F492345

General Info

Members Datasets Scaffolds Average Seq Length
1265 397 1265 87

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_1179642|Ga0395905_1179642_15_338
Length 101
Sequence VVGGGRVPAVDLLGRGGDDLVADLRLPPTELPRRLSVEAPTVVGALREIDEKWPGLLDRLCSHGPTLRPHIHVYVDGRRAQLEDAIDERSRVDVVAAISGG

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
186 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
219 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
244 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
245 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
246 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
247 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
250 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
251 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
252 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
253 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
256 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
257 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
294 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
299 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
308 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
309 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
310 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
311 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
315 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
316 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
317 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
318 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
319 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
320 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
321 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
322 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
328 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
329 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
360 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
361 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
367 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
368 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
377 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 1.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 13.75
Rhizosphere 85.45
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10002884 3300002077 Bacteria 3515
2 JGI24742J22300_10005646 3300002244 Bacteria 2057
3 Ga0070658_10121644 3300005327 Bacteria 2169
4 Ga0070658_11060860 3300005327 Bacteria 705
5 Ga0070683_100113786 3300005329 Bacteria 2554
6 Ga0070683_100319357 3300005329 Bacteria 1478
7 Ga0070683_100382574 3300005329 Bacteria 1341
8 Ga0070683_100598738 3300005329 Bacteria 1055
9 Ga0070683_101665008 3300005329 Bacteria 613
10 Ga0070683_102158758 3300005329 Unclassified 535
11 Ga0070690_100328527 3300005330 Bacteria 1104
12 Ga0070670_101814183 3300005331 Bacteria 561
13 Ga0070677_10107090 3300005333 Bacteria 1242
14 Ga0070680_100010728 3300005336 Bacteria 7074
15 Ga0070680_100046131 3300005336 Bacteria 3544
16 Ga0070680_100101251 3300005336 Bacteria 2391
17 Ga0070680_100992548 3300005336 Bacteria 725
18 Ga0070682_100005203 3300005337 Bacteria 7237
19 Ga0070682_100012014 3300005337 Bacteria 4954
20 Ga0070682_100038562 3300005337 Bacteria 2930
21 Ga0070682_100615740 3300005337 Bacteria 859
22 Ga0070682_101503533 3300005337 Unclassified 579
23 Ga0070682_101702170 3300005337 Bacteria 548
24 Ga0068868_100047501 3300005338 Bacteria 3365
25 Ga0068868_100458818 3300005338 Bacteria 1109
26 Ga0068868_100841141 3300005338 Unclassified 831
27 Ga0070660_100007876 3300005339 Bacteria 7430
28 Ga0070660_100263381 3300005339 Bacteria 1408
29 Ga0070660_100517313 3300005339 Unclassified 994
30 Ga0070660_101322465 3300005339 Bacteria 612
31 Ga0070660_101865784 3300005339 Unclassified 512
32 Ga0070689_100013742 3300005340 Bacteria 5865
33 Ga0070689_100169688 3300005340 Bacteria 1767
34 Ga0070689_100607574 3300005340 Unclassified 948
35 Ga0070687_100904722 3300005343 Bacteria 633
36 Ga0070661_100984439 3300005344 Bacteria 699
37 Ga0070692_10017715 3300005345 Bacteria 3412
38 Ga0070668_101417711 3300005347 Bacteria 634
39 Ga0070669_100359841 3300005353 Bacteria 1183
40 Ga0070675_100065652 3300005354 Bacteria 3001
41 Ga0070675_100975627 3300005354 Bacteria 778
42 Ga0070675_101093248 3300005354 Bacteria 733
43 Ga0070675_101308900 3300005354 Unclassified 668
44 Ga0070671_100043832 3300005355 Bacteria 3718
45 Ga0070671_100050442 3300005355 Bacteria 3461
46 Ga0070671_100199816 3300005355 Bacteria 1695
47 Ga0070671_100581509 3300005355 Bacteria 967
48 Ga0070674_100005302 3300005356 Bacteria 7427
49 Ga0070674_100145759 3300005356 Bacteria 1782
50 Ga0070674_100155400 3300005356 Bacteria 1730
51 Ga0070674_100172688 3300005356 Unclassified 1650
52 Ga0070674_100928816 3300005356 Unclassified 759
53 Ga0070673_101108750 3300005364 Bacteria 739
54 Ga0070688_100008183 3300005365 Bacteria 5665
55 Ga0070688_101080898 3300005365 Bacteria 640
56 Ga0070659_100241562 3300005366 Bacteria 1495
57 Ga0070659_100832331 3300005366 Bacteria 804
58 Ga0070659_100871464 3300005366 Unclassified 786
59 Ga0070667_101336946 3300005367 Unclassified 672
60 Ga0070667_101399362 3300005367 Bacteria 656
61 Ga0070709_10268306 3300005434 Bacteria 1236
62 Ga0070709_10547749 3300005434 Bacteria 885
63 Ga0070709_10611746 3300005434 Unclassified 840
64 Ga0070709_10629416 3300005434 Bacteria 829
65 Ga0070714_100096340 3300005435 Bacteria 2600
66 Ga0070714_100169434 3300005435 Bacteria 1981
67 Ga0070714_100251064 3300005435 Bacteria 1636
68 Ga0070714_100320773 3300005435 Bacteria 1449
69 Ga0070713_100147731 3300005436 Bacteria 2088
70 Ga0070713_100791617 3300005436 Unclassified 909
71 Ga0070713_101981494 3300005436 Bacteria 565
72 Ga0070710_10007082 3300005437 Bacteria 5414
73 Ga0070710_10429532 3300005437 Bacteria 891
74 Ga0070701_10014128 3300005438 Bacteria 3653
75 Ga0070701_10116456 3300005438 Bacteria 1500
76 Ga0070711_100003182 3300005439 Bacteria 9527
77 Ga0070711_100034675 3300005439 Bacteria 3368
78 Ga0070711_100865370 3300005439 Bacteria 770
79 Ga0070705_100023909 3300005440 Bacteria 3290
80 Ga0070700_100001522 3300005441 Bacteria 11542
81 Ga0070700_100024380 3300005441 Bacteria 3551
82 Ga0070700_100477031 3300005441 Unclassified 955
83 Ga0070700_101225522 3300005441 Bacteria 627
