F492291
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1260 | 333 | 2520 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10076279|rootL2_100762795 |
| Length | 252 |
| Sequence | MHFTAPLKFAKGTGYSQFLFLKPYICFPPNQLPPMIEAVLIVLAYLIGSIPTSVWISRYFFEIDIRDYGSGNAGATNTFRVLGSKWGTIVMICDVLKGIIATSLYIMVSFYVVKDHDVDRTKLMIGLGLAAVIGHVFPIWAGFRGGKGVATLFGMIIAMQPAVAACCVLVFLLVLYLTRFVSLSSILAGVAFAILILFIFDDNVTLYRIFSVLVALLVILTHQKNINRLLNGTESKVPILKYRDRRRERRRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 118 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 190 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 205 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 206 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 207 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 208 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 209 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 210 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 211 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 212 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 213 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 214 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 215 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 216 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 220 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 255 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 256 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 257 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 280 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 282 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 283 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 284 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 285 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 286 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 289 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 290 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 291 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 292 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 293 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 294 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 300 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 301 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 302 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 303 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 314 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 316 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 317 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 318 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 319 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 320 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 321 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 322 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 323 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 324 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 325 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 326 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 327 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 329 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 332 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 333 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.57 |
| Metatranscriptomes | 1.19 |
| Isolates | 0.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.75 |
| Nodule | 0 |
| Rhizoplane | 0.71 |
| Rhizosphere | 95.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10076279 | 3300003322 | Bacteria | 5022 |
| 2 | MRS1b_contig_1168309 | 2162886011 | Bacteria | 856 |
| 3 | MBSR1b_contig_4379216 | 2162886012 | Unclassified | 1163 |
| 4 | MBSR1b_contig_7995764 | 2162886012 | Unclassified | 1163 |
| 5 | JGI24751J29686_10061188 | 3300002459 | Bacteria | 775 |
| 6 | rootH1_10109167 | 3300003316 | Bacteria | 1140 |
| 7 | rootH1_10125848 | 3300003316 | Bacteria | 3347 |
| 8 | rootH2_10162769 | 3300003320 | Bacteria | 4159 |
| 9 | rootH2_10197471 | 3300003320 | Bacteria | 2933 |
| 10 | rootH2_10205626 | 3300003320 | Bacteria | 2737 |
| 11 | rootL2_10097124 | 3300003322 | Unclassified | 2320 |
| 12 | rootL2_10135684 | 3300003322 | Bacteria | 4544 |
| 13 | rootH1_10227879 | 3300003323 | Unclassified | 1569 |
| 14 | JGI25160J50197_1003126 | 3300003354 | Bacteria | 7532 |
| 15 | Ga0058861_12043672 | 3300004800 | Bacteria | 744 |
| 16 | Ga0058862_12478465 | 3300004803 | Bacteria | 1575 |
| 17 | Ga0065714_10079249 | 3300005288 | Bacteria | 2531 |
| 18 | Ga0065714_10226543 | 3300005288 | Unclassified | 827 |
| 19 | Ga0065704_10121850 | 3300005289 | Bacteria | 1759 |
| 20 | Ga0065704_10182402 | 3300005289 | Bacteria | 1230 |
| 21 | Ga0065712_10073224 | 3300005290 | Bacteria | 4461 |
| 22 | Ga0065712_10089634 | 3300005290 | Bacteria | 2446 |
| 23 | Ga0065712_10154453 | 3300005290 | Bacteria | 1321 |
| 24 | Ga0065712_10170127 | 3300005290 | Bacteria | 1248 |
| 25 | Ga0065712_10225270 | 3300005290 | Bacteria | 1028 |
| 26 | Ga0065715_10013993 | 3300005293 | Unclassified | 1980 |
| 27 | Ga0065715_10323297 | 3300005293 | Bacteria | 998 |
| 28 | Ga0070658_10001461 | 3300005327 | Bacteria | 20135 |
| 29 | Ga0070658_10045017 | 3300005327 | Bacteria | 3567 |
| 30 | Ga0070658_10045140 | 3300005327 | Bacteria | 3562 |
| 31 | Ga0070658_10100597 | 3300005327 | Bacteria | 2390 |
| 32 | Ga0070658_10182071 | 3300005327 | Bacteria | 1768 |
| 33 | Ga0070658_10824846 | 3300005327 | Bacteria | 806 |
| 34 | Ga0070676_10000153 | 3300005328 | Bacteria | 27368 |
| 35 | Ga0070676_10005303 | 3300005328 | Bacteria | 6859 |
| 36 | Ga0070676_10033838 | 3300005328 | Unclassified | 2932 |
| 37 | Ga0070683_100000329 | 3300005329 | Bacteria | 32745 |
| 38 | Ga0070683_100018651 | 3300005329 | Bacteria | 6149 |
| 39 | Ga0070683_100023520 | 3300005329 | Bacteria | 5511 |
| 40 | Ga0070683_100053673 | 3300005329 | Bacteria | 3735 |
| 41 | Ga0070683_100081163 | 3300005329 | Bacteria | 3036 |
| 42 | Ga0070690_100051558 | 3300005330 | Unclassified | 2627 |
| 43 | Ga0070690_100177737 | 3300005330 | Unclassified | 1469 |
| 44 | Ga0070670_100032449 | 3300005331 | Bacteria | 4498 |
| 45 | Ga0070670_100053200 | 3300005331 | Bacteria | 3477 |
| 46 | Ga0070670_100149986 | 3300005331 | Bacteria | 2018 |
| 47 | Ga0070670_100150728 | 3300005331 | Bacteria | 2012 |
| 48 | Ga0070670_100174216 | 3300005331 | Unclassified | 1867 |
| 49 | Ga0070670_100264373 | 3300005331 | Bacteria | 1500 |
| 50 | Ga0070670_100358496 | 3300005331 | Bacteria | 1282 |
| 51 | Ga0070670_100360560 | 3300005331 | Bacteria | 1278 |
| 52 | Ga0070670_100522309 | 3300005331 | Bacteria | 1057 |
| 53 | Ga0070670_100630214 | 3300005331 | Bacteria | 961 |
| 54 | Ga0070670_100981754 | 3300005331 | Bacteria | 768 |
| 55 | Ga0070677_10002116 | 3300005333 | Bacteria | 6336 |
| 56 | Ga0070677_10042997 | 3300005333 | Bacteria | 1792 |
| 57 | Ga0070677_10115552 | 3300005333 | Bacteria | 1204 |
| 58 | Ga0070677_10153182 | 3300005333 | Unclassified | 1075 |
| 59 | Ga0068869_100007813 | 3300005334 | Bacteria | 6860 |
| 60 | Ga0068869_100012388 | 3300005334 | Bacteria | 5634 |
| 61 | Ga0068869_100024126 | 3300005334 | Bacteria | 4211 |
| 62 | Ga0068869_100031526 | 3300005334 | Bacteria | 3729 |
| 63 | Ga0068869_100118166 | 3300005334 | Unclassified | 2025 |
| 64 | Ga0068869_100162297 | 3300005334 | Bacteria | 1740 |
| 65 | Ga0068869_100401576 | 3300005334 | Bacteria | 1127 |
| 66 | Ga0070666_10000043 | 3300005335 | Bacteria | 111402 |
| 67 | Ga0070666_10000209 | 3300005335 | Bacteria | 40151 |
| 68 | Ga0070666_10031000 | 3300005335 | Bacteria | 3528 |
| 69 | Ga0070666_10031370 | 3300005335 | Bacteria | 3508 |
| 70 | Ga0070666_10119646 | 3300005335 | Unclassified | 1826 |
| 71 | Ga0070666_10144826 | 3300005335 | Bacteria | 1656 |
| 72 | Ga0070666_10292921 | 3300005335 | Bacteria | 1158 |
| 73 | Ga0070680_100000076 | 3300005336 | Bacteria | 53273 |
| 74 | Ga0070680_100012535 | 3300005336 | Bacteria | 6588 |
| 75 | Ga0070680_100021326 | 3300005336 | Bacteria | 5147 |
| 76 | Ga0070680_100024075 | 3300005336 | Bacteria | 4860 |
| 77 | Ga0070680_100045972 | 3300005336 | Bacteria | 3550 |
| 78 | Ga0070682_100000717 | 3300005337 | Bacteria | 19844 |
| 79 | Ga0070682_100086673 | 3300005337 | Bacteria | 2039 |
| 80 | Ga0070682_100155207 | 3300005337 | Bacteria | 1575 |
| 81 | Ga0070682_100169628 | 3300005337 | Unclassified | 1515 |
| 82 | Ga0070682_100243568 | 3300005337 | Bacteria | 1292 |
| 83 | Ga0068868_100000726 | 3300005338 | Bacteria | 22242 |
| 84 | Ga0068868_100001336 | 3300005338 | Bacteria | 17019 |
| 85 | Ga0068868_100022584 | 3300005338 | Bacteria | 4750 |
| 86 | Ga0068868_100078450 | 3300005338 | Bacteria | 2644 |
| 87 | Ga0068868_100097530 | 3300005338 | Bacteria | 2375 |
| 88 | Ga0068868_100172352 | 3300005338 | Bacteria | 1792 |
| 89 | Ga0068868_100180291 | 3300005338 | Bacteria | 1752 |
| 90 | Ga0068868_100247821 | 3300005338 | Unclassified | 1498 |
| 91 | Ga0068868_100595379 | 3300005338 | Bacteria | 979 |
| 92 | Ga0068868_100811708 | 3300005338 | Bacteria | 845 |
| 93 | Ga0070660_100034772 | 3300005339 | Bacteria | 3810 |
| 94 | Ga0070660_100043591 | 3300005339 | Bacteria | 3429 |
| 95 | Ga0070660_100057089 | 3300005339 | Bacteria | 3023 |
| 96 | Ga0070660_100083945 | 3300005339 | Bacteria | 2503 |
| 97 | Ga0070660_100133622 | 3300005339 | Bacteria | 1987 |
| 98 | Ga0070660_100147379 | 3300005339 | Bacteria | 1891 |
| 99 | Ga0070660_100421503 | 3300005339 | Unclassified | 1105 |
| 100 | Ga0070660_100551128 | 3300005339 | Unclassified | 962 |
| 101 | Ga0070689_100019751 | 3300005340 | Bacteria | 4985 |
| 102 | Ga0070689_100503540 | 3300005340 | Bacteria | 1038 |
| 103 | Ga0070691_10001594 | 3300005341 | Bacteria | 9806 |
| 104 | Ga0070691_10007717 | 3300005341 | Bacteria | 4928 |
| 105 | Ga0070691_10041025 | 3300005341 | Bacteria | 2188 |
| 106 | Ga0070687_100014051 | 3300005343 | Unclassified | 3587 |
| 107 | Ga0070687_100125092 | 3300005343 | Bacteria | 1476 |
| 108 | Ga0070687_100147780 | 3300005343 | Bacteria | 1376 |
| 109 | Ga0070687_100356811 | 3300005343 | Bacteria | 945 |
| 110 | Ga0070661_100004831 | 3300005344 | Bacteria | 9277 |
| 111 | Ga0070661_100009444 | 3300005344 | Bacteria | 6751 |
| 112 | Ga0070661_100064706 | 3300005344 | Bacteria | 2687 |
| 113 | Ga0070661_100104590 | 3300005344 | Unclassified | 2109 |
| 114 | Ga0070661_100168713 | 3300005344 | Bacteria | 1661 |
| 115 | Ga0070668_100000556 | 3300005347 | Bacteria | 24937 |
| 116 | Ga0070668_100012182 | 3300005347 | Bacteria | 6404 |
| 117 | Ga0070668_100073785 | 3300005347 | Bacteria | 2660 |
| 118 | Ga0070668_100138846 | 3300005347 | Bacteria | 1957 |
| 119 | Ga0070668_100485189 | 3300005347 | Unclassified | 1068 |
| 120 | Ga0070669_100009249 | 3300005353 | Bacteria | 7020 |
| 121 | Ga0070669_100035738 | 3300005353 | Bacteria | 3600 |
| 122 | Ga0070675_100010042 | 3300005354 | Bacteria | 7381 |
| 123 | Ga0070675_100026514 | 3300005354 | Bacteria | 4652 |
| 124 | Ga0070675_100043632 | 3300005354 | Bacteria | 3665 |
| 125 | Ga0070675_100050419 | 3300005354 | Bacteria | 3418 |
| 126 | Ga0070675_100611183 | 3300005354 | Unclassified | 989 |
| 127 | Ga0070675_100638424 | 3300005354 | Bacteria | 967 |
| 128 | Ga0070671_100001985 | 3300005355 | Bacteria | 15713 |
| 129 | Ga0070671_100013745 | 3300005355 | Bacteria | 6530 |
| 130 | Ga0070671_100069303 | 3300005355 | Bacteria | 2942 |
| 131 | Ga0070671_100115887 | 3300005355 | Unclassified | 2253 |
| 132 | Ga0070671_100585517 | 3300005355 | Unclassified | 964 |
| 133 | Ga0070674_100029455 | 3300005356 | Bacteria | 3617 |
| 134 | Ga0070674_100030959 | 3300005356 | Bacteria | 3541 |
| 135 | Ga0070674_100753954 | 3300005356 | Bacteria | 837 |
| 136 | Ga0070673_100000867 | 3300005364 | Bacteria | 17013 |
| 137 | Ga0070673_100006375 | 3300005364 | Bacteria | 7667 |
| 138 | Ga0070673_100037568 | 3300005364 | Unclassified | 3691 |
| 139 | Ga0070673_100042687 | 3300005364 | Unclassified | 3498 |
| 140 | Ga0070673_100059928 | 3300005364 | Unclassified | 3014 |
| 141 | Ga0070673_100098764 | 3300005364 | Bacteria | 2400 |
| 142 | Ga0070673_100206169 | 3300005364 | Bacteria | 1695 |
| 143 | Ga0070673_100217525 | 3300005364 | Unclassified | 1652 |
| 144 | Ga0070673_100219615 | 3300005364 | Unclassified | 1644 |
| 145 | Ga0070673_100281591 | 3300005364 | Bacteria | 1459 |
| 146 | Ga0070688_100004476 | 3300005365 | Bacteria | 7279 |
| 147 | Ga0070688_100089412 | 3300005365 | Bacteria | 2009 |
| 148 | Ga0070688_100169991 | 3300005365 | Bacteria | 1503 |
| 149 | Ga0070688_100234589 | 3300005365 | Bacteria | 1299 |
| 150 | Ga0070688_100262084 | 3300005365 | Bacteria | 1235 |
| 151 | Ga0070659_100007187 | 3300005366 | Bacteria | 8080 |
| 152 | Ga0070659_100014833 | 3300005366 | Bacteria | 5827 |
| 153 | Ga0070659_100061370 | 3300005366 | Bacteria | 2971 |
| 154 | Ga0070659_100191534 | 3300005366 | Unclassified | 1681 |
| 155 | Ga0070659_100228816 | 3300005366 | Bacteria | 1536 |
| 156 | Ga0070659_100542459 | 3300005366 | Unclassified | 995 |
| 157 | Ga0070667_100000812 | 3300005367 | Bacteria | 29157 |
| 158 | Ga0070667_100008930 | 3300005367 | Bacteria | 8297 |
| 159 | Ga0070667_100020249 | 3300005367 | Bacteria | 5523 |
| 160 | Ga0070667_100028595 | 3300005367 | Bacteria | 4642 |
| 161 | Ga0070667_100057396 | 3300005367 | Unclassified | 3290 |
| 162 | Ga0070667_100220075 | 3300005367 | Bacteria | 1690 |
| 163 | Ga0070667_100250684 | 3300005367 | Bacteria | 1583 |
| 164 | Ga0070667_100282103 | 3300005367 | Bacteria | 1492 |
| 165 | Ga0070667_100299953 | 3300005367 | Bacteria | 1446 |
| 166 | Ga0070667_100353261 | 3300005367 | Bacteria | 1331 |
| 167 | Ga0070667_100547582 | 3300005367 | Bacteria | 1063 |
| 168 | Ga0070701_10030425 | 3300005438 | Bacteria | 2671 |
| 169 | Ga0070701_10042878 | 3300005438 | Unclassified | 2312 |
| 170 | Ga0070700_100027344 | 3300005441 | Unclassified | 3381 |
| 171 | Ga0070700_100206961 | 3300005441 | Unclassified | 1382 |
| 172 | Ga0070663_100161237 | 3300005455 | Bacteria | 1726 |
| 173 | Ga0070663_100370722 | 3300005455 | Bacteria | 1164 |
| 174 | Ga0070663_100577370 | 3300005455 | Bacteria | 943 |
| 175 | Ga0070678_100057003 | 3300005456 | Unclassified | 2860 |
| 176 | Ga0070678_100059231 | 3300005456 | Bacteria | 2814 |
| 177 | Ga0070678_100679540 | 3300005456 | Bacteria | 926 |
| 178 | Ga0070662_100001017 | 3300005457 | Bacteria | 17158 |
| 179 | Ga0070662_100039341 | 3300005457 | Bacteria | 3362 |
| 180 | Ga0070662_100041094 | 3300005457 | Bacteria | 3297 |
| 181 | Ga0070662_100047930 | 3300005457 | Unclassified | 3076 |
| 182 | Ga0070662_100050347 | 3300005457 | Bacteria | 3005 |
| 183 | Ga0070662_100062595 | 3300005457 | Bacteria | 2719 |
| 184 | Ga0070662_100070905 | 3300005457 | Bacteria | 2568 |
| 185 | Ga0070662_100153087 | 3300005457 | Bacteria | 1797 |
| 186 | Ga0070681_10030832 | 3300005458 | Bacteria | 5382 |
| 187 | Ga0070681_10034476 | 3300005458 | Bacteria | 5082 |
| 188 | Ga0070681_10069046 | 3300005458 | Bacteria | 3500 |
| 189 | Ga0070681_10089254 | 3300005458 | Bacteria | 3034 |
| 190 | Ga0070681_10092504 | 3300005458 | Bacteria | 2973 |
| 191 | Ga0070681_10189654 | 3300005458 | Bacteria | 1975 |
| 192 | Ga0070681_10318982 | 3300005458 | Bacteria | 1463 |
| 193 | Ga0070681_10498067 | 3300005458 | Unclassified | 1131 |
| 194 | Ga0068867_100009628 | 3300005459 | Bacteria | 6814 |
| 195 | Ga0068867_100017213 | 3300005459 | Bacteria | 5133 |
| 196 | Ga0068867_100018823 | 3300005459 | Bacteria | 4913 |
| 197 | Ga0068867_100045627 | 3300005459 | Bacteria | 3215 |
| 198 | Ga0068867_100077217 | 3300005459 | Bacteria | 2502 |
