F492297

General Info

Members Datasets Scaffolds Average Seq Length
1260 399 2520 256

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0087549|Ga0373937_0087549_134_1015
Length 293
Sequence MVRSLLEGVRAGGLYNRGSMIARPRAGDPIQTEADMVLEGRVALVTGAASGIGKSIAQRFARAGARVVIADLAIDGAAAAAREIGGDDRAFAVAMDVTDEAAVNAGVAKAIAAYGGIDVLVSNAGVQIVHPLEEFTYAEWRKMLAIHLDGAFLTTRACLPHMYRAGRGSLIYMGSVHSKLASVLKAPYVTAKHGLIGLAKTMAKEGAPHGVRANVICPGFVRTPLVDKQIPEQSRTLGISEEDVVKKVMLKDTVDGEFTTLEDVAEVALMFAAFPTNALTGQSLVVSHGWFMQ

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
158 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
159 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
241 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
242 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
243 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
247 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
251 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
252 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
253 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
256 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
257 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
258 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
259 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
260 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
261 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
262 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
281 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
282 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
283 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
284 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
285 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
286 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
297 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
298 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
301 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
302 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
303 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
304 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
305 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
306 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
314 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
315 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
316 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
317 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
320 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
325 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
347 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
352 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
357 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
361 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
373 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
374 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
375 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
376 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
377 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
378 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
379 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
385 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
386 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
387 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
391 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
392 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
393 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
394 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
395 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
396 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
397 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
398 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
399 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.48
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 0.24
Rhizoplane 6.19
Rhizosphere 88.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0087549 3300036401 Bacteria 2883
2 JGI24737J22298_10029246 3300001990 Bacteria 1729
3 JGI24743J22301_10009131 3300001991 Bacteria 1752
4 JGI24750J21931_1005805 3300002070 Bacteria 1522
5 JGI24750J21931_1008019 3300002070 Bacteria 1336
6 JGI24750J21931_1008042 3300002070 Bacteria 1335
7 JGI24738J21930_10009674 3300002075 Bacteria 2163
8 JGI24749J21850_1009644 3300002076 Bacteria 1349
9 JGI24751J29686_10007247 3300002459 Bacteria 2265
10 JGI25151J46595_10001896 3300003187 Bacteria 13302
11 JGI25151J46595_10008596 3300003187 Bacteria 4895
12 JGI25406J46586_10035972 3300003203 Bacteria 1802
13 Ga0006777J48905_1052058 3300003308 Bacteria 886
14 rootL2_10000128 3300003322 Bacteria 2760
15 rootL2_10096177 3300003322 Bacteria 2983
16 Ga0007417J51691_1018296 3300003544 Bacteria 894
17 Ga0007409J51694_1042546 3300003575 Bacteria 1050
18 Ga0007416J51690_1027846 3300003577 Bacteria 893
19 Ga0007429J51699_1048980 3300003579 Bacteria 893
20 Ga0032354_1014430 3300003693 Bacteria 915
21 Ga0055526_1000050 3300003771 Bacteria 117283
22 Ga0055526_1000439 3300003771 Bacteria 33186
23 Ga0055526_1003172 3300003771 Bacteria 10647
24 Ga0055524_1002528 3300003775 Bacteria 9365
25 JGI25405J52794_10002173 3300003911 Bacteria 3340
26 JGI25405J52794_10026052 3300003911 Bacteria 1200
27 Ga0065165_1000074 3300005262 Bacteria 164454
28 Ga0070658_10004584 3300005327 Bacteria 11229
29 Ga0070658_10018021 3300005327 Bacteria 5646
30 Ga0070658_10097543 3300005327 Bacteria 2427
31 Ga0070658_10244094 3300005327 Bacteria 1523
32 Ga0070676_10010057 3300005328 Bacteria 5123
33 Ga0070683_100023208 3300005329 Bacteria 5548
34 Ga0070683_100023385 3300005329 Bacteria 5527
35 Ga0070683_100083307 3300005329 Bacteria 2996
36 Ga0070683_100098650 3300005329 Bacteria 2749
37 Ga0070683_100332799 3300005329 Bacteria 1446
38 Ga0070690_100000674 3300005330 Bacteria 17423
39 Ga0070670_100000050 3300005331 Bacteria 132470
40 Ga0070670_100004483 3300005331 Bacteria 11699
41 Ga0070670_100008183 3300005331 Bacteria 8905
42 Ga0070670_100013048 3300005331 Bacteria 7116
43 Ga0070670_100017710 3300005331 Bacteria 6111
44 Ga0070670_100041018 3300005331 Bacteria 3977
45 Ga0070670_100052202 3300005331 Bacteria 3511
46 Ga0070670_100067683 3300005331 Bacteria 3064
47 Ga0070670_100093329 3300005331 Bacteria 2589
48 Ga0070670_100134931 3300005331 Bacteria 2133
49 Ga0070670_100274822 3300005331 Bacteria 1471
50 Ga0070677_10025236 3300005333 Bacteria 2217
51 Ga0068869_100029810 3300005334 Bacteria 3826
52 Ga0068869_100136013 3300005334 Bacteria 1893
53 Ga0068869_100165283 3300005334 Bacteria 1725
54 Ga0070666_10006295 3300005335 Bacteria 7300
55 Ga0070666_10039156 3300005335 Bacteria 3158
56 Ga0070666_10068767 3300005335 Bacteria 2407
57 Ga0070666_10109250 3300005335 Bacteria 1911
58 Ga0070680_100001629 3300005336 Bacteria 16406
59 Ga0070680_100008891 3300005336 Bacteria 7698
60 Ga0070680_100060995 3300005336 Bacteria 3087
61 Ga0070680_100089522 3300005336 Bacteria 2547
62 Ga0070680_100192066 3300005336 Bacteria 1721
63 Ga0070682_100010513 3300005337 Bacteria 5252
64 Ga0068868_100011665 3300005338 Bacteria 6402
65 Ga0068868_100019088 3300005338 Bacteria 5134
66 Ga0068868_100060114 3300005338 Bacteria 3007
67 Ga0068868_100086216 3300005338 Bacteria 2524
68 Ga0068868_100180189 3300005338 Bacteria 1752
69 Ga0068868_100212160 3300005338 Bacteria 1618
70 Ga0068868_100550762 3300005338 Bacteria 1016
71 Ga0070660_100001625 3300005339 Bacteria 15452
72 Ga0070660_100020185 3300005339 Bacteria 4893
73 Ga0070660_100040098 3300005339 Bacteria 3562
74 Ga0070660_100046364 3300005339 Bacteria 3332
75 Ga0070689_100002174 3300005340 Bacteria 12697
76 Ga0070689_100010550 3300005340 Bacteria 6585
77 Ga0070689_100020981 3300005340 Bacteria 4856
78 Ga0070689_100049384 3300005340 Bacteria 3248
79 Ga0070691_10003094 3300005341 Bacteria 7459
80 Ga0070691_10047334 3300005341 Bacteria 2044
81 Ga0070691_10133501 3300005341 Bacteria 1260
82 Ga0070687_100006156 3300005343 Bacteria 4901
83 Ga0070687_100063831 3300005343 Bacteria 1954
84 Ga0070661_100002772 3300005344 Bacteria 12020
85 Ga0070661_100003649 3300005344 Bacteria 10597
86 Ga0070661_100007395 3300005344 Bacteria 7571
87 Ga0070661_100033514 3300005344 Bacteria 3720
88 Ga0070661_100057987 3300005344 Bacteria 2837
89 Ga0070661_100059977 3300005344 Bacteria 2791
90 Ga0070661_100203485 3300005344 Bacteria 1513
91 Ga0070661_100224573 3300005344 Bacteria 1441
92 Ga0070692_10008674 3300005345 Bacteria 4544
93 Ga0070692_10010322 3300005345 Bacteria 4245
94 Ga0070692_10051666 3300005345 Bacteria 2139
95 Ga0070668_100000170 3300005347 Bacteria 41682
96 Ga0070668_100002125 3300005347 Bacteria 14489
97 Ga0070668_100002930 3300005347 Bacteria 12612
98 Ga0070668_100047493 3300005347 Bacteria 3301
99 Ga0070668_100322886 3300005347 Bacteria 1300
100 Ga0070669_100000639 3300005353 Bacteria 25933
101 Ga0070669_100012580 3300005353 Bacteria 6002
102 Ga0070669_100044328 3300005353 Bacteria 3241
103 Ga0070669_100151400 3300005353 Bacteria 1796
104 Ga0070669_100267038 3300005353 Bacteria 1367
105 Ga0070675_100003246 3300005354 Bacteria 12316
106 Ga0070675_100007594 3300005354 Bacteria 8389
107 Ga0070671_100005745 3300005355 Bacteria 9880
108 Ga0070671_100021914 3300005355 Bacteria 5219
109 Ga0070671_100099596 3300005355 Bacteria 2438
110 Ga0070671_100153362 3300005355 Bacteria 1946
111 Ga0070671_100413862 3300005355 Bacteria 1154
112 Ga0070671_100647719 3300005355 Bacteria 915
113 Ga0070674_100021328 3300005356 Bacteria 4155
114 Ga0070674_100209971 3300005356 Bacteria 1508
115 Ga0070673_100004666 3300005364 Bacteria 8699
116 Ga0070673_100005099 3300005364 Bacteria 8383
117 Ga0070673_100231922 3300005364 Bacteria 1601
118 Ga0070673_100300015 3300005364 Bacteria 1414
119 Ga0070688_100002832 3300005365 Bacteria 8832
120 Ga0070688_100011717 3300005365 Bacteria 4886
121 Ga0070688_100037833 3300005365 Bacteria 2943
122 Ga0070688_100045737 3300005365 Bacteria 2706
123 Ga0070659_100003380 3300005366 Bacteria 11361
124 Ga0070659_100007453 3300005366 Bacteria 7952
125 Ga0070659_100016214 3300005366 Bacteria 5592
126 Ga0070659_100215789 3300005366 Bacteria 1582
127 Ga0070659_100312134 3300005366 Bacteria 1313
128 Ga0070667_100000140 3300005367 Bacteria 91817
129 Ga0070667_100014818 3300005367 Bacteria 6440
130 Ga0070667_100026157 3300005367 Bacteria 4853
131 Ga0070667_100030395 3300005367 Bacteria 4505
132 Ga0070667_100030963 3300005367 Bacteria 4462
133 Ga0070667_100246802 3300005367 Bacteria 1595
134 Ga0070667_100895894 3300005367 Bacteria 826
135 Ga0070703_10054540 3300005406 Bacteria 1289
136 Ga0070709_10016563 3300005434 Bacteria 4212
137 Ga0070709_10017181 3300005434 Bacteria 4143
138 Ga0070709_10027512 3300005434 Bacteria 3381
139 Ga0070709_10073009 3300005434 Bacteria 2220
140 Ga0070709_10106075 3300005434 Bacteria 1881
141 Ga0070709_10151503 3300005434 Bacteria 1603
142 Ga0070709_10174783 3300005434 Bacteria 1504
143 Ga0070709_10215047 3300005434 Bacteria 1368
144 Ga0070714_100004937 3300005435 Bacteria 10138
145 Ga0070714_100024261 3300005435 Bacteria 4990
146 Ga0070714_100027101 3300005435 Bacteria 4741
147 Ga0070714_100032871 3300005435 Bacteria 4333
148 Ga0070714_100296655 3300005435 Bacteria 1506
149 Ga0070713_100012591 3300005436 Bacteria 6212
150 Ga0070713_100023687 3300005436 Bacteria 4770
151 Ga0070713_100031008 3300005436 Bacteria 4252
152 Ga0070713_100037308 3300005436 Bacteria 3928
153 Ga0070713_100313215 3300005436 Bacteria 1448
154 Ga0070713_100456962 3300005436 Bacteria 1200
155 Ga0070710_10005027 3300005437 Bacteria 6257
156 Ga0070710_10034977 3300005437 Bacteria 2736
157 Ga0070710_10244384 3300005437 Bacteria 1151
158 Ga0070701_10003125 3300005438 Bacteria 6498
159 Ga0070701_10032813 3300005438 Bacteria 2588
160 Ga0070701_10122802 3300005438 Bacteria 1466
161 Ga0070711_100013174 3300005439 Bacteria 5187
162 Ga0070711_100023693 3300005439 Bacteria 3996
163 Ga0070711_100054396 3300005439 Bacteria 2762
164 Ga0070711_100189243 3300005439 Bacteria 1580
165 Ga0070711_100226113 3300005439 Bacteria 1457
166 Ga0070711_100443941 3300005439 Bacteria 1061
167 Ga0070705_100004755 3300005440 Bacteria 6610
168 Ga0070705_100032090 3300005440 Bacteria 2915
169 Ga0070700_100002078 3300005441 Bacteria 10167
170 Ga0070700_100002787 3300005441 Bacteria 8951
171 Ga0070700_100026410 3300005441 Bacteria 3428
172 Ga0070700_100033480 3300005441 Bacteria 3095
173 Ga0070700_100131650 3300005441 Bacteria 1689
174 Ga0070694_100000595 3300005444 Bacteria 19911
175 Ga0070694_100027641 3300005444 Bacteria 3686
176 Ga0070694_100087105 3300005444 Bacteria 2184
177 Ga0070694_100188789 3300005444 Bacteria 1529
178 Ga0070708_100024240 3300005445 Bacteria 5172
179 Ga0070708_100166060 3300005445 Bacteria 2059
180 Ga0070708_100419318 3300005445 Bacteria 1262
181 Ga0070663_100003107 3300005455 Bacteria 9503
182 Ga0070663_100015857 3300005455 Bacteria 4876
183 Ga0070663_100067574 3300005455 Bacteria 2593
184 Ga0070663_100106613 3300005455 Bacteria 2099
185 Ga0070663_100116672 3300005455 Bacteria 2012
186 Ga0070663_100291358 3300005455 Bacteria 1304
187 Ga0070678_100000728 3300005456 Bacteria 16377
188 Ga0070678_100004266 3300005456 Bacteria 8080
189 Ga0070678_100012686 3300005456 Bacteria 5253
190 Ga0070678_100145602 3300005456 Bacteria 1901
191 Ga0070662_100010721 3300005457 Bacteria 6033
192 Ga0070662_100031178 3300005457 Bacteria 3739
193 Ga0070662_100050667 3300005457 Bacteria 2995
194 Ga0070681_10006372 3300005458 Bacteria 11470
195 Ga0070681_10009514 3300005458 Bacteria 9565
196 Ga0070681_10044420 3300005458 Bacteria 4448
197 Ga0070681_10068229 3300005458 Bacteria 3523