84 Ga0070694_100054439 3300005444 Bacteria 2711
85 Ga0070694_100327248 3300005444 Bacteria 1181
86 Ga0070694_100367868 3300005444 Bacteria 1118
87 Ga0070694_100952320 3300005444 Bacteria 711
88 Ga0070708_100238367 3300005445 Bacteria 1708
89 Ga0070708_100928861 3300005445 Unclassified 816
90 Ga0070708_101106228 3300005445 Bacteria 742
91 Ga0070708_101218900 3300005445 Bacteria 704
92 Ga0070663_100007368 3300005455 Bacteria 6693
93 Ga0070663_100129504 3300005455 Bacteria 1915
94 Ga0070663_100745445 3300005455 Bacteria 836
95 Ga0070678_100001885 3300005456 Bacteria 11318
96 Ga0070678_100025558 3300005456 Bacteria 3975
97 Ga0070678_100900165 3300005456 Bacteria 809
98 Ga0070678_101065709 3300005456 Bacteria 745
99 Ga0070678_101556290 3300005456 Bacteria 620
100 Ga0070678_101687957 3300005456 Bacteria 596
101 Ga0070662_100888449 3300005457 Bacteria 760
102 Ga0070662_100948161 3300005457 Unclassified 735
103 Ga0070662_101158666 3300005457 Bacteria 664
104 Ga0070681_10012878 3300005458 Bacteria 8306
105 Ga0070681_10066324 3300005458 Bacteria 3578
106 Ga0070681_10101906 3300005458 Bacteria 2816
107 Ga0070681_10920824 3300005458 Unclassified 793
108 Ga0068867_100002812 3300005459 Bacteria 12234
109 Ga0068867_100322103 3300005459 Bacteria 1281
110 Ga0068867_101609589 3300005459 Bacteria 607
111 Ga0070685_10034706 3300005466 Bacteria 2842
112 Ga0070685_10047068 3300005466 Bacteria 2479
113 Ga0070706_100099647 3300005467 Bacteria 2699
114 Ga0070706_101681800 3300005467 Bacteria 578
115 Ga0070706_101709306 3300005467 Bacteria 573
116 Ga0070707_100020070 3300005468 Bacteria 6302
117 Ga0070707_100971290 3300005468 Unclassified 815
118 Ga0070707_101727840 3300005468 Bacteria 593
119 Ga0070698_100100234 3300005471 Unclassified 2869
120 Ga0070698_100207210 3300005471 Unclassified 1896
121 Ga0070698_100233256 3300005471 Bacteria 1773
122 Ga0070698_100241519 3300005471 Bacteria 1739
123 Ga0070699_100065041 3300005518 Bacteria 3164
124 Ga0070699_100891344 3300005518 Bacteria 815
125 Ga0070679_100044289 3300005530 Bacteria 4433
126 Ga0070679_100057930 3300005530 Bacteria 3861
127 Ga0070679_100260982 3300005530 Bacteria 1688
128 Ga0070679_100780062 3300005530 Bacteria 899
129 Ga0070679_101372135 3300005530 Bacteria 653
130 Ga0070684_100164140 3300005535 Bacteria 2016
131 Ga0070684_100236486 3300005535 Bacteria 1668
132 Ga0070684_100239566 3300005535 Bacteria 1657
133 Ga0070684_100444530 3300005535 Bacteria 1198
134 Ga0070684_100480314 3300005535 Bacteria 1150
135 Ga0070684_100675964 3300005535 Unclassified 962
136 Ga0070684_100952256 3300005535 Bacteria 805
137 Ga0070697_100015513 3300005536 Bacteria 5981
138 Ga0070697_100874373 3300005536 Unclassified 797
139 Ga0070697_101093116 3300005536 Bacteria 710
140 Ga0068853_100010897 3300005539 Bacteria 7365
141 Ga0070672_100100692 3300005543 Unclassified 2343
142 Ga0070672_100551570 3300005543 Bacteria 1001
143 Ga0070672_101535388 3300005543 Bacteria 597
144 Ga0070686_100004420 3300005544 Bacteria 7758
145 Ga0070686_100457101 3300005544 Bacteria 983
146 Ga0070686_101004867 3300005544 Bacteria 684
147 Ga0070686_101704664 3300005544 Unclassified 535
148 Ga0070695_100079175 3300005545 Unclassified 2168
149 Ga0070695_101134292 3300005545 Bacteria 641
150 Ga0070696_100005547 3300005546 Bacteria 8423
151 Ga0070693_100002841 3300005547 Bacteria 7977
152 Ga0070693_100026239 3300005547 Unclassified 3144
153 Ga0070693_100124589 3300005547 Bacteria 1602
154 Ga0070665_100105506 3300005548 Bacteria 2820
155 Ga0070665_100688053 3300005548 Unclassified 1036
156 Ga0070665_101757188 3300005548 Bacteria 627
157 Ga0070665_102187472 3300005548 Bacteria 557
158 Ga0070704_100018433 3300005549 Bacteria 4464
159 Ga0070704_101025894 3300005549 Bacteria 747
160 Ga0070704_102266551 3300005549 Bacteria 505
161 Ga0068855_100108032 3300005563 Bacteria 3196
162 Ga0068855_100215913 3300005563 Bacteria 2153
163 Ga0068855_100391200 3300005563 Bacteria 1525
164 Ga0070664_100417318 3300005564 Unclassified 1229
165 Ga0068854_100733226 3300005578 Bacteria 856
166 Ga0068856_100006334 3300005614 Bacteria 11609
167 Ga0068856_100019097 3300005614 Bacteria 6653
168 Ga0068856_100124975 3300005614 Bacteria 2575
169 Ga0068856_100315940 3300005614 Bacteria 1579
170 Ga0068856_100379374 3300005614 Bacteria 1433
171 Ga0070702_100006871 3300005615 Bacteria 5417
172 Ga0070702_100097384 3300005615 Bacteria 1797
173 Ga0070702_100585912 3300005615 Bacteria 834
174 Ga0068852_100072866 3300005616 Bacteria 3020
175 Ga0068852_101955607 3300005616 Bacteria 608
176 Ga0068852_102801298 3300005616 Bacteria 506
177 Ga0068859_100044009 3300005617 Bacteria 4487
178 Ga0068859_102137476 3300005617 Bacteria 618
179 Ga0068864_100920442 3300005618 Bacteria 864
180 Ga0068864_101029324 3300005618 Bacteria 817
181 Ga0068864_102550393 3300005618 Bacteria 517
182 Ga0068866_10004917 3300005718 Bacteria 5494
183 Ga0068866_10637352 3300005718 Bacteria 724
184 Ga0068866_11113840 3300005718 Bacteria 566
185 Ga0068861_100088714 3300005719 Bacteria 2436
186 Ga0068861_100431878 3300005719 Bacteria 1176
187 Ga0068870_10022453 3300005840 Bacteria 3101
188 Ga0068870_10518789 3300005840 Unclassified 797
189 Ga0068863_100335123 3300005841 Bacteria 1471
190 Ga0068863_101897620 3300005841 Bacteria 606
191 Ga0068860_100221601 3300005843 Unclassified 1837
192 Ga0068860_100398203 3300005843 Bacteria 1362
193 Ga0068860_101038128 3300005843 Unclassified 838
194 Ga0068860_102413470 3300005843 Unclassified 546
195 Ga0081455_10409176 3300005937 Bacteria 939
196 Ga0081539_10142486 3300005985 Bacteria 1163
197 Ga0070717_10007976 3300006028 Bacteria 7885
198 Ga0070717_10032371 3300006028 Bacteria 4213
199 Ga0070717_10762202 3300006028 Bacteria 880
200 Ga0070717_11143804 3300006028 Bacteria 709
201 Ga0070717_11234265 3300006028 Bacteria 680
202 Ga0070717_11376358 3300006028 Unclassified 641
203 Ga0075432_10067820 3300006058 Bacteria 1278
204 Ga0070715_10012087 3300006163 Bacteria 3128
205 Ga0070715_10828576 3300006163 Bacteria 564
206 Ga0070716_100330193 3300006173 Bacteria 1072
207 Ga0070716_101634343 3300006173 Unclassified 530
208 Ga0070712_100078687 3300006175 Bacteria 2381
209 Ga0070712_100098783 3300006175 Bacteria 2154
210 Ga0070712_100492019 3300006175 Bacteria 1027
211 Ga0070712_100732521 3300006175 Bacteria 845
212 Ga0070712_100828983 3300006175 Bacteria 795