| 199 | Ga0068867_100124886 | 3300005459 | Bacteria | 1993 |
| 200 | Ga0068867_100276407 | 3300005459 | Bacteria | 1375 |
| 201 | Ga0068867_100393196 | 3300005459 | Unclassified | 1167 |
| 202 | Ga0068867_100453623 | 3300005459 | Bacteria | 1093 |
| 203 | Ga0068867_100576468 | 3300005459 | Bacteria | 978 |
| 204 | Ga0070685_10023313 | 3300005466 | Unclassified | 3388 |
| 205 | Ga0070685_10030244 | 3300005466 | Bacteria | 3015 |
| 206 | Ga0070685_10162796 | 3300005466 | Unclassified | 1423 |
| 207 | Ga0070685_10482928 | 3300005466 | Bacteria | 874 |
| 208 | Ga0070698_100008720 | 3300005471 | Bacteria | 10923 |
| 209 | Ga0070698_100034419 | 3300005471 | Bacteria | 5242 |
| 210 | Ga0070698_100219385 | 3300005471 | Bacteria | 1836 |
| 211 | Ga0070679_100001661 | 3300005530 | Bacteria | 20056 |
| 212 | Ga0070679_100009375 | 3300005530 | Bacteria | 9257 |
| 213 | Ga0070679_100022898 | 3300005530 | Bacteria | 6110 |
| 214 | Ga0070679_100029983 | 3300005530 | Bacteria | 5368 |
| 215 | Ga0070679_100037881 | 3300005530 | Bacteria | 4791 |
| 216 | Ga0070679_100050468 | 3300005530 | Bacteria | 4145 |
| 217 | Ga0070679_100062160 | 3300005530 | Bacteria | 3722 |
| 218 | Ga0070679_100151851 | 3300005530 | Bacteria | 2292 |
| 219 | Ga0070679_100241274 | 3300005530 | Bacteria | 1764 |
| 220 | Ga0070684_100000768 | 3300005535 | Bacteria | 22215 |
| 221 | Ga0070684_100001060 | 3300005535 | Bacteria | 19661 |
| 222 | Ga0070684_100595267 | 3300005535 | Unclassified | 1028 |
| 223 | Ga0068853_100000520 | 3300005539 | Bacteria | 26128 |
| 224 | Ga0068853_100009389 | 3300005539 | Bacteria | 7886 |
| 225 | Ga0068853_100010204 | 3300005539 | Bacteria | 7594 |
| 226 | Ga0068853_100020753 | 3300005539 | Bacteria | 5465 |
| 227 | Ga0068853_100059557 | 3300005539 | Bacteria | 3299 |
| 228 | Ga0068853_100074904 | 3300005539 | Bacteria | 2954 |
| 229 | Ga0068853_100097777 | 3300005539 | Bacteria | 2592 |
| 230 | Ga0068853_100106099 | 3300005539 | Bacteria | 2489 |
| 231 | Ga0068853_100154878 | 3300005539 | Bacteria | 2064 |
| 232 | Ga0068853_100169030 | 3300005539 | Bacteria | 1977 |
| 233 | Ga0068853_100205813 | 3300005539 | Bacteria | 1792 |
| 234 | Ga0068853_100228366 | 3300005539 | Bacteria | 1702 |
| 235 | Ga0068853_100267326 | 3300005539 | Unclassified | 1574 |
| 236 | Ga0068853_100399359 | 3300005539 | Bacteria | 1286 |
| 237 | Ga0068853_100410303 | 3300005539 | Bacteria | 1269 |
| 238 | Ga0068853_100497853 | 3300005539 | Bacteria | 1150 |
| 239 | Ga0070672_100000738 | 3300005543 | Bacteria | 19396 |
| 240 | Ga0070672_100086295 | 3300005543 | Bacteria | 2524 |
| 241 | Ga0070672_100097907 | 3300005543 | Bacteria | 2375 |
| 242 | Ga0070672_100272233 | 3300005543 | Bacteria | 1430 |
| 243 | Ga0070672_100318410 | 3300005543 | Bacteria | 1322 |
| 244 | Ga0070686_100204799 | 3300005544 | Unclassified | 1417 |
| 245 | Ga0070686_100547308 | 3300005544 | Bacteria | 905 |
| 246 | Ga0070665_100000016 | 3300005548 | Bacteria | 451538 |
| 247 | Ga0070665_100000486 | 3300005548 | Bacteria | 57134 |
| 248 | Ga0070665_100076887 | 3300005548 | Unclassified | 3344 |
| 249 | Ga0070665_100174223 | 3300005548 | Bacteria | 2152 |
| 250 | Ga0070665_100589784 | 3300005548 | Bacteria | 1124 |
| 251 | Ga0070704_100133488 | 3300005549 | Unclassified | 1928 |
| 252 | Ga0068855_100001195 | 3300005563 | Bacteria | 32239 |
| 253 | Ga0068855_100002033 | 3300005563 | Bacteria | 25069 |
| 254 | Ga0068855_100027744 | 3300005563 | Bacteria | 6775 |
| 255 | Ga0068855_100038229 | 3300005563 | Bacteria | 5703 |
| 256 | Ga0068855_100095965 | 3300005563 | Bacteria | 3417 |
| 257 | Ga0068855_100100781 | 3300005563 | Bacteria | 3325 |
| 258 | Ga0068855_100125190 | 3300005563 | Bacteria | 2939 |
| 259 | Ga0068855_100174465 | 3300005563 | Unclassified | 2433 |
| 260 | Ga0068855_101058718 | 3300005563 | Unclassified | 850 |
| 261 | Ga0070664_100007325 | 3300005564 | Bacteria | 8896 |
| 262 | Ga0070664_100017660 | 3300005564 | Bacteria | 5858 |
| 263 | Ga0070664_100101274 | 3300005564 | Unclassified | 2505 |
| 264 | Ga0070664_100190998 | 3300005564 | Bacteria | 1825 |
| 265 | Ga0070664_100252487 | 3300005564 | Bacteria | 1585 |
| 266 | Ga0070664_100413307 | 3300005564 | Bacteria | 1235 |
| 267 | Ga0070664_100501886 | 3300005564 | Bacteria | 1118 |
| 268 | Ga0068857_100008614 | 3300005577 | Bacteria | 8827 |
| 269 | Ga0068857_100032917 | 3300005577 | Bacteria | 4583 |
| 270 | Ga0068857_100115318 | 3300005577 | Bacteria | 2416 |
| 271 | Ga0068857_100132177 | 3300005577 | Bacteria | 2251 |
| 272 | Ga0068857_100190919 | 3300005577 | Bacteria | 1866 |
| 273 | Ga0068857_100499890 | 3300005577 | Bacteria | 1141 |
| 274 | Ga0068857_100556531 | 3300005577 | Bacteria | 1081 |
| 275 | Ga0068854_100003899 | 3300005578 | Bacteria | 9349 |
| 276 | Ga0068854_100043746 | 3300005578 | Bacteria | 3176 |
| 277 | Ga0068854_100061668 | 3300005578 | Bacteria | 2716 |
| 278 | Ga0068854_100064033 | 3300005578 | Unclassified | 2670 |
| 279 | Ga0068854_100068384 | 3300005578 | Bacteria | 2590 |
| 280 | Ga0068854_100329767 | 3300005578 | Bacteria | 1243 |
| 281 | Ga0068854_100505941 | 3300005578 | Bacteria | 1018 |
| 282 | Ga0068856_100028734 | 3300005614 | Bacteria | 5433 |
| 283 | Ga0068856_100062559 | 3300005614 | Bacteria | 3677 |
| 284 | Ga0068856_100074389 | 3300005614 | Bacteria | 3363 |
| 285 | Ga0068856_100113099 | 3300005614 | Bacteria | 2713 |
| 286 | Ga0068856_100289020 | 3300005614 | Bacteria | 1656 |
| 287 | Ga0070702_100453961 | 3300005615 | Unclassified | 930 |
| 288 | Ga0068852_100002161 | 3300005616 | Bacteria | 13498 |
| 289 | Ga0068852_100003948 | 3300005616 | Bacteria | 10424 |
| 290 | Ga0068852_100005616 | 3300005616 | Bacteria | 8998 |
| 291 | Ga0068852_100017743 | 3300005616 | Bacteria | 5592 |
| 292 | Ga0068852_100030471 | 3300005616 | Bacteria | 4441 |
| 293 | Ga0068852_100039278 | 3300005616 | Bacteria | 3984 |
| 294 | Ga0068852_100073856 | 3300005616 | Bacteria | 3002 |
| 295 | Ga0068852_100106272 | 3300005616 | Bacteria | 2544 |
| 296 | Ga0068852_100126231 | 3300005616 | Bacteria | 2350 |
| 297 | Ga0068852_100166256 | 3300005616 | Bacteria | 2064 |
| 298 | Ga0068852_100211024 | 3300005616 | Bacteria | 1842 |
| 299 | Ga0068852_100225934 | 3300005616 | Bacteria | 1782 |
| 300 | Ga0068852_100414732 | 3300005616 | Bacteria | 1327 |
| 301 | Ga0068852_100570823 | 3300005616 | Unclassified | 1133 |
| 302 | Ga0068852_101072624 | 3300005616 | Bacteria | 825 |
| 303 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 304 | Ga0068859_100015449 | 3300005617 | Bacteria | 7669 |
| 305 | Ga0068859_100016918 | 3300005617 | Bacteria | 7320 |
| 306 | Ga0068859_100121114 | 3300005617 | Bacteria | 2683 |
| 307 | Ga0068859_100155678 | 3300005617 | Unclassified | 2362 |
| 308 | Ga0068859_100180962 | 3300005617 | Bacteria | 2191 |
| 309 | Ga0068859_100182763 | 3300005617 | Bacteria | 2180 |
| 310 | Ga0068859_100183247 | 3300005617 | Unclassified | 2177 |
| 311 | Ga0068859_100232318 | 3300005617 | Bacteria | 1933 |
| 312 | Ga0068859_100366272 | 3300005617 | Bacteria | 1536 |
| 313 | Ga0068859_100391475 | 3300005617 | Bacteria | 1485 |
| 314 | Ga0068859_100404895 | 3300005617 | Bacteria | 1460 |
| 315 | Ga0068859_100470510 | 3300005617 | Unclassified | 1352 |
| 316 | Ga0068864_100002330 | 3300005618 | Bacteria | 15704 |
| 317 | Ga0068864_100010946 | 3300005618 | Bacteria | 7499 |
| 318 | Ga0068864_100030323 | 3300005618 | Bacteria | 4583 |
| 319 | Ga0068864_100064925 | 3300005618 | Bacteria | 3167 |
| 320 | Ga0068864_100097281 | 3300005618 | Unclassified | 2606 |
| 321 | Ga0068864_100279758 | 3300005618 | Unclassified | 1557 |
| 322 | Ga0068864_100595738 | 3300005618 | Bacteria | 1072 |
| 323 | Ga0068864_101165326 | 3300005618 | Unclassified | 768 |
| 324 | Ga0068866_10010917 | 3300005718 | Bacteria | 3912 |
| 325 | Ga0068866_10027968 | 3300005718 | Bacteria | 2682 |
| 326 | Ga0068866_10043497 | 3300005718 | Bacteria | 2242 |
| 327 | Ga0068866_10056271 | 3300005718 | Unclassified | 2023 |
| 328 | Ga0068861_100049526 | 3300005719 | Bacteria | 3181 |
| 329 | Ga0068861_100070790 | 3300005719 | Bacteria | 2702 |
| 330 | Ga0068861_100073926 | 3300005719 | Bacteria | 2649 |
| 331 | Ga0068861_100253963 | 3300005719 | Bacteria | 1501 |
| 332 | Ga0068861_100406837 | 3300005719 | Viruses | 1209 |
| 333 | Ga0068861_100440434 | 3300005719 | Bacteria | 1165 |
| 334 | Ga0068851_10000423 | 3300005834 | Bacteria | 18902 |
| 335 | Ga0068851_10019508 | 3300005834 | Bacteria | 3276 |
| 336 | Ga0068851_10026913 | 3300005834 | Bacteria | 2830 |
| 337 | Ga0068851_10066130 | 3300005834 | Bacteria | 1862 |
| 338 | Ga0068870_10029291 | 3300005840 | Bacteria | 2772 |
| 339 | Ga0068870_10038929 | 3300005840 | Unclassified | 2457 |
| 340 | Ga0068863_100000858 | 3300005841 | Bacteria | 30354 |
| 341 | Ga0068863_100003359 | 3300005841 | Bacteria | 15800 |
| 342 | Ga0068863_100020445 | 3300005841 | Bacteria | 6326 |
| 343 | Ga0068863_100024297 | 3300005841 | Bacteria | 5780 |
| 344 | Ga0068863_100025383 | 3300005841 | Bacteria | 5650 |
| 345 | Ga0068863_100031774 | 3300005841 | Bacteria | 5037 |
| 346 | Ga0068863_100276818 | 3300005841 | Bacteria | 1625 |
| 347 | Ga0068863_100325825 | 3300005841 | Bacteria | 1493 |
| 348 | Ga0068863_100629581 | 3300005841 | Bacteria | 1063 |
| 349 | Ga0068858_100001362 | 3300005842 | Bacteria | 25148 |
| 350 | Ga0068858_100008022 | 3300005842 | Bacteria | 10169 |
| 351 | Ga0068858_100047034 | 3300005842 | Bacteria | 4001 |
| 352 | Ga0068858_100063752 | 3300005842 | Bacteria | 3410 |
| 353 | Ga0068858_100319751 | 3300005842 | Bacteria | 1483 |
| 354 | Ga0068858_100390710 | 3300005842 | Bacteria | 1336 |
| 355 | Ga0068858_100856449 | 3300005842 | Bacteria | 888 |
| 356 | Ga0068860_100000026 | 3300005843 | Bacteria | 270483 |
| 357 | Ga0068860_100002209 | 3300005843 | Bacteria | 20481 |
| 358 | Ga0068860_100007860 | 3300005843 | Bacteria | 10646 |
| 359 | Ga0068860_100010129 | 3300005843 | Bacteria | 9342 |
| 360 | Ga0068860_100016541 | 3300005843 | Bacteria | 7194 |
| 361 | Ga0068860_100018967 | 3300005843 | Bacteria | 6682 |
| 362 | Ga0068860_100072785 | 3300005843 | Bacteria | 3267 |
| 363 | Ga0068860_100091780 | 3300005843 | Bacteria | 2893 |
| 364 | Ga0068860_100151072 | 3300005843 | Bacteria | 2236 |
| 365 | Ga0068860_100568775 | 3300005843 | Bacteria | 1137 |
| 366 | Ga0068862_100010995 | 3300005844 | Bacteria | 7476 |
| 367 | Ga0068862_100047162 | 3300005844 | Unclassified | 3676 |
| 368 | Ga0068862_100064721 | 3300005844 | Bacteria | 3148 |
| 369 | Ga0068862_100127894 | 3300005844 | Bacteria | 2244 |
| 370 | Ga0068862_100133853 | 3300005844 | Unclassified | 2195 |
| 371 | Ga0068862_100688106 | 3300005844 | Bacteria | 990 |
| 372 | Ga0081539_10007837 | 3300005985 | Bacteria | 9546 |
| 373 | Ga0070715_10006819 | 3300006163 | Bacteria | 3899 |
| 374 | Ga0075366_10009633 | 3300006195 | Bacteria | 5399 |
| 375 | Ga0075366_10076952 | 3300006195 | Bacteria | 1991 |
| 376 | Ga0097621_100000027 | 3300006237 | Bacteria | 71873 |
| 377 | Ga0097621_100007971 | 3300006237 | Bacteria | 7603 |
| 378 | Ga0097621_100008933 | 3300006237 | Bacteria | 7244 |
| 379 | Ga0097621_100078756 | 3300006237 | Bacteria | 2738 |
| 380 | Ga0097621_100099328 | 3300006237 | Bacteria | 2446 |
| 381 | Ga0097621_100117833 | 3300006237 | Bacteria | 2250 |
| 382 | Ga0097621_100126650 | 3300006237 | Bacteria | 2170 |
| 383 | Ga0097621_100139216 | 3300006237 | Unclassified | 2073 |
| 384 | Ga0097621_100160061 | 3300006237 | Bacteria | 1935 |
| 385 | Ga0097621_100576317 | 3300006237 | Bacteria | 1026 |
| 386 | Ga0097621_100879549 | 3300006237 | Unclassified | 833 |
| 387 | Ga0068871_100000107 | 3300006358 | Bacteria | 50575 |
| 388 | Ga0068871_100008378 | 3300006358 | Bacteria | 7435 |
| 389 | Ga0068871_100083065 | 3300006358 | Bacteria | 2656 |
| 390 | Ga0068871_100086792 | 3300006358 | Bacteria | 2600 |
| 391 | Ga0068871_100095306 | 3300006358 | Bacteria | 2485 |
| 392 | Ga0068871_100097165 | 3300006358 | Bacteria | 2462 |
| 393 | Ga0068871_100103213 | 3300006358 | Bacteria | 2390 |
| 394 | Ga0068871_100125649 | 3300006358 | Bacteria | 2171 |
| 395 | Ga0068871_100136715 | 3300006358 | Bacteria | 2082 |
| 396 | Ga0068871_100161295 | 3300006358 | Unclassified | 1918 |
| 397 | Ga0068871_100553333 | 3300006358 | Bacteria | 1042 |
| 398 | Ga0075428_100056891 | 3300006844 | Bacteria | 4282 |
| 399 | Ga0075430_100005928 | 3300006846 | Bacteria | 10322 |
| 400 | Ga0075431_100001800 | 3300006847 | Bacteria | 20232 |
| 401 | Ga0075434_100540770 | 3300006871 | Unclassified | 1185 |
| 402 | Ga0075429_100015792 | 3300006880 | Bacteria | 6539 |
| 403 | Ga0075429_100037587 | 3300006880 | Unclassified | 4214 |
| 404 | Ga0075429_100041776 | 3300006880 | Bacteria | 3993 |
| 405 | Ga0075429_100252586 | 3300006880 | Bacteria | 1544 |
| 406 | Ga0075429_100642628 | 3300006880 | Unclassified | 929 |
| 407 | Ga0068865_100002249 | 3300006881 | Bacteria | 11354 |
| 408 | Ga0068865_100125695 | 3300006881 | Unclassified | 1914 |
| 409 | Ga0068865_100128968 | 3300006881 | Unclassified | 1892 |
| 410 | Ga0068865_100131110 | 3300006881 | Unclassified | 1878 |
| 411 | Ga0068865_100197973 | 3300006881 | Bacteria | 1558 |
| 412 | Ga0075436_100290683 | 3300006914 | Unclassified | 1170 |
| 413 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 414 | Ga0097620_100015449 | 3300006931 | Bacteria | 7669 |
| 415 | Ga0097620_100016919 | 3300006931 | Bacteria | 7320 |
| 416 | Ga0097620_100121119 | 3300006931 | Bacteria | 2683 |
| 417 | Ga0097620_100155682 | 3300006931 | Unclassified | 2362 |
| 418 | Ga0097620_100180977 | 3300006931 | Bacteria | 2191 |
| 419 | Ga0097620_100182775 | 3300006931 | Bacteria | 2180 |
| 420 | Ga0097620_100183241 | 3300006931 | Unclassified | 2177 |
| 421 | Ga0097620_100232321 | 3300006931 | Bacteria | 1933 |
| 422 | Ga0097620_100366299 | 3300006931 | Bacteria | 1536 |
| 423 | Ga0097620_100391444 | 3300006931 | Bacteria | 1485 |
| 424 | Ga0097620_100404905 | 3300006931 | Bacteria | 1460 |
| 425 | Ga0105251_10095755 | 3300009011 | Bacteria | 1360 |
| 426 | Ga0105240_10000258 | 3300009093 | Bacteria | 105011 |
| 427 | Ga0105240_10000715 | 3300009093 | Bacteria | 60725 |
| 428 | Ga0105240_10002252 | 3300009093 | Bacteria | 31329 |
| 429 | Ga0105240_10004553 | 3300009093 | Bacteria | 21043 |
| 430 | Ga0105240_10004621 | 3300009093 | Bacteria | 20878 |
| 431 | Ga0105240_10016056 | 3300009093 | Bacteria | 10147 |
| 432 | Ga0105240_10023337 | 3300009093 | Bacteria | 8185 |
| 433 | Ga0105240_10039801 | 3300009093 | Bacteria | 6017 |
| 434 | Ga0105240_10054842 | 3300009093 | Bacteria | 4993 |
| 435 | Ga0105240_10060026 | 3300009093 | Bacteria | 4742 |
| 436 | Ga0105240_10203604 | 3300009093 | Unclassified | 2318 |
| 437 | Ga0105240_10212273 | 3300009093 | Bacteria | 2261 |
| 438 | Ga0111539_10162199 | 3300009094 | Unclassified | 2614 |
| 439 | Ga0105245_10507780 | 3300009098 | Bacteria | 1222 |
| 440 | Ga0105247_10001409 | 3300009101 | Bacteria | 17436 |
| 441 | Ga0105247_10008259 | 3300009101 | Bacteria | 6354 |
| 442 | Ga0114129_10015867 | 3300009147 | Bacteria | 10712 |
| 443 | Ga0105241_10000224 | 3300009174 | Bacteria | 42685 |
| 444 | Ga0105241_10000533 | 3300009174 | Bacteria | 28600 |
| 445 | Ga0105241_10069438 | 3300009174 | Bacteria | 2732 |
| 446 | Ga0105241_10097536 | 3300009174 | Bacteria | 2331 |
| 447 | Ga0105241_10139058 | 3300009174 | Bacteria | 1975 |
| 448 | Ga0105241_10259768 | 3300009174 | Unclassified | 1476 |
| 449 | Ga0105241_10332089 | 3300009174 | Bacteria | 1314 |
| 450 | Ga0105241_10769260 | 3300009174 | Bacteria | 884 |
| 451 | Ga0105242_10043542 | 3300009176 | Bacteria | 3631 |
| 452 | Ga0105242_10056582 | 3300009176 | Unclassified | 3210 |
