Ga0466967_0501574
2366 Ga0495638_0072586
2367 Ga0495638_0141913
2368 Ga0495653_0078610
2369 Ga0495580_0033076
2370 Ga0495628_0338979
2371 Ga0495648_0002156
2372 Ga0495587_0033786
2373 Ga0495587_0097319
2374 Ga0495621_0072455
2375 Ga0495621_0116141
2376 Ga0495645_0285819
2377 Ga0495633_0187636
2378 Ga0495668_0050185
2379 Ga0495634_0097080
2380 Ga0495657_0025035
2381 Ga0495599_0413026
2382 Ga0495658_0003503
2383 Ga0495658_0478832
2384 Ga0495680_0447408
2385 Ga0495684_0096239
2386 Ga0495686_0000041
2387 Ga0495686_0045508
2388 Ga0496101_0051249
2389 Ga0496105_0214858
2390 Ga0496107_0251565
2391 Ga0496108_0867115
2392 Ga0496109_0172869
2393 Ga0496111_0017833
2394 Ga0496114_0448181
2395 Ga0496114_0582472
2396 Ga0496115_0371094
2397 Ga0501305_051632
2398 Ga0501292_010651
2399 Ga0501298_004827
2400 Ga0501299_002352
2401 Ga0501313_003594
2402 Ga0501313_003720
2403 Ga0501315_004296
2404 Ga0501340_000795
2405 Ga0501031_0030645
2406 Ga0501032_0011446
2407 Ga0501032_0259844
2408 Ga0501033_0197232
2409 Ga0501034_0013066
2410 Ga0501034_0016139
2411 Ga0501034_0066443
2412 Ga0501034_0070588
2413 Ga0501034_0217761
2414 Ga0501036_0055928
2415 Ga0501036_0078561
2416 Ga0501037_0003876
2417 Ga0501037_0052301
2418 Ga0501037_0098003
2419 Ga0501037_0225536
2420 Ga0501038_0007909
2421 Ga0501038_0320503
2422 Ga0501039_0016596
2423 Ga0501039_0202355
2424 Ga0501040_0183156
2425 Ga0501043_0007741
2426 Ga0501043_0052196
2427 Ga0501043_0068317
2428 Ga0501043_0096161
2429 Ga0501043_0155234
2430 Ga0501046_0010893
2431 Ga0501047_0002262
2432 Ga0501047_0142055
2433 Ga0501047_0326279
2434 Ga0501047_0378910
2435 Ga0501047_0778165
2436 Ga0501067_0030643
2437 Ga0501068_0036486
2438 Ga0501069_0133656
2439 Ga0501070_0014912
2440 Ga0501070_0063339
2441 Ga0501070_0073982
2442 Ga0501070_0418080
2443 Ga0501072_0462128
2444 Ga0501073_0058616
2445 Ga0501074_0057085
2446 Ga0501198_007808
2447 Ga0501201_000258
2448 Ga0501202_004058
2449 Ga0501202_031722
2450 Ga0501216_040980
2451 Ga0501217_001890
2452 Ga0501222_003740
2453 Ga0501223_007746
2454 Ga0501223_019582
2455 Ga0501233_001139
2456 Ga0501235_000140
2457 Ga0501235_013210
2458 Ga0501235_063768
2459 Ga0501250_004483
2460 Ga0501255_011737
2461 Ga0501257_075834
2462 Ga0501259_001544
2463 Ga0501259_025579
2464 Ga0501261_001807
2465 Ga0501221_001525
2466 Ga0501221_060809
2467 Ga0501225_0021105
2468 Ga0501225_0022094
2469 Ga0501245_000855
2470 Ga0501245_010713
2471 Ga0501079_0444552
2472 Ga0501080_0064884
2473 Ga0501083_0050487
2474 Ga0501263_044221
2475 Ga0501266_011754
2476 Ga0501268_018834
2477 Ga0501270_002470
2478 Ga0501279_012781
2479 Ga0501035_0018008
2480 Ga0501035_0025624
2481 Ga0501035_0206525
2482 Ga0501035_0721628
2483 Ga0501044_0065549
2484 Ga0501044_0116849
2485 Ga0501044_0303018
2486 Ga0501044_0576252
2487 Ga0501045_0126116
2488 nmdc:mga0k408_120615_c1
2489 nmdc:mga05p37_145085_c1
2490 nmdc:mga09592_11480_c1
2491 nmdc:mga09592_27033_c1
2492 nmdc:mga09592_42061_c1
2493 nmdc:mga06r32_51640_c1
2494 nmdc:mga08y16_104126_c1
2495 nmdc:mga08y16_178907_c1
2496 Ga0495619_0050828
2497 Ga0500643_026965
2498 Ga0500643_084142
2499 Ga0500644_0028808
2500 Ga0500646_0007425
2501 Ga0500562_000036
2502 Ga0500594_0014966
2503 Ga0500655_012414
2504 Ga0500568_0037481
2505 Ga0500588_0004743
2506 Ga0500604_0001825
2507 Ga0500616_0019418
2508 Ga0500622_0000484
2509 Ga0500622_0001151
2510 Ga0500637_0166241
2511 Ga0500611_000018
2512 Ga0500645_009647
2513 Ga0501084_0058664
2514 Ga0501084_0267362
2515 Ga0500661_015042
2516 Ga0587109_039515
2517 Ga0501082_0112373
2518 2819589611
2519 2914763341
2520 2929156201

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

43

229

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.7798 1 201
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.76 3 206
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.7493 1 201
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.744 3 206
6yxa-assembly1.cif.gz_A-2 structure of the bifunctional rel enzyme from b. subtilis 0.3775 56 159
ID Description Score Start End Superfamily
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7534 10 192 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7424 10 192 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7254 10 192 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7152 10 192 1.10.1760.20
af_I1KG51_268_372_1.20.58.1220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Exo84p, C-terminal helical domain 0.5559 3 126 1.20.58.1220
ID Description Score Start End GO Terms
AF-A0A1I0MYY8-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9389 1 204 GO:0005886
GO:0008654
GO:0043772
AF-A0A4V1ZZ72-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9353 1 121 GO:0005886
GO:0008654
GO:0043772
AF-A0A2T6ENC9-F1-model_v4 deleted 0.935 1 122
AF-A0A380DR25-F1-model_v4 Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY (EC 2.3.1.-) 0.931 1 133 GO:0005886
GO:0008654
GO:0043772
AF-A0A7V1RH82-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9252 3 201 GO:0004366
GO:0005886
GO:0008654
GO:0043772

Map