213 Ga0075367_10962613 3300006178 Bacteria 545
214 Ga0097621_100208813 3300006237 Bacteria 1698
215 Ga0097621_100462764 3300006237 Bacteria 1144
216 Ga0068871_100013932 3300006358 Bacteria 5978
217 Ga0068871_100102089 3300006358 Bacteria 2404
218 Ga0068871_101327441 3300006358 Bacteria 677
219 Ga0075431_100245114 3300006847 Bacteria 1822
220 Ga0075433_10032954 3300006852 Bacteria 4439
221 Ga0075433_10407006 3300006852 Unclassified 1200
222 Ga0075433_11091582 3300006852 Unclassified 694
223 Ga0075434_100030670 3300006871 Bacteria 5296
224 Ga0075434_100075775 3300006871 Bacteria 3358
225 Ga0075434_100359519 3300006871 Bacteria 1477
226 Ga0075434_100563152 3300006871 Bacteria 1159
227 Ga0075434_100668080 3300006871 Bacteria 1057
228 Ga0075434_101205432 3300006871 Bacteria 769
229 Ga0075434_101491305 3300006871 Unclassified 686
230 Ga0068865_100002447 3300006881 Bacteria 10981
231 Ga0068865_100014363 3300006881 Bacteria 5031
232 Ga0068865_101039587 3300006881 Bacteria 719
233 Ga0068865_101220758 3300006881 Bacteria 666
234 Ga0068865_101277837 3300006881 Bacteria 652
235 Ga0075436_100023051 3300006914 Bacteria 4275
236 Ga0075436_100025415 3300006914 Bacteria 4076
237 Ga0097620_100044009 3300006931 Bacteria 4487
238 Ga0097620_102136633 3300006931 Bacteria 618
239 Ga0075435_100000729 3300007076 Bacteria 20397
240 Ga0075435_100008824 3300007076 Bacteria 7262
241 Ga0075435_101616031 3300007076 Bacteria 569
242 Ga0111539_10007764 3300009094 Bacteria 13697
243 Ga0111539_10950637 3300009094 Bacteria 999
244 Ga0111539_11167054 3300009094 Unclassified 895
245 Ga0105245_10067558 3300009098 Bacteria 3238
246 Ga0105245_10280204 3300009098 Bacteria 1629
247 Ga0105245_10344290 3300009098 Bacteria 1475
248 Ga0105245_10537085 3300009098 Unclassified 1190
249 Ga0105245_11473113 3300009098 Bacteria 731
250 Ga0105245_12625668 3300009098 Unclassified 557
251 Ga0105245_12648972 3300009098 Bacteria 554
252 Ga0105245_12938323 3300009098 Bacteria 528
253 Ga0105247_10246670 3300009101 Unclassified 1219
254 Ga0105247_10481939 3300009101 Bacteria 900
255 Ga0105247_10775271 3300009101 Bacteria 729
256 Ga0105247_11209260 3300009101 Bacteria 602
257 Ga0105247_11618496 3300009101 Bacteria 532
258 Ga0114129_10002432 3300009147 Bacteria 25835
259 Ga0114129_10052442 3300009147 Bacteria 5724
260 Ga0114129_10198068 3300009147 Bacteria 2722
261 Ga0114129_10260979 3300009147 Unclassified 2322
262 Ga0114129_10384421 3300009147 Bacteria 1853
263 Ga0114129_11606517 3300009147 Unclassified 796
264 Ga0114129_12627120 3300009147 Bacteria 601
265 Ga0105243_10003824 3300009148 Bacteria 12041
266 Ga0105243_10028730 3300009148 Bacteria 4271
267 Ga0105243_10145387 3300009148 Bacteria 2028
268 Ga0105243_10594517 3300009148 Unclassified 1064
269 Ga0105243_10880415 3300009148 Unclassified 889
270 Ga0105243_11381352 3300009148 Bacteria 724
271 Ga0105241_10499577 3300009174 Bacteria 1084
272 Ga0105241_12483902 3300009174 Bacteria 519
273 Ga0105242_10003423 3300009176 Bacteria 12337
274 Ga0105242_10033783 3300009176 Bacteria 4098
275 Ga0105242_10366867 3300009176 Bacteria 1334
276 Ga0105242_10503809 3300009176 Bacteria 1152
277 Ga0105242_10514446 3300009176 Bacteria 1141
278 Ga0105242_10679578 3300009176 Unclassified 1005
279 Ga0105242_10864895 3300009176 Bacteria 901
280 Ga0105242_11385119 3300009176 Unclassified 730
281 Ga0105242_13291476 3300009176 Bacteria 502
282 Ga0105248_10012945 3300009177 Bacteria 9195
283 Ga0105248_10290675 3300009177 Bacteria 1840
284 Ga0105248_10325855 3300009177 Bacteria 1730
285 Ga0105248_10515917 3300009177 Bacteria 1348
286 Ga0105248_11446796 3300009177 Bacteria 778
287 Ga0105237_10515948 3300009545 Unclassified 1202
288 Ga0105237_12550279 3300009545 Bacteria 522
289 Ga0105238_10123948 3300009551 Bacteria 2563
290 Ga0105238_11000362 3300009551 Unclassified 857
291 Ga0105238_12568878 3300009551 Bacteria 545
292 Ga0105249_10001792 3300009553 Bacteria 18700
293 Ga0105249_11102300 3300009553 Bacteria 864
294 Ga0105249_11411222 3300009553 Bacteria 768
295 Ga0105249_11439250 3300009553 Bacteria 761
296 Ga0105249_11576452 3300009553 Bacteria 729
297 Ga0105249_13273095 3300009553 Bacteria 521
298 Ga0105239_10006563 3300010375 Bacteria 13473
299 Ga0105239_10661247 3300010375 Unclassified 1194
300 Ga0105239_11510191 3300010375 Bacteria 776
301 Ga0105239_11616860 3300010375 Bacteria 749
302 Ga0105239_12746030 3300010375 Unclassified 575
303 Ga0105239_12994387 3300010375 Unclassified 551
304 Ga0105246_10168375 3300011119 Bacteria 1676
305 Ga0105246_10428207 3300011119 Bacteria 1106
306 Ga0105246_12433871 3300011119 Bacteria 514
307 Ga0157373_10546942 3300013100 Unclassified 839
308 Ga0157373_10755650 3300013100 Bacteria 715
309 Ga0157369_10010968 3300013105 Bacteria 10315
310 Ga0157369_10030270 3300013105 Bacteria 5972
311 Ga0157369_10908364 3300013105 Bacteria 903
312 Ga0157369_11145233 3300013105 Bacteria 795
313 Ga0157374_10012233 3300013296 Bacteria 7459
314 Ga0157374_10575700 3300013296 Unclassified 1135
315 Ga0157374_10661230 3300013296 Bacteria 1057
316 Ga0157374_11958134 3300013296 Bacteria 612
317 Ga0157378_10004712 3300013297 Bacteria 11959
318 Ga0157378_10059956 3300013297 Bacteria 3396
319 Ga0157378_10318789 3300013297 Unclassified 1510
320 Ga0157378_11209026 3300013297 Bacteria 795
321 Ga0157378_13040822 3300013297 Unclassified 520
322 Ga0163162_10005507 3300013306 Bacteria 12239
323 Ga0163162_10220218 3300013306 Bacteria 2028
324 Ga0163162_10878044 3300013306 Unclassified 1011
325 Ga0157372_10499303 3300013307 Bacteria 1419
326 Ga0157372_10550663 3300013307 Unclassified 1345
327 Ga0157375_10327919 3300013308 Unclassified 1695
328 Ga0157375_10926392 3300013308 Bacteria 1014
329 Ga0157375_11404638 3300013308 Bacteria 822
330 Ga0157375_13453507 3300013308 Bacteria 526
331 Ga0157375_13737890 3300013308 Unclassified 506
332 Ga0163163_10113274 3300014325 Bacteria 2742
333 Ga0163163_10213174 3300014325 Bacteria 1980
334 Ga0157380_10008142 3300014326 Bacteria 7468
335 Ga0157380_10095551 3300014326 Bacteria 2462
336 Ga0157380_10151368 3300014326 Bacteria 2006
337 Ga0157380_10259385 3300014326 Bacteria 1578
338 Ga0157380_12209236 3300014326 Bacteria 614
339 Ga0182008_10172015 3300014497 Bacteria 1094
340 Ga0182008_10423783 3300014497 Bacteria 719
341 Ga0157377_10009687 3300014745 Unclassified 4739
342 Ga0157377_10076540 3300014745 Bacteria 1946
343 Ga0157377_10252177 3300014745 Bacteria 1144