198 Ga0070681_10070252 3300005458 Bacteria 3467
199 Ga0070681_10114590 3300005458 Bacteria 2634
200 Ga0070681_10161763 3300005458 Bacteria 2163
201 Ga0070681_10434323 3300005458 Bacteria 1225
202 Ga0068867_100000275 3300005459 Bacteria 33877
203 Ga0068867_100070292 3300005459 Bacteria 2617
204 Ga0068867_100487316 3300005459 Bacteria 1057
205 Ga0068867_100488545 3300005459 Bacteria 1056
206 Ga0070685_10002126 3300005466 Bacteria 10235
207 Ga0070685_10032285 3300005466 Bacteria 2932
208 Ga0070685_10036946 3300005466 Bacteria 2764
209 Ga0070706_100015493 3300005467 Bacteria 7041
210 Ga0070706_100023458 3300005467 Bacteria 5681
211 Ga0070707_100196313 3300005468 Bacteria 1967
212 Ga0070698_100001471 3300005471 Bacteria 26153
213 Ga0070698_100010828 3300005471 Bacteria 9706
214 Ga0070699_100011671 3300005518 Bacteria 7584
215 Ga0070699_100026303 3300005518 Bacteria 5019
216 Ga0070699_100200048 3300005518 Bacteria 1776
217 Ga0070699_100233375 3300005518 Bacteria 1641
218 Ga0070679_100004955 3300005530 Bacteria 12287
219 Ga0070679_100030613 3300005530 Bacteria 5313
220 Ga0070679_100054395 3300005530 Bacteria 3985
221 Ga0070679_100076170 3300005530 Bacteria 3345
222 Ga0070679_100081043 3300005530 Bacteria 3235
223 Ga0070679_100084636 3300005530 Bacteria 3159
224 Ga0070679_100113090 3300005530 Bacteria 2700
225 Ga0070679_100179509 3300005530 Bacteria 2090
226 Ga0070684_100008955 3300005535 Bacteria 7861
227 Ga0070684_100009493 3300005535 Bacteria 7665
228 Ga0070684_100052663 3300005535 Bacteria 3540
229 Ga0070684_100072913 3300005535 Bacteria 3024
230 Ga0070684_100078790 3300005535 Bacteria 2912
231 Ga0070684_100102699 3300005535 Bacteria 2556
232 Ga0070684_100105393 3300005535 Bacteria 2523
233 Ga0070684_100111284 3300005535 Bacteria 2456
234 Ga0070697_100033150 3300005536 Bacteria 4159
235 Ga0068853_100027279 3300005539 Bacteria 4797
236 Ga0068853_100036301 3300005539 Bacteria 4190
237 Ga0068853_100044767 3300005539 Bacteria 3789
238 Ga0068853_100199563 3300005539 Bacteria 1820
239 Ga0068853_100217667 3300005539 Bacteria 1743
240 Ga0070672_100001043 3300005543 Bacteria 16892
241 Ga0070672_100028934 3300005543 Bacteria 4149
242 Ga0070672_100068309 3300005543 Bacteria 2819
243 Ga0070672_100109845 3300005543 Bacteria 2246
244 Ga0070672_100333406 3300005543 Bacteria 1291
245 Ga0070686_100015699 3300005544 Bacteria 4393
246 Ga0070686_100018517 3300005544 Bacteria 4089
247 Ga0070686_100090637 3300005544 Bacteria 2044
248 Ga0070695_100004124 3300005545 Bacteria 8486
249 Ga0070695_100187680 3300005545 Bacteria 1469
250 Ga0070695_100414046 3300005545 Bacteria 1025
251 Ga0070696_100001676 3300005546 Bacteria 14514
252 Ga0070696_100024590 3300005546 Bacteria 4094
253 Ga0070696_100029965 3300005546 Bacteria 3722
254 Ga0070696_100183404 3300005546 Bacteria 1554
255 Ga0070696_100200663 3300005546 Bacteria 1489
256 Ga0070693_100006433 3300005547 Bacteria 5695
257 Ga0070693_100025992 3300005547 Bacteria 3156
258 Ga0070693_100265224 3300005547 Bacteria 1144
259 Ga0070693_100277672 3300005547 Bacteria 1121
260 Ga0070665_100000923 3300005548 Bacteria 37614
261 Ga0070665_100042906 3300005548 Bacteria 4547
262 Ga0070665_100261891 3300005548 Bacteria 1730
263 Ga0070665_100354621 3300005548 Bacteria 1472
264 Ga0070704_100005192 3300005549 Bacteria 7574
265 Ga0070704_100273409 3300005549 Bacteria 1397
266 Ga0068855_100008469 3300005563 Bacteria 12437
267 Ga0068855_100018228 3300005563 Bacteria 8433
268 Ga0068855_100043137 3300005563 Bacteria 5345
269 Ga0068855_100079548 3300005563 Bacteria 3801
270 Ga0068855_100174712 3300005563 Bacteria 2431
271 Ga0070664_100001520 3300005564 Bacteria 18509
272 Ga0070664_100002944 3300005564 Bacteria 13770
273 Ga0070664_100004852 3300005564 Bacteria 10773
274 Ga0070664_100009264 3300005564 Bacteria 7991
275 Ga0070664_100020665 3300005564 Bacteria 5424
276 Ga0070664_100079787 3300005564 Bacteria 2818
277 Ga0070664_100336630 3300005564 Bacteria 1370
278 Ga0070664_100475443 3300005564 Bacteria 1149
279 Ga0068857_100002553 3300005577 Bacteria 14914
280 Ga0068857_100047974 3300005577 Bacteria 3793
281 Ga0068857_100057284 3300005577 Bacteria 3459
282 Ga0068857_100144922 3300005577 Bacteria 2149
283 Ga0068857_100180610 3300005577 Bacteria 1920
284 Ga0068854_100031269 3300005578 Bacteria 3698
285 Ga0068854_100067368 3300005578 Bacteria 2608
286 Ga0068854_100098350 3300005578 Bacteria 2189
287 Ga0068854_100197990 3300005578 Bacteria 1577
288 Ga0068854_100209400 3300005578 Bacteria 1537
289 Ga0068854_100249538 3300005578 Bacteria 1416
290 Ga0068856_100003437 3300005614 Bacteria 16010
291 Ga0068856_100015279 3300005614 Bacteria 7418
292 Ga0068856_100022065 3300005614 Bacteria 6190
293 Ga0068856_100023951 3300005614 Bacteria 5938
294 Ga0068856_100024651 3300005614 Bacteria 5857
295 Ga0068856_100364433 3300005614 Bacteria 1464
296 Ga0068852_100011936 3300005616 Bacteria 6571
297 Ga0068852_100014001 3300005616 Bacteria 6154
298 Ga0068852_100055776 3300005616 Bacteria 3412
299 Ga0068852_100103802 3300005616 Bacteria 2571
300 Ga0068852_100295085 3300005616 Bacteria 1567
301 Ga0068852_100658501 3300005616 Bacteria 1055
302 Ga0068859_100002993 3300005617 Bacteria 17130
303 Ga0068859_100112202 3300005617 Bacteria 2789
304 Ga0068859_100219201 3300005617 Bacteria 1990
305 Ga0068864_100000275 3300005618 Bacteria 45877
306 Ga0068864_100010491 3300005618 Bacteria 7655
307 Ga0068864_100013588 3300005618 Bacteria 6749
308 Ga0068864_100019783 3300005618 Bacteria 5629
309 Ga0068864_100122126 3300005618 Bacteria 2330
310 Ga0068864_100149958 3300005618 Bacteria 2111
311 Ga0068866_10006601 3300005718 Bacteria 4838
312 Ga0068861_100004038 3300005719 Bacteria 9829
313 Ga0068861_100012217 3300005719 Bacteria 5987
314 Ga0068861_100124174 3300005719 Bacteria 2086
315 Ga0068861_100124365 3300005719 Bacteria 2085
316 Ga0068851_10002997 3300005834 Bacteria 7459
317 Ga0068851_10007904 3300005834 Bacteria 4900
318 Ga0068851_10040310 3300005834 Bacteria 2347
319 Ga0068851_10074380 3300005834 Bacteria 1763
320 Ga0068851_10128435 3300005834 Bacteria 1369
321 Ga0068870_10015301 3300005840 Bacteria 3637
322 Ga0068863_100000292 3300005841 Bacteria 51956
323 Ga0068863_100001479 3300005841 Bacteria 23291
324 Ga0068863_100128577 3300005841 Bacteria 2417
325 Ga0068863_100299546 3300005841 Bacteria 1560
326 Ga0068863_100551394 3300005841 Bacteria 1138
327 Ga0068858_100001164 3300005842 Bacteria 27258
328 Ga0068858_100004751 3300005842 Bacteria 13300
329 Ga0068858_100018757 3300005842 Bacteria 6471
330 Ga0068858_100036953 3300005842 Bacteria 4528
331 Ga0068858_100042024 3300005842 Bacteria 4238
332 Ga0068858_100056320 3300005842 Bacteria 3634
333 Ga0068858_100206150 3300005842 Bacteria 1860
334 Ga0068860_100000845 3300005843 Bacteria 34265
335 Ga0068860_100001112 3300005843 Bacteria 29597
336 Ga0068860_100014779 3300005843 Bacteria 7635
337 Ga0068860_100256761 3300005843 Bacteria 1703
338 Ga0068860_100978724 3300005843 Bacteria 863
339 Ga0068862_100001028 3300005844 Bacteria 26829
340 Ga0068862_100007003 3300005844 Bacteria 9360
341 Ga0068862_100048918 3300005844 Bacteria 3610
342 Ga0068862_100121350 3300005844 Bacteria 2304
343 Ga0081455_10001860 3300005937 Bacteria 25395
344 Ga0081455_10009744 3300005937 Bacteria 9841
345 Ga0081455_10031798 3300005937 Bacteria 4767
346 Ga0081455_10056258 3300005937 Bacteria 3341
347 Ga0081538_10035782 3300005981 Bacteria 3255
348 Ga0081538_10098511 3300005981 Bacteria 1481
349 Ga0081540_1009789 3300005983 Bacteria 6562
350 Ga0081539_10009313 3300005985 Bacteria 8243
351 Ga0081539_10070877 3300005985 Bacteria 1869
352 Ga0070717_10000603 3300006028 Bacteria 23074
353 Ga0070717_10060335 3300006028 Bacteria 3141
354 Ga0070717_10067436 3300006028 Bacteria 2977
355 Ga0070717_10597256 3300006028 Bacteria 1001
356 Ga0075365_10086667 3300006038 Bacteria 2128
357 Ga0075365_10243504 3300006038 Bacteria 1263
358 Ga0075363_100005387 3300006048 Bacteria 5686
359 Ga0075364_10088814 3300006051 Bacteria 2049
360 Ga0075364_10174241 3300006051 Bacteria 1454
361 Ga0075364_10232699 3300006051 Bacteria 1251
362 Ga0075432_10019769 3300006058 Bacteria 2302
363 Ga0075432_10098210 3300006058 Bacteria 1080
364 Ga0070715_10000159 3300006163 Bacteria 15732
365 Ga0070715_10123102 3300006163 Bacteria 1239
366 Ga0070716_100010521 3300006173 Bacteria 4640
367 Ga0070716_100078273 3300006173 Bacteria 1965
368 Ga0070716_100186501 3300006173 Bacteria 1367
369 Ga0070712_100004130 3300006175 Bacteria 8923
370 Ga0070712_100020375 3300006175 Bacteria 4340
371 Ga0070712_100035681 3300006175 Bacteria 3376
372 Ga0070712_100269546 3300006175 Bacteria 1367
373 Ga0070712_100284587 3300006175 Bacteria 1333
374 Ga0070712_100320342 3300006175 Bacteria 1260
375 Ga0070712_100606662 3300006175 Bacteria 927
376 Ga0075362_10092615 3300006177 Bacteria 1404
377 Ga0075367_10128398 3300006178 Bacteria 1566
378 Ga0075366_10037733 3300006195 Bacteria 2853
379 Ga0097621_100019564 3300006237 Bacteria 5199
380 Ga0097621_100172487 3300006237 Bacteria 1865
381 Ga0097621_100418712 3300006237 Bacteria 1202
382 Ga0097621_100545495 3300006237 Bacteria 1055
383 Ga0068871_100057919 3300006358 Bacteria 3154
384 Ga0068871_100062414 3300006358 Bacteria 3045
385 Ga0068871_100078716 3300006358 Bacteria 2726
386 Ga0068871_100123662 3300006358 Bacteria 2188
387 Ga0075428_100040725 3300006844 Bacteria 5110
388 Ga0075428_100199872 3300006844 Bacteria 2161
389 Ga0075428_100221034 3300006844 Bacteria 2045
390 Ga0075428_100221243 3300006844 Bacteria 2044
391 Ga0075428_100298902 3300006844 Bacteria 1731
392 Ga0075428_100302655 3300006844 Bacteria 1719
393 Ga0075430_100007044 3300006846 Bacteria 9480
394 Ga0075430_100035206 3300006846 Bacteria 4248
395 Ga0075430_100063617 3300006846 Bacteria 3099
396 Ga0075431_100013070 3300006847 Bacteria 8384
397 Ga0075431_100014686 3300006847 Bacteria 7926
398 Ga0075431_100061633 3300006847 Bacteria 3870
399 Ga0075431_100063587 3300006847 Bacteria 3808
400 Ga0075431_100076425 3300006847 Bacteria 3456
401 Ga0075431_100242051 3300006847 Bacteria 1835
402 Ga0075433_10000981 3300006852 Bacteria 20288
403 Ga0075433_10151262 3300006852 Bacteria 2065
404 Ga0075433_10178897 3300006852 Bacteria 1887
405 Ga0075433_10197585 3300006852 Bacteria 1789
406 Ga0075433_10242784 3300006852 Bacteria 1599
407 Ga0075433_10245154 3300006852 Bacteria 1590
408 Ga0075433_10430911 3300006852 Bacteria 1163
409 Ga0075434_100001241 3300006871 Bacteria 21209
410 Ga0075434_100068221 3300006871 Bacteria 3542
411 Ga0075434_100086729 3300006871 Bacteria 3130
412 Ga0075434_100487636 3300006871 Bacteria 1253
413 Ga0075434_101059223 3300006871 Bacteria 824
414 Ga0075429_100242406 3300006880 Bacteria 1579
415 Ga0068865_100003957 3300006881 Bacteria 8888
416 Ga0068865_100009546 3300006881 Bacteria 6022
417 Ga0068865_100054893 3300006881 Bacteria 2771
418 Ga0068865_100152883 3300006881 Bacteria 1752
419 Ga0068865_100259793 3300006881 Bacteria 1374
420 Ga0075436_100127879 3300006914 Bacteria 1780
421 Ga0075436_100188984 3300006914 Bacteria 1457
422 Ga0097620_100002993 3300006931 Bacteria 17130
423 Ga0097620_100112201 3300006931 Bacteria 2789
424 Ga0075435_100219670 3300007076 Bacteria 1614
425 Ga0099794_10048714 3300007265 Bacteria 2034
426 Ga0099795_10000525 3300007788 Bacteria 7210
427 Ga0099795_10011044 3300007788 Bacteria 2682
428 Ga0105244_10014193 3300009036 Bacteria 4617
429 Ga0105244_10116398 3300009036 Bacteria 1297
430 Ga0105250_10039487 3300009092 Bacteria 1892
431 Ga0105240_10010466 3300009093 Bacteria 13036
432 Ga0105240_10014808 3300009093 Bacteria 10629
433 Ga0105240_10030349 3300009093 Bacteria 7026
434 Ga0105240_10031660 3300009093 Bacteria 6854
435 Ga0105240_10121886 3300009093 Bacteria 3139
436 Ga0105240_10331535 3300009093 Bacteria 1731
437 Ga0111539_10028072 3300009094 Bacteria 6871
438 Ga0111539_10059595 3300009094 Bacteria 4526
439 Ga0111539_10062101 3300009094 Bacteria 4424
440 Ga0111539_10069739 3300009094 Bacteria 4151
441 Ga0111539_10072021 3300009094 Bacteria 4077
442 Ga0111539_10091969 3300009094 Bacteria 3565
443 Ga0111539_10130516 3300009094 Bacteria 2942
444 Ga0111539_10153741 3300009094 Bacteria 2693
445 Ga0111539_10369179 3300009094 Bacteria 1670
446 Ga0105245_10020211 3300009098 Bacteria 5836
447 Ga0105245_10046360 3300009098 Bacteria 3884
448 Ga0105245_10064876 3300009098 Bacteria 3301
449 Ga0105245_10218523 3300009098 Bacteria 1838
450 Ga0105245_10317840 3300009098 Bacteria 1533
451 Ga0105247_10010893 3300009101 Bacteria 5493
452 Ga0105247_10148326 3300009101 Bacteria 1543
453 Ga0105247_10215435 3300009101 Bacteria 1297
454 Ga0114129_10011942 3300009147 Bacteria 12351
455 Ga0114129_10022955 3300009147 Bacteria 8851
456 Ga0114129_10061066 3300009147 Bacteria 5268
457 Ga0114129_10061685 3300009147 Bacteria 5240
458 Ga0114129_10102860 3300009147 Bacteria 3950
459 Ga0114129_10298861 3300009147 Bacteria 2146
460 Ga0114129_10480363 3300009147 Bacteria 1626
461 Ga0114129_11359643 3300009147 Bacteria 878
462 Ga0105243_10002331 3300009148 Bacteria 15887
463 Ga0105243_10007058 3300009148 Bacteria 8637
464 Ga0105243_10026946 3300009148 Bacteria 4401
465 Ga0105243_10063327 3300009148 Bacteria 2963
466 Ga0105241_10009508 3300009174 Bacteria 7140
467 Ga0105241_10386389 3300009174 Bacteria 1224
468 Ga0105242_10003922 3300009176 Bacteria 11559
469 Ga0105242_10057719 3300009176 Bacteria 3180
470 Ga0105242_10099932 3300009176 Bacteria 2456
471 Ga0105242_10447400 3300009176 Bacteria 1217
472 Ga0105248_10005206 3300009177 Bacteria 14330
473 Ga0105248_10017766 3300009177 Bacteria 7847
474 Ga0105248_10022900 3300009177 Bacteria 6936
475 Ga0105248_10045266 3300009177 Bacteria 4935
476 Ga0105248_10069700 3300009177 Bacteria 3948
477 Ga0105248_10115363 3300009177 Bacteria 3029
478 Ga0105248_10141427 3300009177 Bacteria 2715