| 453 | Ga0105242_10076969 | 3300009176 | Bacteria | 2782 |
| 454 | Ga0105242_10451632 | 3300009176 | Bacteria | 1212 |
| 455 | Ga0105242_10631368 | 3300009176 | Bacteria | 1039 |
| 456 | Ga0105242_10844261 | 3300009176 | Bacteria | 911 |
| 457 | Ga0105248_10004939 | 3300009177 | Bacteria | 14734 |
| 458 | Ga0105248_10060288 | 3300009177 | Bacteria | 4260 |
| 459 | Ga0105237_10005490 | 3300009545 | Bacteria | 14294 |
| 460 | Ga0105237_10005694 | 3300009545 | Bacteria | 14017 |
| 461 | Ga0105237_10014096 | 3300009545 | Bacteria | 8363 |
| 462 | Ga0105237_10022472 | 3300009545 | Bacteria | 6471 |
| 463 | Ga0105237_10047089 | 3300009545 | Bacteria | 4335 |
| 464 | Ga0105237_10064862 | 3300009545 | Bacteria | 3648 |
| 465 | Ga0105237_10098324 | 3300009545 | Bacteria | 2918 |
| 466 | Ga0105237_10126957 | 3300009545 | Unclassified | 2545 |
| 467 | Ga0105238_10006981 | 3300009551 | Bacteria | 11286 |
| 468 | Ga0105238_10064549 | 3300009551 | Unclassified | 3662 |
| 469 | Ga0105238_10078160 | 3300009551 | Bacteria | 3300 |
| 470 | Ga0105238_10134127 | 3300009551 | Unclassified | 2454 |
| 471 | Ga0105249_10001958 | 3300009553 | Bacteria | 17861 |
| 472 | Ga0105249_10023081 | 3300009553 | Bacteria | 5579 |
| 473 | Ga0105249_10034852 | 3300009553 | Unclassified | 4562 |
| 474 | Ga0105249_10041170 | 3300009553 | Bacteria | 4198 |
| 475 | Ga0105249_10102452 | 3300009553 | Unclassified | 2694 |
| 476 | Ga0105249_10580375 | 3300009553 | Bacteria | 1174 |
| 477 | Ga0105249_10596564 | 3300009553 | Bacteria | 1159 |
| 478 | Ga0105249_10974557 | 3300009553 | Bacteria | 916 |
| 479 | Ga0105239_10001037 | 3300010375 | Bacteria | 38729 |
| 480 | Ga0105239_10011083 | 3300010375 | Bacteria | 10062 |
| 481 | Ga0105239_10017966 | 3300010375 | Bacteria | 7820 |
| 482 | Ga0105239_10043883 | 3300010375 | Bacteria | 4903 |
| 483 | Ga0105239_10066389 | 3300010375 | Bacteria | 3963 |
| 484 | Ga0105239_10127719 | 3300010375 | Bacteria | 2826 |
| 485 | Ga0105239_10192320 | 3300010375 | Bacteria | 2284 |
| 486 | Ga0105239_10371360 | 3300010375 | Bacteria | 1616 |
| 487 | Ga0105239_10386859 | 3300010375 | Unclassified | 1582 |
| 488 | Ga0105239_10411698 | 3300010375 | Bacteria | 1531 |
| 489 | Ga0105246_10005718 | 3300011119 | Bacteria | 7591 |
| 490 | Ga0105246_10094380 | 3300011119 | Bacteria | 2164 |
| 491 | Ga0105246_10145723 | 3300011119 | Bacteria | 1786 |
| 492 | Ga0105246_10215943 | 3300011119 | Bacteria | 1500 |
| 493 | Ga0105246_10425992 | 3300011119 | Bacteria | 1109 |
| 494 | Ga0105246_10767641 | 3300011119 | Bacteria | 852 |
| 495 | Ga0157373_10000275 | 3300013100 | Bacteria | 41320 |
| 496 | Ga0157373_10015282 | 3300013100 | Bacteria | 5611 |
| 497 | Ga0157373_10016691 | 3300013100 | Bacteria | 5350 |
| 498 | Ga0157373_10026324 | 3300013100 | Bacteria | 4202 |
| 499 | Ga0157373_10038389 | 3300013100 | Unclassified | 3432 |
| 500 | Ga0157373_10050702 | 3300013100 | Bacteria | 2955 |
| 501 | Ga0157373_10110592 | 3300013100 | Unclassified | 1932 |
| 502 | Ga0157373_10211189 | 3300013100 | Bacteria | 1369 |
| 503 | Ga0157373_10277050 | 3300013100 | Unclassified | 1188 |
| 504 | Ga0157373_10290340 | 3300013100 | Unclassified | 1160 |
| 505 | Ga0157371_10000596 | 3300013102 | Bacteria | 43030 |
| 506 | Ga0157371_10002078 | 3300013102 | Bacteria | 19616 |
| 507 | Ga0157371_10011331 | 3300013102 | Bacteria | 6878 |
| 508 | Ga0157371_10012915 | 3300013102 | Bacteria | 6359 |
| 509 | Ga0157371_10024481 | 3300013102 | Bacteria | 4408 |
| 510 | Ga0157371_10029505 | 3300013102 | Bacteria | 3965 |
| 511 | Ga0157371_10064707 | 3300013102 | Bacteria | 2591 |
| 512 | Ga0157371_10091472 | 3300013102 | Bacteria | 2155 |
| 513 | Ga0157371_10091597 | 3300013102 | Bacteria | 2153 |
| 514 | Ga0157371_10110867 | 3300013102 | Bacteria | 1947 |
| 515 | Ga0157371_10137041 | 3300013102 | Bacteria | 1743 |
| 516 | Ga0157371_10162979 | 3300013102 | Bacteria | 1592 |
| 517 | Ga0157371_10169831 | 3300013102 | Bacteria | 1558 |
| 518 | Ga0157371_10179070 | 3300013102 | Bacteria | 1516 |
| 519 | Ga0157371_10226367 | 3300013102 | Bacteria | 1343 |
| 520 | Ga0157371_10263919 | 3300013102 | Bacteria | 1242 |
| 521 | Ga0157371_10755418 | 3300013102 | Bacteria | 730 |
| 522 | Ga0157370_10000238 | 3300013104 | Bacteria | 70036 |
| 523 | Ga0157370_10000405 | 3300013104 | Bacteria | 54383 |
| 524 | Ga0157370_10001393 | 3300013104 | Bacteria | 29968 |
| 525 | Ga0157370_10005886 | 3300013104 | Bacteria | 13672 |
| 526 | Ga0157370_10055078 | 3300013104 | Bacteria | 3790 |
| 527 | Ga0157370_10070212 | 3300013104 | Bacteria | 3307 |
| 528 | Ga0157370_10160251 | 3300013104 | Bacteria | 2093 |
| 529 | Ga0157370_10209739 | 3300013104 | Unclassified | 1806 |
| 530 | Ga0157370_10322742 | 3300013104 | Bacteria | 1424 |
| 531 | Ga0157370_10389986 | 3300013104 | Bacteria | 1282 |
| 532 | Ga0157370_10770037 | 3300013104 | Bacteria | 876 |
| 533 | Ga0157369_10023820 | 3300013105 | Bacteria | 6816 |
| 534 | Ga0157369_10040594 | 3300013105 | Bacteria | 5079 |
| 535 | Ga0157369_10059170 | 3300013105 | Bacteria | 4132 |
| 536 | Ga0157369_10067243 | 3300013105 | Bacteria | 3853 |
| 537 | Ga0157369_10068914 | 3300013105 | Bacteria | 3801 |
| 538 | Ga0157369_10100151 | 3300013105 | Unclassified | 3089 |
| 539 | Ga0157369_10161499 | 3300013105 | Bacteria | 2365 |
| 540 | Ga0157369_10185665 | 3300013105 | Bacteria | 2187 |
| 541 | Ga0157369_10188812 | 3300013105 | Unclassified | 2166 |
| 542 | Ga0157369_10279023 | 3300013105 | Bacteria | 1740 |
| 543 | Ga0157369_10366869 | 3300013105 | Bacteria | 1495 |
| 544 | Ga0157369_10485617 | 3300013105 | Bacteria | 1278 |
| 545 | Ga0157369_10583150 | 3300013105 | Bacteria | 1155 |
| 546 | Ga0157369_10997484 | 3300013105 | Bacteria | 857 |
| 547 | Ga0157374_10000841 | 3300013296 | Bacteria | 26835 |
| 548 | Ga0157374_10006478 | 3300013296 | Bacteria | 9936 |
| 549 | Ga0157374_10015281 | 3300013296 | Bacteria | 6732 |
| 550 | Ga0157374_10017671 | 3300013296 | Bacteria | 6284 |
| 551 | Ga0157374_10046728 | 3300013296 | Bacteria | 4011 |
| 552 | Ga0157374_10128112 | 3300013296 | Unclassified | 2455 |
| 553 | Ga0157374_10154491 | 3300013296 | Bacteria | 2232 |
| 554 | Ga0157374_10296805 | 3300013296 | Unclassified | 1598 |
| 555 | Ga0157374_10357898 | 3300013296 | Bacteria | 1451 |
| 556 | Ga0157374_10450174 | 3300013296 | Bacteria | 1289 |
| 557 | Ga0157374_10490250 | 3300013296 | Bacteria | 1233 |
| 558 | Ga0157374_11316718 | 3300013296 | Bacteria | 744 |
| 559 | Ga0157378_10002090 | 3300013297 | Bacteria | 17837 |
| 560 | Ga0157378_10005857 | 3300013297 | Bacteria | 10768 |
| 561 | Ga0157378_10010065 | 3300013297 | Bacteria | 8242 |
| 562 | Ga0157378_10012644 | 3300013297 | Bacteria | 7387 |
| 563 | Ga0157378_10023595 | 3300013297 | Bacteria | 5411 |
| 564 | Ga0157378_10031342 | 3300013297 | Bacteria | 4697 |
| 565 | Ga0157378_10045275 | 3300013297 | Unclassified | 3909 |
| 566 | Ga0157378_10069077 | 3300013297 | Bacteria | 3169 |
| 567 | Ga0157378_10101789 | 3300013297 | Bacteria | 2624 |
| 568 | Ga0157378_10132143 | 3300013297 | Unclassified | 2311 |
| 569 | Ga0157378_10369500 | 3300013297 | Unclassified | 1406 |
| 570 | Ga0157378_10415877 | 3300013297 | Bacteria | 1328 |
| 571 | Ga0157378_11065749 | 3300013297 | Bacteria | 844 |
| 572 | Ga0157378_11356574 | 3300013297 | Bacteria | 753 |
| 573 | Ga0163162_10000100 | 3300013306 | Bacteria | 78269 |
| 574 | Ga0163162_10000279 | 3300013306 | Bacteria | 46872 |
| 575 | Ga0163162_10001517 | 3300013306 | Bacteria | 21625 |
| 576 | Ga0163162_10003820 | 3300013306 | Bacteria | 14438 |
| 577 | Ga0163162_10004813 | 3300013306 | Bacteria | 13027 |
| 578 | Ga0163162_10006228 | 3300013306 | Bacteria | 11565 |
| 579 | Ga0163162_10006285 | 3300013306 | Bacteria | 11505 |
| 580 | Ga0163162_10020346 | 3300013306 | Bacteria | 6519 |
| 581 | Ga0163162_10038399 | 3300013306 | Bacteria | 4778 |
| 582 | Ga0163162_10118184 | 3300013306 | Unclassified | 2753 |
| 583 | Ga0163162_10162009 | 3300013306 | Bacteria | 2359 |
| 584 | Ga0163162_10387958 | 3300013306 | Bacteria | 1530 |
| 585 | Ga0163162_10502404 | 3300013306 | Bacteria | 1343 |
| 586 | Ga0163162_10551733 | 3300013306 | Unclassified | 1280 |
| 587 | Ga0163162_11602752 | 3300013306 | Bacteria | 743 |
| 588 | Ga0157372_10002704 | 3300013307 | Bacteria | 19172 |
| 589 | Ga0157372_10009200 | 3300013307 | Bacteria | 10502 |
| 590 | Ga0157372_10010252 | 3300013307 | Bacteria | 9953 |
| 591 | Ga0157372_10010966 | 3300013307 | Bacteria | 9644 |
| 592 | Ga0157372_10015765 | 3300013307 | Bacteria | 8107 |
| 593 | Ga0157372_10029622 | 3300013307 | Bacteria | 5980 |
| 594 | Ga0157372_10031629 | 3300013307 | Bacteria | 5794 |
| 595 | Ga0157372_10072476 | 3300013307 | Bacteria | 3882 |
| 596 | Ga0157372_10090343 | 3300013307 | Bacteria | 3482 |
| 597 | Ga0157372_10103164 | 3300013307 | Bacteria | 3258 |
| 598 | Ga0157372_10109383 | 3300013307 | Bacteria | 3165 |
| 599 | Ga0157372_10113091 | 3300013307 | Bacteria | 3111 |
| 600 | Ga0157372_10114415 | 3300013307 | Bacteria | 3093 |
| 601 | Ga0157372_10139494 | 3300013307 | Bacteria | 2792 |
| 602 | Ga0157372_10141929 | 3300013307 | Bacteria | 2768 |
| 603 | Ga0157372_10156889 | 3300013307 | Bacteria | 2629 |
| 604 | Ga0157372_10165768 | 3300013307 | Bacteria | 2555 |
| 605 | Ga0157372_10199261 | 3300013307 | Bacteria | 2319 |
| 606 | Ga0157372_10222536 | 3300013307 | Bacteria | 2188 |
| 607 | Ga0157372_10294364 | 3300013307 | Unclassified | 1888 |
| 608 | Ga0157372_10298073 | 3300013307 | Bacteria | 1875 |
| 609 | Ga0157372_10382776 | 3300013307 | Unclassified | 1639 |
| 610 | Ga0157372_10388080 | 3300013307 | Bacteria | 1627 |
| 611 | Ga0157372_10388520 | 3300013307 | Bacteria | 1626 |
| 612 | Ga0157372_10626420 | 3300013307 | Bacteria | 1253 |
| 613 | Ga0157372_10677249 | 3300013307 | Bacteria | 1201 |
| 614 | Ga0157372_10711664 | 3300013307 | Bacteria | 1168 |
| 615 | Ga0157372_10791279 | 3300013307 | Unclassified | 1102 |
| 616 | Ga0157372_11149835 | 3300013307 | Bacteria | 897 |
| 617 | Ga0157372_11462428 | 3300013307 | Bacteria | 787 |
| 618 | Ga0157375_10000057 | 3300013308 | Bacteria | 122654 |
| 619 | Ga0157375_10000336 | 3300013308 | Bacteria | 42479 |
| 620 | Ga0157375_10038477 | 3300013308 | Unclassified | 4593 |
| 621 | Ga0157375_10039491 | 3300013308 | Bacteria | 4543 |
| 622 | Ga0157375_10053145 | 3300013308 | Bacteria | 3985 |
| 623 | Ga0157375_10064756 | 3300013308 | Bacteria | 3641 |
| 624 | Ga0157375_10076446 | 3300013308 | Bacteria | 3375 |
| 625 | Ga0157375_10084012 | 3300013308 | Bacteria | 3231 |
| 626 | Ga0157375_10086998 | 3300013308 | Bacteria | 3177 |
| 627 | Ga0157375_10155431 | 3300013308 | Bacteria | 2426 |
| 628 | Ga0157375_10166926 | 3300013308 | Bacteria | 2346 |
| 629 | Ga0157375_10183454 | 3300013308 | Bacteria | 2245 |
| 630 | Ga0157375_10275825 | 3300013308 | Bacteria | 1844 |
| 631 | Ga0157375_10289583 | 3300013308 | Unclassified | 1801 |
| 632 | Ga0157375_10348648 | 3300013308 | Unclassified | 1646 |
| 633 | Ga0157375_10357986 | 3300013308 | Bacteria | 1625 |
| 634 | Ga0157375_10653920 | 3300013308 | Unclassified | 1207 |
| 635 | Ga0157375_10704417 | 3300013308 | Bacteria | 1163 |
| 636 | Ga0157375_10734074 | 3300013308 | Bacteria | 1140 |
| 637 | Ga0157375_11143710 | 3300013308 | Bacteria | 912 |
| 638 | Ga0163163_10000193 | 3300014325 | Bacteria | 62699 |
| 639 | Ga0163163_10000254 | 3300014325 | Bacteria | 54049 |
| 640 | Ga0163163_10002122 | 3300014325 | Bacteria | 16737 |
| 641 | Ga0163163_10009925 | 3300014325 | Bacteria | 8537 |
| 642 | Ga0163163_10020274 | 3300014325 | Bacteria | 6258 |
| 643 | Ga0163163_10142515 | 3300014325 | Bacteria | 2439 |
| 644 | Ga0163163_10232058 | 3300014325 | Bacteria | 1894 |
| 645 | Ga0163163_10238362 | 3300014325 | Bacteria | 1868 |
| 646 | Ga0163163_10442588 | 3300014325 | Bacteria | 1359 |
| 647 | Ga0163163_10506995 | 3300014325 | Bacteria | 1268 |
| 648 | Ga0157380_10001093 | 3300014326 | Bacteria | 17458 |
| 649 | Ga0157380_10006970 | 3300014326 | Bacteria | 7998 |
| 650 | Ga0157380_10010950 | 3300014326 | Bacteria | 6540 |
| 651 | Ga0157380_10150228 | 3300014326 | Unclassified | 2013 |
| 652 | Ga0157380_10196143 | 3300014326 | Bacteria | 1787 |
| 653 | Ga0157380_10248107 | 3300014326 | Unclassified | 1609 |
| 654 | Ga0157380_10272719 | 3300014326 | Bacteria | 1543 |
| 655 | Ga0157380_10399881 | 3300014326 | Bacteria | 1303 |
| 656 | Ga0157380_10735489 | 3300014326 | Bacteria | 996 |
| 657 | Ga0157380_11066258 | 3300014326 | Bacteria | 845 |
| 658 | Ga0157377_10028251 | 3300014745 | Bacteria | 3018 |
| 659 | Ga0157377_10057265 | 3300014745 | Unclassified | 2215 |
| 660 | Ga0157377_10197146 | 3300014745 | Unclassified | 1276 |
| 661 | Ga0157377_10210314 | 3300014745 | Unclassified | 1240 |
| 662 | Ga0157379_10000367 | 3300014968 | Bacteria | 36246 |
| 663 | Ga0157379_10017665 | 3300014968 | Bacteria | 6283 |
| 664 | Ga0157379_10026404 | 3300014968 | Bacteria | 5170 |
| 665 | Ga0157379_10033384 | 3300014968 | Bacteria | 4589 |
| 666 | Ga0157379_10047182 | 3300014968 | Bacteria | 3842 |
| 667 | Ga0157379_10132198 | 3300014968 | Bacteria | 2246 |
| 668 | Ga0157379_10145105 | 3300014968 | Bacteria | 2140 |
| 669 | Ga0157379_10304482 | 3300014968 | Unclassified | 1453 |
| 670 | Ga0157379_10583198 | 3300014968 | Bacteria | 1042 |
| 671 | Ga0157376_10000135 | 3300014969 | Bacteria | 50667 |
| 672 | Ga0157376_10002989 | 3300014969 | Bacteria | 11593 |
| 673 | Ga0157376_10007359 | 3300014969 | Bacteria | 7849 |
| 674 | Ga0157376_10019024 | 3300014969 | Bacteria | 5283 |
| 675 | Ga0157376_10127764 | 3300014969 | Bacteria | 2264 |
| 676 | Ga0157376_10216996 | 3300014969 | Unclassified | 1769 |
| 677 | Ga0157376_10242873 | 3300014969 | Bacteria | 1678 |
| 678 | Ga0157376_10355273 | 3300014969 | Bacteria | 1404 |
| 679 | Ga0157376_10411918 | 3300014969 | Bacteria | 1309 |
| 680 | Ga0157376_10526796 | 3300014969 | Unclassified | 1166 |
| 681 | Ga0157376_10766548 | 3300014969 | Bacteria | 975 |
| 682 | Ga0163161_10001091 | 3300017792 | Bacteria | 20526 |
| 683 | Ga0163161_10035078 | 3300017792 | Bacteria | 3589 |
| 684 | Ga0163161_10101064 | 3300017792 | Bacteria | 2147 |
| 685 | Ga0163161_10104760 | 3300017792 | Bacteria | 2109 |
| 686 | Ga0163161_10268021 | 3300017792 | Bacteria | 1335 |
| 687 | Ga0163161_10485161 | 3300017792 | Bacteria | 1004 |
| 688 | Ga0197907_10191818 | 3300020069 | Bacteria | 1660 |
| 689 | Ga0197907_10951066 | 3300020069 | Bacteria | 1812 |
| 690 | Ga0206356_11664014 | 3300020070 | Bacteria | 1543 |
| 691 | Ga0206355_1373070 | 3300020076 | Unclassified | 1018 |
| 692 | Ga0206352_10396221 | 3300020078 | Unclassified | 965 |
| 693 | Ga0206352_11083765 | 3300020078 | Bacteria | 1973 |
| 694 | Ga0213876_10001740 | 3300021384 | Bacteria | 13213 |
| 695 | Ga0213876_10010098 | 3300021384 | Bacteria | 5073 |
| 696 | Ga0224712_10165530 | 3300022467 | Unclassified | 989 |
| 697 | Ga0207426_1000104 | 3300025302 | Bacteria | 249464 |
| 698 | Ga0207697_10013979 | 3300025315 | Bacteria | 3341 |
| 699 | Ga0207697_10093496 | 3300025315 | Unclassified | 1276 |
| 700 | Ga0207697_10181130 | 3300025315 | Unclassified | 923 |
| 701 | Ga0207656_10002124 | 3300025321 | Bacteria | 6625 |
| 702 | Ga0207682_10001049 | 3300025893 | Bacteria | 12716 |
| 703 | Ga0207682_10063133 | 3300025893 | Bacteria | 1554 |
| 704 | Ga0207642_10027167 | 3300025899 | Bacteria | 2340 |
| 705 | Ga0207710_10012887 | 3300025900 | Bacteria | 3522 |
| 706 | Ga0207710_10050658 | 3300025900 | Unclassified | 1863 |
| 707 | Ga0207688_10035812 | 3300025901 | Unclassified | 2750 |
| 708 | Ga0207688_10045084 | 3300025901 | Unclassified | 2459 |
| 709 | Ga0207688_10077139 | 3300025901 | Bacteria | 1898 |