344 Ga0157377_10260024 3300014745 Bacteria 1129
345 Ga0157379_10020906 3300014968 Bacteria 5791
346 Ga0157379_10361185 3300014968 Unclassified 1331
347 Ga0157379_10718591 3300014968 Unclassified 939
348 Ga0157376_10105712 3300014969 Bacteria 2469
349 Ga0157376_10740124 3300014969 Bacteria 991
350 Ga0157376_10789091 3300014969 Unclassified 962
351 Ga0157376_11175458 3300014969 Unclassified 795
352 Ga0163161_10087553 3300017792 Bacteria 2301
353 Ga0163161_10481392 3300017792 Bacteria 1008
354 Ga0206356_10172331 3300020070 Bacteria 1596
355 Ga0206356_10678942 3300020070 Unclassified 976
356 Ga0206356_10993319 3300020070 Bacteria 645
357 Ga0206356_11167277 3300020070 Unclassified 940
358 Ga0206352_11292620 3300020078 Bacteria 681
359 Ga0206354_10455214 3300020081 Bacteria 2102
360 Ga0206354_10676597 3300020081 Bacteria 2311
361 Ga0206353_10102796 3300020082 Bacteria 615
362 Ga0206353_10372582 3300020082 Bacteria 1946
363 Ga0206353_10675843 3300020082 Unclassified 1175
364 Ga0206353_11625761 3300020082 Bacteria 888
365 Ga0224712_10007070 3300022467 Bacteria 3245
366 Ga0224712_10047123 3300022467 Bacteria 1657
367 Ga0224712_10068353 3300022467 Bacteria 1436
368 Ga0207682_10154266 3300025893 Bacteria 1037
369 Ga0207682_10281490 3300025893 Bacteria 778
370 Ga0207692_10055044 3300025898 Bacteria 2034
371 Ga0207692_10661931 3300025898 Bacteria 675
372 Ga0207642_10016714 3300025899 Bacteria 2772
373 Ga0207642_10127453 3300025899 Bacteria 1323
374 Ga0207642_10283039 3300025899 Bacteria 954
375 Ga0207642_11002624 3300025899 Bacteria 538
376 Ga0207710_10028513 3300025900 Bacteria 2424
377 Ga0207710_10067904 3300025900 Bacteria 1629
378 Ga0207688_10002129 3300025901 Bacteria 10635
379 Ga0207680_10644434 3300025903 Unclassified 758
380 Ga0207680_10863525 3300025903 Bacteria 649
381 Ga0207647_10465061 3300025904 Bacteria 708
382 Ga0207685_10126770 3300025905 Bacteria 1128
383 Ga0207685_10665083 3300025905 Bacteria 564
384 Ga0207699_10158681 3300025906 Unclassified 1504
385 Ga0207699_10323969 3300025906 Bacteria 1082
386 Ga0207699_10395806 3300025906 Bacteria 983
387 Ga0207699_10551525 3300025906 Unclassified 836
388 Ga0207699_10685621 3300025906 Bacteria 750
389 Ga0207645_10545046 3300025907 Unclassified 787
390 Ga0207643_10304662 3300025908 Bacteria 992
391 Ga0207643_10571474 3300025908 Unclassified 726
392 Ga0207705_10779298 3300025909 Bacteria 742
393 Ga0207705_11542996 3300025909 Bacteria 502
394 Ga0207684_10898466 3300025910 Bacteria 745
395 Ga0207684_11060235 3300025910 Bacteria 676
396 Ga0207654_10213377 3300025911 Bacteria 1277
397 Ga0207654_11070562 3300025911 Unclassified 587
398 Ga0207707_10009696 3300025912 Bacteria 8354
399 Ga0207707_10063602 3300025912 Bacteria 3212
400 Ga0207707_10174884 3300025912 Unclassified 1875
401 Ga0207707_10260741 3300025912 Bacteria 1504
402 Ga0207707_10516051 3300025912 Bacteria 1018
403 Ga0207707_11118963 3300025912 Bacteria 641
404 Ga0207695_10066320 3300025913 Bacteria 3708
405 Ga0207695_10699672 3300025913 Unclassified 894
406 Ga0207671_10283450 3300025914 Bacteria 1307
407 Ga0207671_10330692 3300025914 Unclassified 1207
408 Ga0207671_10546126 3300025914 Bacteria 924
409 Ga0207693_10011416 3300025915 Bacteria 7192
410 Ga0207693_10062134 3300025915 Bacteria 2926
411 Ga0207693_10092812 3300025915 Bacteria 2366
412 Ga0207693_10225180 3300025915 Bacteria 1473
413 Ga0207663_10005939 3300025916 Bacteria 6197
414 Ga0207663_10284791 3300025916 Bacteria 1229
415 Ga0207663_10387108 3300025916 Bacteria 1066
416 Ga0207663_10517321 3300025916 Bacteria 929
417 Ga0207663_11057398 3300025916 Bacteria 652
418 Ga0207663_11495085 3300025916 Bacteria 544
419 Ga0207660_10018008 3300025917 Bacteria 4704
420 Ga0207660_10054691 3300025917 Bacteria 2850
421 Ga0207660_10505944 3300025917 Bacteria 980
422 Ga0207660_10637437 3300025917 Unclassified 868
423 Ga0207660_11276870 3300025917 Bacteria 596
424 Ga0207662_10093761 3300025918 Bacteria 1850
425 Ga0207657_10000634 3300025919 Bacteria 37262
426 Ga0207657_10020702 3300025919 Bacteria 6210
427 Ga0207657_10039256 3300025919 Bacteria 4209
428 Ga0207657_10258570 3300025919 Bacteria 1386
429 Ga0207657_10577615 3300025919 Unclassified 878
430 Ga0207652_10011117 3300025921 Bacteria 7255
431 Ga0207652_10311665 3300025921 Bacteria 1420
432 Ga0207652_10453012 3300025921 Bacteria 1156
433 Ga0207652_10633063 3300025921 Bacteria 957
434 Ga0207652_10851545 3300025921 Bacteria 807
435 Ga0207652_11322722 3300025921 Unclassified 623
436 Ga0207652_11851358 3300025921 Bacteria 509
437 Ga0207646_10020445 3300025922 Bacteria 6133
438 Ga0207646_10024163 3300025922 Bacteria 5570
439 Ga0207646_10026800 3300025922 Bacteria 5257
440 Ga0207646_10492678 3300025922 Unclassified 1104
441 Ga0207646_10757078 3300025922 Bacteria 867
442 Ga0207646_11937892 3300025922 Bacteria 501
443 Ga0207681_10429477 3300025923 Bacteria 1072
444 Ga0207694_10027888 3300025924 Bacteria 4303
445 Ga0207694_10067468 3300025924 Bacteria 2792
446 Ga0207694_10476609 3300025924 Bacteria 1043
447 Ga0207694_10743848 3300025924 Bacteria 827
448 Ga0207694_11619420 3300025924 Bacteria 545
449 Ga0207650_10553760 3300025925 Unclassified 964
450 Ga0207659_10094951 3300025926 Bacteria 2235
451 Ga0207659_10469800 3300025926 Bacteria 1061
452 Ga0207659_10548498 3300025926 Unclassified 982
453 Ga0207659_10554439 3300025926 Bacteria 977
454 Ga0207659_10997366 3300025926 Bacteria 720
455 Ga0207659_11716208 3300025926 Bacteria 535
456 Ga0207687_10002883 3300025927 Bacteria 11674
457 Ga0207687_10042917 3300025927 Bacteria 3114
458 Ga0207687_10179844 3300025927 Bacteria 1638
459 Ga0207687_10212040 3300025927 Bacteria 1520
460 Ga0207687_10247152 3300025927 Bacteria 1416
461 Ga0207687_10743390 3300025927 Bacteria 834
462 Ga0207687_10836733 3300025927 Bacteria 786
463 Ga0207700_10143507 3300025928 Bacteria 1965
464 Ga0207700_10380517 3300025928 Bacteria 1234
465 Ga0207700_10569667 3300025928 Bacteria 1006
466 Ga0207664_10004970 3300025929 Bacteria 9047
467 Ga0207664_10051918 3300025929 Bacteria 3240
468 Ga0207664_10094481 3300025929 Bacteria 2457
469 Ga0207664_10159922 3300025929 Bacteria 1920
470 Ga0207664_10469645 3300025929 Bacteria 1124
471 Ga0207664_10563018 3300025929 Bacteria 1023
472 Ga0207664_10756441 3300025929 Unclassified 874
473 Ga0207644_10053241 3300025931 Bacteria 2912
474 Ga0207644_10079005 3300025931 Unclassified 2426