479 Ga0105248_10161153 3300009177 Bacteria 2530
480 Ga0105248_10421495 3300009177 Bacteria 1503
481 Ga0105248_10510953 3300009177 Bacteria 1355
482 Ga0105248_11364523 3300009177 Bacteria 802
483 Ga0105237_10022783 3300009545 Bacteria 6426
484 Ga0105237_10082572 3300009545 Bacteria 3204
485 Ga0105237_10287832 3300009545 Bacteria 1646
486 Ga0105237_10317152 3300009545 Bacteria 1562
487 Ga0105238_10003490 3300009551 Bacteria 15647
488 Ga0105238_10010511 3300009551 Bacteria 9291
489 Ga0105238_10031634 3300009551 Bacteria 5387
490 Ga0105238_10038745 3300009551 Bacteria 4839
491 Ga0105238_10046908 3300009551 Bacteria 4357
492 Ga0105238_10416888 3300009551 Bacteria 1337
493 Ga0105249_10001113 3300009553 Bacteria 23889
494 Ga0105249_10003043 3300009553 Bacteria 14468
495 Ga0105249_10162864 3300009553 Bacteria 2157
496 Ga0105249_10239556 3300009553 Bacteria 1793
497 Ga0105239_10115907 3300010375 Bacteria 2972
498 Ga0105239_10118340 3300010375 Bacteria 2940
499 Ga0105239_10119880 3300010375 Bacteria 2920
500 Ga0105239_10199484 3300010375 Bacteria 2241
501 Ga0105239_10764368 3300010375 Bacteria 1106
502 Ga0105239_11202922 3300010375 Bacteria 873
503 Ga0105246_10018900 3300011119 Bacteria 4395
504 Ga0105246_10020051 3300011119 Bacteria 4285
505 Ga0105246_10089601 3300011119 Bacteria 2214
506 Ga0157373_10010428 3300013100 Bacteria 6835
507 Ga0157373_10010753 3300013100 Bacteria 6734
508 Ga0157373_10167222 3300013100 Bacteria 1548
509 Ga0157371_10023743 3300013102 Bacteria 4483
510 Ga0157371_10033215 3300013102 Bacteria 3708
511 Ga0157371_10072031 3300013102 Bacteria 2447
512 Ga0157371_10150202 3300013102 Bacteria 1661
513 Ga0157370_10002532 3300013104 Bacteria 21969
514 Ga0157370_10004330 3300013104 Bacteria 16316
515 Ga0157370_10015571 3300013104 Bacteria 7730
516 Ga0157370_10018623 3300013104 Bacteria 6980
517 Ga0157370_10026491 3300013104 Bacteria 5724
518 Ga0157370_10058461 3300013104 Bacteria 3665
519 Ga0157370_10168643 3300013104 Bacteria 2035
520 Ga0157369_10007438 3300013105 Bacteria 12612
521 Ga0157369_10032889 3300013105 Bacteria 5700
522 Ga0157369_10051814 3300013105 Bacteria 4442
523 Ga0157369_10061545 3300013105 Bacteria 4046
524 Ga0157369_10105059 3300013105 Bacteria 3007
525 Ga0157369_10143782 3300013105 Bacteria 2522
526 Ga0157369_10148788 3300013105 Bacteria 2475
527 Ga0157369_10219729 3300013105 Bacteria 1989
528 Ga0157374_10008130 3300013296 Bacteria 8965
529 Ga0157374_10008516 3300013296 Bacteria 8774
530 Ga0157374_10062647 3300013296 Bacteria 3487
531 Ga0157374_10126224 3300013296 Bacteria 2473
532 Ga0157374_10158265 3300013296 Bacteria 2206
533 Ga0157374_10227085 3300013296 Bacteria 1833
534 Ga0157374_10281164 3300013296 Bacteria 1643
535 Ga0157374_10363912 3300013296 Bacteria 1439
536 Ga0157378_10018792 3300013297 Bacteria 6077
537 Ga0157378_10033486 3300013297 Bacteria 4543
538 Ga0157378_10046583 3300013297 Bacteria 3854
539 Ga0157378_10070373 3300013297 Bacteria 3141
540 Ga0157378_10095877 3300013297 Bacteria 2702
541 Ga0157378_10281331 3300013297 Bacteria 1603
542 Ga0163162_10007822 3300013306 Bacteria 10420
543 Ga0163162_10034723 3300013306 Bacteria 5020
544 Ga0163162_10193449 3300013306 Bacteria 2162
545 Ga0163162_10195759 3300013306 Bacteria 2150
546 Ga0163162_10322882 3300013306 Bacteria 1676
547 Ga0163162_10335457 3300013306 Bacteria 1644
548 Ga0163162_10341367 3300013306 Bacteria 1630
549 Ga0163162_10354834 3300013306 Bacteria 1599
550 Ga0163162_10401034 3300013306 Bacteria 1504
551 Ga0157372_10003130 3300013307 Bacteria 17832
552 Ga0157372_10011420 3300013307 Bacteria 9446
553 Ga0157372_10012456 3300013307 Bacteria 9065
554 Ga0157372_10034622 3300013307 Bacteria 5554
555 Ga0157372_10051086 3300013307 Bacteria 4600
556 Ga0157372_10082396 3300013307 Bacteria 3642
557 Ga0157372_10103907 3300013307 Bacteria 3247
558 Ga0157372_10128120 3300013307 Bacteria 2919
559 Ga0157372_10240052 3300013307 Bacteria 2103
560 Ga0157372_10312514 3300013307 Bacteria 1829
561 Ga0157372_10333214 3300013307 Bacteria 1767
562 Ga0157372_10404621 3300013307 Bacteria 1590
563 Ga0157372_10545212 3300013307 Bacteria 1352
564 Ga0157375_10020474 3300013308 Bacteria 6044
565 Ga0157375_10181975 3300013308 Bacteria 2253
566 Ga0157375_10292498 3300013308 Bacteria 1792
567 Ga0157375_10428176 3300013308 Bacteria 1489
568 Ga0163163_10004818 3300014325 Bacteria 11591
569 Ga0163163_10007632 3300014325 Bacteria 9554
570 Ga0163163_10027715 3300014325 Bacteria 5431
571 Ga0163163_10054993 3300014325 Bacteria 3934
572 Ga0163163_10155272 3300014325 Bacteria 2333
573 Ga0163163_10490960 3300014325 Bacteria 1289
574 Ga0157380_10008406 3300014326 Bacteria 7365
575 Ga0157380_10037017 3300014326 Bacteria 3780
576 Ga0157380_10067001 3300014326 Bacteria 2889
577 Ga0157380_10455955 3300014326 Bacteria 1229
578 Ga0157377_10007033 3300014745 Bacteria 5405
579 Ga0157379_10007852 3300014968 Bacteria 9242
580 Ga0157379_10030891 3300014968 Bacteria 4771
581 Ga0157379_10061468 3300014968 Bacteria 3358
582 Ga0157379_10072004 3300014968 Bacteria 3092
583 Ga0157379_10326605 3300014968 Bacteria 1401
584 Ga0157376_10025325 3300014969 Bacteria 4672
585 Ga0157376_10028899 3300014969 Bacteria 4412
586 Ga0157376_10089349 3300014969 Bacteria 2664
587 Ga0157376_10439344 3300014969 Bacteria 1270
588 Ga0163161_10031958 3300017792 Bacteria 3754
589 Ga0163161_10117266 3300017792 Bacteria 1996
590 Ga0163161_10201015 3300017792 Bacteria 1536
591 Ga0163161_10216482 3300017792 Bacteria 1481
592 Ga0213872_10000279 3300021361 Bacteria 43537
593 Ga0213872_10000502 3300021361 Bacteria 31150
594 Ga0213872_10000712 3300021361 Bacteria 25019
595 Ga0213872_10002578 3300021361 Bacteria 10554
596 Ga0213872_10028105 3300021361 Bacteria 2580
597 Ga0213876_10232443 3300021384 Bacteria 980
598 Ga0228598_1037143 3300024227 Bacteria 961
599 Ga0209437_105260 3300025233 Bacteria 2212
600 Ga0209646_1000072 3300025246 Bacteria 224823
601 Ga0209148_1000386 3300025254 Bacteria 52794
602 Ga0209565_1023186 3300025263 Bacteria 1277
603 Ga0207666_1005781 3300025271 Bacteria 1587
604 Ga0209025_1000624 3300025294 Bacteria 62814
605 Ga0209025_1000929 3300025294 Bacteria 44729
606 Ga0209025_1060115 3300025294 Bacteria 1429
607 Ga0209564_1000007 3300025295 Bacteria 1028582
608 Ga0209564_1000072 3300025295 Bacteria 289331
609 Ga0209256_1000176 3300025299 Bacteria 126545
610 Ga0207697_10001389 3300025315 Bacteria 13262
611 Ga0207656_10005345 3300025321 Bacteria 4533
612 Ga0207656_10008756 3300025321 Bacteria 3740
613 Ga0207656_10015099 3300025321 Bacteria 2985
614 Ga0207656_10046627 3300025321 Bacteria 1860
615 Ga0207656_10238124 3300025321 Bacteria 889
616 Ga0207655_1016139 3300025728 Bacteria 4104
617 Ga0207682_10000199 3300025893 Bacteria 27325
618 Ga0207682_10108196 3300025893 Bacteria 1222
619 Ga0207692_10004390 3300025898 Bacteria 5583
620 Ga0207692_10057340 3300025898 Bacteria 2002
621 Ga0207692_10333781 3300025898 Bacteria 931
622 Ga0207642_10092999 3300025899 Bacteria 1494
623 Ga0207642_10152269 3300025899 Bacteria 1232
624 Ga0207710_10005521 3300025900 Bacteria 5441
625 Ga0207710_10021773 3300025900 Bacteria 2750
626 Ga0207688_10002037 3300025901 Bacteria 10853
627 Ga0207688_10002110 3300025901 Bacteria 10695
628 Ga0207688_10012316 3300025901 Bacteria 4655
629 Ga0207680_10002416 3300025903 Bacteria 8708
630 Ga0207680_10022090 3300025903 Bacteria 3455
631 Ga0207680_10026989 3300025903 Bacteria 3190
632 Ga0207680_10047487 3300025903 Bacteria 2544
633 Ga0207680_10133850 3300025903 Bacteria 1636
634 Ga0207680_10150519 3300025903 Bacteria 1551
635 Ga0207647_10018037 3300025904 Bacteria 4785
636 Ga0207647_10136734 3300025904 Bacteria 1438
637 Ga0207685_10003238 3300025905 Bacteria 3922
638 Ga0207685_10081428 3300025905 Bacteria 1340
639 Ga0207699_10022753 3300025906 Bacteria 3401
640 Ga0207699_10024177 3300025906 Bacteria 3318
641 Ga0207699_10053258 3300025906 Bacteria 2398
642 Ga0207699_10085922 3300025906 Bacteria 1963
643 Ga0207699_10095416 3300025906 Bacteria 1875
644 Ga0207699_10253341 3300025906 Bacteria 1214
645 Ga0207645_10015977 3300025907 Bacteria 4973
646 Ga0207645_10023307 3300025907 Bacteria 4024
647 Ga0207645_10026627 3300025907 Bacteria 3736
648 Ga0207645_10039569 3300025907 Bacteria 3021
649 Ga0207645_10055884 3300025907 Bacteria 2520
650 Ga0207645_10085880 3300025907 Bacteria 2021
651 Ga0207645_10243356 3300025907 Bacteria 1189
652 Ga0207645_10301151 3300025907 Bacteria 1067
653 Ga0207643_10000285 3300025908 Bacteria 35142
654 Ga0207643_10000872 3300025908 Bacteria 18178
655 Ga0207643_10013410 3300025908 Bacteria 4438
656 Ga0207643_10083901 3300025908 Bacteria 1849
657 Ga0207705_10030823 3300025909 Bacteria 3827
658 Ga0207705_10037392 3300025909 Bacteria 3474
659 Ga0207684_10006392 3300025910 Bacteria 10740
660 Ga0207684_10059972 3300025910 Bacteria 3231
661 Ga0207684_10073880 3300025910 Bacteria 2896
662 Ga0207684_10176364 3300025910 Bacteria 1842
663 Ga0207654_10097298 3300025911 Bacteria 1807
664 Ga0207707_10000993 3300025912 Bacteria 27228
665 Ga0207707_10007140 3300025912 Bacteria 9727
666 Ga0207707_10011673 3300025912 Bacteria 7647
667 Ga0207707_10012952 3300025912 Bacteria 7259
668 Ga0207707_10025294 3300025912 Bacteria 5194
669 Ga0207707_10026682 3300025912 Bacteria 5049
670 Ga0207707_10040679 3300025912 Bacteria 4060
671 Ga0207707_10162531 3300025912 Bacteria 1952
672 Ga0207695_10006493 3300025913 Bacteria 15155
673 Ga0207695_10040712 3300025913 Bacteria 4979
674 Ga0207695_10087600 3300025913 Bacteria 3136
675 Ga0207695_10213503 3300025913 Bacteria 1839
676 Ga0207695_10423272 3300025913 Bacteria 1216
677 Ga0207671_10195738 3300025914 Bacteria 1577
678 Ga0207671_10237712 3300025914 Bacteria 1430
679 Ga0207671_10349954 3300025914 Bacteria 1172
680 Ga0207693_10003527 3300025915 Bacteria 13355
681 Ga0207693_10014239 3300025915 Bacteria 6398
682 Ga0207693_10024667 3300025915 Bacteria 4769
683 Ga0207693_10292137 3300025915 Bacteria 1277
684 Ga0207693_10370698 3300025915 Bacteria 1120
685 Ga0207663_10015515 3300025916 Bacteria 4204
686 Ga0207663_10034041 3300025916 Bacteria 3042
687 Ga0207663_10170581 3300025916 Bacteria 1545
688 Ga0207660_10012309 3300025917 Bacteria 5594
689 Ga0207660_10045654 3300025917 Bacteria 3087
690 Ga0207660_10045893 3300025917 Bacteria 3081
691 Ga0207660_10074565 3300025917 Bacteria 2477
692 Ga0207660_10102775 3300025917 Bacteria 2137
693 Ga0207660_10166533 3300025917 Bacteria 1704
694 Ga0207660_10236524 3300025917 Bacteria 1438
695 Ga0207662_10000929 3300025918 Bacteria 13584
696 Ga0207662_10003667 3300025918 Bacteria 7955
697 Ga0207662_10096112 3300025918 Bacteria 1830
698 Ga0207657_10000882 3300025919 Bacteria 31708
699 Ga0207657_10002238 3300025919 Bacteria 20984
700 Ga0207657_10006109 3300025919 Bacteria 12522
701 Ga0207657_10014997 3300025919 Bacteria 7527
702 Ga0207657_10030389 3300025919 Bacteria 4904
703 Ga0207657_10051541 3300025919 Bacteria 3577
704 Ga0207649_10002511 3300025920 Bacteria 10231
705 Ga0207649_10006622 3300025920 Bacteria 6295
706 Ga0207649_10037866 3300025920 Bacteria 2916
707 Ga0207649_10063142 3300025920 Bacteria 2337
708 Ga0207649_10064299 3300025920 Bacteria 2319
709 Ga0207649_10089484 3300025920 Bacteria 2012
710 Ga0207649_10309828 3300025920 Bacteria 1157
711 Ga0207652_10006566 3300025921 Bacteria 9374
712 Ga0207652_10010460 3300025921 Bacteria 7468
713 Ga0207652_10019084 3300025921 Bacteria 5633
714 Ga0207652_10061698 3300025921 Bacteria 3238
715 Ga0207652_10079971 3300025921 Bacteria 2857
716 Ga0207652_10090872 3300025921 Bacteria 2684
717 Ga0207652_10111889 3300025921 Bacteria 2422
718 Ga0207646_10084014 3300025922 Bacteria 2848
719 Ga0207681_10001443 3300025923 Bacteria 15297
720 Ga0207681_10060289 3300025923 Bacteria 2604
721 Ga0207681_10256457 3300025923 Bacteria 1367
722 Ga0207694_10004100 3300025924 Bacteria 11458
723 Ga0207694_10007945 3300025924 Bacteria 8024
724 Ga0207694_10044084 3300025924 Bacteria 3444
725 Ga0207650_10000133 3300025925 Bacteria 90953
726 Ga0207650_10002222 3300025925 Bacteria 13558
727 Ga0207650_10006091 3300025925 Bacteria 8225
728 Ga0207650_10108529 3300025925 Bacteria 2145
729 Ga0207659_10001360 3300025926 Bacteria 14606
730 Ga0207659_10026579 3300025926 Bacteria 3906
731 Ga0207659_10146489 3300025926 Bacteria 1839
732 Ga0207659_10190888 3300025926 Bacteria 1630
733 Ga0207687_10015863 3300025927 Bacteria 4944
734 Ga0207687_10162814 3300025927 Bacteria 1714
735 Ga0207687_10248115 3300025927 Bacteria 1414
736 Ga0207700_10020365 3300025928 Bacteria 4504
737 Ga0207700_10050938 3300025928 Bacteria 3087
738 Ga0207700_10082293 3300025928 Bacteria 2517
739 Ga0207700_10112191 3300025928 Bacteria 2196
740 Ga0207700_10482378 3300025928 Bacteria 1096
741 Ga0207664_10001046 3300025929 Bacteria 18542
742 Ga0207664_10012686 3300025929 Bacteria 6031
743 Ga0207664_10050774 3300025929 Bacteria 3271
744 Ga0207664_10051133 3300025929 Bacteria 3261
745 Ga0207664_10059671 3300025929 Bacteria 3039
746 Ga0207664_10297437 3300025929 Bacteria 1419
747 Ga0207644_10003477 3300025931 Bacteria 10184
748 Ga0207644_10012046 3300025931 Bacteria 5734
749 Ga0207644_10018949 3300025931 Bacteria 4666
750 Ga0207644_10094661 3300025931 Bacteria 2232
751 Ga0207644_10111199 3300025931 Bacteria 2072
752 Ga0207644_10145787 3300025931 Bacteria 1827
753 Ga0207644_10515210 3300025931 Bacteria 988
754 Ga0207690_10005099 3300025932 Bacteria 7756
755 Ga0207690_10007295 3300025932 Bacteria 6565
756 Ga0207690_10013597 3300025932 Bacteria 4894
757 Ga0207690_10027060 3300025932 Bacteria 3621
758 Ga0207690_10046682 3300025932 Bacteria 2870
759 Ga0207690_10207707 3300025932 Bacteria 1491
760 Ga0207706_10000820 3300025933 Bacteria 32304
761 Ga0207706_10006344 3300025933 Bacteria 10985
762 Ga0207706_10006730 3300025933 Bacteria 10626