| 710 | Ga0207680_10000371 | 3300025903 | Bacteria | 21501 |
| 711 | Ga0207680_10025925 | 3300025903 | Unclassified | 3240 |
| 712 | Ga0207680_10028803 | 3300025903 | Bacteria | 3112 |
| 713 | Ga0207680_10075669 | 3300025903 | Unclassified | 2100 |
| 714 | Ga0207680_10449108 | 3300025903 | Bacteria | 915 |
| 715 | Ga0207647_10004784 | 3300025904 | Bacteria | 10024 |
| 716 | Ga0207647_10012837 | 3300025904 | Bacteria | 5819 |
| 717 | Ga0207647_10019112 | 3300025904 | Bacteria | 4613 |
| 718 | Ga0207685_10010434 | 3300025905 | Bacteria | 2743 |
| 719 | Ga0207645_10000511 | 3300025907 | Bacteria | 32164 |
| 720 | Ga0207645_10004291 | 3300025907 | Bacteria | 10577 |
| 721 | Ga0207645_10017285 | 3300025907 | Unclassified | 4765 |
| 722 | Ga0207645_10297712 | 3300025907 | Unclassified | 1074 |
| 723 | Ga0207645_10507983 | 3300025907 | Bacteria | 816 |
| 724 | Ga0207643_10001735 | 3300025908 | Bacteria | 12216 |
| 725 | Ga0207643_10061009 | 3300025908 | Bacteria | 2153 |
| 726 | Ga0207643_10089852 | 3300025908 | Unclassified | 1789 |
| 727 | Ga0207643_10205166 | 3300025908 | Bacteria | 1201 |
| 728 | Ga0207643_10250150 | 3300025908 | Bacteria | 1092 |
| 729 | Ga0207705_10034312 | 3300025909 | Bacteria | 3627 |
| 730 | Ga0207705_10043425 | 3300025909 | Bacteria | 3230 |
| 731 | Ga0207705_10163048 | 3300025909 | Bacteria | 1675 |
| 732 | Ga0207705_10308121 | 3300025909 | Bacteria | 1215 |
| 733 | Ga0207705_10345656 | 3300025909 | Bacteria | 1145 |
| 734 | Ga0207705_10541303 | 3300025909 | Bacteria | 905 |
| 735 | Ga0207654_10001646 | 3300025911 | Bacteria | 11680 |
| 736 | Ga0207654_10003857 | 3300025911 | Bacteria | 7553 |
| 737 | Ga0207654_10239301 | 3300025911 | Bacteria | 1212 |
| 738 | Ga0207707_10000574 | 3300025912 | Bacteria | 37317 |
| 739 | Ga0207707_10046727 | 3300025912 | Bacteria | 3771 |
| 740 | Ga0207707_10073490 | 3300025912 | Bacteria | 2982 |
| 741 | Ga0207707_10177512 | 3300025912 | Bacteria | 1860 |
| 742 | Ga0207707_10255823 | 3300025912 | Bacteria | 1520 |
| 743 | Ga0207707_10255895 | 3300025912 | Bacteria | 1520 |
| 744 | Ga0207707_10476152 | 3300025912 | Unclassified | 1067 |
| 745 | Ga0207707_10752275 | 3300025912 | Bacteria | 815 |
| 746 | Ga0207695_10000327 | 3300025913 | Bacteria | 113436 |
| 747 | Ga0207695_10000486 | 3300025913 | Bacteria | 84856 |
| 748 | Ga0207695_10003818 | 3300025913 | Bacteria | 20882 |
| 749 | Ga0207695_10008726 | 3300025913 | Bacteria | 12639 |
| 750 | Ga0207695_10008950 | 3300025913 | Bacteria | 12463 |
| 751 | Ga0207695_10012720 | 3300025913 | Bacteria | 10076 |
| 752 | Ga0207695_10038067 | 3300025913 | Bacteria | 5184 |
| 753 | Ga0207695_10043454 | 3300025913 | Bacteria | 4789 |
| 754 | Ga0207695_10099398 | 3300025913 | Unclassified | 2907 |
| 755 | Ga0207695_10152595 | 3300025913 | Unclassified | 2248 |
| 756 | Ga0207671_10001742 | 3300025914 | Bacteria | 24460 |
| 757 | Ga0207671_10004018 | 3300025914 | Bacteria | 14291 |
| 758 | Ga0207671_10006632 | 3300025914 | Bacteria | 10262 |
| 759 | Ga0207671_10059149 | 3300025914 | Bacteria | 2841 |
| 760 | Ga0207671_10071305 | 3300025914 | Unclassified | 2591 |
| 761 | Ga0207671_10166148 | 3300025914 | Bacteria | 1711 |
| 762 | Ga0207671_10214903 | 3300025914 | Bacteria | 1505 |
| 763 | Ga0207671_10384454 | 3300025914 | Bacteria | 1115 |
| 764 | Ga0207660_10010881 | 3300025917 | Bacteria | 5915 |
| 765 | Ga0207660_10135955 | 3300025917 | Bacteria | 1876 |
| 766 | Ga0207662_10033075 | 3300025918 | Bacteria | 3012 |
| 767 | Ga0207662_10327142 | 3300025918 | Bacteria | 1024 |
| 768 | Ga0207657_10004159 | 3300025919 | Bacteria | 15337 |
| 769 | Ga0207657_10018632 | 3300025919 | Bacteria | 6618 |
| 770 | Ga0207657_10029137 | 3300025919 | Bacteria | 5029 |
| 771 | Ga0207657_10136773 | 3300025919 | Bacteria | 2004 |
| 772 | Ga0207657_10400054 | 3300025919 | Bacteria | 1080 |
| 773 | Ga0207649_10006464 | 3300025920 | Bacteria | 6364 |
| 774 | Ga0207649_10022783 | 3300025920 | Bacteria | 3619 |
| 775 | Ga0207649_10082255 | 3300025920 | Unclassified | 2087 |
| 776 | Ga0207649_10206618 | 3300025920 | Bacteria | 1390 |
| 777 | Ga0207652_10000210 | 3300025921 | Bacteria | 61797 |
| 778 | Ga0207652_10001002 | 3300025921 | Bacteria | 26045 |
| 779 | Ga0207652_10002655 | 3300025921 | Bacteria | 15013 |
| 780 | Ga0207652_10007311 | 3300025921 | Bacteria | 8898 |
| 781 | Ga0207652_10028457 | 3300025921 | Bacteria | 4662 |
| 782 | Ga0207652_10045845 | 3300025921 | Bacteria | 3728 |
| 783 | Ga0207652_10058906 | 3300025921 | Bacteria | 3309 |
| 784 | Ga0207652_10135432 | 3300025921 | Bacteria | 2199 |
| 785 | Ga0207652_10175339 | 3300025921 | Bacteria | 1925 |
| 786 | Ga0207652_10331774 | 3300025921 | Bacteria | 1373 |
| 787 | Ga0207681_10027241 | 3300025923 | Unclassified | 3694 |
| 788 | Ga0207681_10068587 | 3300025923 | Bacteria | 2464 |
| 789 | Ga0207681_10330514 | 3300025923 | Unclassified | 1215 |
| 790 | Ga0207694_10057302 | 3300025924 | Unclassified | 3029 |
| 791 | Ga0207694_10061747 | 3300025924 | Bacteria | 2917 |
| 792 | Ga0207694_10262784 | 3300025924 | Bacteria | 1414 |
| 793 | Ga0207650_10009262 | 3300025925 | Bacteria | 6729 |
| 794 | Ga0207650_10025960 | 3300025925 | Unclassified | 4176 |
| 795 | Ga0207650_10041161 | 3300025925 | Unclassified | 3384 |
| 796 | Ga0207650_10097267 | 3300025925 | Bacteria | 2260 |
| 797 | Ga0207650_10117984 | 3300025925 | Bacteria | 2062 |
| 798 | Ga0207650_10134753 | 3300025925 | Bacteria | 1936 |
| 799 | Ga0207650_10313288 | 3300025925 | Bacteria | 1284 |
| 800 | Ga0207650_10911341 | 3300025925 | Bacteria | 746 |
| 801 | Ga0207659_10052816 | 3300025926 | Bacteria | 2897 |
| 802 | Ga0207659_10077944 | 3300025926 | Bacteria | 2441 |
| 803 | Ga0207659_10095451 | 3300025926 | Bacteria | 2230 |
| 804 | Ga0207659_10185262 | 3300025926 | Bacteria | 1652 |
| 805 | Ga0207659_10231083 | 3300025926 | Unclassified | 1492 |
| 806 | Ga0207644_10045467 | 3300025931 | Bacteria | 3123 |
| 807 | Ga0207644_10226122 | 3300025931 | Bacteria | 1485 |
| 808 | Ga0207644_10248240 | 3300025931 | Bacteria | 1419 |
| 809 | Ga0207644_10651355 | 3300025931 | Bacteria | 877 |
| 810 | Ga0207644_10720483 | 3300025931 | Unclassified | 832 |
| 811 | Ga0207644_10742717 | 3300025931 | Bacteria | 819 |
| 812 | Ga0207690_10008207 | 3300025932 | Bacteria | 6194 |
| 813 | Ga0207690_10029723 | 3300025932 | Bacteria | 3477 |
| 814 | Ga0207690_10217383 | 3300025932 | Bacteria | 1460 |
| 815 | Ga0207690_10358006 | 3300025932 | Bacteria | 1155 |
| 816 | Ga0207706_10003803 | 3300025933 | Bacteria | 14383 |
| 817 | Ga0207706_10005368 | 3300025933 | Bacteria | 11945 |
| 818 | Ga0207706_10007905 | 3300025933 | Bacteria | 9817 |
| 819 | Ga0207706_10026061 | 3300025933 | Bacteria | 5235 |
| 820 | Ga0207706_10031025 | 3300025933 | Bacteria | 4763 |
| 821 | Ga0207706_10032502 | 3300025933 | Bacteria | 4646 |
| 822 | Ga0207706_10654384 | 3300025933 | Unclassified | 900 |
| 823 | Ga0207686_10010535 | 3300025934 | Bacteria | 5037 |
| 824 | Ga0207686_10023055 | 3300025934 | Bacteria | 3590 |
| 825 | Ga0207686_10030121 | 3300025934 | Unclassified | 3210 |
| 826 | Ga0207686_10147518 | 3300025934 | Unclassified | 1634 |
| 827 | Ga0207686_10552608 | 3300025934 | Bacteria | 900 |
| 828 | Ga0207670_10012704 | 3300025936 | Bacteria | 4936 |
| 829 | Ga0207670_10113038 | 3300025936 | Bacteria | 1960 |
| 830 | Ga0207670_10321076 | 3300025936 | Bacteria | 1218 |
| 831 | Ga0207670_10797940 | 3300025936 | Bacteria | 786 |
| 832 | Ga0207669_10043590 | 3300025937 | Bacteria | 2629 |
| 833 | Ga0207669_10060082 | 3300025937 | Bacteria | 2328 |
| 834 | Ga0207669_10077992 | 3300025937 | Bacteria | 2109 |
| 835 | Ga0207669_10270361 | 3300025937 | Bacteria | 1276 |
| 836 | Ga0207669_10310274 | 3300025937 | Bacteria | 1203 |
| 837 | Ga0207704_10000484 | 3300025938 | Bacteria | 17750 |
| 838 | Ga0207704_10045597 | 3300025938 | Unclassified | 2605 |
| 839 | Ga0207704_10102486 | 3300025938 | Bacteria | 1912 |
| 840 | Ga0207691_10002120 | 3300025940 | Bacteria | 19396 |
| 841 | Ga0207691_10012396 | 3300025940 | Bacteria | 8172 |
| 842 | Ga0207691_10013692 | 3300025940 | Bacteria | 7750 |
| 843 | Ga0207691_10043591 | 3300025940 | Bacteria | 4134 |
| 844 | Ga0207691_10064166 | 3300025940 | Bacteria | 3328 |
| 845 | Ga0207691_10078152 | 3300025940 | Bacteria | 2979 |
| 846 | Ga0207691_10079939 | 3300025940 | Bacteria | 2942 |
| 847 | Ga0207691_10098164 | 3300025940 | Bacteria | 2617 |
| 848 | Ga0207691_10213394 | 3300025940 | Bacteria | 1676 |
| 849 | Ga0207691_10428141 | 3300025940 | Bacteria | 1127 |
| 850 | Ga0207691_10478718 | 3300025940 | Bacteria | 1058 |
| 851 | Ga0207711_10249460 | 3300025941 | Bacteria | 1630 |
| 852 | Ga0207689_10000329 | 3300025942 | Bacteria | 44014 |
| 853 | Ga0207689_10002405 | 3300025942 | Bacteria | 17429 |
| 854 | Ga0207689_10005043 | 3300025942 | Bacteria | 11902 |
| 855 | Ga0207689_10010393 | 3300025942 | Bacteria | 8016 |
| 856 | Ga0207689_10021416 | 3300025942 | Bacteria | 5435 |
| 857 | Ga0207689_10038305 | 3300025942 | Bacteria | 3972 |
| 858 | Ga0207689_10044691 | 3300025942 | Bacteria | 3663 |
| 859 | Ga0207689_10361108 | 3300025942 | Unclassified | 1208 |
| 860 | Ga0207689_10381998 | 3300025942 | Unclassified | 1173 |
| 861 | Ga0207661_10007884 | 3300025944 | Bacteria | 7589 |
| 862 | Ga0207661_10043012 | 3300025944 | Bacteria | 3564 |
| 863 | Ga0207661_10056567 | 3300025944 | Bacteria | 3149 |
| 864 | Ga0207661_10107804 | 3300025944 | Unclassified | 2350 |
| 865 | Ga0207679_10000751 | 3300025945 | Bacteria | 21527 |
| 866 | Ga0207679_10001121 | 3300025945 | Bacteria | 17095 |
| 867 | Ga0207679_10070887 | 3300025945 | Bacteria | 2627 |
| 868 | Ga0207679_10113802 | 3300025945 | Unclassified | 2141 |
| 869 | Ga0207679_10181918 | 3300025945 | Bacteria | 1740 |
| 870 | Ga0207679_10191868 | 3300025945 | Bacteria | 1699 |
| 871 | Ga0207679_10287659 | 3300025945 | Bacteria | 1412 |
| 872 | Ga0207679_10470098 | 3300025945 | Bacteria | 1118 |
| 873 | Ga0207667_10000340 | 3300025949 | Bacteria | 63904 |
| 874 | Ga0207667_10009409 | 3300025949 | Bacteria | 11510 |
| 875 | Ga0207667_10058269 | 3300025949 | Bacteria | 4052 |
| 876 | Ga0207667_10061201 | 3300025949 | Bacteria | 3939 |
| 877 | Ga0207667_10089071 | 3300025949 | Bacteria | 3190 |
| 878 | Ga0207667_10109580 | 3300025949 | Bacteria | 2848 |
| 879 | Ga0207667_10167573 | 3300025949 | Bacteria | 2258 |
| 880 | Ga0207667_10235251 | 3300025949 | Bacteria | 1875 |
| 881 | Ga0207667_10272676 | 3300025949 | Bacteria | 1729 |
| 882 | Ga0207651_10002824 | 3300025960 | Bacteria | 8358 |
| 883 | Ga0207651_10043146 | 3300025960 | Bacteria | 3008 |
| 884 | Ga0207651_10069071 | 3300025960 | Bacteria | 2494 |
| 885 | Ga0207651_10108025 | 3300025960 | Bacteria | 2081 |
| 886 | Ga0207651_10119421 | 3300025960 | Bacteria | 1996 |
| 887 | Ga0207651_10127715 | 3300025960 | Unclassified | 1940 |
| 888 | Ga0207651_10297261 | 3300025960 | Bacteria | 1341 |
| 889 | Ga0207651_10514420 | 3300025960 | Bacteria | 1036 |
| 890 | Ga0207712_10001475 | 3300025961 | Bacteria | 16057 |
| 891 | Ga0207712_10011683 | 3300025961 | Bacteria | 5598 |
| 892 | Ga0207712_10012015 | 3300025961 | Bacteria | 5526 |
| 893 | Ga0207712_10013170 | 3300025961 | Bacteria | 5301 |
| 894 | Ga0207712_10031288 | 3300025961 | Bacteria | 3583 |
| 895 | Ga0207712_10395825 | 3300025961 | Bacteria | 1160 |
| 896 | Ga0207712_11050023 | 3300025961 | Bacteria | 724 |
| 897 | Ga0207668_10034958 | 3300025972 | Bacteria | 3342 |
| 898 | Ga0207668_10251892 | 3300025972 | Bacteria | 1434 |
| 899 | Ga0207668_10328437 | 3300025972 | Bacteria | 1272 |
| 900 | Ga0207640_10017218 | 3300025981 | Bacteria | 4223 |
| 901 | Ga0207640_10155426 | 3300025981 | Unclassified | 1685 |
| 902 | Ga0207640_10270452 | 3300025981 | Unclassified | 1329 |
| 903 | Ga0207640_10639296 | 3300025981 | Bacteria | 905 |
| 904 | Ga0207658_10000847 | 3300025986 | Bacteria | 25559 |
| 905 | Ga0207658_10039539 | 3300025986 | Bacteria | 3403 |
| 906 | Ga0207658_10051028 | 3300025986 | Bacteria | 3047 |
| 907 | Ga0207658_10090037 | 3300025986 | Bacteria | 2377 |
| 908 | Ga0207658_10260123 | 3300025986 | Bacteria | 1479 |
| 909 | Ga0207658_10303514 | 3300025986 | Unclassified | 1376 |
| 910 | Ga0207658_10591277 | 3300025986 | Bacteria | 996 |
| 911 | Ga0207677_10001136 | 3300026023 | Bacteria | 14521 |
| 912 | Ga0207677_10007895 | 3300026023 | Bacteria | 5915 |
| 913 | Ga0207677_10018452 | 3300026023 | Bacteria | 4186 |
| 914 | Ga0207677_10062805 | 3300026023 | Unclassified | 2578 |
| 915 | Ga0207677_10067033 | 3300026023 | Bacteria | 2513 |
| 916 | Ga0207677_10256846 | 3300026023 | Unclassified | 1422 |
| 917 | Ga0207677_10369311 | 3300026023 | Bacteria | 1208 |
| 918 | Ga0207677_10764604 | 3300026023 | Bacteria | 862 |
| 919 | Ga0207703_10010768 | 3300026035 | Bacteria | 7135 |
| 920 | Ga0207703_10040034 | 3300026035 | Bacteria | 3749 |
| 921 | Ga0207703_10091248 | 3300026035 | Bacteria | 2562 |
| 922 | Ga0207703_10276170 | 3300026035 | Bacteria | 1524 |
| 923 | Ga0207703_10459619 | 3300026035 | Bacteria | 1190 |
| 924 | Ga0207703_10790010 | 3300026035 | Bacteria | 906 |
| 925 | Ga0207703_10827590 | 3300026035 | Bacteria | 885 |
| 926 | Ga0207639_10010003 | 3300026041 | Bacteria | 6556 |
| 927 | Ga0207639_10016589 | 3300026041 | Bacteria | 5213 |
| 928 | Ga0207639_10019883 | 3300026041 | Bacteria | 4798 |
| 929 | Ga0207639_10026659 | 3300026041 | Bacteria | 4200 |
| 930 | Ga0207639_10123392 | 3300026041 | Bacteria | 2132 |
| 931 | Ga0207639_10138006 | 3300026041 | Unclassified | 2028 |
| 932 | Ga0207639_10149936 | 3300026041 | Bacteria | 1952 |
| 933 | Ga0207639_10196223 | 3300026041 | Unclassified | 1728 |
| 934 | Ga0207639_10200336 | 3300026041 | Bacteria | 1712 |
| 935 | Ga0207639_10280880 | 3300026041 | Bacteria | 1464 |
| 936 | Ga0207639_10289581 | 3300026041 | Bacteria | 1443 |
| 937 | Ga0207639_10323026 | 3300026041 | Unclassified | 1371 |
| 938 | Ga0207639_10379437 | 3300026041 | Bacteria | 1269 |
| 939 | Ga0207639_10607474 | 3300026041 | Bacteria | 1009 |
| 940 | Ga0207639_10655436 | 3300026041 | Bacteria | 971 |
| 941 | Ga0207639_10723978 | 3300026041 | Unclassified | 924 |
| 942 | Ga0207678_10013940 | 3300026067 | Bacteria | 7065 |
| 943 | Ga0207678_10108296 | 3300026067 | Bacteria | 2370 |
| 944 | Ga0207678_10171337 | 3300026067 | Bacteria | 1853 |
| 945 | Ga0207708_10049982 | 3300026075 | Bacteria | 3183 |
| 946 | Ga0207708_10132051 | 3300026075 | Bacteria | 1953 |
| 947 | Ga0207708_10507710 | 3300026075 | Unclassified | 1011 |
| 948 | Ga0207702_10093619 | 3300026078 | Bacteria | 2635 |
| 949 | Ga0207702_10138992 | 3300026078 | Bacteria | 2195 |
| 950 | Ga0207702_10643854 | 3300026078 | Bacteria | 1042 |
| 951 | Ga0207641_10000152 | 3300026088 | Bacteria | 98311 |
| 952 | Ga0207641_10000418 | 3300026088 | Bacteria | 49680 |
| 953 | Ga0207641_10004489 | 3300026088 | Bacteria | 12072 |
| 954 | Ga0207641_10051955 | 3300026088 | Bacteria | 3470 |
| 955 | Ga0207641_10087159 | 3300026088 | Bacteria | 2724 |
| 956 | Ga0207641_10115859 | 3300026088 | Bacteria | 2383 |
| 957 | Ga0207641_10365245 | 3300026088 | Bacteria | 1379 |
| 958 | Ga0207648_10001186 | 3300026089 | Bacteria | 29157 |
| 959 | Ga0207648_10031158 | 3300026089 | Bacteria | 4715 |
| 960 | Ga0207648_10045600 | 3300026089 | Bacteria | 3845 |
| 961 | Ga0207648_10055669 | 3300026089 | Bacteria | 3452 |
| 962 | Ga0207648_10063825 | 3300026089 | Bacteria | 3210 |
| 963 | Ga0207648_10097621 | 3300026089 | Bacteria | 2571 |
| 964 | Ga0207648_10101771 | 3300026089 | Unclassified | 2517 |
| 965 | Ga0207648_10146808 | 3300026089 | Unclassified | 2080 |
| 966 | Ga0207648_10148765 | 3300026089 | Bacteria | 2066 |
| 967 | Ga0207648_10238101 | 3300026089 | Bacteria | 1620 |