475 Ga0207644_10231332 3300025931 Unclassified 1469
476 Ga0207644_10685979 3300025931 Bacteria 854
477 Ga0207644_11114024 3300025931 Bacteria 663
478 Ga0207644_11443525 3300025931 Bacteria 578
479 Ga0207690_10062330 3300025932 Bacteria 2538
480 Ga0207690_10601228 3300025932 Bacteria 898
481 Ga0207690_10758794 3300025932 Unclassified 800
482 Ga0207690_11382477 3300025932 Unclassified 589
483 Ga0207706_10301561 3300025933 Bacteria 1396
484 Ga0207706_10534891 3300025933 Bacteria 1010
485 Ga0207706_10807827 3300025933 Unclassified 796
486 Ga0207706_11487915 3300025933 Unclassified 553
487 Ga0207686_10055329 3300025934 Bacteria 2489
488 Ga0207686_10093475 3300025934 Bacteria 1991
489 Ga0207686_10330075 3300025934 Bacteria 1142
490 Ga0207686_10536197 3300025934 Bacteria 913
491 Ga0207686_11121636 3300025934 Bacteria 642
492 Ga0207686_11168308 3300025934 Unclassified 629
493 Ga0207709_10002377 3300025935 Bacteria 11868
494 Ga0207709_10151080 3300025935 Bacteria 1609
495 Ga0207709_10394647 3300025935 Unclassified 1056
496 Ga0207709_10717423 3300025935 Bacteria 801
497 Ga0207709_10952123 3300025935 Bacteria 700
498 Ga0207670_10081500 3300025936 Bacteria 2265
499 Ga0207670_10107535 3300025936 Bacteria 2003
500 Ga0207670_10151429 3300025936 Unclassified 1722
501 Ga0207670_11727551 3300025936 Unclassified 532
502 Ga0207669_10029874 3300025937 Bacteria 3020
503 Ga0207669_10063387 3300025937 Bacteria 2282
504 Ga0207669_10178905 3300025937 Bacteria 1518
505 Ga0207669_10269703 3300025937 Bacteria 1278
506 Ga0207669_10382403 3300025937 Unclassified 1097
507 Ga0207669_11040327 3300025937 Bacteria 689
508 Ga0207669_11065469 3300025937 Bacteria 681
509 Ga0207669_11438889 3300025937 Bacteria 587
510 Ga0207704_10002110 3300025938 Bacteria 8920
511 Ga0207704_10083955 3300025938 Bacteria 2069
512 Ga0207704_11259563 3300025938 Bacteria 632
513 Ga0207665_10047629 3300025939 Bacteria 2875
514 Ga0207665_11688697 3300025939 Unclassified 501
515 Ga0207691_10170188 3300025940 Unclassified 1908
516 Ga0207691_10412639 3300025940 Bacteria 1151
517 Ga0207711_10188004 3300025941 Bacteria 1881
518 Ga0207711_10284621 3300025941 Bacteria 1523
519 Ga0207711_10304497 3300025941 Bacteria 1470
520 Ga0207711_10977781 3300025941 Bacteria 786
521 Ga0207711_11364419 3300025941 Unclassified 651
522 Ga0207689_10064532 3300025942 Bacteria 3013
523 Ga0207689_10153100 3300025942 Bacteria 1901
524 Ga0207689_11443332 3300025942 Bacteria 576
525 Ga0207661_10007239 3300025944 Bacteria 7889
526 Ga0207661_10398856 3300025944 Unclassified 1247
527 Ga0207661_10522415 3300025944 Bacteria 1086
528 Ga0207661_10786654 3300025944 Bacteria 876
529 Ga0207661_10797259 3300025944 Bacteria 870
530 Ga0207661_11114765 3300025944 Unclassified 727
531 Ga0207661_11497688 3300025944 Bacteria 618
532 Ga0207679_10131913 3300025945 Bacteria 2006
533 Ga0207679_10734981 3300025945 Bacteria 897
534 Ga0207679_11149697 3300025945 Bacteria 712
535 Ga0207679_12005472 3300025945 Bacteria 527
536 Ga0207667_10014735 3300025949 Bacteria 8897
537 Ga0207667_10071035 3300025949 Bacteria 3622
538 Ga0207667_10278952 3300025949 Unclassified 1708
539 Ga0207667_10381461 3300025949 Bacteria 1436
540 Ga0207667_10472124 3300025949 Unclassified 1274
541 Ga0207667_10652743 3300025949 Unclassified 1058
542 Ga0207651_10257990 3300025960 Bacteria 1430
543 Ga0207651_10328927 3300025960 Bacteria 1280
544 Ga0207651_10854940 3300025960 Bacteria 809
545 Ga0207651_10986231 3300025960 Unclassified 752
546 Ga0207651_11570052 3300025960 Bacteria 593
547 Ga0207712_10049053 3300025961 Bacteria 2940
548 Ga0207712_10751797 3300025961 Bacteria 854
549 Ga0207712_10831429 3300025961 Bacteria 813
550 Ga0207712_11031570 3300025961 Bacteria 730
551 Ga0207712_11409175 3300025961 Unclassified 624
552 Ga0207668_10422558 3300025972 Bacteria 1132
553 Ga0207640_10035199 3300025981 Bacteria 3132
554 Ga0207640_10209330 3300025981 Unclassified 1484
555 Ga0207640_10320503 3300025981 Bacteria 1234
556 Ga0207640_10473701 3300025981 Bacteria 1037
557 Ga0207640_10503988 3300025981 Bacteria 1009
558 Ga0207640_10616488 3300025981 Bacteria 920
559 Ga0207640_11648689 3300025981 Bacteria 578
560 Ga0207658_11052806 3300025986 Unclassified 743
561 Ga0207658_12037101 3300025986 Unclassified 522
562 Ga0207677_10029819 3300026023 Bacteria 3473
563 Ga0207677_10041071 3300026023 Bacteria 3055
564 Ga0207677_10134929 3300026023 Unclassified 1880
565 Ga0207677_10247502 3300026023 Bacteria 1446
566 Ga0207703_10054226 3300026035 Bacteria 3260
567 Ga0207703_10194060 3300026035 Unclassified 1801
568 Ga0207703_11038658 3300026035 Bacteria 787
569 Ga0207639_10168366 3300026041 Unclassified 1853
570 Ga0207639_10412337 3300026041 Bacteria 1219
571 Ga0207639_11178178 3300026041 Bacteria 719
572 Ga0207678_10028844 3300026067 Unclassified 4845
573 Ga0207678_10461043 3300026067 Bacteria 1105
574 Ga0207678_10572544 3300026067 Bacteria 989
575 Ga0207678_10860238 3300026067 Bacteria 801
576 Ga0207708_10001783 3300026075 Bacteria 15882
577 Ga0207708_10022225 3300026075 Bacteria 4789
578 Ga0207708_10225572 3300026075 Unclassified 1503
579 Ga0207708_10449974 3300026075 Bacteria 1072
580 Ga0207708_10726645 3300026075 Bacteria 851
581 Ga0207702_10006756 3300026078 Bacteria 9845
582 Ga0207702_10029006 3300026078 Unclassified 4602
583 Ga0207702_10043354 3300026078 Bacteria 3777
584 Ga0207702_10108322 3300026078 Bacteria 2465
585 Ga0207702_10120971 3300026078 Bacteria 2343
586 Ga0207702_10251169 3300026078 Bacteria 1661
587 Ga0207702_10499984 3300026078 Unclassified 1185
588 Ga0207641_10505792 3300026088 Bacteria 1174
589 Ga0207641_11012330 3300026088 Bacteria 828
590 Ga0207648_10002707 3300026089 Bacteria 18858
591 Ga0207648_10147193 3300026089 Bacteria 2078
592 Ga0207648_10279515 3300026089 Bacteria 1493
593 Ga0207648_10380207 3300026089 Bacteria 1277
594 Ga0207648_11128089 3300026089 Bacteria 736
595 Ga0207648_11488528 3300026089 Bacteria 636
596 Ga0207676_10810236 3300026095 Bacteria 914
597 Ga0207676_10904023 3300026095 Bacteria 866
598 Ga0207676_12378160 3300026095 Unclassified 527
599 Ga0207674_11861390 3300026116 Bacteria 568
600 Ga0207675_100319986 3300026118 Bacteria 1514
601 Ga0207675_100708291 3300026118 Bacteria 1016
602 Ga0207675_101319701 3300026118 Unclassified 742
603 Ga0207683_10000699 3300026121 Bacteria 30634
604 Ga0207683_10020326 3300026121 Bacteria 5677
605 Ga0207683_10038254 3300026121 Bacteria 4180