763 Ga0207706_10073712 3300025933 Bacteria 3002
764 Ga0207706_10152699 3300025933 Bacteria 2031
765 Ga0207706_10343471 3300025933 Bacteria 1298
766 Ga0207686_10016093 3300025934 Bacteria 4192
767 Ga0207709_10003308 3300025935 Bacteria 9661
768 Ga0207709_10024538 3300025935 Bacteria 3444
769 Ga0207709_10223798 3300025935 Bacteria 1359
770 Ga0207670_10002275 3300025936 Bacteria 10057
771 Ga0207670_10006012 3300025936 Bacteria 6707
772 Ga0207669_10003358 3300025937 Bacteria 6926
773 Ga0207669_10034055 3300025937 Bacteria 2882
774 Ga0207669_10049274 3300025937 Bacteria 2509
775 Ga0207669_10362329 3300025937 Bacteria 1124
776 Ga0207665_10001863 3300025939 Bacteria 14223
777 Ga0207665_10006295 3300025939 Bacteria 7873
778 Ga0207691_10017740 3300025940 Bacteria 6748
779 Ga0207691_10025399 3300025940 Bacteria 5563
780 Ga0207691_10035330 3300025940 Bacteria 4640
781 Ga0207691_10045423 3300025940 Bacteria 4038
782 Ga0207691_10049616 3300025940 Bacteria 3846
783 Ga0207711_10012247 3300025941 Bacteria 7131
784 Ga0207711_10029383 3300025941 Bacteria 4636
785 Ga0207711_10032690 3300025941 Bacteria 4399
786 Ga0207711_10075247 3300025941 Bacteria 2938
787 Ga0207711_10122103 3300025941 Bacteria 2327
788 Ga0207711_10340269 3300025941 Bacteria 1388
789 Ga0207711_10400896 3300025941 Bacteria 1275
790 Ga0207711_10411695 3300025941 Bacteria 1257
791 Ga0207711_10502108 3300025941 Bacteria 1131
792 Ga0207689_10000559 3300025942 Bacteria 35553
793 Ga0207689_10014667 3300025942 Bacteria 6655
794 Ga0207689_10044726 3300025942 Bacteria 3661
795 Ga0207689_10052332 3300025942 Bacteria 3365
796 Ga0207661_10028106 3300025944 Bacteria 4304
797 Ga0207661_10030482 3300025944 Bacteria 4155
798 Ga0207661_10034410 3300025944 Bacteria 3940
799 Ga0207661_10274424 3300025944 Bacteria 1505
800 Ga0207679_10003380 3300025945 Bacteria 9850
801 Ga0207679_10003681 3300025945 Bacteria 9500
802 Ga0207679_10010584 3300025945 Bacteria 5943
803 Ga0207679_10033072 3300025945 Bacteria 3637
804 Ga0207679_10064697 3300025945 Bacteria 2734
805 Ga0207667_10001841 3300025949 Bacteria 26629
806 Ga0207667_10063675 3300025949 Bacteria 3853
807 Ga0207667_10091854 3300025949 Bacteria 3136
808 Ga0207667_10277015 3300025949 Bacteria 1714
809 Ga0207667_10500891 3300025949 Bacteria 1232
810 Ga0207667_10557931 3300025949 Bacteria 1158
811 Ga0207667_10763780 3300025949 Bacteria 965
812 Ga0207651_10002984 3300025960 Bacteria 8189
813 Ga0207651_10117362 3300025960 Bacteria 2010
814 Ga0207651_10157406 3300025960 Bacteria 1777
815 Ga0207651_10237925 3300025960 Bacteria 1482
816 Ga0207651_10497188 3300025960 Bacteria 1054
817 Ga0207651_10731312 3300025960 Bacteria 874
818 Ga0207712_10000689 3300025961 Bacteria 26097
819 Ga0207712_10045875 3300025961 Bacteria 3028
820 Ga0207712_10132703 3300025961 Bacteria 1900
821 Ga0207712_10271093 3300025961 Bacteria 1381
822 Ga0207668_10000275 3300025972 Bacteria 34283
823 Ga0207668_10002130 3300025972 Bacteria 11550
824 Ga0207668_10018888 3300025972 Bacteria 4345
825 Ga0207668_10079489 3300025972 Bacteria 2372
826 Ga0207668_10141487 3300025972 Bacteria 1851
827 Ga0207668_10190862 3300025972 Bacteria 1623
828 Ga0207668_10271282 3300025972 Bacteria 1387
829 Ga0207668_10370634 3300025972 Bacteria 1202
830 Ga0207640_10038374 3300025981 Bacteria 3022
831 Ga0207640_10045477 3300025981 Bacteria 2819
832 Ga0207640_10049413 3300025981 Bacteria 2723
833 Ga0207640_10063362 3300025981 Bacteria 2456
834 Ga0207640_10483660 3300025981 Bacteria 1027
835 Ga0207658_10001145 3300025986 Bacteria 21251
836 Ga0207658_10020076 3300025986 Bacteria 4626
837 Ga0207658_10025067 3300025986 Bacteria 4174
838 Ga0207658_10025918 3300025986 Bacteria 4107
839 Ga0207658_10198488 3300025986 Bacteria 1673
840 Ga0207658_10553520 3300025986 Bacteria 1029
841 Ga0207677_10087500 3300026023 Bacteria 2256
842 Ga0207677_10090482 3300026023 Bacteria 2224
843 Ga0207677_10094049 3300026023 Bacteria 2187
844 Ga0207677_10164628 3300026023 Bacteria 1727
845 Ga0207677_10198376 3300026023 Bacteria 1593
846 Ga0207703_10002292 3300026035 Bacteria 16690
847 Ga0207703_10026290 3300026035 Bacteria 4580
848 Ga0207703_10097426 3300026035 Bacteria 2485
849 Ga0207703_10902203 3300026035 Bacteria 846
850 Ga0207703_10906624 3300026035 Bacteria 844
851 Ga0207639_10012698 3300026041 Bacteria 5874
852 Ga0207639_10030893 3300026041 Bacteria 3933
853 Ga0207639_10036924 3300026041 Bacteria 3625
854 Ga0207639_10048995 3300026041 Bacteria 3201
855 Ga0207639_10099833 3300026041 Bacteria 2343
856 Ga0207639_10132235 3300026041 Bacteria 2067
857 Ga0207639_10351348 3300026041 Bacteria 1317
858 Ga0207639_10796769 3300026041 Bacteria 880
859 Ga0207678_10001637 3300026067 Bacteria 20525
860 Ga0207678_10005238 3300026067 Bacteria 11614
861 Ga0207678_10020833 3300026067 Bacteria 5746
862 Ga0207678_10038735 3300026067 Bacteria 4140
863 Ga0207678_10073617 3300026067 Bacteria 2928
864 Ga0207678_10367688 3300026067 Bacteria 1242
865 Ga0207678_10421032 3300026067 Bacteria 1158
866 Ga0207678_10609596 3300026067 Bacteria 957
867 Ga0207708_10000560 3300026075 Bacteria 28691
868 Ga0207708_10003553 3300026075 Bacteria 11489
869 Ga0207708_10009000 3300026075 Bacteria 7390
870 Ga0207708_10060105 3300026075 Bacteria 2901
871 Ga0207702_10042978 3300026078 Bacteria 3792
872 Ga0207702_10050842 3300026078 Bacteria 3500
873 Ga0207702_10066459 3300026078 Bacteria 3091
874 Ga0207702_10340732 3300026078 Bacteria 1432
875 Ga0207702_10532124 3300026078 Bacteria 1148
876 Ga0207641_10001486 3300026088 Bacteria 22946
877 Ga0207641_10004884 3300026088 Bacteria 11534
878 Ga0207641_10266332 3300026088 Bacteria 1606
879 Ga0207641_10415295 3300026088 Bacteria 1294
880 Ga0207641_10838603 3300026088 Bacteria 911
881 Ga0207648_10001104 3300026089 Bacteria 30219
882 Ga0207648_10001209 3300026089 Bacteria 28896
883 Ga0207648_10026444 3300026089 Bacteria 5156
884 Ga0207648_10044844 3300026089 Bacteria 3880
885 Ga0207648_10088386 3300026089 Bacteria 2706
886 Ga0207648_10285860 3300026089 Bacteria 1476
887 Ga0207648_10426945 3300026089 Bacteria 1204
888 Ga0207676_10002421 3300026095 Bacteria 13294
889 Ga0207676_10005547 3300026095 Bacteria 8928
890 Ga0207676_10007903 3300026095 Bacteria 7566
891 Ga0207676_10096057 3300026095 Bacteria 2445
892 Ga0207676_10714313 3300026095 Bacteria 972
893 Ga0207676_10718003 3300026095 Bacteria 970
894 Ga0207674_10000089 3300026116 Bacteria 99911
895 Ga0207674_10002196 3300026116 Bacteria 24709
896 Ga0207674_10004693 3300026116 Bacteria 16399
897 Ga0207674_10004995 3300026116 Bacteria 15857
898 Ga0207674_10010018 3300026116 Bacteria 10784
899 Ga0207674_10132705 3300026116 Bacteria 2453
900 Ga0207674_10190171 3300026116 Bacteria 2003
901 Ga0207674_10287779 3300026116 Bacteria 1592
902 Ga0207675_100000047 3300026118 Bacteria 85113
903 Ga0207675_100000376 3300026118 Bacteria 42834
904 Ga0207675_100001008 3300026118 Bacteria 27852
905 Ga0207675_100059299 3300026118 Bacteria 3571
906 Ga0207675_100125288 3300026118 Bacteria 2433
907 Ga0207675_100547266 3300026118 Bacteria 1156
908 Ga0207683_10000127 3300026121 Bacteria 62271
909 Ga0207683_10007701 3300026121 Bacteria 9225
910 Ga0207683_10016793 3300026121 Bacteria 6230
911 Ga0207683_10019753 3300026121 Bacteria 5755
912 Ga0207683_10064796 3300026121 Bacteria 3221
913 Ga0207698_10008357 3300026142 Bacteria 6541
914 Ga0207698_10031784 3300026142 Bacteria 3815
915 Ga0207698_10042815 3300026142 Bacteria 3387
916 Ga0207698_10045785 3300026142 Bacteria 3298
917 Ga0207698_10099036 3300026142 Bacteria 2410
918 Ga0207698_10153243 3300026142 Bacteria 2004
919 Ga0209995_1012932 3300027471 Bacteria 1365
920 Ga0209983_1005434 3300027665 Bacteria 2638
921 Ga0209971_1001127 3300027682 Bacteria 6774
922 Ga0207428_10012008 3300027907 Bacteria 7623
923 Ga0207428_10070875 3300027907 Bacteria 2739
924 Ga0207428_10113181 3300027907 Bacteria 2086
925 Ga0207428_10132546 3300027907 Bacteria 1906
926 Ga0207428_10170995 3300027907 Bacteria 1646
927 Ga0207428_10518449 3300027907 Bacteria 864
928 Ga0268266_10006847 3300028379 Bacteria 10381
929 Ga0268266_10028221 3300028379 Bacteria 4771
930 Ga0268266_10038608 3300028379 Bacteria 4065
931 Ga0268265_10000728 3300028380 Bacteria 32178
932 Ga0268265_10004940 3300028380 Bacteria 9166
933 Ga0268265_10045406 3300028380 Bacteria 3278
934 Ga0268265_10126967 3300028380 Bacteria 2112
935 Ga0268265_10730613 3300028380 Bacteria 959
936 Ga0268264_10000358 3300028381 Bacteria 68359
937 Ga0268264_10042905 3300028381 Bacteria 3746
938 Ga0268264_10165288 3300028381 Bacteria 1997
939 Ga0265328_10009096 3300031239 Bacteria 4057
940 Ga0265339_10016519 3300031249 Bacteria 4397
941 Ga0265331_10000002 3300031250 Bacteria 511481
942 Ga0265331_10000355 3300031250 Bacteria 48482
943 Ga0265327_10000033 3300031251 Bacteria 317182
944 Ga0265316_10021653 3300031344 Bacteria 5439
945 Ga0265314_10003660 3300031711 Bacteria 14746
946 Ga0307516_10145603 3300031730 Bacteria 2135
947 Ga0307413_10237381 3300031824 Bacteria 1343
948 Ga0307412_10026142 3300031911 Bacteria 3625
949 Ga0307414_10161608 3300032004 Bacteria 1780
950 Ga0373929_0007593 3300035085 Bacteria 1983
951 Ga0373929_0040769 3300035085 Bacteria 1030
952 Ga0373934_0000639 3300035086 Bacteria 12380
953 Ga0373940_0009937 3300035088 Bacteria 2225
954 Ga0373952_0041093 3300035092 Bacteria 1069
955 Ga0373923_0050607 3300035111 Bacteria 1741
956 Ga0373923_0097413 3300035111 Bacteria 1294
957 Ga0373932_0011564 3300035112 Bacteria 2159
958 Ga0373939_0045629 3300035114 Bacteria 1338
959 Ga0373941_0063328 3300035115 Bacteria 1209
960 Ga0373953_0073359 3300035117 Bacteria 1415
961 Ga0373954_0025888 3300035118 Bacteria 2686
962 Ga0373956_0000135 3300035119 Bacteria 26321
963 Ga0373957_0000933 3300035120 Bacteria 7664
964 Ga0373960_0014938 3300035121 Bacteria 1975
965 Ga0373960_0021024 3300035121 Bacteria 1731
966 Ga0373955_0023281 3300035172 Bacteria 3153
967 Ga0373955_0259703 3300035172 Bacteria 1043
968 Ga0373962_0005595 3300035242 Bacteria 3035
969 Ga0373931_0004770 3300035691 Bacteria 6219
970 Ga0373931_0007171 3300035691 Bacteria 5243
971 Ga0373931_0016109 3300035691 Bacteria 3675
972 Ga0373931_0189881 3300035691 Bacteria 1222
973 Ga0373935_0140496 3300035692 Bacteria 1631
974 Ga0373927_0218147 3300035695 Bacteria 1253
975 Ga0373927_0336775 3300035695 Bacteria 994
976 Ga0373933_0000813 3300035724 Bacteria 19033
977 Ga0373947_0112483 3300035725 Bacteria 1722
978 Ga0373937_0004329 3300036401 Bacteria 12048
979 Ga0373937_0023186 3300036401 Bacteria 5588
980 Ga0373925_0031236 3300037068 Bacteria 3913
981 Ga0373925_0087309 3300037068 Bacteria 2381
982 Ga0395899_0007777 3300037312 Bacteria 8266
983 Ga0395900_0010652 3300037418 Bacteria 9404
984 Ga0395900_0019699 3300037418 Bacteria 6877
985 Ga0395898_0462143 3300037466 Bacteria 1208
986 Ga0395905_0000086 3300037471 Bacteria 153641
987 Ga0395905_0004236 3300037471 Bacteria 14996
988 Ga0395905_0112475 3300037471 Bacteria 2557
989 Ga0395901_0007491 3300038443 Bacteria 11024
990 Ga0395901_0079508 3300038443 Bacteria 3424
991 Ga0395901_0209231 3300038443 Bacteria 2042
992 Ga0395901_0415128 3300038443 Bacteria 1381
993 Ga0242420_009807 3300038996 Bacteria 1579
994 Ga0436360_0220478 3300039438 Bacteria 1158
995 Ga0436361_0032090 3300039447 Bacteria 10247
996 Ga0436361_0421236 3300039447 Bacteria 851
997 Ga0436361_0530365 3300039447 Bacteria 62073
998 Ga0436361_0579013 3300039447 Bacteria 26383
999 Ga0436361_0972320 3300039447 Bacteria 18071
1000 Ga0436361_1044948 3300039447 Bacteria 4449
1001 Ga0436363_1091328 3300039450 Bacteria 1041
1002 Ga0436363_1403698 3300039450 Bacteria 987
1003 Ga0436362_0201408 3300039453 Bacteria 1174
1004 Ga0436362_0326174 3300039453 Bacteria 850
1005 Ga0439465_0001164 3300041413 Bacteria 8448
1006 Ga0451847_0461108 3300041503 Bacteria 1307
1007 Ga0451577_0097984 3300042876 Bacteria 2619
1008 Ga0466968_0074670 3300044735 Bacteria 1481
1009 Ga0451576_0025457 3300045051 Bacteria 6374
1010 Ga0451576_0104326 3300045051 Bacteria 2949
1011 Ga0495590_0000006 3300046457 Bacteria 372949
1012 Ga0495629_0054326 3300046459 Bacteria 2801
1013 Ga0495629_0096585 3300046459 Bacteria 2061
1014 Ga0495638_0000333 3300046460 Bacteria 59483
1015 Ga0495651_0000274 3300046462 Bacteria 40100
1016 Ga0495650_0000194 3300046471 Bacteria 131682
1017 Ga0495650_0008058 3300046471 Bacteria 6220
1018 Ga0495580_0033707 3300046472 Bacteria 3688
1019 Ga0495580_0036032 3300046472 Bacteria 3555
1020 Ga0495580_0072639 3300046472 Bacteria 2402
1021 Ga0495662_0110605 3300046476 Bacteria 1347
1022 Ga0495584_0073030 3300046491 Bacteria 1724
1023 Ga0495584_0095625 3300046491 Bacteria 1500
1024 Ga0495585_0112778 3300046492 Bacteria 1444
1025 Ga0495607_0001831 3300046501 Bacteria 18117
1026 Ga0495583_0000475 3300046506 Bacteria 58746
1027 Ga0495606_0013329 3300046507 Bacteria 6507
1028 Ga0495606_0269849 3300046507 Bacteria 935
1029 Ga0495616_0088407 3300046513 Bacteria 1471
1030 Ga0495618_0128240 3300046514 Bacteria 1624
1031 Ga0495620_0065924 3300046515 Bacteria 1493
1032 Ga0495643_0000358 3300046522 Bacteria 62194
1033 Ga0495648_0000054 3300046524 Bacteria 159674
1034 Ga0495666_0011471 3300046526 Bacteria 4418
1035 Ga0495642_0009074 3300046528 Bacteria 3807
1036 Ga0495642_0122436 3300046528 Bacteria 1116
1037 Ga0495642_0178150 3300046528 Bacteria 925
1038 Ga0495621_0054737 3300046539 Bacteria 1435
1039 Ga0495621_0105795 3300046539 Bacteria 1075
1040 Ga0495621_0128057 3300046539 Bacteria 986
1041 Ga0495597_0000191 3300046542 Bacteria 55786
1042 Ga0495622_0000038 3300046557 Bacteria 119397
1043 Ga0495633_0001301 3300046558 Bacteria 19710
1044 Ga0495633_0089268 3300046558 Bacteria 1433
1045 Ga0495656_0076154 3300046615 Bacteria 1503
1046 Ga0495668_0001151 3300046616 Bacteria 27068
1047 Ga0495668_0002784 3300046616 Bacteria 13927