| 968 | Ga0207648_10643040 | 3300026089 | Unclassified | 980 |
| 969 | Ga0207648_10733062 | 3300026089 | Unclassified | 917 |
| 970 | Ga0207648_11067979 | 3300026089 | Bacteria | 757 |
| 971 | Ga0207676_10006216 | 3300026095 | Bacteria | 8433 |
| 972 | Ga0207676_10098522 | 3300026095 | Unclassified | 2417 |
| 973 | Ga0207676_10367815 | 3300026095 | Bacteria | 1335 |
| 974 | Ga0207676_10389956 | 3300026095 | Unclassified | 1299 |
| 975 | Ga0207676_10586540 | 3300026095 | Bacteria | 1069 |
| 976 | Ga0207676_11199633 | 3300026095 | Bacteria | 752 |
| 977 | Ga0207674_10006492 | 3300026116 | Bacteria | 13755 |
| 978 | Ga0207674_10012911 | 3300026116 | Bacteria | 9316 |
| 979 | Ga0207674_10030052 | 3300026116 | Bacteria | 5715 |
| 980 | Ga0207674_10081980 | 3300026116 | Bacteria | 3227 |
| 981 | Ga0207674_10184496 | 3300026116 | Bacteria | 2037 |
| 982 | Ga0207674_10254963 | 3300026116 | Bacteria | 1701 |
| 983 | Ga0207674_10516949 | 3300026116 | Bacteria | 1153 |
| 984 | Ga0207674_10754037 | 3300026116 | Bacteria | 940 |
| 985 | Ga0207675_100062346 | 3300026118 | Bacteria | 3482 |
| 986 | Ga0207675_100062529 | 3300026118 | Bacteria | 3477 |
| 987 | Ga0207675_100075735 | 3300026118 | Bacteria | 3150 |
| 988 | Ga0207675_100099250 | 3300026118 | Bacteria | 2743 |
| 989 | Ga0207675_100103587 | 3300026118 | Bacteria | 2682 |
| 990 | Ga0207675_100217452 | 3300026118 | Unclassified | 1840 |
| 991 | Ga0207675_100233673 | 3300026118 | Bacteria | 1774 |
| 992 | Ga0207675_100239542 | 3300026118 | Bacteria | 1753 |
| 993 | Ga0207675_100337059 | 3300026118 | Bacteria | 1475 |
| 994 | Ga0207683_10057040 | 3300026121 | Unclassified | 3428 |
| 995 | Ga0207683_10141863 | 3300026121 | Bacteria | 2165 |
| 996 | Ga0207683_10149980 | 3300026121 | Bacteria | 2104 |
| 997 | Ga0207683_10178411 | 3300026121 | Bacteria | 1925 |
| 998 | Ga0207683_10222892 | 3300026121 | Unclassified | 1718 |
| 999 | Ga0207683_10259266 | 3300026121 | Bacteria | 1588 |
| 1000 | Ga0207698_10008700 | 3300026142 | Bacteria | 6434 |
| 1001 | Ga0207698_10023196 | 3300026142 | Bacteria | 4330 |
| 1002 | Ga0207698_10024494 | 3300026142 | Bacteria | 4237 |
| 1003 | Ga0207698_10025309 | 3300026142 | Bacteria | 4178 |
| 1004 | Ga0207698_10033415 | 3300026142 | Bacteria | 3738 |
| 1005 | Ga0207698_10049762 | 3300026142 | Bacteria | 3192 |
| 1006 | Ga0207698_10065551 | 3300026142 | Bacteria | 2853 |
| 1007 | Ga0207698_10080035 | 3300026142 | Unclassified | 2630 |
| 1008 | Ga0207698_10140634 | 3300026142 | Bacteria | 2079 |
| 1009 | Ga0207698_10156315 | 3300026142 | Bacteria | 1987 |
| 1010 | Ga0207698_10308193 | 3300026142 | Bacteria | 1477 |
| 1011 | Ga0209984_1016211 | 3300027424 | Bacteria | 994 |
| 1012 | Ga0209995_1025689 | 3300027471 | Unclassified | 982 |
| 1013 | Ga0268266_10000034 | 3300028379 | Bacteria | 354251 |
| 1014 | Ga0268266_10002645 | 3300028379 | Bacteria | 18878 |
| 1015 | Ga0268266_10028759 | 3300028379 | Bacteria | 4725 |
| 1016 | Ga0268266_10960939 | 3300028379 | Bacteria | 827 |
| 1017 | Ga0268265_10044613 | 3300028380 | Bacteria | 3302 |
| 1018 | Ga0268265_10045980 | 3300028380 | Bacteria | 3261 |
| 1019 | Ga0268265_10472459 | 3300028380 | Unclassified | 1176 |
| 1020 | Ga0268265_11386286 | 3300028380 | Bacteria | 705 |
| 1021 | Ga0268264_10000117 | 3300028381 | Bacteria | 195037 |
| 1022 | Ga0268264_10005355 | 3300028381 | Bacteria | 10876 |
| 1023 | Ga0268264_10007632 | 3300028381 | Bacteria | 9016 |
| 1024 | Ga0268264_10024882 | 3300028381 | Bacteria | 4892 |
| 1025 | Ga0268264_10090261 | 3300028381 | Bacteria | 2640 |
| 1026 | Ga0268264_10103812 | 3300028381 | Unclassified | 2476 |
| 1027 | Ga0268264_10234265 | 3300028381 | Bacteria | 1697 |
| 1028 | Ga0268264_10328300 | 3300028381 | Unclassified | 1449 |
| 1029 | Ga0268264_10709918 | 3300028381 | Bacteria | 999 |
| 1030 | Ga0307517_10030353 | 3300028786 | Bacteria | 6340 |
| 1031 | Ga0307515_10000039 | 3300028794 | Bacteria | 323229 |
| 1032 | Ga0307511_10000153 | 3300030521 | Bacteria | 65598 |
| 1033 | Ga0265327_10000030 | 3300031251 | Bacteria | 333531 |
| 1034 | Ga0307513_10029047 | 3300031456 | Bacteria | 6311 |
| 1035 | Ga0307408_100275715 | 3300031548 | Bacteria | 1398 |
| 1036 | Ga0307508_10000937 | 3300031616 | Bacteria | 33974 |
| 1037 | Ga0307518_10263568 | 3300031838 | Bacteria | 1083 |
| 1038 | Ga0307410_10230324 | 3300031852 | Bacteria | 1430 |
| 1039 | Ga0307414_10024549 | 3300032004 | Bacteria | 3847 |
| 1040 | Ga0307414_10334306 | 3300032004 | Bacteria | 1294 |
| 1041 | Ga0307415_100058480 | 3300032126 | Bacteria | 2654 |
| 1042 | Ga0373955_0126666 | 3300035172 | Bacteria | 1488 |
| 1043 | Ga0373924_0101236 | 3300035410 | Bacteria | 1240 |
| 1044 | Ga0373933_0270802 | 3300035724 | Bacteria | 1096 |
| 1045 | Ga0373933_0447585 | 3300035724 | Bacteria | 845 |
| 1046 | Ga0373937_0261971 | 3300036401 | Bacteria | 1630 |
| 1047 | Ga0373937_0423600 | 3300036401 | Bacteria | 1263 |
| 1048 | Ga0395899_0004650 | 3300037312 | Bacteria | 10707 |
| 1049 | Ga0395899_0014385 | 3300037312 | Bacteria | 6040 |
| 1050 | Ga0395899_0017265 | 3300037312 | Bacteria | 5499 |
| 1051 | Ga0395899_0344742 | 3300037312 | Bacteria | 998 |
| 1052 | Ga0395900_0000594 | 3300037418 | Bacteria | 49651 |
| 1053 | Ga0395900_0026735 | 3300037418 | Bacteria | 5907 |
| 1054 | Ga0395900_0038159 | 3300037418 | Bacteria | 4952 |
| 1055 | Ga0395900_0113079 | 3300037418 | Bacteria | 2787 |
| 1056 | Ga0395900_0492261 | 3300037418 | Bacteria | 1177 |
| 1057 | Ga0395900_0506480 | 3300037418 | Bacteria | 1157 |
| 1058 | Ga0395898_0001271 | 3300037466 | Bacteria | 37310 |
| 1059 | Ga0395898_0019396 | 3300037466 | Bacteria | 6921 |
| 1060 | Ga0395898_0031929 | 3300037466 | Bacteria | 5258 |
| 1061 | Ga0395898_0084334 | 3300037466 | Bacteria | 3063 |
| 1062 | Ga0395898_0294244 | 3300037466 | Bacteria | 1549 |
| 1063 | Ga0395905_0000527 | 3300037471 | Bacteria | 52435 |
| 1064 | Ga0395905_0045277 | 3300037471 | Bacteria | 4127 |
| 1065 | Ga0395905_0050843 | 3300037471 | Bacteria | 3882 |
| 1066 | Ga0395901_0014247 | 3300038443 | Bacteria | 8095 |
| 1067 | Ga0395901_0017770 | 3300038443 | Bacteria | 7260 |
| 1068 | Ga0395901_0087877 | 3300038443 | Bacteria | 3250 |
| 1069 | Ga0395901_0105083 | 3300038443 | Bacteria | 2964 |
| 1070 | Ga0395901_0179498 | 3300038443 | Bacteria | 2220 |
| 1071 | Ga0395901_0581778 | 3300038443 | Bacteria | 1131 |
| 1072 | Ga0436365_1161343 | 3300039437 | Bacteria | 9975 |
| 1073 | Ga0436365_1876803 | 3300039437 | Bacteria | 22992 |
| 1074 | Ga0439465_0057582 | 3300041413 | Bacteria | 1283 |
| 1075 | Ga0451849_0457641 | 3300041505 | Bacteria | 1154 |
| 1076 | Ga0451851_0698711 | 3300041507 | Bacteria | 834 |
| 1077 | Ga0439441_005719 | 3300042001 | Bacteria | 1945 |
| 1078 | Ga0439443_030000 | 3300042003 | Bacteria | 893 |
| 1079 | Ga0439445_0023729 | 3300042004 | Unclassified | 1555 |
| 1080 | Ga0439449_0012045 | 3300042007 | Unclassified | 3251 |
| 1081 | Ga0439449_0015551 | 3300042007 | Bacteria | 2860 |
| 1082 | Ga0439454_020763 | 3300042011 | Bacteria | 966 |
| 1083 | Ga0439457_010574 | 3300042014 | Bacteria | 2119 |
| 1084 | Ga0439457_060182 | 3300042014 | Bacteria | 859 |
| 1085 | Ga0450895_009516 | 3300042132 | Bacteria | 823 |
| 1086 | Ga0450896_028602 | 3300042133 | Bacteria | 838 |
| 1087 | Ga0450898_001510 | 3300042134 | Bacteria | 3081 |
| 1088 | Ga0439460_0022853 | 3300042461 | Bacteria | 1719 |
| 1089 | Ga0451577_0107026 | 3300042876 | Bacteria | 2500 |
| 1090 | Ga0451577_0222244 | 3300042876 | Bacteria | 1707 |
| 1091 | Ga0466972_0000175 | 3300044658 | Bacteria | 49585 |
| 1092 | Ga0466972_0000782 | 3300044658 | Bacteria | 15085 |
| 1093 | Ga0466966_0335187 | 3300044684 | Bacteria | 909 |
| 1094 | Ga0466964_0052419 | 3300044706 | Unclassified | 1677 |
| 1095 | Ga0453684_0038732 | 3300044712 | Bacteria | 6509 |
| 1096 | Ga0453684_0054306 | 3300044712 | Bacteria | 5219 |
| 1097 | Ga0453684_0077553 | 3300044712 | Bacteria | 4163 |
| 1098 | Ga0466968_0038156 | 3300044735 | Bacteria | 2018 |
| 1099 | Ga0466968_0125093 | 3300044735 | Unclassified | 1166 |
| 1100 | Ga0466970_0001012 | 3300044765 | Bacteria | 13547 |
| 1101 | Ga0466960_0091924 | 3300044901 | Bacteria | 1548 |
| 1102 | Ga0466959_0503167 | 3300045049 | Bacteria | 819 |
| 1103 | Ga0451576_0077826 | 3300045051 | Bacteria | 3452 |
| 1104 | Ga0451576_0305980 | 3300045051 | Bacteria | 1663 |
| 1105 | Ga0466967_0501574 | 3300045976 | Bacteria | 1191 |
| 1106 | Ga0495638_0072586 | 3300046460 | Unclassified | 2103 |
| 1107 | Ga0495638_0141913 | 3300046460 | Unclassified | 1401 |
| 1108 | Ga0495653_0078610 | 3300046463 | Bacteria | 2446 |
| 1109 | Ga0495580_0033076 | 3300046472 | Bacteria | 3727 |
| 1110 | Ga0495628_0338979 | 3300046516 | Bacteria | 1107 |
| 1111 | Ga0495648_0002156 | 3300046524 | Bacteria | 18542 |
| 1112 | Ga0495587_0033786 | 3300046536 | Bacteria | 3086 |
| 1113 | Ga0495587_0097319 | 3300046536 | Bacteria | 1697 |
| 1114 | Ga0495621_0072455 | 3300046539 | Bacteria | 1271 |
| 1115 | Ga0495621_0116141 | 3300046539 | Bacteria | 1031 |
| 1116 | Ga0495645_0285819 | 3300046543 | Bacteria | 1083 |
| 1117 | Ga0495633_0187636 | 3300046558 | Unclassified | 951 |
| 1118 | Ga0495668_0050185 | 3300046616 | Bacteria | 2312 |
| 1119 | Ga0495634_0097080 | 3300046642 | Bacteria | 1908 |
| 1120 | Ga0495657_0025035 | 3300046675 | Bacteria | 4241 |
| 1121 | Ga0495599_0413026 | 3300046678 | Bacteria | 803 |
| 1122 | Ga0495658_0003503 | 3300046683 | Bacteria | 7765 |
| 1123 | Ga0495658_0478832 | 3300046683 | Unclassified | 796 |
| 1124 | Ga0495680_0447408 | 3300047322 | Bacteria | 885 |
| 1125 | Ga0495684_0096239 | 3300047471 | Bacteria | 2241 |
| 1126 | Ga0495686_0000041 | 3300047472 | Bacteria | 297599 |
| 1127 | Ga0495686_0045508 | 3300047472 | Bacteria | 2776 |
| 1128 | Ga0496101_0051249 | 3300048904 | Bacteria | 2974 |
| 1129 | Ga0496105_0214858 | 3300048908 | Bacteria | 1567 |
| 1130 | Ga0496107_0251565 | 3300048910 | Bacteria | 1315 |
| 1131 | Ga0496108_0867115 | 3300048911 | Bacteria | 776 |
| 1132 | Ga0496109_0172869 | 3300048912 | Unclassified | 2027 |
| 1133 | Ga0496111_0017833 | 3300048914 | Unclassified | 4910 |
| 1134 | Ga0496114_0448181 | 3300048917 | Unclassified | 1143 |
| 1135 | Ga0496114_0582472 | 3300048917 | Unclassified | 987 |
| 1136 | Ga0496115_0371094 | 3300048918 | Bacteria | 1165 |
| 1137 | Ga0501305_051632 | 3300049161 | Bacteria | 691 |
| 1138 | Ga0501292_010651 | 3300049515 | Unclassified | 1379 |
| 1139 | Ga0501298_004827 | 3300049521 | Bacteria | 2143 |
| 1140 | Ga0501299_002352 | 3300049522 | Bacteria | 2609 |
| 1141 | Ga0501313_003594 | 3300049529 | Bacteria | 1552 |
| 1142 | Ga0501313_003720 | 3300049529 | Bacteria | 1532 |
| 1143 | Ga0501315_004296 | 3300049531 | Unclassified | 1483 |
| 1144 | Ga0501340_000795 | 3300049556 | Bacteria | 1534 |
| 1145 | Ga0501031_0030645 | 3300049568 | Bacteria | 3509 |
| 1146 | Ga0501032_0011446 | 3300049569 | Bacteria | 6373 |
| 1147 | Ga0501032_0259844 | 3300049569 | Bacteria | 1126 |
| 1148 | Ga0501033_0197232 | 3300049570 | Bacteria | 1439 |
| 1149 | Ga0501034_0013066 | 3300049571 | Bacteria | 8557 |
| 1150 | Ga0501034_0016139 | 3300049571 | Bacteria | 7661 |
| 1151 | Ga0501034_0066443 | 3300049571 | Bacteria | 3619 |
| 1152 | Ga0501034_0070588 | 3300049571 | Bacteria | 3504 |
| 1153 | Ga0501034_0217761 | 3300049571 | Bacteria | 1863 |
| 1154 | Ga0501036_0055928 | 3300049572 | Bacteria | 3343 |
| 1155 | Ga0501036_0078561 | 3300049572 | Bacteria | 2791 |
| 1156 | Ga0501037_0003876 | 3300049573 | Bacteria | 10850 |
| 1157 | Ga0501037_0052301 | 3300049573 | Bacteria | 2988 |
| 1158 | Ga0501037_0098003 | 3300049573 | Bacteria | 2118 |
| 1159 | Ga0501037_0225536 | 3300049573 | Bacteria | 1317 |
| 1160 | Ga0501038_0007909 | 3300049574 | Bacteria | 9802 |
| 1161 | Ga0501038_0320503 | 3300049574 | Bacteria | 1213 |
| 1162 | Ga0501039_0016596 | 3300049575 | Bacteria | 5640 |
| 1163 | Ga0501039_0202355 | 3300049575 | Bacteria | 1561 |
| 1164 | Ga0501040_0183156 | 3300049576 | Unclassified | 1485 |
| 1165 | Ga0501043_0007741 | 3300049579 | Bacteria | 8502 |
| 1166 | Ga0501043_0052196 | 3300049579 | Bacteria | 3212 |
| 1167 | Ga0501043_0068317 | 3300049579 | Unclassified | 2790 |
| 1168 | Ga0501043_0096161 | 3300049579 | Bacteria | 2328 |
| 1169 | Ga0501043_0155234 | 3300049579 | Bacteria | 1790 |
| 1170 | Ga0501046_0010893 | 3300049580 | Bacteria | 7792 |
| 1171 | Ga0501047_0002262 | 3300049581 | Bacteria | 18429 |
| 1172 | Ga0501047_0142055 | 3300049581 | Bacteria | 2279 |
| 1173 | Ga0501047_0326279 | 3300049581 | Bacteria | 1374 |
| 1174 | Ga0501047_0378910 | 3300049581 | Bacteria | 1249 |
| 1175 | Ga0501047_0778165 | 3300049581 | Unclassified | 772 |
| 1176 | Ga0501067_0030643 | 3300049583 | Bacteria | 2983 |
| 1177 | Ga0501068_0036486 | 3300049584 | Bacteria | 2940 |
| 1178 | Ga0501069_0133656 | 3300049585 | Bacteria | 1421 |
| 1179 | Ga0501070_0014912 | 3300049586 | Bacteria | 6537 |
| 1180 | Ga0501070_0063339 | 3300049586 | Bacteria | 3063 |
| 1181 | Ga0501070_0073982 | 3300049586 | Bacteria | 2820 |
| 1182 | Ga0501070_0418080 | 3300049586 | Bacteria | 1083 |
| 1183 | Ga0501072_0462128 | 3300049588 | Bacteria | 1005 |
| 1184 | Ga0501073_0058616 | 3300049589 | Bacteria | 2690 |
| 1185 | Ga0501074_0057085 | 3300049590 | Bacteria | 2812 |
| 1186 | Ga0501198_007808 | 3300049649 | Bacteria | 1543 |
| 1187 | Ga0501201_000258 | 3300049651 | Bacteria | 4759 |
| 1188 | Ga0501202_004058 | 3300049652 | Bacteria | 2546 |
| 1189 | Ga0501202_031722 | 3300049652 | Bacteria | 1106 |
| 1190 | Ga0501216_040980 | 3300049660 | Unclassified | 886 |
| 1191 | Ga0501217_001890 | 3300049661 | Bacteria | 4016 |
| 1192 | Ga0501222_003740 | 3300049662 | Bacteria | 2069 |
| 1193 | Ga0501223_007746 | 3300049663 | Bacteria | 2193 |
| 1194 | Ga0501223_019582 | 3300049663 | Bacteria | 1329 |
| 1195 | Ga0501233_001139 | 3300049668 | Bacteria | 4515 |
| 1196 | Ga0501235_000140 | 3300049669 | Bacteria | 12163 |
| 1197 | Ga0501235_013210 | 3300049669 | Bacteria | 1817 |
| 1198 | Ga0501235_063768 | 3300049669 | Unclassified | 865 |
| 1199 | Ga0501250_004483 | 3300049680 | Bacteria | 1392 |
| 1200 | Ga0501255_011737 | 3300049684 | Bacteria | 1016 |
| 1201 | Ga0501257_075834 | 3300049686 | Bacteria | 863 |
| 1202 | Ga0501259_001544 | 3300049688 | Bacteria | 3831 |
| 1203 | Ga0501259_025579 | 3300049688 | Bacteria | 1082 |
| 1204 | Ga0501261_001807 | 3300049690 | Bacteria | 2636 |
| 1205 | Ga0501221_001525 | 3300049704 | Bacteria | 3834 |
| 1206 | Ga0501221_060809 | 3300049704 | Bacteria | 873 |
| 1207 | Ga0501225_0021105 | 3300049705 | Bacteria | 1799 |
| 1208 | Ga0501225_0022094 | 3300049705 | Unclassified | 1757 |
| 1209 | Ga0501245_000855 | 3300049708 | Bacteria | 3855 |
| 1210 | Ga0501245_010713 | 3300049708 | Unclassified | 1327 |
| 1211 | Ga0501079_0444552 | 3300049741 | Unclassified | 1018 |
| 1212 | Ga0501080_0064884 | 3300049742 | Bacteria | 3396 |
| 1213 | Ga0501083_0050487 | 3300049744 | Bacteria | 2799 |
| 1214 | Ga0501263_044221 | 3300049760 | Bacteria | 662 |
| 1215 | Ga0501266_011754 | 3300049763 | Bacteria | 1124 |
| 1216 | Ga0501268_018834 | 3300049765 | Bacteria | 1165 |
| 1217 | Ga0501270_002470 | 3300049767 | Bacteria | 1898 |
| 1218 | Ga0501279_012781 | 3300049775 | Unclassified | 1144 |
| 1219 | Ga0501035_0018008 | 3300049822 | Bacteria | 6512 |
| 1220 | Ga0501035_0025624 | 3300049822 | Bacteria | 5405 |
| 1221 | Ga0501035_0206525 | 3300049822 | Bacteria | 1682 |
| 1222 | Ga0501035_0721628 | 3300049822 | Unclassified | 802 |
| 1223 | Ga0501044_0065549 | 3300049823 | Bacteria | 3704 |
| 1224 | Ga0501044_0116849 | 3300049823 | Bacteria | 2672 |
| 1225 | Ga0501044_0303018 | 3300049823 | Bacteria | 1526 |