606 Ga0207683_10042579 3300026121 Bacteria 3966
607 Ga0207683_10095111 3300026121 Bacteria 2656
608 Ga0207683_10149892 3300026121 Bacteria 2105
609 Ga0207683_11027164 3300026121 Bacteria 765
610 Ga0207683_11451711 3300026121 Bacteria 634
611 Ga0207683_11610444 3300026121 Bacteria 599
612 Ga0207683_12009757 3300026121 Bacteria 526
613 Ga0207698_10095146 3300026142 Bacteria 2451
614 Ga0207698_10149617 3300026142 Bacteria 2024
615 Ga0268266_10093455 3300028379 Bacteria 2639
616 Ga0268266_11662482 3300028379 Unclassified 614
617 Ga0268265_10248599 3300028380 Bacteria 1574
618 Ga0268265_10280885 3300028380 Bacteria 1490
619 Ga0268264_10166989 3300028381 Unclassified 1988
620 Ga0268264_10174346 3300028381 Bacteria 1948
621 Ga0268264_10278200 3300028381 Bacteria 1566
622 Ga0268264_11772661 3300028381 Unclassified 628
623 Ga0265326_10004431 3300028558 Bacteria 4499
624 Ga0265319_1039859 3300028563 Bacteria 1590
625 Ga0265319_1183755 3300028563 Unclassified 644
626 Ga0265334_10002745 3300028573 Bacteria 8136
627 Ga0265334_10063249 3300028573 Bacteria 1391
628 Ga0265318_10003154 3300028577 Bacteria 8431
629 Ga0265323_10052375 3300028653 Bacteria 1444
630 Ga0265338_10011051 3300028800 Bacteria 10473
631 Ga0265338_10049930 3300028800 Bacteria 3786
632 Ga0265338_10252698 3300028800 Unclassified 1300
633 Ga0265324_10047255 3300029957 Bacteria 1481
634 Ga0265330_10003366 3300031235 Bacteria 8386
635 Ga0265332_10015422 3300031238 Bacteria 3372
636 Ga0265332_10496749 3300031238 Unclassified 505
637 Ga0265328_10004140 3300031239 Bacteria 6325
638 Ga0265320_10291301 3300031240 Unclassified 722
639 Ga0265325_10007375 3300031241 Bacteria 6585
640 Ga0265329_10010827 3300031242 Bacteria 3335
641 Ga0265340_10003923 3300031247 Bacteria 8377
642 Ga0265331_10032605 3300031250 Bacteria 2580
643 Ga0265327_10008410 3300031251 Bacteria 7691
644 Ga0265327_10141872 3300031251 Bacteria 1122
645 Ga0265316_10069891 3300031344 Bacteria 2709
646 Ga0307408_100562109 3300031548 Bacteria 1008
647 Ga0307408_102093537 3300031548 Bacteria 545
648 Ga0265313_10005872 3300031595 Bacteria 8903
649 Ga0265314_10076599 3300031711 Bacteria 2221
650 Ga0265342_10060378 3300031712 Bacteria 2236
651 Ga0265342_10082671 3300031712 Bacteria 1852
652 Ga0307405_10309853 3300031731 Bacteria 1201
653 Ga0307413_10150376 3300031824 Bacteria 1621
654 Ga0307410_10133577 3300031852 Bacteria 1826
655 Ga0307406_10890562 3300031901 Bacteria 757
656 Ga0307406_11806593 3300031901 Bacteria 543
657 Ga0307407_10079347 3300031903 Bacteria 1980
658 Ga0307412_11090809 3300031911 Bacteria 710
659 Ga0307409_100060984 3300031995 Bacteria 2945
660 Ga0307409_100390166 3300031995 Bacteria 1326
661 Ga0307409_101091193 3300031995 Bacteria 819
662 Ga0307416_100777964 3300032002 Bacteria 1051
663 Ga0307416_102108532 3300032002 Bacteria 666
664 Ga0307416_103728462 3300032002 Bacteria 510
665 Ga0373934_0063858 3300035086 Unclassified 1469
666 Ga0373940_0320095 3300035088 Bacteria 538
667 Ga0373944_0006456 3300035089 Bacteria 3116
668 Ga0373923_0023565 3300035111 Bacteria 2423
669 Ga0373932_0405959 3300035112 Unclassified 528
670 Ga0373936_0026574 3300035113 Bacteria 2267
671 Ga0373941_0097663 3300035115 Unclassified 1018
672 Ga0373941_0403348 3300035115 Bacteria 566
673 Ga0373945_0005948 3300035116 Bacteria 3918
674 Ga0373945_0347016 3300035116 Bacteria 643
675 Ga0373956_0060749 3300035119 Unclassified 1712
676 Ga0373943_0001876 3300035170 Bacteria 9505
677 Ga0373943_0055277 3300035170 Bacteria 1966
678 Ga0373943_0574757 3300035170 Bacteria 662
679 Ga0373946_0061295 3300035171 Unclassified 1601
680 Ga0373955_0316646 3300035172 Unclassified 942
681 Ga0373942_0311451 3300035207 Unclassified 549
682 Ga0373924_0022475 3300035410 Bacteria 2466
683 Ga0373931_1287311 3300035691 Bacteria 503
684 Ga0373935_0023556 3300035692 Bacteria 3784
685 Ga0373935_0811979 3300035692 Unclassified 691
686 Ga0373927_0015218 3300035695 Bacteria 5084
687 Ga0373927_0461873 3300035695 Bacteria 839
688 Ga0373933_0172615 3300035724 Bacteria 1376
689 Ga0373947_0005562 3300035725 Bacteria 7344
690 Ga0373947_0188339 3300035725 Bacteria 1346
691 Ga0373947_0467779 3300035725 Bacteria 855
692 Ga0373947_0741252 3300035725 Unclassified 670
693 Ga0373937_0030848 3300036401 Bacteria 4855
694 Ga0373925_0006097 3300037068 Bacteria 8917
695 Ga0373925_0077407 3300037068 Bacteria 2524
696 Ga0395899_0006013 3300037312 Bacteria 9421
697 Ga0395899_0010325 3300037312 Bacteria 7159
698 Ga0395899_0018595 3300037312 Bacteria 5280
699 Ga0395899_0019784 3300037312 Bacteria 5109
700 Ga0395899_0021385 3300037312 Bacteria 4906
701 Ga0395899_0034223 3300037312 Bacteria 3814
702 Ga0395899_0919223 3300037312 Bacteria 532
703 Ga0395900_0005086 3300037418 Bacteria 13803
704 Ga0395900_0030800 3300037418 Bacteria 5509
705 Ga0395900_0040417 3300037418 Bacteria 4806
706 Ga0395900_0071158 3300037418 Bacteria 3575
707 Ga0395900_0105601 3300037418 Bacteria 2894
708 Ga0395900_0123245 3300037418 Bacteria 2658
709 Ga0395900_0141996 3300037418 Bacteria 2458
710 Ga0395900_0519651 3300037418 Bacteria 1139
711 Ga0395900_0581837 3300037418 Bacteria 1061
712 Ga0395900_0885359 3300037418 Unclassified 817
713 Ga0395900_1785947 3300037418 Bacteria 525
714 Ga0395898_0004841 3300037466 Bacteria 14635
715 Ga0395898_0015334 3300037466 Bacteria 7859
716 Ga0395898_0015934 3300037466 Bacteria 7703
717 Ga0395898_0052076 3300037466 Bacteria 4000
718 Ga0395898_0060561 3300037466 Bacteria 3678
719 Ga0395898_0230569 3300037466 Bacteria 1766
720 Ga0395898_0389713 3300037466 Bacteria 1328
721 Ga0395898_1352261 3300037466 Bacteria 641
722 Ga0395898_1646242 3300037466 Unclassified 565
723 Ga0395898_1718011 3300037466 Bacteria 550
724 Ga0395905_0006168 3300037471 Bacteria 12099
725 Ga0395905_0011152 3300037471 Bacteria 8690
726 Ga0395905_0027947 3300037471 Bacteria 5319
727 Ga0395905_0064124 3300037471 Bacteria 3437
728 Ga0395905_0088822 3300037471 Bacteria 2896
729 Ga0395905_0131753 3300037471 Bacteria 2351
730 Ga0395905_0146092 3300037471 Bacteria 2225
731 Ga0395905_0162955 3300037471 Unclassified 2095
732 Ga0395905_0286674 3300037471 Unclassified 1533
733 Ga0395905_0378826 3300037471 Bacteria 1309
734 Ga0395905_0476674 3300037471 Unclassified 1147
735 Ga0395905_0570849 3300037471 Bacteria 1032
736 Ga0395905_1179642 3300037471 Bacteria 669
737 Ga0395905_1557512 3300037471 Unclassified 565