1048 Ga0495625_0000436 3300046660 Bacteria 62756
1049 Ga0495625_0000558 3300046660 Bacteria 54572
1050 Ga0495657_0022641 3300046675 Bacteria 4498
1051 Ga0495647_0038760 3300046681 Bacteria 1803
1052 Ga0495669_0088311 3300046684 Bacteria 1429
1053 Ga0495669_0109852 3300046684 Bacteria 1287
1054 Ga0495670_0062773 3300046691 Bacteria 1870
1055 Ga0495649_0172884 3300046694 Bacteria 1130
1056 Ga0495600_0255963 3300046809 Bacteria 1113
1057 Ga0495581_0157408 3300047315 Bacteria 1328
1058 Ga0495604_0050123 3300047317 Bacteria 3242
1059 Ga0495674_0267585 3300047319 Bacteria 1403
1060 Ga0495672_0250784 3300047320 Bacteria 859
1061 Ga0495676_0226328 3300047321 Bacteria 1286
1062 Ga0495680_0076772 3300047322 Bacteria 2532
1063 Ga0495683_0213944 3300047323 Bacteria 863
1064 Ga0495687_001334 3300047443 Bacteria 23017
1065 Ga0495687_004548 3300047443 Bacteria 9302
1066 Ga0495684_0144589 3300047471 Bacteria 1782
1067 Ga0495686_0270025 3300047472 Bacteria 949
1068 Ga0495593_0197086 3300047673 Bacteria 1012
1069 Ga0495614_0038867 3300048089 Bacteria 2043
1070 Ga0495614_0058997 3300048089 Bacteria 1648
1071 Ga0496100_0022383 3300048903 Bacteria 3824
1072 Ga0496100_0242447 3300048903 Bacteria 1330
1073 Ga0496101_0023566 3300048904 Bacteria 4254
1074 Ga0496101_0061606 3300048904 Bacteria 2725
1075 Ga0496101_0114106 3300048904 Bacteria 2037
1076 Ga0496101_0138658 3300048904 Bacteria 1852
1077 Ga0496101_0155871 3300048904 Bacteria 1749
1078 Ga0496101_0449248 3300048904 Bacteria 1017
1079 Ga0496101_0679824 3300048904 Bacteria 813
1080 Ga0496102_0012224 3300048905 Bacteria 7423
1081 Ga0496102_0032411 3300048905 Bacteria 4693
1082 Ga0496102_0034017 3300048905 Bacteria 4583
1083 Ga0496102_0034379 3300048905 Bacteria 4558
1084 Ga0496102_0137229 3300048905 Bacteria 2292
1085 Ga0496102_0411198 3300048905 Bacteria 1271
1086 Ga0496103_0004445 3300048906 Bacteria 8503
1087 Ga0496103_0024209 3300048906 Bacteria 3662
1088 Ga0496103_0027729 3300048906 Bacteria 3434
1089 Ga0496103_0058180 3300048906 Bacteria 2401
1090 Ga0496103_0064765 3300048906 Bacteria 2279
1091 Ga0496103_0072089 3300048906 Bacteria 2163
1092 Ga0496103_0263325 3300048906 Bacteria 1109
1093 Ga0496104_0003625 3300048907 Bacteria 13338
1094 Ga0496104_0003891 3300048907 Bacteria 12924
1095 Ga0496104_0049441 3300048907 Bacteria 3965
1096 Ga0496104_0296340 3300048907 Bacteria 1530
1097 Ga0496104_0414017 3300048907 Bacteria 1260
1098 Ga0496104_0674134 3300048907 Bacteria 942
1099 Ga0496105_0001322 3300048908 Bacteria 17343
1100 Ga0496105_0023569 3300048908 Bacteria 4993
1101 Ga0496105_0036542 3300048908 Bacteria 4046
1102 Ga0496105_0220084 3300048908 Bacteria 1546
1103 Ga0496105_0324557 3300048908 Bacteria 1233
1104 Ga0496106_0021775 3300048909 Bacteria 4760
1105 Ga0496106_0079115 3300048909 Bacteria 2524
1106 Ga0496106_0113686 3300048909 Bacteria 2110
1107 Ga0496106_0178145 3300048909 Bacteria 1687
1108 Ga0496107_0002458 3300048910 Bacteria 12020
1109 Ga0496107_0029338 3300048910 Bacteria 3913
1110 Ga0496107_0037478 3300048910 Bacteria 3479
1111 Ga0496107_0054627 3300048910 Bacteria 2882
1112 Ga0496107_0376757 3300048910 Bacteria 1056
1113 Ga0496108_0002238 3300048911 Bacteria 15499
1114 Ga0496108_0069736 3300048911 Bacteria 2966
1115 Ga0496108_0395200 3300048911 Bacteria 1207
1116 Ga0496109_0002809 3300048912 Bacteria 14583
1117 Ga0496109_0006173 3300048912 Bacteria 10068
1118 Ga0496109_0015267 3300048912 Bacteria 6687
1119 Ga0496109_0031863 3300048912 Bacteria 4735
1120 Ga0496109_0043237 3300048912 Bacteria 4083
1121 Ga0496109_0136861 3300048912 Bacteria 2289
1122 Ga0496109_0298500 3300048912 Bacteria 1519
1123 Ga0496109_0453695 3300048912 Bacteria 1211
1124 Ga0496110_0024038 3300048913 Bacteria 5191
1125 Ga0496110_0024415 3300048913 Bacteria 5152
1126 Ga0496110_0030989 3300048913 Bacteria 4612
1127 Ga0496110_0037915 3300048913 Bacteria 4191
1128 Ga0496110_0065317 3300048913 Bacteria 3216
1129 Ga0496110_0226002 3300048913 Bacteria 1702
1130 Ga0496110_0283722 3300048913 Bacteria 1508
1131 Ga0496110_0292335 3300048913 Bacteria 1484
1132 Ga0496111_0017001 3300048914 Bacteria 5021
1133 Ga0496111_0036092 3300048914 Bacteria 3534
1134 Ga0496111_0038968 3300048914 Bacteria 3405
1135 Ga0496111_0124351 3300048914 Bacteria 1906
1136 Ga0496111_0137848 3300048914 Bacteria 1808
1137 Ga0496112_0033514 3300048915 Bacteria 4993
1138 Ga0496112_0047020 3300048915 Bacteria 4233
1139 Ga0496112_0128607 3300048915 Bacteria 2503
1140 Ga0496112_0145141 3300048915 Bacteria 2341
1141 Ga0496112_0214935 3300048915 Bacteria 1879
1142 Ga0496113_0001266 3300048916 Bacteria 13932
1143 Ga0496113_0059870 3300048916 Bacteria 2869
1144 Ga0496113_0152766 3300048916 Bacteria 1822
1145 Ga0496114_0018456 3300048917 Bacteria 5639
1146 Ga0496114_0360228 3300048917 Bacteria 1286
1147 Ga0496115_0022583 3300048918 Bacteria 4877
1148 Ga0496117_0002582 3300048920 Bacteria 22541
1149 Ga0496118_0002912 3300048921 Bacteria 22251
1150 Ga0496118_0138530 3300048921 Bacteria 1548
1151 Ga0496121_0001731 3300048924 Bacteria 35624
1152 Ga0496121_0020294 3300048924 Bacteria 6587
1153 Ga0496124_0000315 3300048927 Bacteria 89492
1154 Ga0496124_0051010 3300048927 Bacteria 3522
1155 Ga0496125_0007726 3300048928 Bacteria 11390
1156 Ga0496125_0100672 3300048928 Bacteria 2129
1157 Ga0495678_003848 3300049459 Bacteria 9024
1158 Ga0495678_005316 3300049459 Bacteria 7144
1159 Ga0501034_0002928 3300049571 Bacteria 19795
1160 Ga0501034_0090019 3300049571 Bacteria 3067
1161 Ga0501036_0141693 3300049572 Bacteria 2028
1162 Ga0501046_0001880 3300049580 Bacteria 19972
1163 Ga0501046_0031358 3300049580 Bacteria 4309
1164 Ga0501047_0047668 3300049581 Bacteria 4139
1165 Ga0501047_0169371 3300049581 Bacteria 2053
1166 Ga0501067_0010788 3300049583 Bacteria 5053
1167 Ga0501067_0094672 3300049583 Bacteria 1658
1168 Ga0501067_0167473 3300049583 Bacteria 1224
1169 Ga0501068_0034944 3300049584 Bacteria 2999
1170 Ga0501068_0195709 3300049584 Bacteria 1282
1171 Ga0501070_0274753 3300049586 Bacteria 1375
1172 Ga0501073_0076383 3300049589 Bacteria 2331
1173 Ga0501250_007422 3300049680 Bacteria 1184
1174 Ga0501079_0369281 3300049741 Bacteria 1125
1175 Ga0501080_0201871 3300049742 Bacteria 1825
1176 Ga0501081_0112261 3300049743 Bacteria 1935
1177 Ga0501083_0024996 3300049744 Bacteria 4137
1178 Ga0501083_0050819 3300049744 Bacteria 2789
1179 Ga0501044_0199410 3300049823 Bacteria 1960
1180 Ga0501044_0599599 3300049823 Bacteria 995
1181 nmdc:mga03683_83289_c1 3300050489 Bacteria 1384
1182 nmdc:mga00v17_75055_c1 3300050491 Bacteria 2102
1183 nmdc:mga0yw44_25520_c1 3300050492 Bacteria 3362
1184 nmdc:mga0yw44_30075_c1 3300050492 Bacteria 3143
1185 nmdc:mga0yw44_62260_c1 3300050492 Bacteria 2291
1186 nmdc:mga0k408_91021_c1 3300050493 Bacteria 1792
1187 nmdc:mga06z11_166450_c1 3300050494 Bacteria 1263
1188 nmdc:mga06z11_223427_c1 3300050494 Bacteria 1101
1189 nmdc:mga06z11_43777_c1 3300050494 Bacteria 2254
1190 nmdc:mga07m45_238953_c1 3300050496 Bacteria 1057
1191 nmdc:mga07m45_291084_c1 3300050496 Bacteria 950
1192 nmdc:mga05p37_1011036_c1 3300050507 Bacteria 882
1193 nmdc:mga05p37_25897_c1 3300050507 Bacteria 7131
1194 nmdc:mga05p37_44460_c1 3300050507 Bacteria 5464
1195 nmdc:mga05p37_565804_c1 3300050507 Bacteria 1291
1196 nmdc:mga05p37_96346_c1 3300050507 Bacteria 3645
1197 nmdc:mga09592_128149_c1 3300050508 Bacteria 2182
1198 nmdc:mga0qj67_15707_c1 3300050509 Bacteria 5735
1199 nmdc:mga0qj67_256687_c1 3300050509 Bacteria 1418
1200 nmdc:mga0qj67_42590_c1 3300050509 Bacteria 3574
1201 nmdc:mga0qj67_48788_c1 3300050509 Bacteria 3345
1202 nmdc:mga06r32_139724_c1 3300050510 Bacteria 2398
1203 nmdc:mga06r32_173683_c1 3300050510 Bacteria 2139
1204 nmdc:mga06r32_219085_c1 3300050510 Bacteria 1891
1205 nmdc:mga06r32_25454_c1 3300050510 Bacteria 4782
1206 nmdc:mga06r32_30438_c1 3300050510 Bacteria 5064
1207 nmdc:mga06r32_73504_c1 3300050510 Bacteria 3312
1208 nmdc:mga08y16_140040_c1 3300050511 Bacteria 2515
1209 nmdc:mga08y16_147138_c1 3300050511 Bacteria 2449
1210 nmdc:mga08y16_152775_c1 3300050511 Bacteria 2399
1211 nmdc:mga08y16_239051_c1 3300050511 Bacteria 1878
1212 nmdc:mga08y16_276208_c1 3300050511 Bacteria 1734
1213 nmdc:mga08y16_286908_c1 3300050511 Bacteria 1697
1214 nmdc:mga08y16_375153_c1 3300050511 Bacteria 1459
1215 nmdc:mga08y16_672347_c1 3300050511 Bacteria 1038
1216 nmdc:mga08y16_68397_c1 3300050511 Bacteria 3703
1217 nmdc:mga08y16_84713_c1 3300050511 Bacteria 3304
1218 nmdc:mga0n895_116657_c1 3300050512 Bacteria 2689
1219 nmdc:mga0n895_182762_c1 3300050512 Bacteria 2128
1220 nmdc:mga0n895_219747_c1 3300050512 Bacteria 1929
1221 nmdc:mga0n895_232339_c1 3300050512 Bacteria 1872
1222 nmdc:mga0n895_39655_c1 3300050512 Bacteria 4571
1223 nmdc:mga0n895_64693_c1 3300050512 Bacteria 3618
1224 nmdc:mga0n895_94644_c1 3300050512 Bacteria 2991
1225 nmdc:mga0rr50_185515_c1 3300050513 Bacteria 1702
1226 nmdc:mga0rr50_307731_c1 3300050513 Bacteria 1327
1227 nmdc:mga0rr50_367324_c1 3300050513 Bacteria 1212
1228 nmdc:mga08x19_109026_c1 3300050514 Bacteria 1845
1229 nmdc:mga08x19_310542_c1 3300050514 Bacteria 1096
1230 nmdc:mga08x19_60991_c1 3300050514 Bacteria 2444
1231 nmdc:mga0a205_2299_c1 3300050515 Bacteria 16862
1232 nmdc:mga0a205_2472_c1 3300050515 Bacteria 16291
1233 nmdc:mga0a205_256485_c1 3300050515 Bacteria 1627
1234 nmdc:mga0a205_61465_c1 3300050515 Bacteria 3629
1235 Ga0495601_0300039 3300053077 Bacteria 1046
1236 Ga0495655_0000902 3300053083 Bacteria 4633
1237 Ga0495655_0020756 3300053083 Bacteria 1478
1238 Ga0495655_0038608 3300053083 Bacteria 1206
1239 Ga0495619_0129091 3300053085 Bacteria 1736
1240 Ga0495619_0294433 3300053085 Bacteria 1124
1241 Ga0500647_0099467 3300053091 Bacteria 1389
1242 Ga0500618_015233 3300053125 Bacteria 1946
1243 Ga0500590_004048 3300053148 Bacteria 6864
1244 Ga0500590_011367 3300053148 Bacteria 4507
1245 Ga0500619_000121 3300053154 Bacteria 20412
1246 Ga0501084_0091452 3300054114 Bacteria 2555
1247 Ga0501084_0185728 3300054114 Bacteria 1755
1248 Ga0501082_0042293 3300060353 Bacteria 3928
1249 Ga0501082_0501645 3300060353 Bacteria 1061
1250 Ga0501082_0606628 3300060353 Bacteria 958
1251 Ga0530510_0108414 3300061734 Bacteria 2033
1252 2513598224 2513237088 Bacteria 6927906
1253 2515646586 2515154114 Bacteria 7848616
1254 2585165055 2582581283 Bacteria 6030556
1255 2770195882 2767802442 Bacteria 5747986
1256 2776269411 2775506902 Bacteria 6208009
1257 2776282341 2775506904 Bacteria 5954060
1258 2953996336 2953994433 Bacteria 4303959
1259 8024488839 8024486573 Bacteria 6540512
1260 8046774800 8046767195 Bacteria 7547379
1261 Ga0373937_0087549
1262 JGI24737J22298_10029246
1263 JGI24743J22301_10009131
1264 JGI24750J21931_1005805
1265 JGI24750J21931_1008019
1266 JGI24750J21931_1008042
1267 JGI24738J21930_10009674
1268 JGI24749J21850_1009644
1269 JGI24751J29686_10007247
1270 JGI25151J46595_10001896
1271 JGI25151J46595_10008596
1272 JGI25406J46586_10035972
1273 Ga0006777J48905_1052058
1274 rootL2_10000128
1275 rootL2_10096177
1276 Ga0007417J51691_1018296
1277 Ga0007409J51694_1042546
1278 Ga0007416J51690_1027846
1279 Ga0007429J51699_1048980
1280 Ga0032354_1014430
1281 Ga0055526_1000050
1282 Ga0055526_1000439
1283 Ga0055526_1003172
1284 Ga0055524_1002528
1285 JGI25405J52794_10002173
1286 JGI25405J52794_10026052
1287 Ga0065165_1000074
1288 Ga0070658_10004584
1289 Ga0070658_10018021
1290 Ga0070658_10097543
1291 Ga0070658_10244094
1292 Ga0070676_10010057
1293 Ga0070683_100023208
1294 Ga0070683_100023385
1295 Ga0070683_100083307
1296 Ga0070683_100098650
1297 Ga0070683_100332799
1298 Ga0070690_100000674
1299 Ga0070670_100000050
1300 Ga0070670_100004483
1301 Ga0070670_100008183
1302 Ga0070670_100013048
1303 Ga0070670_100017710
1304 Ga0070670_100041018
1305 Ga0070670_100052202
1306 Ga0070670_100067683
1307 Ga0070670_100093329
1308 Ga0070670_100134931
1309 Ga0070670_100274822
1310 Ga0070677_10025236
1311 Ga0068869_100029810
1312 Ga0068869_100136013
1313 Ga0068869_100165283
1314 Ga0070666_10006295
1315 Ga0070666_10039156
1316 Ga0070666_10068767
1317 Ga0070666_10109250
1318 Ga0070680_100001629
1319 Ga0070680_100008891
1320 Ga0070680_100060995
1321 Ga0070680_100089522
1322 Ga0070680_100192066
1323 Ga0070682_100010513
1324 Ga0068868_100011665
1325 Ga0068868_100019088
1326 Ga0068868_100060114
1327 Ga0068868_100086216
1328 Ga0068868_100180189
1329 Ga0068868_100212160
1330 Ga0068868_100550762
1331 Ga0070660_100001625
1332 Ga0070660_100020185
1333 Ga0070660_100040098
1334 Ga0070660_100046364
1335 Ga0070689_100002174
1336 Ga0070689_100010550
1337 Ga0070689_100020981
1338 Ga0070689_100049384
1339 Ga0070691_10003094
1340 Ga0070691_10047334
1341 Ga0070691_10133501
1342 Ga0070687_100006156
1343 Ga0070687_100063831
1344 Ga0070661_100002772
1345 Ga0070661_100003649
1346 Ga0070661_100007395
1347 Ga0070661_100033514
1348 Ga0070661_100057987
1349 Ga0070661_100059977
1350 Ga0070661_100203485
1351 Ga0070661_100224573
1352 Ga0070692_10008674
1353 Ga0070692_10010322
1354 Ga0070692_10051666
1355 Ga0070668_100000170
1356 Ga0070668_100002125
1357 Ga0070668_100002930
1358 Ga0070668_100047493
1359 Ga0070668_100322886
1360 Ga0070669_100000639
1361 Ga0070669_100012580
1362 Ga0070669_100044328
1363 Ga0070669_100151400
1364 Ga0070669_100267038
1365 Ga0070675_100003246
1366 Ga0070675_100007594
1367 Ga0070671_100005745
1368 Ga0070671_100021914
1369 Ga0070671_100099596
1370 Ga0070671_100153362
1371 Ga0070671_100413862
1372 Ga0070671_100647719
1373 Ga0070674_100021328
1374 Ga0070674_100209971
1375 Ga0070673_100004666
1376 Ga0070673_100005099
1377 Ga0070673_100231922
1378 Ga0070673_100300015
1379 Ga0070688_100002832
1380 Ga0070688_100011717
1381 Ga0070688_100037833
1382 Ga0070688_100045737
1383 Ga0070659_100003380
1384 Ga0070659_100007453
1385 Ga0070659_100016214
1386 Ga0070659_100215789
1387 Ga0070659_100312134