| 1226 | Ga0501044_0576252 | 3300049823 | Bacteria | 1020 |
| 1227 | Ga0501045_0126116 | 3300049824 | Bacteria | 1902 |
| 1228 | nmdc:mga0k408_120615_c1 | 3300050493 | Bacteria | 1553 |
| 1229 | nmdc:mga05p37_145085_c1 | 3300050507 | Unclassified | 2907 |
| 1230 | nmdc:mga09592_11480_c1 | 3300050508 | Bacteria | 7209 |
| 1231 | nmdc:mga09592_27033_c1 | 3300050508 | Bacteria | 4758 |
| 1232 | nmdc:mga09592_42061_c1 | 3300050508 | Unclassified | 3844 |
| 1233 | nmdc:mga06r32_51640_c1 | 3300050510 | Bacteria | 3935 |
| 1234 | nmdc:mga08y16_104126_c1 | 3300050511 | Unclassified | 2954 |
| 1235 | nmdc:mga08y16_178907_c1 | 3300050511 | Bacteria | 2202 |
| 1236 | Ga0495619_0050828 | 3300053085 | Bacteria | 2738 |
| 1237 | Ga0500643_026965 | 3300053087 | Unclassified | 1792 |
| 1238 | Ga0500643_084142 | 3300053087 | Unclassified | 871 |
| 1239 | Ga0500644_0028808 | 3300053088 | Bacteria | 1740 |
| 1240 | Ga0500646_0007425 | 3300053090 | Bacteria | 2802 |
| 1241 | Ga0500562_000036 | 3300053108 | Bacteria | 78006 |
| 1242 | Ga0500594_0014966 | 3300053118 | Bacteria | 1865 |
| 1243 | Ga0500655_012414 | 3300053133 | Unclassified | 1549 |
| 1244 | Ga0500568_0037481 | 3300053139 | Bacteria | 1966 |
| 1245 | Ga0500588_0004743 | 3300053146 | Bacteria | 2965 |
| 1246 | Ga0500604_0001825 | 3300053151 | Bacteria | 5927 |
| 1247 | Ga0500616_0019418 | 3300053153 | Bacteria | 3831 |
| 1248 | Ga0500622_0000484 | 3300053156 | Bacteria | 37287 |
| 1249 | Ga0500622_0001151 | 3300053156 | Bacteria | 22018 |
| 1250 | Ga0500637_0166241 | 3300053178 | Bacteria | 1270 |
| 1251 | Ga0500611_000018 | 3300053727 | Bacteria | 111023 |
| 1252 | Ga0500645_009647 | 3300053730 | Bacteria | 3234 |
| 1253 | Ga0501084_0058664 | 3300054114 | Bacteria | 3220 |
| 1254 | Ga0501084_0267362 | 3300054114 | Bacteria | 1444 |
| 1255 | Ga0500661_015042 | 3300055283 | Bacteria | 1389 |
| 1256 | Ga0587109_039515 | 3300059624 | Bacteria | 930 |
| 1257 | Ga0501082_0112373 | 3300060353 | Bacteria | 2358 |
| 1258 | 2819589611 | 2818991444 | Bacteria | 6968812 |
| 1259 | 2914763341 | 2914759650 | Bacteria | 4701441 |
| 1260 | 2929156201 | 2929154850 | Bacteria | 6753285 |
| 1261 | rootL2_10076279 | |||
| 1262 | MRS1b_contig_1168309 | |||
| 1263 | MBSR1b_contig_4379216 | |||
| 1264 | MBSR1b_contig_7995764 | |||
| 1265 | JGI24751J29686_10061188 | |||
| 1266 | rootH1_10109167 | |||
| 1267 | rootH1_10125848 | |||
| 1268 | rootH2_10162769 | |||
| 1269 | rootH2_10197471 | |||
| 1270 | rootH2_10205626 | |||
| 1271 | rootL2_10097124 | |||
| 1272 | rootL2_10135684 | |||
| 1273 | rootH1_10227879 | |||
| 1274 | JGI25160J50197_1003126 | |||
| 1275 | Ga0058861_12043672 | |||
| 1276 | Ga0058862_12478465 | |||
| 1277 | Ga0065714_10079249 | |||
| 1278 | Ga0065714_10226543 | |||
| 1279 | Ga0065704_10121850 | |||
| 1280 | Ga0065704_10182402 | |||
| 1281 | Ga0065712_10073224 | |||
| 1282 | Ga0065712_10089634 | |||
| 1283 | Ga0065712_10154453 | |||
| 1284 | Ga0065712_10170127 | |||
| 1285 | Ga0065712_10225270 | |||
| 1286 | Ga0065715_10013993 | |||
| 1287 | Ga0065715_10323297 | |||
| 1288 | Ga0070658_10001461 | |||
| 1289 | Ga0070658_10045017 | |||
| 1290 | Ga0070658_10045140 | |||
| 1291 | Ga0070658_10100597 | |||
| 1292 | Ga0070658_10182071 | |||
| 1293 | Ga0070658_10824846 | |||
| 1294 | Ga0070676_10000153 | |||
| 1295 | Ga0070676_10005303 | |||
| 1296 | Ga0070676_10033838 | |||
| 1297 | Ga0070683_100000329 | |||
| 1298 | Ga0070683_100018651 | |||
| 1299 | Ga0070683_100023520 | |||
| 1300 | Ga0070683_100053673 | |||
| 1301 | Ga0070683_100081163 | |||
| 1302 | Ga0070690_100051558 | |||
| 1303 | Ga0070690_100177737 | |||
| 1304 | Ga0070670_100032449 | |||
| 1305 | Ga0070670_100053200 | |||
| 1306 | Ga0070670_100149986 | |||
| 1307 | Ga0070670_100150728 | |||
| 1308 | Ga0070670_100174216 | |||
| 1309 | Ga0070670_100264373 | |||
| 1310 | Ga0070670_100358496 | |||
| 1311 | Ga0070670_100360560 | |||
| 1312 | Ga0070670_100522309 | |||
| 1313 | Ga0070670_100630214 | |||
| 1314 | Ga0070670_100981754 | |||
| 1315 | Ga0070677_10002116 | |||
| 1316 | Ga0070677_10042997 | |||
| 1317 | Ga0070677_10115552 | |||
| 1318 | Ga0070677_10153182 | |||
| 1319 | Ga0068869_100007813 | |||
| 1320 | Ga0068869_100012388 | |||
| 1321 | Ga0068869_100024126 | |||
| 1322 | Ga0068869_100031526 | |||
| 1323 | Ga0068869_100118166 | |||
| 1324 | Ga0068869_100162297 | |||
| 1325 | Ga0068869_100401576 | |||
| 1326 | Ga0070666_10000043 | |||
| 1327 | Ga0070666_10000209 | |||
| 1328 | Ga0070666_10031000 | |||
| 1329 | Ga0070666_10031370 | |||
| 1330 | Ga0070666_10119646 | |||
| 1331 | Ga0070666_10144826 | |||
| 1332 | Ga0070666_10292921 | |||
| 1333 | Ga0070680_100000076 | |||
| 1334 | Ga0070680_100012535 | |||
| 1335 | Ga0070680_100021326 | |||
| 1336 | Ga0070680_100024075 | |||
| 1337 | Ga0070680_100045972 | |||
| 1338 | Ga0070682_100000717 | |||
| 1339 | Ga0070682_100086673 | |||
| 1340 | Ga0070682_100155207 | |||
| 1341 | Ga0070682_100169628 | |||
| 1342 | Ga0070682_100243568 | |||
| 1343 | Ga0068868_100000726 | |||
| 1344 | Ga0068868_100001336 | |||
| 1345 | Ga0068868_100022584 | |||
| 1346 | Ga0068868_100078450 | |||
| 1347 | Ga0068868_100097530 | |||
| 1348 | Ga0068868_100172352 | |||
| 1349 | Ga0068868_100180291 | |||
| 1350 | Ga0068868_100247821 | |||
| 1351 | Ga0068868_100595379 | |||
| 1352 | Ga0068868_100811708 | |||
| 1353 | Ga0070660_100034772 | |||
| 1354 | Ga0070660_100043591 | |||
| 1355 | Ga0070660_100057089 | |||
| 1356 | Ga0070660_100083945 | |||
| 1357 | Ga0070660_100133622 | |||
| 1358 | Ga0070660_100147379 | |||
| 1359 | Ga0070660_100421503 | |||
| 1360 | Ga0070660_100551128 | |||
| 1361 | Ga0070689_100019751 | |||
| 1362 | Ga0070689_100503540 | |||
| 1363 | Ga0070691_10001594 | |||
| 1364 | Ga0070691_10007717 | |||
| 1365 | Ga0070691_10041025 | |||
| 1366 | Ga0070687_100014051 | |||
| 1367 | Ga0070687_100125092 | |||
| 1368 | Ga0070687_100147780 | |||
| 1369 | Ga0070687_100356811 | |||
| 1370 | Ga0070661_100004831 | |||
| 1371 | Ga0070661_100009444 | |||
| 1372 | Ga0070661_100064706 | |||
| 1373 | Ga0070661_100104590 | |||
| 1374 | Ga0070661_100168713 | |||
| 1375 | Ga0070668_100000556 | |||
| 1376 | Ga0070668_100012182 | |||
| 1377 | Ga0070668_100073785 | |||
| 1378 | Ga0070668_100138846 | |||
| 1379 | Ga0070668_100485189 | |||
| 1380 | Ga0070669_100009249 | |||
| 1381 | Ga0070669_100035738 | |||
| 1382 | Ga0070675_100010042 | |||
| 1383 | Ga0070675_100026514 | |||
| 1384 | Ga0070675_100043632 | |||
| 1385 | Ga0070675_100050419 | |||
| 1386 | Ga0070675_100611183 | |||
| 1387 | Ga0070675_100638424 | |||
| 1388 | Ga0070671_100001985 | |||
| 1389 | Ga0070671_100013745 | |||
| 1390 | Ga0070671_100069303 | |||
| 1391 | Ga0070671_100115887 | |||
| 1392 | Ga0070671_100585517 | |||
| 1393 | Ga0070674_100029455 | |||
| 1394 | Ga0070674_100030959 | |||
| 1395 | Ga0070674_100753954 | |||
| 1396 | Ga0070673_100000867 | |||
| 1397 | Ga0070673_100006375 | |||
| 1398 | Ga0070673_100037568 | |||
| 1399 | Ga0070673_100042687 | |||
| 1400 | Ga0070673_100059928 | |||
| 1401 | Ga0070673_100098764 | |||
| 1402 | Ga0070673_100206169 | |||
| 1403 | Ga0070673_100217525 | |||
| 1404 | Ga0070673_100219615 | |||
| 1405 | Ga0070673_100281591 | |||
| 1406 | Ga0070688_100004476 | |||
| 1407 | Ga0070688_100089412 | |||
| 1408 | Ga0070688_100169991 | |||
| 1409 | Ga0070688_100234589 | |||
| 1410 | Ga0070688_100262084 | |||
| 1411 | Ga0070659_100007187 | |||
| 1412 | Ga0070659_100014833 | |||
| 1413 | Ga0070659_100061370 | |||
| 1414 | Ga0070659_100191534 | |||
| 1415 | Ga0070659_100228816 | |||
| 1416 | Ga0070659_100542459 | |||
| 1417 | Ga0070667_100000812 | |||
| 1418 | Ga0070667_100008930 | |||
| 1419 | Ga0070667_100020249 | |||
| 1420 | Ga0070667_100028595 | |||
| 1421 | Ga0070667_100057396 | |||
| 1422 | Ga0070667_100220075 | |||
| 1423 | Ga0070667_100250684 | |||
| 1424 | Ga0070667_100282103 | |||
| 1425 | Ga0070667_100299953 | |||
| 1426 | Ga0070667_100353261 | |||
| 1427 | Ga0070667_100547582 | |||
| 1428 | Ga0070701_10030425 | |||
| 1429 | Ga0070701_10042878 | |||
| 1430 | Ga0070700_100027344 | |||
| 1431 | Ga0070700_100206961 | |||
| 1432 | Ga0070663_100161237 | |||
| 1433 | Ga0070663_100370722 | |||
| 1434 | Ga0070663_100577370 | |||
| 1435 | Ga0070678_100057003 | |||
| 1436 | Ga0070678_100059231 | |||
| 1437 | Ga0070678_100679540 | |||
| 1438 | Ga0070662_100001017 | |||
| 1439 | Ga0070662_100039341 | |||
| 1440 | Ga0070662_100041094 | |||
| 1441 | Ga0070662_100047930 | |||
| 1442 | Ga0070662_100050347 | |||
| 1443 | Ga0070662_100062595 | |||
| 1444 | Ga0070662_100070905 | |||
| 1445 | Ga0070662_100153087 | |||
| 1446 | Ga0070681_10030832 | |||
| 1447 | Ga0070681_10034476 | |||
| 1448 | Ga0070681_10069046 | |||
| 1449 | Ga0070681_10089254 | |||
| 1450 | Ga0070681_10092504 | |||
| 1451 | Ga0070681_10189654 | |||
| 1452 | Ga0070681_10318982 | |||
| 1453 | Ga0070681_10498067 | |||
| 1454 | Ga0068867_100009628 | |||
| 1455 | Ga0068867_100017213 | |||
| 1456 | Ga0068867_100018823 | |||
| 1457 | Ga0068867_100045627 | |||
| 1458 | Ga0068867_100077217 | |||
| 1459 | Ga0068867_100124886 | |||
| 1460 | Ga0068867_100276407 | |||
| 1461 | Ga0068867_100393196 | |||
| 1462 | Ga0068867_100453623 | |||
| 1463 | Ga0068867_100576468 | |||
| 1464 | Ga0070685_10023313 | |||
| 1465 | Ga0070685_10030244 | |||
| 1466 | Ga0070685_10162796 | |||
| 1467 | Ga0070685_10482928 | |||
| 1468 | Ga0070698_100008720 | |||
| 1469 | Ga0070698_100034419 | |||
| 1470 | Ga0070698_100219385 | |||
| 1471 | Ga0070679_100001661 | |||
| 1472 | Ga0070679_100009375 | |||
| 1473 | Ga0070679_100022898 | |||
| 1474 | Ga0070679_100029983 | |||
| 1475 | Ga0070679_100037881 | |||
| 1476 | Ga0070679_100050468 | |||
| 1477 | Ga0070679_100062160 | |||
| 1478 | Ga0070679_100151851 | |||
| 1479 | Ga0070679_100241274 | |||
| 1480 | Ga0070684_100000768 | |||
| 1481 | Ga0070684_100001060 | |||
| 1482 | Ga0070684_100595267 | |||
| 1483 | Ga0068853_100000520 | |||
| 1484 | Ga0068853_100009389 | |||
| 1485 | Ga0068853_100010204 | |||
| 1486 | Ga0068853_100020753 | |||
| 1487 | Ga0068853_100059557 | |||
| 1488 | Ga0068853_100074904 | |||
| 1489 | Ga0068853_100097777 | |||
| 1490 | Ga0068853_100106099 | |||
| 1491 | Ga0068853_100154878 | |||
| 1492 | Ga0068853_100169030 | |||
| 1493 | Ga0068853_100205813 | |||
| 1494 | Ga0068853_100228366 | |||
| 1495 | Ga0068853_100267326 | |||
| 1496 | Ga0068853_100399359 | |||
| 1497 | Ga0068853_100410303 | |||
| 1498 | Ga0068853_100497853 | |||
| 1499 | Ga0070672_100000738 | |||
| 1500 | Ga0070672_100086295 | |||
| 1501 | Ga0070672_100097907 | |||
| 1502 | Ga0070672_100272233 | |||
| 1503 | Ga0070672_100318410 | |||
| 1504 | Ga0070686_100204799 | |||
| 1505 | Ga0070686_100547308 | |||
| 1506 | Ga0070665_100000016 | |||
| 1507 | Ga0070665_100000486 | |||
| 1508 | Ga0070665_100076887 | |||
| 1509 | Ga0070665_100174223 | |||
| 1510 | Ga0070665_100589784 | |||
| 1511 | Ga0070704_100133488 | |||
| 1512 | Ga0068855_100001195 | |||
| 1513 | Ga0068855_100002033 | |||
| 1514 | Ga0068855_100027744 | |||
| 1515 | Ga0068855_100038229 | |||
| 1516 | Ga0068855_100095965 | |||
| 1517 | Ga0068855_100100781 | |||
| 1518 | Ga0068855_100125190 | |||
| 1519 | Ga0068855_100174465 | |||
| 1520 | Ga0068855_101058718 | |||
| 1521 | Ga0070664_100007325 | |||
| 1522 | Ga0070664_100017660 | |||
| 1523 | Ga0070664_100101274 | |||
| 1524 | Ga0070664_100190998 | |||
| 1525 | Ga0070664_100252487 | |||
| 1526 | Ga0070664_100413307 | |||
| 1527 | Ga0070664_100501886 | |||
| 1528 | Ga0068857_100008614 | |||
| 1529 | Ga0068857_100032917 | |||
| 1530 | Ga0068857_100115318 | |||
| 1531 | Ga0068857_100132177 | |||
| 1532 | Ga0068857_100190919 | |||
| 1533 | Ga0068857_100499890 | |||
| 1534 | Ga0068857_100556531 | |||
| 1535 | Ga0068854_100003899 | |||
| 1536 | Ga0068854_100043746 | |||
| 1537 | Ga0068854_100061668 | |||
| 1538 | Ga0068854_100064033 | |||
| 1539 | Ga0068854_100068384 | |||
| 1540 | Ga0068854_100329767 | |||
| 1541 | Ga0068854_100505941 | |||
| 1542 | Ga0068856_100028734 | |||
| 1543 | Ga0068856_100062559 | |||
| 1544 | Ga0068856_100074389 | |||
| 1545 | Ga0068856_100113099 | |||
| 1546 | Ga0068856_100289020 | |||
| 1547 | Ga0070702_100453961 | |||
| 1548 | Ga0068852_100002161 | |||
| 1549 | Ga0068852_100003948 | |||
| 1550 | Ga0068852_100005616 | |||
| 1551 | Ga0068852_100017743 | |||
| 1552 | Ga0068852_100030471 | |||
| 1553 | Ga0068852_100039278 | |||
| 1554 | Ga0068852_100073856 | |||
| 1555 | Ga0068852_100106272 | |||
| 1556 | Ga0068852_100126231 | |||
| 1557 | Ga0068852_100166256 | |||
| 1558 | Ga0068852_100211024 | |||
| 1559 | Ga0068852_100225934 | |||
| 1560 | Ga0068852_100414732 | |||
| 1561 | Ga0068852_100570823 | |||
| 1562 | Ga0068852_101072624 | |||
| 1563 | Ga0068859_100000012 | |||
| 1564 | Ga0068859_100015449 | |||
| 1565 | Ga0068859_100016918 | |||
| 1566 | Ga0068859_100121114 | |||
| 1567 | Ga0068859_100155678 | |||
| 1568 | Ga0068859_100180962 | |||
| 1569 | Ga0068859_100182763 | |||
| 1570 | Ga0068859_100183247 | |||
| 1571 | Ga0068859_100232318 | |||
| 1572 | Ga0068859_100366272 | |||
| 1573 | Ga0068859_100391475 | |||
| 1574 | Ga0068859_100404895 | |||
| 1575 | Ga0068859_100470510 | |||
| 1576 | Ga0068864_100002330 | |||
| 1577 | Ga0068864_100010946 | |||
| 1578 | Ga0068864_100030323 | |||
| 1579 | Ga0068864_100064925 | |||
| 1580 | Ga0068864_100097281 | |||
| 1581 | Ga0068864_100279758 | |||
| 1582 | Ga0068864_100595738 | |||
| 1583 | Ga0068864_101165326 | |||
| 1584 | Ga0068866_10010917 | |||
| 1585 | Ga0068866_10027968 | |||
| 1586 | Ga0068866_10043497 | |||
| 1587 | Ga0068866_10056271 | |||
| 1588 | Ga0068861_100049526 | |||
| 1589 | Ga0068861_100070790 | |||
| 1590 | Ga0068861_100073926 | |||
| 1591 | Ga0068861_100253963 | |||
| 1592 | Ga0068861_100406837 | |||
| 1593 | Ga0068861_100440434 | |||
| 1594 | Ga0068851_10000423 | |||
| 1595 | Ga0068851_10019508 | |||
| 1596 | Ga0068851_10026913 | |||
| 1597 | Ga0068851_10066130 | |||
| 1598 | Ga0068870_10029291 | |||
| 1599 | Ga0068870_10038929 | |||
| 1600 | Ga0068863_100000858 | |||
| 1601 | Ga0068863_100003359 | |||
| 1602 | Ga0068863_100020445 | |||
| 1603 | Ga0068863_100024297 | |||
| 1604 | Ga0068863_100025383 | |||
| 1605 | Ga0068863_100031774 | |||
| 1606 | Ga0068863_100276818 | |||
| 1607 | Ga0068863_100325825 | |||
| 1608 | Ga0068863_100629581 | |||
| 1609 | Ga0068858_100001362 | |||
| 1610 | Ga0068858_100008022 | |||
| 1611 | Ga0068858_100047034 | |||
| 1612 | Ga0068858_100063752 | |||
| 1613 | Ga0068858_100319751 | |||
| 1614 | Ga0068858_100390710 | |||
| 1615 | Ga0068858_100856449 | |||
| 1616 | Ga0068860_100000026 | |||
| 1617 | Ga0068860_100002209 | |||
| 1618 | Ga0068860_100007860 | |||
| 1619 | Ga0068860_100010129 | |||
| 1620 | Ga0068860_100016541 | |||
| 1621 | Ga0068860_100018967 | |||
| 1622 | Ga0068860_100072785 | |||
| 1623 | Ga0068860_100091780 | |||
| 1624 | Ga0068860_100151072 | |||
| 1625 | Ga0068860_100568775 | |||
| 1626 | Ga0068862_100010995 | |||
| 1627 | Ga0068862_100047162 | |||
| 1628 | Ga0068862_100064721 | |||
| 1629 | Ga0068862_100127894 | |||
| 1630 | Ga0068862_100133853 | |||
| 1631 | Ga0068862_100688106 | |||
| 1632 | Ga0081539_10007837 | |||
| 1633 | Ga0070715_10006819 | |||
| 1634 | Ga0075366_10009633 | |||
| 1635 | Ga0075366_10076952 | |||
| 1636 | Ga0097621_100000027 | |||
| 1637 | Ga0097621_100007971 | |||
| 1638 | Ga0097621_100008933 | |||
| 1639 | Ga0097621_100078756 | |||
| 1640 | Ga0097621_100099328 | |||
| 1641 | Ga0097621_100117833 | |||
| 1642 | Ga0097621_100126650 | |||
| 1643 | Ga0097621_100139216 | |||
| 1644 | Ga0097621_100160061 | |||
| 1645 | Ga0097621_100576317 | |||
| 1646 | Ga0097621_100879549 | |||
| 1647 | Ga0068871_100000107 | |||