738 Ga0395901_0002976 3300038443 Bacteria 17087
739 Ga0395901_0004555 3300038443 Bacteria 13988
740 Ga0395901_0012209 3300038443 Bacteria 8718
741 Ga0395901_0032039 3300038443 Bacteria 5423
742 Ga0395901_0074131 3300038443 Bacteria 3550
743 Ga0395901_0126740 3300038443 Bacteria 2683
744 Ga0395901_0137165 3300038443 Bacteria 2571
745 Ga0395901_0138741 3300038443 Bacteria 2555
746 Ga0395901_0149601 3300038443 Bacteria 2453
747 Ga0395901_0269273 3300038443 Unclassified 1772
748 Ga0395901_0285109 3300038443 Bacteria 1715
749 Ga0395901_1501230 3300038443 Unclassified 630
750 Ga0395901_1670391 3300038443 Bacteria 589
751 Ga0436360_1209873 3300039438 Bacteria 8972
752 Ga0436361_0026300 3300039447 Bacteria 515
753 Ga0436363_0518779 3300039450 Unclassified 546
754 Ga0451789_0380733 3300041443 Bacteria 502
755 Ga0451793_1706676 3300041452 Bacteria 594
756 Ga0451802_0705323 3300041460 Bacteria 627
757 Ga0451835_0621129 3300041492 Unclassified 686
758 Ga0451839_1641712 3300041496 Bacteria 620
759 Ga0451853_0117807 3300041512 Unclassified 504
760 Ga0451853_3775861 3300041512 Bacteria 679
761 Ga0439441_014949 3300042001 Bacteria 1367
762 Ga0439448_0173777 3300042005 Bacteria 752
763 Ga0450920_121881 3300042122 Bacteria 547
764 Ga0450907_025673 3300042146 Bacteria 996
765 Ga0439464_0251447 3300042439 Unclassified 571
766 Ga0451577_1463288 3300042876 Unclassified 605
767 Ga0466969_0019364 3300044656 Bacteria 3540
768 Ga0466969_0042798 3300044656 Unclassified 2258
769 Ga0466969_0106436 3300044656 Unclassified 1316
770 Ga0466972_0273988 3300044658 Bacteria 789
771 Ga0466965_0604843 3300044683 Unclassified 623
772 Ga0466966_0101649 3300044684 Bacteria 1777
773 Ga0466966_0203378 3300044684 Unclassified 1198
774 Ga0466966_0273398 3300044684 Unclassified 1016
775 Ga0466966_0790636 3300044684 Bacteria 572
776 Ga0466961_0072060 3300044693 Bacteria 2192
777 Ga0466961_0149887 3300044693 Bacteria 1456
778 Ga0466961_0201710 3300044693 Unclassified 1230
779 Ga0466961_0755438 3300044693 Bacteria 581
780 Ga0466963_0009099 3300044694 Bacteria 5970
781 Ga0466963_0490667 3300044694 Unclassified 867
782 Ga0466964_0079595 3300044706 Bacteria 1404
783 Ga0466964_0194053 3300044706 Bacteria 971
784 Ga0453684_1382627 3300044712 Bacteria 731
785 Ga0466971_0116994 3300044719 Unclassified 1232
786 Ga0466968_0024836 3300044735 Bacteria 2451
787 Ga0466968_0325614 3300044735 Unclassified 743
788 Ga0466957_0088704 3300044842 Bacteria 1935
789 Ga0466960_0152888 3300044901 Bacteria 1234
790 Ga0466960_0515195 3300044901 Bacteria 702
791 Ga0466959_0014947 3300045049 Bacteria 5656
792 Ga0466959_0037335 3300045049 Bacteria 3589
793 Ga0466959_0205622 3300045049 Bacteria 1369
794 Ga0451576_1824563 3300045051 Bacteria 628
795 Ga0466958_0029671 3300045836 Bacteria 3245
796 Ga0466958_0037298 3300045836 Bacteria 2913
797 Ga0466967_0020616 3300045976 Bacteria 5333
798 Ga0466967_0036183 3300045976 Bacteria 4212
799 Ga0466967_0038364 3300045976 Bacteria 4108
800 Ga0466967_0044354 3300045976 Bacteria 3857
801 Ga0466967_0085141 3300045976 Bacteria 2862
802 Ga0466967_0167800 3300045976 Bacteria 2063
803 Ga0466967_0194932 3300045976 Bacteria 1916
804 Ga0466967_2451757 3300045976 Unclassified 517
805 Ga0495592_0092780 3300046454 Bacteria 2163
806 Ga0495592_0371206 3300046454 Bacteria 913
807 Ga0495603_0051729 3300046455 Unclassified 2440
808 Ga0495603_0387355 3300046455 Bacteria 801
809 Ga0495629_0027827 3300046459 Bacteria 4015
810 Ga0495629_0135213 3300046459 Bacteria 1716
811 Ga0495629_0165592 3300046459 Bacteria 1535
812 Ga0495629_0252963 3300046459 Bacteria 1212
813 Ga0495629_1022820 3300046459 Unclassified 537
814 Ga0495629_1028762 3300046459 Unclassified 535
815 Ga0495641_0003765 3300046461 Bacteria 11150
816 Ga0495641_0107080 3300046461 Bacteria 1247
817 Ga0495641_0122006 3300046461 Bacteria 1163
818 Ga0495651_0095140 3300046462 Bacteria 2228
819 Ga0495651_0404239 3300046462 Bacteria 891
820 Ga0495651_0683285 3300046462 Bacteria 641
821 Ga0495653_0005235 3300046463 Bacteria 10547
822 Ga0495580_0326341 3300046472 Bacteria 1043
823 Ga0495580_0788469 3300046472 Bacteria 617
824 Ga0495582_0002392 3300046473 Bacteria 10485
825 Ga0495582_0061575 3300046473 Bacteria 2072
826 Ga0495582_0148979 3300046473 Bacteria 1328
827 Ga0495582_0149991 3300046473 Bacteria 1323
828 Ga0495582_0431465 3300046473 Unclassified 760
829 Ga0495582_0768032 3300046473 Unclassified 558
830 Ga0495605_0226241 3300046474 Bacteria 807
831 Ga0495605_0233847 3300046474 Unclassified 791
832 Ga0495639_0002167 3300046475 Bacteria 8650
833 Ga0495639_0042740 3300046475 Bacteria 2045
834 Ga0495639_0613859 3300046475 Bacteria 559
835 Ga0495662_0032603 3300046476 Bacteria 2517
836 Ga0495662_0104749 3300046476 Bacteria 1384
837 Ga0495662_0440127 3300046476 Bacteria 640
838 Ga0495664_0107281 3300046477 Unclassified 1685
839 Ga0495584_0120605 3300046491 Unclassified 1328
840 Ga0495584_0253988 3300046491 Bacteria 894
841 Ga0495585_0143746 3300046492 Bacteria 1248
842 Ga0495594_0004059 3300046499 Bacteria 7526
843 Ga0495594_0109794 3300046499 Unclassified 1555
844 Ga0495594_0136226 3300046499 Unclassified 1392
845 Ga0495594_0649606 3300046499 Bacteria 597
846 Ga0495594_0810808 3300046499 Bacteria 527
847 Ga0495608_0006095 3300046511 Bacteria 8553
848 Ga0495618_0004507 3300046514 Bacteria 8560
849 Ga0495628_0072630 3300046516 Bacteria 2681
850 Ga0495628_0388405 3300046516 Bacteria 1021
851 Ga0495630_0003907 3300046517 Bacteria 10421
852 Ga0495630_0051113 3300046517 Bacteria 3093
853 Ga0495630_0221660 3300046517 Bacteria 1444
854 Ga0495630_1186127 3300046517 Bacteria 577
855 Ga0495631_0175973 3300046518 Unclassified 917
856 Ga0495631_0458531 3300046518 Bacteria 543
857 Ga0495644_0120273 3300046523 Unclassified 999
858 Ga0495644_0207396 3300046523 Unclassified 756
859 Ga0495644_0407523 3300046523 Bacteria 539
860 Ga0495666_0091585 3300046526 Bacteria 1434
861 Ga0495666_0192538 3300046526 Unclassified 939
862 Ga0495642_0252935 3300046528 Bacteria 770
863 Ga0495652_0116556 3300046529 Bacteria 2138
864 Ga0495652_0200275 3300046529 Bacteria 1516
865 Ga0495665_0001485 3300046531 Bacteria 12559
866 Ga0495665_0014212 3300046531 Bacteria 4295
867 Ga0495640_0003074 3300046533 Bacteria 13442
868 Ga0495640_0228717 3300046533 Bacteria 1170
869 Ga0495640_0441513 3300046533 Unclassified 796
870 Ga0495587_0043290 3300046536 Bacteria 2681
871 Ga0495598_0170055 3300046537 Bacteria 772