1388 Ga0070667_100000140
1389 Ga0070667_100014818
1390 Ga0070667_100026157
1391 Ga0070667_100030395
1392 Ga0070667_100030963
1393 Ga0070667_100246802
1394 Ga0070667_100895894
1395 Ga0070703_10054540
1396 Ga0070709_10016563
1397 Ga0070709_10017181
1398 Ga0070709_10027512
1399 Ga0070709_10073009
1400 Ga0070709_10106075
1401 Ga0070709_10151503
1402 Ga0070709_10174783
1403 Ga0070709_10215047
1404 Ga0070714_100004937
1405 Ga0070714_100024261
1406 Ga0070714_100027101
1407 Ga0070714_100032871
1408 Ga0070714_100296655
1409 Ga0070713_100012591
1410 Ga0070713_100023687
1411 Ga0070713_100031008
1412 Ga0070713_100037308
1413 Ga0070713_100313215
1414 Ga0070713_100456962
1415 Ga0070710_10005027
1416 Ga0070710_10034977
1417 Ga0070710_10244384
1418 Ga0070701_10003125
1419 Ga0070701_10032813
1420 Ga0070701_10122802
1421 Ga0070711_100013174
1422 Ga0070711_100023693
1423 Ga0070711_100054396
1424 Ga0070711_100189243
1425 Ga0070711_100226113
1426 Ga0070711_100443941
1427 Ga0070705_100004755
1428 Ga0070705_100032090
1429 Ga0070700_100002078
1430 Ga0070700_100002787
1431 Ga0070700_100026410
1432 Ga0070700_100033480
1433 Ga0070700_100131650
1434 Ga0070694_100000595
1435 Ga0070694_100027641
1436 Ga0070694_100087105
1437 Ga0070694_100188789
1438 Ga0070708_100024240
1439 Ga0070708_100166060
1440 Ga0070708_100419318
1441 Ga0070663_100003107
1442 Ga0070663_100015857
1443 Ga0070663_100067574
1444 Ga0070663_100106613
1445 Ga0070663_100116672
1446 Ga0070663_100291358
1447 Ga0070678_100000728
1448 Ga0070678_100004266
1449 Ga0070678_100012686
1450 Ga0070678_100145602
1451 Ga0070662_100010721
1452 Ga0070662_100031178
1453 Ga0070662_100050667
1454 Ga0070681_10006372
1455 Ga0070681_10009514
1456 Ga0070681_10044420
1457 Ga0070681_10068229
1458 Ga0070681_10070252
1459 Ga0070681_10114590
1460 Ga0070681_10161763
1461 Ga0070681_10434323
1462 Ga0068867_100000275
1463 Ga0068867_100070292
1464 Ga0068867_100487316
1465 Ga0068867_100488545
1466 Ga0070685_10002126
1467 Ga0070685_10032285
1468 Ga0070685_10036946
1469 Ga0070706_100015493
1470 Ga0070706_100023458
1471 Ga0070707_100196313
1472 Ga0070698_100001471
1473 Ga0070698_100010828
1474 Ga0070699_100011671
1475 Ga0070699_100026303
1476 Ga0070699_100200048
1477 Ga0070699_100233375
1478 Ga0070679_100004955
1479 Ga0070679_100030613
1480 Ga0070679_100054395
1481 Ga0070679_100076170
1482 Ga0070679_100081043
1483 Ga0070679_100084636
1484 Ga0070679_100113090
1485 Ga0070679_100179509
1486 Ga0070684_100008955
1487 Ga0070684_100009493
1488 Ga0070684_100052663
1489 Ga0070684_100072913
1490 Ga0070684_100078790
1491 Ga0070684_100102699
1492 Ga0070684_100105393
1493 Ga0070684_100111284
1494 Ga0070697_100033150
1495 Ga0068853_100027279
1496 Ga0068853_100036301
1497 Ga0068853_100044767
1498 Ga0068853_100199563
1499 Ga0068853_100217667
1500 Ga0070672_100001043
1501 Ga0070672_100028934
1502 Ga0070672_100068309
1503 Ga0070672_100109845
1504 Ga0070672_100333406
1505 Ga0070686_100015699
1506 Ga0070686_100018517
1507 Ga0070686_100090637
1508 Ga0070695_100004124
1509 Ga0070695_100187680
1510 Ga0070695_100414046
1511 Ga0070696_100001676
1512 Ga0070696_100024590
1513 Ga0070696_100029965
1514 Ga0070696_100183404
1515 Ga0070696_100200663
1516 Ga0070693_100006433
1517 Ga0070693_100025992
1518 Ga0070693_100265224
1519 Ga0070693_100277672
1520 Ga0070665_100000923
1521 Ga0070665_100042906
1522 Ga0070665_100261891
1523 Ga0070665_100354621
1524 Ga0070704_100005192
1525 Ga0070704_100273409
1526 Ga0068855_100008469
1527 Ga0068855_100018228
1528 Ga0068855_100043137
1529 Ga0068855_100079548
1530 Ga0068855_100174712
1531 Ga0070664_100001520
1532 Ga0070664_100002944
1533 Ga0070664_100004852
1534 Ga0070664_100009264
1535 Ga0070664_100020665
1536 Ga0070664_100079787
1537 Ga0070664_100336630
1538 Ga0070664_100475443
1539 Ga0068857_100002553
1540 Ga0068857_100047974
1541 Ga0068857_100057284
1542 Ga0068857_100144922
1543 Ga0068857_100180610
1544 Ga0068854_100031269
1545 Ga0068854_100067368
1546 Ga0068854_100098350
1547 Ga0068854_100197990
1548 Ga0068854_100209400
1549 Ga0068854_100249538
1550 Ga0068856_100003437
1551 Ga0068856_100015279
1552 Ga0068856_100022065
1553 Ga0068856_100023951
1554 Ga0068856_100024651
1555 Ga0068856_100364433
1556 Ga0068852_100011936
1557 Ga0068852_100014001
1558 Ga0068852_100055776
1559 Ga0068852_100103802
1560 Ga0068852_100295085
1561 Ga0068852_100658501
1562 Ga0068859_100002993
1563 Ga0068859_100112202
1564 Ga0068859_100219201
1565 Ga0068864_100000275
1566 Ga0068864_100010491
1567 Ga0068864_100013588
1568 Ga0068864_100019783
1569 Ga0068864_100122126
1570 Ga0068864_100149958
1571 Ga0068866_10006601
1572 Ga0068861_100004038
1573 Ga0068861_100012217
1574 Ga0068861_100124174
1575 Ga0068861_100124365
1576 Ga0068851_10002997
1577 Ga0068851_10007904
1578 Ga0068851_10040310
1579 Ga0068851_10074380
1580 Ga0068851_10128435
1581 Ga0068870_10015301
1582 Ga0068863_100000292
1583 Ga0068863_100001479
1584 Ga0068863_100128577
1585 Ga0068863_100299546
1586 Ga0068863_100551394
1587 Ga0068858_100001164
1588 Ga0068858_100004751
1589 Ga0068858_100018757
1590 Ga0068858_100036953
1591 Ga0068858_100042024
1592 Ga0068858_100056320
1593 Ga0068858_100206150
1594 Ga0068860_100000845
1595 Ga0068860_100001112
1596 Ga0068860_100014779
1597 Ga0068860_100256761
1598 Ga0068860_100978724
1599 Ga0068862_100001028
1600 Ga0068862_100007003
1601 Ga0068862_100048918
1602 Ga0068862_100121350
1603 Ga0081455_10001860
1604 Ga0081455_10009744
1605 Ga0081455_10031798
1606 Ga0081455_10056258
1607 Ga0081538_10035782
1608 Ga0081538_10098511
1609 Ga0081540_1009789
1610 Ga0081539_10009313
1611 Ga0081539_10070877
1612 Ga0070717_10000603
1613 Ga0070717_10060335
1614 Ga0070717_10067436
1615 Ga0070717_10597256
1616 Ga0075365_10086667
1617 Ga0075365_10243504
1618 Ga0075363_100005387
1619 Ga0075364_10088814
1620 Ga0075364_10174241
1621 Ga0075364_10232699
1622 Ga0075432_10019769
1623 Ga0075432_10098210
1624 Ga0070715_10000159
1625 Ga0070715_10123102
1626 Ga0070716_100010521
1627 Ga0070716_100078273
1628 Ga0070716_100186501
1629 Ga0070712_100004130
1630 Ga0070712_100020375
1631 Ga0070712_100035681
1632 Ga0070712_100269546
1633 Ga0070712_100284587
1634 Ga0070712_100320342
1635 Ga0070712_100606662
1636 Ga0075362_10092615
1637 Ga0075367_10128398
1638 Ga0075366_10037733
1639 Ga0097621_100019564
1640 Ga0097621_100172487
1641 Ga0097621_100418712
1642 Ga0097621_100545495
1643 Ga0068871_100057919
1644 Ga0068871_100062414
1645 Ga0068871_100078716
1646 Ga0068871_100123662
1647 Ga0075428_100040725
1648 Ga0075428_100199872
1649 Ga0075428_100221034
1650 Ga0075428_100221243
1651 Ga0075428_100298902
1652 Ga0075428_100302655
1653 Ga0075430_100007044
1654 Ga0075430_100035206
1655 Ga0075430_100063617
1656 Ga0075431_100013070
1657 Ga0075431_100014686
1658 Ga0075431_100061633
1659 Ga0075431_100063587
1660 Ga0075431_100076425
1661 Ga0075431_100242051
1662 Ga0075433_10000981
1663 Ga0075433_10151262
1664 Ga0075433_10178897
1665 Ga0075433_10197585
1666 Ga0075433_10242784
1667 Ga0075433_10245154
1668 Ga0075433_10430911
1669 Ga0075434_100001241
1670 Ga0075434_100068221
1671 Ga0075434_100086729
1672 Ga0075434_100487636
1673 Ga0075434_101059223
1674 Ga0075429_100242406
1675 Ga0068865_100003957
1676 Ga0068865_100009546
1677 Ga0068865_100054893
1678 Ga0068865_100152883
1679 Ga0068865_100259793
1680 Ga0075436_100127879
1681 Ga0075436_100188984
1682 Ga0097620_100002993
1683 Ga0097620_100112201
1684 Ga0075435_100219670
1685 Ga0099794_10048714
1686 Ga0099795_10000525
1687 Ga0099795_10011044
1688 Ga0105244_10014193
1689 Ga0105244_10116398
1690 Ga0105250_10039487
1691 Ga0105240_10010466
1692 Ga0105240_10014808
1693 Ga0105240_10030349
1694 Ga0105240_10031660
1695 Ga0105240_10121886
1696 Ga0105240_10331535
1697 Ga0111539_10028072
1698 Ga0111539_10059595
1699 Ga0111539_10062101
1700 Ga0111539_10069739
1701 Ga0111539_10072021
1702 Ga0111539_10091969
1703 Ga0111539_10130516
1704 Ga0111539_10153741
1705 Ga0111539_10369179
1706 Ga0105245_10020211
1707 Ga0105245_10046360
1708 Ga0105245_10064876
1709 Ga0105245_10218523
1710 Ga0105245_10317840
1711 Ga0105247_10010893
1712 Ga0105247_10148326
1713 Ga0105247_10215435
1714 Ga0114129_10011942
1715 Ga0114129_10022955
1716 Ga0114129_10061066
1717 Ga0114129_10061685
1718 Ga0114129_10102860
1719 Ga0114129_10298861
1720 Ga0114129_10480363
1721 Ga0114129_11359643
1722 Ga0105243_10002331
1723 Ga0105243_10007058
1724 Ga0105243_10026946
1725 Ga0105243_10063327
1726 Ga0105241_10009508
1727 Ga0105241_10386389
1728 Ga0105242_10003922
1729 Ga0105242_10057719
1730 Ga0105242_10099932
1731 Ga0105242_10447400
1732 Ga0105248_10005206
1733 Ga0105248_10017766
1734 Ga0105248_10022900
1735 Ga0105248_10045266
1736 Ga0105248_10069700
1737 Ga0105248_10115363
1738 Ga0105248_10141427
1739 Ga0105248_10161153
1740 Ga0105248_10421495
1741 Ga0105248_10510953
1742 Ga0105248_11364523
1743 Ga0105237_10022783
1744 Ga0105237_10082572
1745 Ga0105237_10287832
1746 Ga0105237_10317152
1747 Ga0105238_10003490
1748 Ga0105238_10010511
1749 Ga0105238_10031634
1750 Ga0105238_10038745
1751 Ga0105238_10046908
1752 Ga0105238_10416888
1753 Ga0105249_10001113
1754 Ga0105249_10003043
1755 Ga0105249_10162864
1756 Ga0105249_10239556
1757 Ga0105239_10115907
1758 Ga0105239_10118340
1759 Ga0105239_10119880
1760 Ga0105239_10199484
1761 Ga0105239_10764368
1762 Ga0105239_11202922
1763 Ga0105246_10018900
1764 Ga0105246_10020051
1765 Ga0105246_10089601
1766 Ga0157373_10010428
1767 Ga0157373_10010753
1768 Ga0157373_10167222
1769 Ga0157371_10023743
1770 Ga0157371_10033215
1771 Ga0157371_10072031
1772 Ga0157371_10150202
1773 Ga0157370_10002532
1774 Ga0157370_10004330
1775 Ga0157370_10015571
1776 Ga0157370_10018623
1777 Ga0157370_10026491
1778 Ga0157370_10058461
1779 Ga0157370_10168643
1780 Ga0157369_10007438
1781 Ga0157369_10032889
1782 Ga0157369_10051814
1783 Ga0157369_10061545
1784 Ga0157369_10105059
1785 Ga0157369_10143782
1786 Ga0157369_10148788
1787 Ga0157369_10219729
1788 Ga0157374_10008130
1789 Ga0157374_10008516
1790 Ga0157374_10062647
1791 Ga0157374_10126224
1792 Ga0157374_10158265
1793 Ga0157374_10227085
1794 Ga0157374_10281164
1795 Ga0157374_10363912
1796 Ga0157378_10018792
1797 Ga0157378_10033486
1798 Ga0157378_10046583
1799 Ga0157378_10070373
1800 Ga0157378_10095877
1801 Ga0157378_10281331
1802 Ga0163162_10007822
1803 Ga0163162_10034723
1804 Ga0163162_10193449
1805 Ga0163162_10195759
1806 Ga0163162_10322882
1807 Ga0163162_10335457
1808 Ga0163162_10341367
1809 Ga0163162_10354834
1810 Ga0163162_10401034
1811 Ga0157372_10003130
1812 Ga0157372_10011420
1813 Ga0157372_10012456
1814 Ga0157372_10034622
1815 Ga0157372_10051086
1816 Ga0157372_10082396
1817 Ga0157372_10103907
1818 Ga0157372_10128120
1819 Ga0157372_10240052
1820 Ga0157372_10312514
1821 Ga0157372_10333214
1822 Ga0157372_10404621
1823 Ga0157372_10545212
1824 Ga0157375_10020474
1825 Ga0157375_10181975
1826 Ga0157375_10292498
1827 Ga0157375_10428176
1828 Ga0163163_10004818
1829 Ga0163163_10007632
1830 Ga0163163_10027715
1831 Ga0163163_10054993
1832 Ga0163163_10155272
1833 Ga0163163_10490960
1834 Ga0157380_10008406
1835 Ga0157380_10037017
1836 Ga0157380_10067001
1837 Ga0157380_10455955
1838 Ga0157377_10007033
1839 Ga0157379_10007852
1840 Ga0157379_10030891
1841 Ga0157379_10061468
1842 Ga0157379_10072004
1843 Ga0157379_10326605
1844 Ga0157376_10025325
1845 Ga0157376_10028899
1846 Ga0157376_10089349
1847 Ga0157376_10439344
1848 Ga0163161_10031958
1849 Ga0163161_10117266
1850 Ga0163161_10201015
1851 Ga0163161_10216482
1852 Ga0213872_10000279
1853 Ga0213872_10000502
1854 Ga0213872_10000712
1855 Ga0213872_10002578
1856 Ga0213872_10028105
1857 Ga0213876_10232443
1858 Ga0228598_1037143
1859 Ga0209437_105260
1860 Ga0209646_1000072
1861 Ga0209148_1000386
1862 Ga0209565_1023186
1863 Ga0207666_1005781
1864 Ga0209025_1000624
1865 Ga0209025_1000929
1866 Ga0209025_1060115
1867 Ga0209564_1000007
1868 Ga0209564_1000072
1869 Ga0209256_1000176
1870 Ga0207697_10001389
1871 Ga0207656_10005345
1872 Ga0207656_10008756
1873 Ga0207656_10015099
1874 Ga0207656_10046627
1875 Ga0207656_10238124
1876 Ga0207655_1016139
1877 Ga0207682_10000199
1878 Ga0207682_10108196
1879 Ga0207692_10004390
1880 Ga0207692_10057340
1881 Ga0207692_10333781
1882 Ga0207642_10092999
1883 Ga0207642_10152269
1884 Ga0207710_10005521
1885 Ga0207710_10021773
1886 Ga0207688_10002037
1887 Ga0207688_10002110
1888 Ga0207688_10012316
1889 Ga0207680_10002416
1890 Ga0207680_10022090
1891 Ga0207680_10026989
1892 Ga0207680_10047487
1893 Ga0207680_10133850
1894 Ga0207680_10150519
1895 Ga0207647_10018037
1896 Ga0207647_10136734
1897 Ga0207685_10003238
1898 Ga0207685_10081428
1899 Ga0207699_10022753
1900 Ga0207699_10024177
1901 Ga0207699_10053258
1902 Ga0207699_10085922
1903 Ga0207699_10095416
1904 Ga0207699_10253341
1905 Ga0207645_10015977
1906 Ga0207645_10023307
1907 Ga0207645_10026627
1908 Ga0207645_10039569
1909 Ga0207645_10055884
1910 Ga0207645_10085880
1911 Ga0207645_10243356
1912 Ga0207645_10301151
1913 Ga0207643_10000285
1914 Ga0207643_10000872
1915 Ga0207643_10013410
1916 Ga0207643_10083901
1917 Ga0207705_10030823
1918 Ga0207705_10037392
1919 Ga0207684_10006392
1920 Ga0207684_10059972
1921 Ga0207684_10073880
1922 Ga0207684_10176364
1923 Ga0207654_10097298
1924 Ga0207707_10000993
1925 Ga0207707_10007140
1926 Ga0207707_10011673
1927 Ga0207707_10012952
1928 Ga0207707_10025294
1929 Ga0207707_10026682
1930 Ga0207707_10040679
1931 Ga0207707_10162531
1932 Ga0207695_10006493
1933 Ga0207695_10040712
1934 Ga0207695_10087600
1935 Ga0207695_10213503
1936 Ga0207695_10423272
1937 Ga0207671_10195738
1938 Ga0207671_10237712
1939 Ga0207671_10349954
1940 Ga0207693_10003527
1941 Ga0207693_10014239
1942 Ga0207693_10024667
1943 Ga0207693_10292137
1944 Ga0207693_10370698
1945 Ga0207663_10015515
1946 Ga0207663_10034041
1947 Ga0207663_10170581
1948 Ga0207660_10012309
1949 Ga0207660_10045654