| 1648 | Ga0068871_100008378 | |||
| 1649 | Ga0068871_100083065 | |||
| 1650 | Ga0068871_100086792 | |||
| 1651 | Ga0068871_100095306 | |||
| 1652 | Ga0068871_100097165 | |||
| 1653 | Ga0068871_100103213 | |||
| 1654 | Ga0068871_100125649 | |||
| 1655 | Ga0068871_100136715 | |||
| 1656 | Ga0068871_100161295 | |||
| 1657 | Ga0068871_100553333 | |||
| 1658 | Ga0075428_100056891 | |||
| 1659 | Ga0075430_100005928 | |||
| 1660 | Ga0075431_100001800 | |||
| 1661 | Ga0075434_100540770 | |||
| 1662 | Ga0075429_100015792 | |||
| 1663 | Ga0075429_100037587 | |||
| 1664 | Ga0075429_100041776 | |||
| 1665 | Ga0075429_100252586 | |||
| 1666 | Ga0075429_100642628 | |||
| 1667 | Ga0068865_100002249 | |||
| 1668 | Ga0068865_100125695 | |||
| 1669 | Ga0068865_100128968 | |||
| 1670 | Ga0068865_100131110 | |||
| 1671 | Ga0068865_100197973 | |||
| 1672 | Ga0075436_100290683 | |||
| 1673 | Ga0097620_100000012 | |||
| 1674 | Ga0097620_100015449 | |||
| 1675 | Ga0097620_100016919 | |||
| 1676 | Ga0097620_100121119 | |||
| 1677 | Ga0097620_100155682 | |||
| 1678 | Ga0097620_100180977 | |||
| 1679 | Ga0097620_100182775 | |||
| 1680 | Ga0097620_100183241 | |||
| 1681 | Ga0097620_100232321 | |||
| 1682 | Ga0097620_100366299 | |||
| 1683 | Ga0097620_100391444 | |||
| 1684 | Ga0097620_100404905 | |||
| 1685 | Ga0105251_10095755 | |||
| 1686 | Ga0105240_10000258 | |||
| 1687 | Ga0105240_10000715 | |||
| 1688 | Ga0105240_10002252 | |||
| 1689 | Ga0105240_10004553 | |||
| 1690 | Ga0105240_10004621 | |||
| 1691 | Ga0105240_10016056 | |||
| 1692 | Ga0105240_10023337 | |||
| 1693 | Ga0105240_10039801 | |||
| 1694 | Ga0105240_10054842 | |||
| 1695 | Ga0105240_10060026 | |||
| 1696 | Ga0105240_10203604 | |||
| 1697 | Ga0105240_10212273 | |||
| 1698 | Ga0111539_10162199 | |||
| 1699 | Ga0105245_10507780 | |||
| 1700 | Ga0105247_10001409 | |||
| 1701 | Ga0105247_10008259 | |||
| 1702 | Ga0114129_10015867 | |||
| 1703 | Ga0105241_10000224 | |||
| 1704 | Ga0105241_10000533 | |||
| 1705 | Ga0105241_10069438 | |||
| 1706 | Ga0105241_10097536 | |||
| 1707 | Ga0105241_10139058 | |||
| 1708 | Ga0105241_10259768 | |||
| 1709 | Ga0105241_10332089 | |||
| 1710 | Ga0105241_10769260 | |||
| 1711 | Ga0105242_10043542 | |||
| 1712 | Ga0105242_10056582 | |||
| 1713 | Ga0105242_10076969 | |||
| 1714 | Ga0105242_10451632 | |||
| 1715 | Ga0105242_10631368 | |||
| 1716 | Ga0105242_10844261 | |||
| 1717 | Ga0105248_10004939 | |||
| 1718 | Ga0105248_10060288 | |||
| 1719 | Ga0105237_10005490 | |||
| 1720 | Ga0105237_10005694 | |||
| 1721 | Ga0105237_10014096 | |||
| 1722 | Ga0105237_10022472 | |||
| 1723 | Ga0105237_10047089 | |||
| 1724 | Ga0105237_10064862 | |||
| 1725 | Ga0105237_10098324 | |||
| 1726 | Ga0105237_10126957 | |||
| 1727 | Ga0105238_10006981 | |||
| 1728 | Ga0105238_10064549 | |||
| 1729 | Ga0105238_10078160 | |||
| 1730 | Ga0105238_10134127 | |||
| 1731 | Ga0105249_10001958 | |||
| 1732 | Ga0105249_10023081 | |||
| 1733 | Ga0105249_10034852 | |||
| 1734 | Ga0105249_10041170 | |||
| 1735 | Ga0105249_10102452 | |||
| 1736 | Ga0105249_10580375 | |||
| 1737 | Ga0105249_10596564 | |||
| 1738 | Ga0105249_10974557 | |||
| 1739 | Ga0105239_10001037 | |||
| 1740 | Ga0105239_10011083 | |||
| 1741 | Ga0105239_10017966 | |||
| 1742 | Ga0105239_10043883 | |||
| 1743 | Ga0105239_10066389 | |||
| 1744 | Ga0105239_10127719 | |||
| 1745 | Ga0105239_10192320 | |||
| 1746 | Ga0105239_10371360 | |||
| 1747 | Ga0105239_10386859 | |||
| 1748 | Ga0105239_10411698 | |||
| 1749 | Ga0105246_10005718 | |||
| 1750 | Ga0105246_10094380 | |||
| 1751 | Ga0105246_10145723 | |||
| 1752 | Ga0105246_10215943 | |||
| 1753 | Ga0105246_10425992 | |||
| 1754 | Ga0105246_10767641 | |||
| 1755 | Ga0157373_10000275 | |||
| 1756 | Ga0157373_10015282 | |||
| 1757 | Ga0157373_10016691 | |||
| 1758 | Ga0157373_10026324 | |||
| 1759 | Ga0157373_10038389 | |||
| 1760 | Ga0157373_10050702 | |||
| 1761 | Ga0157373_10110592 | |||
| 1762 | Ga0157373_10211189 | |||
| 1763 | Ga0157373_10277050 | |||
| 1764 | Ga0157373_10290340 | |||
| 1765 | Ga0157371_10000596 | |||
| 1766 | Ga0157371_10002078 | |||
| 1767 | Ga0157371_10011331 | |||
| 1768 | Ga0157371_10012915 | |||
| 1769 | Ga0157371_10024481 | |||
| 1770 | Ga0157371_10029505 | |||
| 1771 | Ga0157371_10064707 | |||
| 1772 | Ga0157371_10091472 | |||
| 1773 | Ga0157371_10091597 | |||
| 1774 | Ga0157371_10110867 | |||
| 1775 | Ga0157371_10137041 | |||
| 1776 | Ga0157371_10162979 | |||
| 1777 | Ga0157371_10169831 | |||
| 1778 | Ga0157371_10179070 | |||
| 1779 | Ga0157371_10226367 | |||
| 1780 | Ga0157371_10263919 | |||
| 1781 | Ga0157371_10755418 | |||
| 1782 | Ga0157370_10000238 | |||
| 1783 | Ga0157370_10000405 | |||
| 1784 | Ga0157370_10001393 | |||
| 1785 | Ga0157370_10005886 | |||
| 1786 | Ga0157370_10055078 | |||
| 1787 | Ga0157370_10070212 | |||
| 1788 | Ga0157370_10160251 | |||
| 1789 | Ga0157370_10209739 | |||
| 1790 | Ga0157370_10322742 | |||
| 1791 | Ga0157370_10389986 | |||
| 1792 | Ga0157370_10770037 | |||
| 1793 | Ga0157369_10023820 | |||
| 1794 | Ga0157369_10040594 | |||
| 1795 | Ga0157369_10059170 | |||
| 1796 | Ga0157369_10067243 | |||
| 1797 | Ga0157369_10068914 | |||
| 1798 | Ga0157369_10100151 | |||
| 1799 | Ga0157369_10161499 | |||
| 1800 | Ga0157369_10185665 | |||
| 1801 | Ga0157369_10188812 | |||
| 1802 | Ga0157369_10279023 | |||
| 1803 | Ga0157369_10366869 | |||
| 1804 | Ga0157369_10485617 | |||
| 1805 | Ga0157369_10583150 | |||
| 1806 | Ga0157369_10997484 | |||
| 1807 | Ga0157374_10000841 | |||
| 1808 | Ga0157374_10006478 | |||
| 1809 | Ga0157374_10015281 | |||
| 1810 | Ga0157374_10017671 | |||
| 1811 | Ga0157374_10046728 | |||
| 1812 | Ga0157374_10128112 | |||
| 1813 | Ga0157374_10154491 | |||
| 1814 | Ga0157374_10296805 | |||
| 1815 | Ga0157374_10357898 | |||
| 1816 | Ga0157374_10450174 | |||
| 1817 | Ga0157374_10490250 | |||
| 1818 | Ga0157374_11316718 | |||
| 1819 | Ga0157378_10002090 | |||
| 1820 | Ga0157378_10005857 | |||
| 1821 | Ga0157378_10010065 | |||
| 1822 | Ga0157378_10012644 | |||
| 1823 | Ga0157378_10023595 | |||
| 1824 | Ga0157378_10031342 | |||
| 1825 | Ga0157378_10045275 | |||
| 1826 | Ga0157378_10069077 | |||
| 1827 | Ga0157378_10101789 | |||
| 1828 | Ga0157378_10132143 | |||
| 1829 | Ga0157378_10369500 | |||
| 1830 | Ga0157378_10415877 | |||
| 1831 | Ga0157378_11065749 | |||
| 1832 | Ga0157378_11356574 | |||
| 1833 | Ga0163162_10000100 | |||
| 1834 | Ga0163162_10000279 | |||
| 1835 | Ga0163162_10001517 | |||
| 1836 | Ga0163162_10003820 | |||
| 1837 | Ga0163162_10004813 | |||
| 1838 | Ga0163162_10006228 | |||
| 1839 | Ga0163162_10006285 | |||
| 1840 | Ga0163162_10020346 | |||
| 1841 | Ga0163162_10038399 | |||
| 1842 | Ga0163162_10118184 | |||
| 1843 | Ga0163162_10162009 | |||
| 1844 | Ga0163162_10387958 | |||
| 1845 | Ga0163162_10502404 | |||
| 1846 | Ga0163162_10551733 | |||
| 1847 | Ga0163162_11602752 | |||
| 1848 | Ga0157372_10002704 | |||
| 1849 | Ga0157372_10009200 | |||
| 1850 | Ga0157372_10010252 | |||
| 1851 | Ga0157372_10010966 | |||
| 1852 | Ga0157372_10015765 | |||
| 1853 | Ga0157372_10029622 | |||
| 1854 | Ga0157372_10031629 | |||
| 1855 | Ga0157372_10072476 | |||
| 1856 | Ga0157372_10090343 | |||
| 1857 | Ga0157372_10103164 | |||
| 1858 | Ga0157372_10109383 | |||
| 1859 | Ga0157372_10113091 | |||
| 1860 | Ga0157372_10114415 | |||
| 1861 | Ga0157372_10139494 | |||
| 1862 | Ga0157372_10141929 | |||
| 1863 | Ga0157372_10156889 | |||
| 1864 | Ga0157372_10165768 | |||
| 1865 | Ga0157372_10199261 | |||
| 1866 | Ga0157372_10222536 | |||
| 1867 | Ga0157372_10294364 | |||
| 1868 | Ga0157372_10298073 | |||
| 1869 | Ga0157372_10382776 | |||
| 1870 | Ga0157372_10388080 | |||
| 1871 | Ga0157372_10388520 | |||
| 1872 | Ga0157372_10626420 | |||
| 1873 | Ga0157372_10677249 | |||
| 1874 | Ga0157372_10711664 | |||
| 1875 | Ga0157372_10791279 | |||
| 1876 | Ga0157372_11149835 | |||
| 1877 | Ga0157372_11462428 | |||
| 1878 | Ga0157375_10000057 | |||
| 1879 | Ga0157375_10000336 | |||
| 1880 | Ga0157375_10038477 | |||
| 1881 | Ga0157375_10039491 | |||
| 1882 | Ga0157375_10053145 | |||
| 1883 | Ga0157375_10064756 | |||
| 1884 | Ga0157375_10076446 | |||
| 1885 | Ga0157375_10084012 | |||
| 1886 | Ga0157375_10086998 | |||
| 1887 | Ga0157375_10155431 | |||
| 1888 | Ga0157375_10166926 | |||
| 1889 | Ga0157375_10183454 | |||
| 1890 | Ga0157375_10275825 | |||
| 1891 | Ga0157375_10289583 | |||
| 1892 | Ga0157375_10348648 | |||
| 1893 | Ga0157375_10357986 | |||
| 1894 | Ga0157375_10653920 | |||
| 1895 | Ga0157375_10704417 | |||
| 1896 | Ga0157375_10734074 | |||
| 1897 | Ga0157375_11143710 | |||
| 1898 | Ga0163163_10000193 | |||
| 1899 | Ga0163163_10000254 | |||
| 1900 | Ga0163163_10002122 | |||
| 1901 | Ga0163163_10009925 | |||
| 1902 | Ga0163163_10020274 | |||
| 1903 | Ga0163163_10142515 | |||
| 1904 | Ga0163163_10232058 | |||
| 1905 | Ga0163163_10238362 | |||
| 1906 | Ga0163163_10442588 | |||
| 1907 | Ga0163163_10506995 | |||
| 1908 | Ga0157380_10001093 | |||
| 1909 | Ga0157380_10006970 | |||
| 1910 | Ga0157380_10010950 | |||
| 1911 | Ga0157380_10150228 | |||
| 1912 | Ga0157380_10196143 | |||
| 1913 | Ga0157380_10248107 | |||
| 1914 | Ga0157380_10272719 | |||
| 1915 | Ga0157380_10399881 | |||
| 1916 | Ga0157380_10735489 | |||
| 1917 | Ga0157380_11066258 | |||
| 1918 | Ga0157377_10028251 | |||
| 1919 | Ga0157377_10057265 | |||
| 1920 | Ga0157377_10197146 | |||
| 1921 | Ga0157377_10210314 | |||
| 1922 | Ga0157379_10000367 | |||
| 1923 | Ga0157379_10017665 | |||
| 1924 | Ga0157379_10026404 | |||
| 1925 | Ga0157379_10033384 | |||
| 1926 | Ga0157379_10047182 | |||
| 1927 | Ga0157379_10132198 | |||
| 1928 | Ga0157379_10145105 | |||
| 1929 | Ga0157379_10304482 | |||
| 1930 | Ga0157379_10583198 | |||
| 1931 | Ga0157376_10000135 | |||
| 1932 | Ga0157376_10002989 | |||
| 1933 | Ga0157376_10007359 | |||
| 1934 | Ga0157376_10019024 | |||
| 1935 | Ga0157376_10127764 | |||
| 1936 | Ga0157376_10216996 | |||
| 1937 | Ga0157376_10242873 | |||
| 1938 | Ga0157376_10355273 | |||
| 1939 | Ga0157376_10411918 | |||
| 1940 | Ga0157376_10526796 | |||
| 1941 | Ga0157376_10766548 | |||
| 1942 | Ga0163161_10001091 | |||
| 1943 | Ga0163161_10035078 | |||
| 1944 | Ga0163161_10101064 | |||
| 1945 | Ga0163161_10104760 | |||
| 1946 | Ga0163161_10268021 | |||
| 1947 | Ga0163161_10485161 | |||
| 1948 | Ga0197907_10191818 | |||
| 1949 | Ga0197907_10951066 | |||
| 1950 | Ga0206356_11664014 | |||
| 1951 | Ga0206355_1373070 | |||
| 1952 | Ga0206352_10396221 | |||
| 1953 | Ga0206352_11083765 | |||
| 1954 | Ga0213876_10001740 | |||
| 1955 | Ga0213876_10010098 | |||
| 1956 | Ga0224712_10165530 | |||
| 1957 | Ga0207426_1000104 | |||
| 1958 | Ga0207697_10013979 | |||
| 1959 | Ga0207697_10093496 | |||
| 1960 | Ga0207697_10181130 | |||
| 1961 | Ga0207656_10002124 | |||
| 1962 | Ga0207682_10001049 | |||
| 1963 | Ga0207682_10063133 | |||
| 1964 | Ga0207642_10027167 | |||
| 1965 | Ga0207710_10012887 | |||
| 1966 | Ga0207710_10050658 | |||
| 1967 | Ga0207688_10035812 | |||
| 1968 | Ga0207688_10045084 | |||
| 1969 | Ga0207688_10077139 | |||
| 1970 | Ga0207680_10000371 | |||
| 1971 | Ga0207680_10025925 | |||
| 1972 | Ga0207680_10028803 | |||
| 1973 | Ga0207680_10075669 | |||
| 1974 | Ga0207680_10449108 | |||
| 1975 | Ga0207647_10004784 | |||
| 1976 | Ga0207647_10012837 | |||
| 1977 | Ga0207647_10019112 | |||
| 1978 | Ga0207685_10010434 | |||
| 1979 | Ga0207645_10000511 | |||
| 1980 | Ga0207645_10004291 | |||
| 1981 | Ga0207645_10017285 | |||
| 1982 | Ga0207645_10297712 | |||
| 1983 | Ga0207645_10507983 | |||
| 1984 | Ga0207643_10001735 | |||
| 1985 | Ga0207643_10061009 | |||
| 1986 | Ga0207643_10089852 | |||
| 1987 | Ga0207643_10205166 | |||
| 1988 | Ga0207643_10250150 | |||
| 1989 | Ga0207705_10034312 | |||
| 1990 | Ga0207705_10043425 | |||
| 1991 | Ga0207705_10163048 | |||
| 1992 | Ga0207705_10308121 | |||
| 1993 | Ga0207705_10345656 | |||
| 1994 | Ga0207705_10541303 | |||
| 1995 | Ga0207654_10001646 | |||
| 1996 | Ga0207654_10003857 | |||
| 1997 | Ga0207654_10239301 | |||
| 1998 | Ga0207707_10000574 | |||
| 1999 | Ga0207707_10046727 | |||
| 2000 | Ga0207707_10073490 | |||
| 2001 | Ga0207707_10177512 | |||
| 2002 | Ga0207707_10255823 | |||
| 2003 | Ga0207707_10255895 | |||
| 2004 | Ga0207707_10476152 | |||
| 2005 | Ga0207707_10752275 | |||
| 2006 | Ga0207695_10000327 | |||
| 2007 | Ga0207695_10000486 | |||
| 2008 | Ga0207695_10003818 | |||
| 2009 | Ga0207695_10008726 | |||
| 2010 | Ga0207695_10008950 | |||
| 2011 | Ga0207695_10012720 | |||
| 2012 | Ga0207695_10038067 | |||
| 2013 | Ga0207695_10043454 | |||
| 2014 | Ga0207695_10099398 | |||
| 2015 | Ga0207695_10152595 | |||
| 2016 | Ga0207671_10001742 | |||
| 2017 | Ga0207671_10004018 | |||
| 2018 | Ga0207671_10006632 | |||
| 2019 | Ga0207671_10059149 | |||
| 2020 | Ga0207671_10071305 | |||
| 2021 | Ga0207671_10166148 | |||
| 2022 | Ga0207671_10214903 | |||
| 2023 | Ga0207671_10384454 | |||
| 2024 | Ga0207660_10010881 | |||
| 2025 | Ga0207660_10135955 | |||
| 2026 | Ga0207662_10033075 | |||
| 2027 | Ga0207662_10327142 | |||
| 2028 | Ga0207657_10004159 | |||
| 2029 | Ga0207657_10018632 | |||
| 2030 | Ga0207657_10029137 | |||
| 2031 | Ga0207657_10136773 | |||
| 2032 | Ga0207657_10400054 | |||
| 2033 | Ga0207649_10006464 | |||
| 2034 | Ga0207649_10022783 | |||
| 2035 | Ga0207649_10082255 | |||
| 2036 | Ga0207649_10206618 | |||
| 2037 | Ga0207652_10000210 | |||
| 2038 | Ga0207652_10001002 | |||
| 2039 | Ga0207652_10002655 | |||
| 2040 | Ga0207652_10007311 | |||
| 2041 | Ga0207652_10028457 | |||
| 2042 | Ga0207652_10045845 | |||
| 2043 | Ga0207652_10058906 | |||
| 2044 | Ga0207652_10135432 | |||
| 2045 | Ga0207652_10175339 | |||
| 2046 | Ga0207652_10331774 | |||
| 2047 | Ga0207681_10027241 | |||
| 2048 | Ga0207681_10068587 | |||
| 2049 | Ga0207681_10330514 | |||
| 2050 | Ga0207694_10057302 | |||
| 2051 | Ga0207694_10061747 | |||
| 2052 | Ga0207694_10262784 | |||
| 2053 | Ga0207650_10009262 | |||
| 2054 | Ga0207650_10025960 | |||
| 2055 | Ga0207650_10041161 | |||
| 2056 | Ga0207650_10097267 | |||
| 2057 | Ga0207650_10117984 | |||
| 2058 | Ga0207650_10134753 | |||
| 2059 | Ga0207650_10313288 | |||
| 2060 | Ga0207650_10911341 | |||
| 2061 | Ga0207659_10052816 | |||
| 2062 | Ga0207659_10077944 | |||
| 2063 | Ga0207659_10095451 | |||
| 2064 | Ga0207659_10185262 | |||
| 2065 | Ga0207659_10231083 | |||
| 2066 | Ga0207644_10045467 | |||
| 2067 | Ga0207644_10226122 | |||
| 2068 | Ga0207644_10248240 | |||
| 2069 | Ga0207644_10651355 | |||
| 2070 | Ga0207644_10720483 | |||
| 2071 | Ga0207644_10742717 | |||
| 2072 | Ga0207690_10008207 | |||
| 2073 | Ga0207690_10029723 | |||
| 2074 | Ga0207690_10217383 | |||
| 2075 | Ga0207690_10358006 | |||
| 2076 | Ga0207706_10003803 | |||
| 2077 | Ga0207706_10005368 | |||
| 2078 | Ga0207706_10007905 | |||
| 2079 | Ga0207706_10026061 | |||
| 2080 | Ga0207706_10031025 | |||
| 2081 | Ga0207706_10032502 | |||
| 2082 | Ga0207706_10654384 | |||
| 2083 | Ga0207686_10010535 | |||
| 2084 | Ga0207686_10023055 | |||
| 2085 | Ga0207686_10030121 | |||
| 2086 | Ga0207686_10147518 | |||
| 2087 | Ga0207686_10552608 | |||
| 2088 | Ga0207670_10012704 | |||
| 2089 | Ga0207670_10113038 | |||
| 2090 | Ga0207670_10321076 | |||
| 2091 | Ga0207670_10797940 | |||
| 2092 | Ga0207669_10043590 | |||
| 2093 | Ga0207669_10060082 | |||
| 2094 | Ga0207669_10077992 | |||
| 2095 | Ga0207669_10270361 | |||
| 2096 | Ga0207669_10310274 | |||
| 2097 | Ga0207704_10000484 | |||
| 2098 | Ga0207704_10045597 | |||
| 2099 | Ga0207704_10102486 | |||
| 2100 | Ga0207691_10002120 | |||
| 2101 | Ga0207691_10012396 | |||
| 2102 | Ga0207691_10013692 | |||
| 2103 | Ga0207691_10043591 | |||
| 2104 | Ga0207691_10064166 | |||
| 2105 | Ga0207691_10078152 | |||
| 2106 | Ga0207691_10079939 | |||
| 2107 | Ga0207691_10098164 | |||
| 2108 | Ga0207691_10213394 | |||
| 2109 | Ga0207691_10428141 | |||
| 2110 | Ga0207691_10478718 | |||
| 2111 | Ga0207711_10249460 | |||
| 2112 | Ga0207689_10000329 | |||
| 2113 | Ga0207689_10002405 | |||
| 2114 | Ga0207689_10005043 | |||
| 2115 | Ga0207689_10010393 | |||
| 2116 | Ga0207689_10021416 | |||
| 2117 | Ga0207689_10038305 | |||
| 2118 | Ga0207689_10044691 | |||
| 2119 | Ga0207689_10361108 | |||
| 2120 | Ga0207689_10381998 | |||
| 2121 | Ga0207661_10007884 | |||
| 2122 | Ga0207661_10043012 | |||
| 2123 | Ga0207661_10056567 | |||
| 2124 | Ga0207661_10107804 | |||
| 2125 | Ga0207679_10000751 | |||
| 2126 | Ga0207679_10001121 | |||
| 2127 | Ga0207679_10070887 | |||
| 2128 | Ga0207679_10113802 | |||
| 2129 | Ga0207679_10181918 | |||
| 2130 | Ga0207679_10191868 | |||
| 2131 | Ga0207679_10287659 | |||
| 2132 | Ga0207679_10470098 | |||
| 2133 | Ga0207667_10000340 | |||
| 2134 | Ga0207667_10009409 | |||
| 2135 | Ga0207667_10058269 | |||
| 2136 | Ga0207667_10061201 | |||
| 2137 | Ga0207667_10089071 | |||
| 2138 | Ga0207667_10109580 | |||
| 2139 | Ga0207667_10167573 | |||
| 2140 | Ga0207667_10235251 | |||
| 2141 | Ga0207667_10272676 | |||
| 2142 | Ga0207651_10002824 | |||
| 2143 | Ga0207651_10043146 | |||
| 2144 | Ga0207651_10069071 | |||
| 2145 | Ga0207651_10108025 | |||
| 2146 | Ga0207651_10119421 | |||
| 2147 | Ga0207651_10127715 | |||
| 2148 | Ga0207651_10297261 | |||
| 2149 | Ga0207651_10514420 | |||
| 2150 | Ga0207712_10001475 | |||
| 2151 | Ga0207712_10011683 | |||
| 2152 | Ga0207712_10012015 | |||
| 2153 | Ga0207712_10013170 | |||
| 2154 | Ga0207712_10031288 | |||
| 2155 | Ga0207712_10395825 | |||
| 2156 | Ga0207712_11050023 | |||
| 2157 | Ga0207668_10034958 | |||
| 2158 | Ga0207668_10251892 | |||
| 2159 | Ga0207668_10328437 | |||
| 2160 | Ga0207640_10017218 | |||
| 2161 | Ga0207640_10155426 | |||
| 2162 | Ga0207640_10270452 | |||
| 2163 | Ga0207640_10639296 | |||
| 2164 | Ga0207658_10000847 | |||
| 2165 | Ga0207658_10039539 | |||
| 2166 | Ga0207658_10051028 | |||
| 2167 | Ga0207658_10090037 | |||
| 2168 | Ga0207658_10260123 | |||
| 2169 | Ga0207658_10303514 | |||
| 2170 | Ga0207658_10591277 | |||
| 2171 | Ga0207677_10001136 | |||
| 2172 | Ga0207677_10007895 | |||
| 2173 | Ga0207677_10018452 | |||
| 2174 | Ga0207677_10062805 | |||
| 2175 | Ga0207677_10067033 | |||
| 2176 | Ga0207677_10256846 | |||
| 2177 | Ga0207677_10369311 | |||
| 2178 | Ga0207677_10764604 | |||
| 2179 | Ga0207703_10010768 | |||
| 2180 | Ga0207703_10040034 | |||
| 2181 | Ga0207703_10091248 | |||
| 2182 | Ga0207703_10276170 | |||
| 2183 | Ga0207703_10459619 | |||
| 2184 | Ga0207703_10790010 | |||
| 2185 | Ga0207703_10827590 | |||
| 2186 | Ga0207639_10010003 | |||
| 2187 | Ga0207639_10016589 | |||
| 2188 | Ga0207639_10019883 | |||
| 2189 | Ga0207639_10026659 | |||
| 2190 | Ga0207639_10123392 | |||
| 2191 | Ga0207639_10138006 | |||
| 2192 | Ga0207639_10149936 | |||
| 2193 | Ga0207639_10196223 | |||
| 2194 | Ga0207639_10200336 | |||
| 2195 | Ga0207639_10280880 | |||
| 2196 | Ga0207639_10289581 | |||
| 2197 | Ga0207639_10323026 | |||
| 2198 | Ga0207639_10379437 | |||
| 2199 | Ga0207639_10607474 | |||
| 2200 | Ga0207639_10655436 | |||
| 2201 | Ga0207639_10723978 | |||
| 2202 | Ga0207678_10013940 | |||
| 2203 | Ga0207678_10108296 | |||
| 2204 | Ga0207678_10171337 | |||
| 2205 | Ga0207708_10049982 | |||
| 2206 | Ga0207708_10132051 | |||
| 2207 | Ga0207708_10507710 | |||
| 2208 | Ga0207702_10093619 | |||
| 2209 | Ga0207702_10138992 | |||
| 2210 | Ga0207702_10643854 | |||
| 2211 | Ga0207641_10000152 | |||
| 2212 | Ga0207641_10000418 | |||
| 2213 | Ga0207641_10004489 | |||
| 2214 | Ga0207641_10051955 | |||
| 2215 | Ga0207641_10087159 | |||
| 2216 | Ga0207641_10115859 | |||
| 2217 | Ga0207641_10365245 | |||
| 2218 | Ga0207648_10001186 | |||
| 2219 | Ga0207648_10031158 | |||
| 2220 | Ga0207648_10045600 | |||
| 2221 | Ga0207648_10055669 | |||
| 2222 | Ga0207648_10063825 | |||
| 2223 | Ga0207648_10097621 | |||
| 2224 | Ga0207648_10101771 | |||
| 2225 | Ga0207648_10146808 | |||
| 2226 | Ga0207648_10148765 | |||
| 2227 | Ga0207648_10238101 | |||
| 2228 | Ga0207648_10643040 | |||
| 2229 | Ga0207648_10733062 | |||
| 2230 | Ga0207648_11067979 | |||
| 2231 | Ga0207676_10006216 | |||
| 2232 | Ga0207676_10098522 | |||
| 2233 | Ga0207676_10367815 | |||
| 2234 | Ga0207676_10389956 | |||
| 2235 | Ga0207676_10586540 | |||
| 2236 | Ga0207676_11199633 | |||
| 2237 | Ga0207674_10006492 | |||
| 2238 | Ga0207674_10012911 | |||
| 2239 | Ga0207674_10030052 | |||
| 2240 | Ga0207674_10081980 | |||
| 2241 | Ga0207674_10184496 | |||
| 2242 | Ga0207674_10254963 | |||
| 2243 | Ga0207674_10516949 | |||
| 2244 | Ga0207674_10754037 | |||
| 2245 | Ga0207675_100062346 | |||
| 2246 | Ga0207675_100062529 | |||
| 2247 | Ga0207675_100075735 | |||
| 2248 | Ga0207675_100099250 | |||
| 2249 | Ga0207675_100103587 | |||
| 2250 | Ga0207675_100217452 | |||
| 2251 | Ga0207675_100233673 | |||
| 2252 | Ga0207675_100239542 | |||
| 2253 | Ga0207675_100337059 | |||
| 2254 | Ga0207683_10057040 | |||
| 2255 | Ga0207683_10141863 | |||
| 2256 | Ga0207683_10149980 | |||
| 2257 | Ga0207683_10178411 | |||
| 2258 | Ga0207683_10222892 | |||
| 2259 | Ga0207683_10259266 | |||
| 2260 | Ga0207698_10008700 | |||
| 2261 | Ga0207698_10023196 | |||
| 2262 | Ga0207698_10024494 | |||
| 2263 | Ga0207698_10025309 | |||
| 2264 | Ga0207698_10033415 | |||
| 2265 | Ga0207698_10049762 | |||
| 2266 | Ga0207698_10065551 | |||
| 2267 | Ga0207698_10080035 | |||
| 2268 | Ga0207698_10140634 | |||
| 2269 | Ga0207698_10156315 | |||
| 2270 | Ga0207698_10308193 | |||
| 2271 | Ga0209984_1016211 | |||
| 2272 | Ga0209995_1025689 | |||
| 2273 | Ga0268266_10000034 | |||
| 2274 | Ga0268266_10002645 | |||
| 2275 | Ga0268266_10028759 | |||
| 2276 | Ga0268266_10960939 | |||
| 2277 | Ga0268265_10044613 | |||
| 2278 | Ga0268265_10045980 | |||
| 2279 | Ga0268265_10472459 | |||
| 2280 | Ga0268265_11386286 | |||
| 2281 | Ga0268264_10000117 | |||
| 2282 | Ga0268264_10005355 | |||
| 2283 | Ga0268264_10007632 | |||
| 2284 | Ga0268264_10024882 | |||
| 2285 | Ga0268264_10090261 | |||
| 2286 | Ga0268264_10103812 | |||
| 2287 | Ga0268264_10234265 | |||
| 2288 | Ga0268264_10328300 | |||
| 2289 | Ga0268264_10709918 | |||
| 2290 | Ga0307517_10030353 | |||
| 2291 | Ga0307515_10000039 | |||
| 2292 | Ga0307511_10000153 | |||
| 2293 | Ga0265327_10000030 | |||
| 2294 | Ga0307513_10029047 | |||
| 2295 | Ga0307408_100275715 | |||
| 2296 | Ga0307508_10000937 | |||
| 2297 | Ga0307518_10263568 | |||
| 2298 | Ga0307410_10230324 | |||
| 2299 | Ga0307414_10024549 | |||
| 2300 | Ga0307414_10334306 | |||
| 2301 | Ga0307415_100058480 | |||
| 2302 | Ga0373955_0126666 | |||
| 2303 | Ga0373924_0101236 | |||
| 2304 | Ga0373933_0270802 | |||
| 2305 | Ga0373933_0447585 | |||
| 2306 | Ga0373937_0261971 | |||
| 2307 | Ga0373937_0423600 | |||
| 2308 | Ga0395899_0004650 | |||
| 2309 | Ga0395899_0014385 | |||
| 2310 | Ga0395899_0017265 | |||
| 2311 | Ga0395899_0344742 | |||
| 2312 | Ga0395900_0000594 | |||
| 2313 | Ga0395900_0026735 | |||
| 2314 | Ga0395900_0038159 | |||
| 2315 | Ga0395900_0113079 | |||
| 2316 | Ga0395900_0492261 | |||
| 2317 | Ga0395900_0506480 | |||
| 2318 | Ga0395898_0001271 | |||
| 2319 | Ga0395898_0019396 | |||
| 2320 | Ga0395898_0031929 | |||
| 2321 | Ga0395898_0084334 | |||
| 2322 | Ga0395898_0294244 | |||
| 2323 | Ga0395905_0000527 | |||
| 2324 | Ga0395905_0045277 | |||
| 2325 | Ga0395905_0050843 | |||
| 2326 | Ga0395901_0014247 | |||
| 2327 | Ga0395901_0017770 | |||
| 2328 | Ga0395901_0087877 | |||
| 2329 | Ga0395901_0105083 | |||
| 2330 | Ga0395901_0179498 | |||
| 2331 | Ga0395901_0581778 | |||
| 2332 | Ga0436365_1161343 | |||
| 2333 | Ga0436365_1876803 | |||
| 2334 | Ga0439465_0057582 | |||
| 2335 | Ga0451849_0457641 | |||
| 2336 | Ga0451851_0698711 | |||
| 2337 | Ga0439441_005719 | |||
| 2338 | Ga0439443_030000 | |||
| 2339 | Ga0439445_0023729 | |||
| 2340 | Ga0439449_0012045 | |||
| 2341 | Ga0439449_0015551 | |||
| 2342 | Ga0439454_020763 | |||
| 2343 | Ga0439457_010574 | |||
| 2344 | Ga0439457_060182 | |||
| 2345 | Ga0450895_009516 | |||
| 2346 | Ga0450896_028602 | |||
| 2347 | Ga0450898_001510 | |||
| 2348 | Ga0439460_0022853 | |||
| 2349 | Ga0451577_0107026 | |||
| 2350 | Ga0451577_0222244 | |||
| 2351 | Ga0466972_0000175 | |||
| 2352 | Ga0466972_0000782 | |||
| 2353 | Ga0466966_0335187 | |||
| 2354 | Ga0466964_0052419 | |||
| 2355 | Ga0453684_0038732 | |||
| 2356 | Ga0453684_0054306 | |||
| 2357 | Ga0453684_0077553 | |||
| 2358 | Ga0466968_0038156 | |||
| 2359 | Ga0466968_0125093 | |||
| 2360 | Ga0466970_0001012 | |||
| 2361 | Ga0466960_0091924 | |||
| 2362 | Ga0466959_0503167 | |||
| 2363 | Ga0451576_0077826 | |||
| 2364 | Ga0451576_0305980 | |||
| 2365 | Ga0466967_0501574 | |||
| 2366 | Ga0495638_0072586 | |||
| 2367 | Ga0495638_0141913 | |||
| 2368 | Ga0495653_0078610 | |||
| 2369 | Ga0495580_0033076 | |||
| 2370 | Ga0495628_0338979 | |||
| 2371 | Ga0495648_0002156 | |||
| 2372 | Ga0495587_0033786 | |||
| 2373 | Ga0495587_0097319 | |||
| 2374 | Ga0495621_0072455 | |||
| 2375 | Ga0495621_0116141 | |||
| 2376 | Ga0495645_0285819 | |||
| 2377 | Ga0495633_0187636 | |||
| 2378 | Ga0495668_0050185 | |||
| 2379 | Ga0495634_0097080 | |||
| 2380 | Ga0495657_0025035 | |||
| 2381 | Ga0495599_0413026 | |||
| 2382 | Ga0495658_0003503 | |||
| 2383 | Ga0495658_0478832 | |||
| 2384 | Ga0495680_0447408 | |||
| 2385 | Ga0495684_0096239 | |||
| 2386 | Ga0495686_0000041 | |||
| 2387 | Ga0495686_0045508 | |||
| 2388 | Ga0496101_0051249 | |||
| 2389 | Ga0496105_0214858 | |||
| 2390 | Ga0496107_0251565 | |||
| 2391 | Ga0496108_0867115 | |||
| 2392 | Ga0496109_0172869 | |||
| 2393 | Ga0496111_0017833 | |||
| 2394 | Ga0496114_0448181 | |||
| 2395 | Ga0496114_0582472 | |||
| 2396 | Ga0496115_0371094 | |||
| 2397 | Ga0501305_051632 | |||
| 2398 | Ga0501292_010651 | |||
| 2399 | Ga0501298_004827 | |||
| 2400 | Ga0501299_002352 | |||
| 2401 | Ga0501313_003594 | |||
| 2402 | Ga0501313_003720 | |||
| 2403 | Ga0501315_004296 | |||
| 2404 | Ga0501340_000795 | |||
| 2405 | Ga0501031_0030645 | |||
| 2406 | Ga0501032_0011446 | |||
| 2407 | Ga0501032_0259844 | |||
| 2408 | Ga0501033_0197232 | |||
| 2409 | Ga0501034_0013066 | |||
| 2410 | Ga0501034_0016139 | |||
| 2411 | Ga0501034_0066443 | |||
| 2412 | Ga0501034_0070588 | |||
| 2413 | Ga0501034_0217761 | |||
| 2414 | Ga0501036_0055928 | |||
| 2415 | Ga0501036_0078561 | |||
| 2416 | Ga0501037_0003876 | |||
| 2417 | Ga0501037_0052301 | |||
| 2418 | Ga0501037_0098003 | |||
| 2419 | Ga0501037_0225536 | |||
| 2420 | Ga0501038_0007909 | |||
| 2421 | Ga0501038_0320503 | |||
| 2422 | Ga0501039_0016596 | |||
| 2423 | Ga0501039_0202355 | |||
| 2424 | Ga0501040_0183156 | |||
| 2425 | Ga0501043_0007741 | |||
| 2426 | Ga0501043_0052196 | |||
| 2427 | Ga0501043_0068317 | |||
| 2428 | Ga0501043_0096161 | |||
| 2429 | Ga0501043_0155234 | |||
| 2430 | Ga0501046_0010893 | |||
| 2431 | Ga0501047_0002262 | |||
| 2432 | Ga0501047_0142055 | |||
| 2433 | Ga0501047_0326279 | |||
| 2434 | Ga0501047_0378910 | |||
| 2435 | Ga0501047_0778165 | |||
| 2436 | Ga0501067_0030643 | |||
| 2437 | Ga0501068_0036486 | |||
| 2438 | Ga0501069_0133656 | |||
| 2439 | Ga0501070_0014912 | |||
| 2440 | Ga0501070_0063339 | |||
| 2441 | Ga0501070_0073982 | |||
| 2442 | Ga0501070_0418080 | |||
| 2443 | Ga0501072_0462128 | |||
| 2444 | Ga0501073_0058616 | |||
| 2445 | Ga0501074_0057085 | |||
| 2446 | Ga0501198_007808 | |||
| 2447 | Ga0501201_000258 | |||
| 2448 | Ga0501202_004058 | |||
| 2449 | Ga0501202_031722 | |||
| 2450 | Ga0501216_040980 | |||
| 2451 | Ga0501217_001890 | |||
| 2452 | Ga0501222_003740 | |||
| 2453 | Ga0501223_007746 | |||
| 2454 | Ga0501223_019582 | |||
| 2455 | Ga0501233_001139 | |||
| 2456 | Ga0501235_000140 | |||
| 2457 | Ga0501235_013210 | |||
| 2458 | Ga0501235_063768 | |||
| 2459 | Ga0501250_004483 | |||
| 2460 | Ga0501255_011737 | |||
| 2461 | Ga0501257_075834 | |||
| 2462 | Ga0501259_001544 | |||
| 2463 | Ga0501259_025579 | |||
| 2464 | Ga0501261_001807 | |||
| 2465 | Ga0501221_001525 | |||
| 2466 | Ga0501221_060809 | |||
| 2467 | Ga0501225_0021105 | |||
| 2468 | Ga0501225_0022094 | |||
| 2469 | Ga0501245_000855 | |||
| 2470 | Ga0501245_010713 | |||
| 2471 | Ga0501079_0444552 | |||
| 2472 | Ga0501080_0064884 | |||
| 2473 | Ga0501083_0050487 | |||
| 2474 | Ga0501263_044221 | |||
| 2475 | Ga0501266_011754 | |||
| 2476 | Ga0501268_018834 | |||
| 2477 | Ga0501270_002470 | |||
| 2478 | Ga0501279_012781 | |||
| 2479 | Ga0501035_0018008 | |||
| 2480 | Ga0501035_0025624 | |||
| 2481 | Ga0501035_0206525 | |||
| 2482 | Ga0501035_0721628 | |||
| 2483 | Ga0501044_0065549 | |||
| 2484 | Ga0501044_0116849 | |||
| 2485 | Ga0501044_0303018 | |||
| 2486 | Ga0501044_0576252 | |||
| 2487 | Ga0501045_0126116 | |||
| 2488 | nmdc:mga0k408_120615_c1 | |||
| 2489 | nmdc:mga05p37_145085_c1 | |||
| 2490 | nmdc:mga09592_11480_c1 | |||
| 2491 | nmdc:mga09592_27033_c1 | |||
| 2492 | nmdc:mga09592_42061_c1 | |||
| 2493 | nmdc:mga06r32_51640_c1 | |||
| 2494 | nmdc:mga08y16_104126_c1 | |||
| 2495 | nmdc:mga08y16_178907_c1 | |||
| 2496 | Ga0495619_0050828 | |||
| 2497 | Ga0500643_026965 | |||
| 2498 | Ga0500643_084142 | |||
| 2499 | Ga0500644_0028808 | |||
| 2500 | Ga0500646_0007425 | |||
| 2501 | Ga0500562_000036 | |||
| 2502 | Ga0500594_0014966 | |||
| 2503 | Ga0500655_012414 | |||
| 2504 | Ga0500568_0037481 | |||
| 2505 | Ga0500588_0004743 | |||
| 2506 | Ga0500604_0001825 | |||
| 2507 | Ga0500616_0019418 | |||
| 2508 | Ga0500622_0000484 | |||
| 2509 | Ga0500622_0001151 | |||
| 2510 | Ga0500637_0166241 | |||
| 2511 | Ga0500611_000018 | |||
| 2512 | Ga0500645_009647 | |||
| 2513 | Ga0501084_0058664 | |||
| 2514 | Ga0501084_0267362 | |||
| 2515 | Ga0500661_015042 | |||
| 2516 | Ga0587109_039515 | |||
| 2517 | Ga0501082_0112373 | |||
| 2518 | 2819589611 | |||
| 2519 | 2914763341 | |||
| 2520 | 2929156201 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xj8-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form | 0.7798 | 1 | 201 |
| 5xj5-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form | 0.76 | 3 | 206 |
| 5xj8-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form | 0.7493 | 1 | 201 |
| 5xj5-assembly1.cif.gz_A | crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form | 0.744 | 3 | 206 |
| 6yxa-assembly1.cif.gz_A-2 | structure of the bifunctional rel enzyme from b. subtilis | 0.3775 | 56 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P60782_11_184_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7534 | 10 | 192 | 1.10.1760.20 |
| af_P60782_11_184_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7424 | 10 | 192 | 1.10.1760.20 |
| af_Q2FYS6_9_191_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7254 | 10 | 192 | 1.10.1760.20 |
| af_Q2FYS6_9_191_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7152 | 10 | 192 | 1.10.1760.20 |
| af_I1KG51_268_372_1.20.58.1220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Exo84p, C-terminal helical domain | 0.5559 | 3 | 126 | 1.20.58.1220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I0MYY8-F1-model_v4 | Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) | 0.9389 | 1 | 204 |
GO:0005886
GO:0008654 GO:0043772 |
| AF-A0A4V1ZZ72-F1-model_v4 | Glycerol-3-phosphate acyltransferase | 0.9353 | 1 | 121 |
GO:0005886
GO:0008654 GO:0043772 |
| AF-A0A2T6ENC9-F1-model_v4 | deleted | 0.935 | 1 | 122 |
|
| AF-A0A380DR25-F1-model_v4 | Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY (EC 2.3.1.-) | 0.931 | 1 | 133 |
GO:0005886
GO:0008654 GO:0043772 |
| AF-A0A7V1RH82-F1-model_v4 | Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) | 0.9252 | 3 | 201 |
GO:0004366
GO:0005886 GO:0008654 GO:0043772 |