1950 Ga0207660_10045893
1951 Ga0207660_10074565
1952 Ga0207660_10102775
1953 Ga0207660_10166533
1954 Ga0207660_10236524
1955 Ga0207662_10000929
1956 Ga0207662_10003667
1957 Ga0207662_10096112
1958 Ga0207657_10000882
1959 Ga0207657_10002238
1960 Ga0207657_10006109
1961 Ga0207657_10014997
1962 Ga0207657_10030389
1963 Ga0207657_10051541
1964 Ga0207649_10002511
1965 Ga0207649_10006622
1966 Ga0207649_10037866
1967 Ga0207649_10063142
1968 Ga0207649_10064299
1969 Ga0207649_10089484
1970 Ga0207649_10309828
1971 Ga0207652_10006566
1972 Ga0207652_10010460
1973 Ga0207652_10019084
1974 Ga0207652_10061698
1975 Ga0207652_10079971
1976 Ga0207652_10090872
1977 Ga0207652_10111889
1978 Ga0207646_10084014
1979 Ga0207681_10001443
1980 Ga0207681_10060289
1981 Ga0207681_10256457
1982 Ga0207694_10004100
1983 Ga0207694_10007945
1984 Ga0207694_10044084
1985 Ga0207650_10000133
1986 Ga0207650_10002222
1987 Ga0207650_10006091
1988 Ga0207650_10108529
1989 Ga0207659_10001360
1990 Ga0207659_10026579
1991 Ga0207659_10146489
1992 Ga0207659_10190888
1993 Ga0207687_10015863
1994 Ga0207687_10162814
1995 Ga0207687_10248115
1996 Ga0207700_10020365
1997 Ga0207700_10050938
1998 Ga0207700_10082293
1999 Ga0207700_10112191
2000 Ga0207700_10482378
2001 Ga0207664_10001046
2002 Ga0207664_10012686
2003 Ga0207664_10050774
2004 Ga0207664_10051133
2005 Ga0207664_10059671
2006 Ga0207664_10297437
2007 Ga0207644_10003477
2008 Ga0207644_10012046
2009 Ga0207644_10018949
2010 Ga0207644_10094661
2011 Ga0207644_10111199
2012 Ga0207644_10145787
2013 Ga0207644_10515210
2014 Ga0207690_10005099
2015 Ga0207690_10007295
2016 Ga0207690_10013597
2017 Ga0207690_10027060
2018 Ga0207690_10046682
2019 Ga0207690_10207707
2020 Ga0207706_10000820
2021 Ga0207706_10006344
2022 Ga0207706_10006730
2023 Ga0207706_10073712
2024 Ga0207706_10152699
2025 Ga0207706_10343471
2026 Ga0207686_10016093
2027 Ga0207709_10003308
2028 Ga0207709_10024538
2029 Ga0207709_10223798
2030 Ga0207670_10002275
2031 Ga0207670_10006012
2032 Ga0207669_10003358
2033 Ga0207669_10034055
2034 Ga0207669_10049274
2035 Ga0207669_10362329
2036 Ga0207665_10001863
2037 Ga0207665_10006295
2038 Ga0207691_10017740
2039 Ga0207691_10025399
2040 Ga0207691_10035330
2041 Ga0207691_10045423
2042 Ga0207691_10049616
2043 Ga0207711_10012247
2044 Ga0207711_10029383
2045 Ga0207711_10032690
2046 Ga0207711_10075247
2047 Ga0207711_10122103
2048 Ga0207711_10340269
2049 Ga0207711_10400896
2050 Ga0207711_10411695
2051 Ga0207711_10502108
2052 Ga0207689_10000559
2053 Ga0207689_10014667
2054 Ga0207689_10044726
2055 Ga0207689_10052332
2056 Ga0207661_10028106
2057 Ga0207661_10030482
2058 Ga0207661_10034410
2059 Ga0207661_10274424
2060 Ga0207679_10003380
2061 Ga0207679_10003681
2062 Ga0207679_10010584
2063 Ga0207679_10033072
2064 Ga0207679_10064697
2065 Ga0207667_10001841
2066 Ga0207667_10063675
2067 Ga0207667_10091854
2068 Ga0207667_10277015
2069 Ga0207667_10500891
2070 Ga0207667_10557931
2071 Ga0207667_10763780
2072 Ga0207651_10002984
2073 Ga0207651_10117362
2074 Ga0207651_10157406
2075 Ga0207651_10237925
2076 Ga0207651_10497188
2077 Ga0207651_10731312
2078 Ga0207712_10000689
2079 Ga0207712_10045875
2080 Ga0207712_10132703
2081 Ga0207712_10271093
2082 Ga0207668_10000275
2083 Ga0207668_10002130
2084 Ga0207668_10018888
2085 Ga0207668_10079489
2086 Ga0207668_10141487
2087 Ga0207668_10190862
2088 Ga0207668_10271282
2089 Ga0207668_10370634
2090 Ga0207640_10038374
2091 Ga0207640_10045477
2092 Ga0207640_10049413
2093 Ga0207640_10063362
2094 Ga0207640_10483660
2095 Ga0207658_10001145
2096 Ga0207658_10020076
2097 Ga0207658_10025067
2098 Ga0207658_10025918
2099 Ga0207658_10198488
2100 Ga0207658_10553520
2101 Ga0207677_10087500
2102 Ga0207677_10090482
2103 Ga0207677_10094049
2104 Ga0207677_10164628
2105 Ga0207677_10198376
2106 Ga0207703_10002292
2107 Ga0207703_10026290
2108 Ga0207703_10097426
2109 Ga0207703_10902203
2110 Ga0207703_10906624
2111 Ga0207639_10012698
2112 Ga0207639_10030893
2113 Ga0207639_10036924
2114 Ga0207639_10048995
2115 Ga0207639_10099833
2116 Ga0207639_10132235
2117 Ga0207639_10351348
2118 Ga0207639_10796769
2119 Ga0207678_10001637
2120 Ga0207678_10005238
2121 Ga0207678_10020833
2122 Ga0207678_10038735
2123 Ga0207678_10073617
2124 Ga0207678_10367688
2125 Ga0207678_10421032
2126 Ga0207678_10609596
2127 Ga0207708_10000560
2128 Ga0207708_10003553
2129 Ga0207708_10009000
2130 Ga0207708_10060105
2131 Ga0207702_10042978
2132 Ga0207702_10050842
2133 Ga0207702_10066459
2134 Ga0207702_10340732
2135 Ga0207702_10532124
2136 Ga0207641_10001486
2137 Ga0207641_10004884
2138 Ga0207641_10266332
2139 Ga0207641_10415295
2140 Ga0207641_10838603
2141 Ga0207648_10001104
2142 Ga0207648_10001209
2143 Ga0207648_10026444
2144 Ga0207648_10044844
2145 Ga0207648_10088386
2146 Ga0207648_10285860
2147 Ga0207648_10426945
2148 Ga0207676_10002421
2149 Ga0207676_10005547
2150 Ga0207676_10007903
2151 Ga0207676_10096057
2152 Ga0207676_10714313
2153 Ga0207676_10718003
2154 Ga0207674_10000089
2155 Ga0207674_10002196
2156 Ga0207674_10004693
2157 Ga0207674_10004995
2158 Ga0207674_10010018
2159 Ga0207674_10132705
2160 Ga0207674_10190171
2161 Ga0207674_10287779
2162 Ga0207675_100000047
2163 Ga0207675_100000376
2164 Ga0207675_100001008
2165 Ga0207675_100059299
2166 Ga0207675_100125288
2167 Ga0207675_100547266
2168 Ga0207683_10000127
2169 Ga0207683_10007701
2170 Ga0207683_10016793
2171 Ga0207683_10019753
2172 Ga0207683_10064796
2173 Ga0207698_10008357
2174 Ga0207698_10031784
2175 Ga0207698_10042815
2176 Ga0207698_10045785
2177 Ga0207698_10099036
2178 Ga0207698_10153243
2179 Ga0209995_1012932
2180 Ga0209983_1005434
2181 Ga0209971_1001127
2182 Ga0207428_10012008
2183 Ga0207428_10070875
2184 Ga0207428_10113181
2185 Ga0207428_10132546
2186 Ga0207428_10170995
2187 Ga0207428_10518449
2188 Ga0268266_10006847
2189 Ga0268266_10028221
2190 Ga0268266_10038608
2191 Ga0268265_10000728
2192 Ga0268265_10004940
2193 Ga0268265_10045406
2194 Ga0268265_10126967
2195 Ga0268265_10730613
2196 Ga0268264_10000358
2197 Ga0268264_10042905
2198 Ga0268264_10165288
2199 Ga0265328_10009096
2200 Ga0265339_10016519
2201 Ga0265331_10000002
2202 Ga0265331_10000355
2203 Ga0265327_10000033
2204 Ga0265316_10021653
2205 Ga0265314_10003660
2206 Ga0307516_10145603
2207 Ga0307413_10237381
2208 Ga0307412_10026142
2209 Ga0307414_10161608
2210 Ga0373929_0007593
2211 Ga0373929_0040769
2212 Ga0373934_0000639
2213 Ga0373940_0009937
2214 Ga0373952_0041093
2215 Ga0373923_0050607
2216 Ga0373923_0097413
2217 Ga0373932_0011564
2218 Ga0373939_0045629
2219 Ga0373941_0063328
2220 Ga0373953_0073359
2221 Ga0373954_0025888
2222 Ga0373956_0000135
2223 Ga0373957_0000933
2224 Ga0373960_0014938
2225 Ga0373960_0021024
2226 Ga0373955_0023281
2227 Ga0373955_0259703
2228 Ga0373962_0005595
2229 Ga0373931_0004770
2230 Ga0373931_0007171
2231 Ga0373931_0016109
2232 Ga0373931_0189881
2233 Ga0373935_0140496
2234 Ga0373927_0218147
2235 Ga0373927_0336775
2236 Ga0373933_0000813
2237 Ga0373947_0112483
2238 Ga0373937_0004329
2239 Ga0373937_0023186
2240 Ga0373925_0031236
2241 Ga0373925_0087309
2242 Ga0395899_0007777
2243 Ga0395900_0010652
2244 Ga0395900_0019699
2245 Ga0395898_0462143
2246 Ga0395905_0000086
2247 Ga0395905_0004236
2248 Ga0395905_0112475
2249 Ga0395901_0007491
2250 Ga0395901_0079508
2251 Ga0395901_0209231
2252 Ga0395901_0415128
2253 Ga0242420_009807
2254 Ga0436360_0220478
2255 Ga0436361_0032090
2256 Ga0436361_0421236
2257 Ga0436361_0530365
2258 Ga0436361_0579013
2259 Ga0436361_0972320
2260 Ga0436361_1044948
2261 Ga0436363_1091328
2262 Ga0436363_1403698
2263 Ga0436362_0201408
2264 Ga0436362_0326174
2265 Ga0439465_0001164
2266 Ga0451847_0461108
2267 Ga0451577_0097984
2268 Ga0466968_0074670
2269 Ga0451576_0025457
2270 Ga0451576_0104326
2271 Ga0495590_0000006
2272 Ga0495629_0054326
2273 Ga0495629_0096585
2274 Ga0495638_0000333
2275 Ga0495651_0000274
2276 Ga0495650_0000194
2277 Ga0495650_0008058
2278 Ga0495580_0033707
2279 Ga0495580_0036032
2280 Ga0495580_0072639
2281 Ga0495662_0110605
2282 Ga0495584_0073030
2283 Ga0495584_0095625
2284 Ga0495585_0112778
2285 Ga0495607_0001831
2286 Ga0495583_0000475
2287 Ga0495606_0013329
2288 Ga0495606_0269849
2289 Ga0495616_0088407
2290 Ga0495618_0128240
2291 Ga0495620_0065924
2292 Ga0495643_0000358
2293 Ga0495648_0000054
2294 Ga0495666_0011471
2295 Ga0495642_0009074
2296 Ga0495642_0122436
2297 Ga0495642_0178150
2298 Ga0495621_0054737
2299 Ga0495621_0105795
2300 Ga0495621_0128057
2301 Ga0495597_0000191
2302 Ga0495622_0000038
2303 Ga0495633_0001301
2304 Ga0495633_0089268
2305 Ga0495656_0076154
2306 Ga0495668_0001151
2307 Ga0495668_0002784
2308 Ga0495625_0000436
2309 Ga0495625_0000558
2310 Ga0495657_0022641
2311 Ga0495647_0038760
2312 Ga0495669_0088311
2313 Ga0495669_0109852
2314 Ga0495670_0062773
2315 Ga0495649_0172884
2316 Ga0495600_0255963
2317 Ga0495581_0157408
2318 Ga0495604_0050123
2319 Ga0495674_0267585
2320 Ga0495672_0250784
2321 Ga0495676_0226328
2322 Ga0495680_0076772
2323 Ga0495683_0213944
2324 Ga0495687_001334
2325 Ga0495687_004548
2326 Ga0495684_0144589
2327 Ga0495686_0270025
2328 Ga0495593_0197086
2329 Ga0495614_0038867
2330 Ga0495614_0058997
2331 Ga0496100_0022383
2332 Ga0496100_0242447
2333 Ga0496101_0023566
2334 Ga0496101_0061606
2335 Ga0496101_0114106
2336 Ga0496101_0138658
2337 Ga0496101_0155871
2338 Ga0496101_0449248
2339 Ga0496101_0679824
2340 Ga0496102_0012224
2341 Ga0496102_0032411
2342 Ga0496102_0034017
2343 Ga0496102_0034379
2344 Ga0496102_0137229
2345 Ga0496102_0411198
2346 Ga0496103_0004445
2347 Ga0496103_0024209
2348 Ga0496103_0027729
2349 Ga0496103_0058180
2350 Ga0496103_0064765
2351 Ga0496103_0072089
2352 Ga0496103_0263325
2353 Ga0496104_0003625
2354 Ga0496104_0003891
2355 Ga0496104_0049441
2356 Ga0496104_0296340
2357 Ga0496104_0414017
2358 Ga0496104_0674134
2359 Ga0496105_0001322
2360 Ga0496105_0023569
2361 Ga0496105_0036542
2362 Ga0496105_0220084
2363 Ga0496105_0324557
2364 Ga0496106_0021775
2365 Ga0496106_0079115
2366 Ga0496106_0113686
2367 Ga0496106_0178145
2368 Ga0496107_0002458
2369 Ga0496107_0029338
2370 Ga0496107_0037478
2371 Ga0496107_0054627
2372 Ga0496107_0376757
2373 Ga0496108_0002238
2374 Ga0496108_0069736
2375 Ga0496108_0395200
2376 Ga0496109_0002809
2377 Ga0496109_0006173
2378 Ga0496109_0015267
2379 Ga0496109_0031863
2380 Ga0496109_0043237
2381 Ga0496109_0136861
2382 Ga0496109_0298500
2383 Ga0496109_0453695
2384 Ga0496110_0024038
2385 Ga0496110_0024415
2386 Ga0496110_0030989
2387 Ga0496110_0037915
2388 Ga0496110_0065317
2389 Ga0496110_0226002
2390 Ga0496110_0283722
2391 Ga0496110_0292335
2392 Ga0496111_0017001
2393 Ga0496111_0036092
2394 Ga0496111_0038968
2395 Ga0496111_0124351
2396 Ga0496111_0137848
2397 Ga0496112_0033514
2398 Ga0496112_0047020
2399 Ga0496112_0128607
2400 Ga0496112_0145141
2401 Ga0496112_0214935
2402 Ga0496113_0001266
2403 Ga0496113_0059870
2404 Ga0496113_0152766
2405 Ga0496114_0018456
2406 Ga0496114_0360228
2407 Ga0496115_0022583
2408 Ga0496117_0002582
2409 Ga0496118_0002912
2410 Ga0496118_0138530
2411 Ga0496121_0001731
2412 Ga0496121_0020294
2413 Ga0496124_0000315
2414 Ga0496124_0051010
2415 Ga0496125_0007726
2416 Ga0496125_0100672
2417 Ga0495678_003848
2418 Ga0495678_005316
2419 Ga0501034_0002928
2420 Ga0501034_0090019
2421 Ga0501036_0141693
2422 Ga0501046_0001880
2423 Ga0501046_0031358
2424 Ga0501047_0047668
2425 Ga0501047_0169371
2426 Ga0501067_0010788
2427 Ga0501067_0094672
2428 Ga0501067_0167473
2429 Ga0501068_0034944
2430 Ga0501068_0195709
2431 Ga0501070_0274753
2432 Ga0501073_0076383
2433 Ga0501250_007422
2434 Ga0501079_0369281
2435 Ga0501080_0201871
2436 Ga0501081_0112261
2437 Ga0501083_0024996
2438 Ga0501083_0050819
2439 Ga0501044_0199410
2440 Ga0501044_0599599
2441 nmdc:mga03683_83289_c1
2442 nmdc:mga00v17_75055_c1
2443 nmdc:mga0yw44_25520_c1
2444 nmdc:mga0yw44_30075_c1
2445 nmdc:mga0yw44_62260_c1
2446 nmdc:mga0k408_91021_c1
2447 nmdc:mga06z11_166450_c1
2448 nmdc:mga06z11_223427_c1
2449 nmdc:mga06z11_43777_c1
2450 nmdc:mga07m45_238953_c1
2451 nmdc:mga07m45_291084_c1
2452 nmdc:mga05p37_1011036_c1
2453 nmdc:mga05p37_25897_c1
2454 nmdc:mga05p37_44460_c1
2455 nmdc:mga05p37_565804_c1
2456 nmdc:mga05p37_96346_c1
2457 nmdc:mga09592_128149_c1
2458 nmdc:mga0qj67_15707_c1
2459 nmdc:mga0qj67_256687_c1
2460 nmdc:mga0qj67_42590_c1
2461 nmdc:mga0qj67_48788_c1
2462 nmdc:mga06r32_139724_c1
2463 nmdc:mga06r32_173683_c1
2464 nmdc:mga06r32_219085_c1
2465 nmdc:mga06r32_25454_c1
2466 nmdc:mga06r32_30438_c1
2467 nmdc:mga06r32_73504_c1
2468 nmdc:mga08y16_140040_c1
2469 nmdc:mga08y16_147138_c1
2470 nmdc:mga08y16_152775_c1
2471 nmdc:mga08y16_239051_c1
2472 nmdc:mga08y16_276208_c1
2473 nmdc:mga08y16_286908_c1
2474 nmdc:mga08y16_375153_c1
2475 nmdc:mga08y16_672347_c1
2476 nmdc:mga08y16_68397_c1
2477 nmdc:mga08y16_84713_c1
2478 nmdc:mga0n895_116657_c1
2479 nmdc:mga0n895_182762_c1
2480 nmdc:mga0n895_219747_c1
2481 nmdc:mga0n895_232339_c1
2482 nmdc:mga0n895_39655_c1
2483 nmdc:mga0n895_64693_c1
2484 nmdc:mga0n895_94644_c1
2485 nmdc:mga0rr50_185515_c1
2486 nmdc:mga0rr50_307731_c1
2487 nmdc:mga0rr50_367324_c1
2488 nmdc:mga08x19_109026_c1
2489 nmdc:mga08x19_310542_c1
2490 nmdc:mga08x19_60991_c1
2491 nmdc:mga0a205_2299_c1
2492 nmdc:mga0a205_2472_c1
2493 nmdc:mga0a205_256485_c1
2494 nmdc:mga0a205_61465_c1
2495 Ga0495601_0300039
2496 Ga0495655_0000902
2497 Ga0495655_0020756
2498 Ga0495655_0038608
2499 Ga0495619_0129091
2500 Ga0495619_0294433
2501 Ga0500647_0099467
2502 Ga0500618_015233
2503 Ga0500590_004048
2504 Ga0500590_011367
2505 Ga0500619_000121
2506 Ga0501084_0091452
2507 Ga0501084_0185728
2508 Ga0501082_0042293
2509 Ga0501082_0501645
2510 Ga0501082_0606628
2511 Ga0530510_0108414
2512 2513598224
2513 2515646586
2514 2585165055
2515 2770195882
2516 2776269411
2517 2776282341
2518 2953996336
2519 8024488839
2520 8046774800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

234

0.98

PF08659

KR

KR domain

42

217

0.88

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

290

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dt1-assembly1.cif.gz_C crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.9739 2 257
4trr-assembly2.cif.gz_G crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 0.9716 5 257
8dt1-assembly1.cif.gz_C crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.9664 2 257
6zzq-assembly1.cif.gz_A crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and acetoacetate 0.9653 3 254
5cej-assembly1.cif.gz_A the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.50a resolution 0.9638 2 253
ID Description Score Start End Superfamily
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9716 5 257 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9631 5 257 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 6 179 3.40.50.720
4trrC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9617 2 257 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9537 6 249 3.40.50.720
ID Description Score Start End GO Terms
AF-T0YFG4-F1-model_v4 D-beta-hydroxybutyrate dehydrogenase 0.9839 5 235 GO:0016491
AF-A0A2H0I9M2-F1-model_v4 3-hydroxybutyrate dehydrogenase (EC 1.1.1.30) 0.9806 5 257 GO:0003858
AF-A0A504F657-F1-model_v4 deleted 0.9794 1 257
AF-T1AIA8-F1-model_v4 3-hydroxybutyrate dehydrogenase 0.9789 2 244 GO:0003858
AF-A0A504F657-F1-model_v4 deleted 0.9756 1 257

Map