872 Ga0495598_0361835 3300046537 Unclassified 560
873 Ga0495609_0089082 3300046538 Unclassified 1343
874 Ga0495645_0200585 3300046543 Bacteria 1354
875 Ga0495645_0225258 3300046543 Unclassified 1259
876 Ga0495622_0169833 3300046557 Bacteria 981
877 Ga0495667_0006817 3300046559 Bacteria 7753
878 Ga0495667_0968678 3300046559 Unclassified 520
879 Ga0495656_0098949 3300046615 Unclassified 1346
880 Ga0495656_0198459 3300046615 Bacteria 994
881 Ga0495656_0426621 3300046615 Bacteria 696
882 Ga0495656_0460713 3300046615 Bacteria 671
883 Ga0495656_0479664 3300046615 Bacteria 658
884 Ga0495668_0639610 3300046616 Bacteria 588
885 Ga0495634_0003097 3300046642 Bacteria 13519
886 Ga0495634_0014856 3300046642 Bacteria 5599
887 Ga0495634_0031690 3300046642 Unclassified 3640
888 Ga0495634_0505940 3300046642 Bacteria 708
889 Ga0495635_0022878 3300046663 Bacteria 4356
890 Ga0495635_0067755 3300046663 Bacteria 2448
891 Ga0495635_0131446 3300046663 Unclassified 1706
892 Ga0495661_0220203 3300046665 Unclassified 984
893 Ga0495588_0017098 3300046674 Bacteria 3515
894 Ga0495588_0085922 3300046674 Unclassified 1645
895 Ga0495588_0199384 3300046674 Bacteria 1057
896 Ga0495588_0439639 3300046674 Bacteria 684
897 Ga0495657_0122511 3300046675 Bacteria 1636
898 Ga0495599_0172079 3300046678 Unclassified 1336
899 Ga0495623_0078324 3300046679 Bacteria 2049
900 Ga0495623_0575252 3300046679 Bacteria 587
901 Ga0495647_0000597 3300046681 Bacteria 10685
902 Ga0495647_0012783 3300046681 Bacteria 2896
903 Ga0495647_0099549 3300046681 Bacteria 1202
904 Ga0495647_0212570 3300046681 Unclassified 851
905 Ga0495647_0425018 3300046681 Unclassified 613
906 Ga0495658_0012490 3300046683 Bacteria 4304
907 Ga0495658_0534938 3300046683 Bacteria 750
908 Ga0495613_0005558 3300046689 Bacteria 9465
909 Ga0495613_0043999 3300046689 Bacteria 3304
910 Ga0495613_0173605 3300046689 Bacteria 1529
911 Ga0495624_0006496 3300046690 Bacteria 8290
912 Ga0495624_0011613 3300046690 Bacteria 6050
913 Ga0495624_0416550 3300046690 Unclassified 806
914 Ga0495624_0539623 3300046690 Bacteria 697
915 Ga0495670_0247954 3300046691 Bacteria 949
916 Ga0495670_0511229 3300046691 Bacteria 653
917 Ga0495671_0176532 3300046692 Bacteria 1038
918 Ga0495589_0467220 3300046794 Bacteria 577
919 Ga0495600_0003143 3300046809 Bacteria 9663
920 Ga0495581_0001437 3300047315 Bacteria 13221
921 Ga0495581_0003775 3300047315 Bacteria 8717
922 Ga0495581_0032656 3300047315 Bacteria 3014
923 Ga0495581_0068099 3300047315 Bacteria 2058
924 Ga0495604_0018043 3300047317 Bacteria 5647
925 Ga0495674_0004046 3300047319 Bacteria 14189
926 Ga0495674_0029902 3300047319 Bacteria 4956
927 Ga0495676_0002012 3300047321 Bacteria 17904
928 Ga0495676_0016250 3300047321 Bacteria 6609
929 Ga0495676_0017412 3300047321 Bacteria 6355
930 Ga0495676_0083518 3300047321 Bacteria 2413
931 Ga0495676_1076645 3300047321 Unclassified 511
932 Ga0495680_0012939 3300047322 Bacteria 7310
933 Ga0495680_0189204 3300047322 Bacteria 1481
934 Ga0495677_0218850 3300047445 Bacteria 742
935 Ga0495684_0002922 3300047471 Bacteria 13450
936 Ga0495684_0265396 3300047471 Bacteria 1244
937 Ga0495593_0005440 3300047673 Bacteria 7524
938 Ga0495602_0549458 3300048088 Bacteria 801
939 Ga0495602_0602377 3300048088 Unclassified 755
940 Ga0495614_0007485 3300048089 Bacteria 4861
941 Ga0496100_0001463 3300048903 Bacteria 11564
942 Ga0496100_0001838 3300048903 Bacteria 10605
943 Ga0496100_0016897 3300048903 Bacteria 4293
944 Ga0496100_0030771 3300048903 Bacteria 3332
945 Ga0496100_0057468 3300048903 Bacteria 2548
946 Ga0496100_0086650 3300048903 Bacteria 2128
947 Ga0496100_0103101 3300048903 Bacteria 1969
948 Ga0496100_0299958 3300048903 Bacteria 1202
949 Ga0496100_0812803 3300048903 Bacteria 733
950 Ga0496101_0001319 3300048904 Bacteria 14841
951 Ga0496101_0003443 3300048904 Bacteria 9876
952 Ga0496101_0008890 3300048904 Bacteria 6577
953 Ga0496101_0010095 3300048904 Bacteria 6225
954 Ga0496101_0011879 3300048904 Bacteria 5797
955 Ga0496101_0014879 3300048904 Bacteria 5236
956 Ga0496101_0017205 3300048904 Bacteria 4899
957 Ga0496101_0034788 3300048904 Bacteria 3561
958 Ga0496101_0264692 3300048904 Unclassified 1341
959 Ga0496101_0685391 3300048904 Bacteria 809
960 Ga0496101_0984644 3300048904 Bacteria 663
961 Ga0496101_1292166 3300048904 Bacteria 571
962 Ga0496102_0002028 3300048905 Bacteria 17499
963 Ga0496102_0002197 3300048905 Bacteria 16755
964 Ga0496102_0009883 3300048905 Bacteria 8204
965 Ga0496102_0021038 3300048905 Bacteria 5769
966 Ga0496102_0034991 3300048905 Bacteria 4521
967 Ga0496102_0038224 3300048905 Bacteria 4330
968 Ga0496102_0123627 3300048905 Bacteria 2418
969 Ga0496102_0209187 3300048905 Bacteria 1839
970 Ga0496102_0459717 3300048905 Bacteria 1194
971 Ga0496102_0640824 3300048905 Bacteria 986
972 Ga0496102_0747895 3300048905 Bacteria 900
973 Ga0496102_1419754 3300048905 Bacteria 613
974 Ga0496102_1756911 3300048905 Bacteria 538
975 Ga0496103_0002459 3300048906 Bacteria 11640
976 Ga0496103_0005119 3300048906 Bacteria 7892
977 Ga0496103_0042072 3300048906 Bacteria 2810
978 Ga0496103_0050758 3300048906 Bacteria 2566
979 Ga0496103_0109477 3300048906 Unclassified 1754
980 Ga0496103_0203559 3300048906 Unclassified 1273
981 Ga0496104_0002034 3300048907 Bacteria 17569
982 Ga0496104_0009484 3300048907 Bacteria 8662
983 Ga0496104_0027989 3300048907 Bacteria 5220
984 Ga0496104_0050038 3300048907 Bacteria 3942
985 Ga0496104_0076590 3300048907 Bacteria 3186
986 Ga0496104_0093795 3300048907 Bacteria 2872
987 Ga0496104_0137476 3300048907 Bacteria 2347
988 Ga0496104_0157532 3300048907 Bacteria 2179
989 Ga0496104_0157545 3300048907 Bacteria 2179
990 Ga0496104_0216653 3300048907 Bacteria 1826
991 Ga0496104_0317370 3300048907 Unclassified 1471
992 Ga0496104_0694903 3300048907 Bacteria 925
993 Ga0496105_0000050 3300048908 Bacteria 93402
994 Ga0496105_0005525 3300048908 Bacteria 9592
995 Ga0496105_0017579 3300048908 Bacteria 5736
996 Ga0496105_0020971 3300048908 Bacteria 5285
997 Ga0496105_0021711 3300048908 Bacteria 5195
998 Ga0496105_0074654 3300048908 Bacteria 2801
999 Ga0496105_0266566 3300048908 Bacteria 1384
1000 Ga0496105_0292343 3300048908 Bacteria 1311
1001 Ga0496105_1030859 3300048908 Bacteria 614
1002 Ga0496105_1069247 3300048908 Bacteria 600
1003 Ga0496106_0002042 3300048909 Bacteria 15175
1004 Ga0496106_0004053 3300048909 Bacteria 10936
1005 Ga0496106_0005239 3300048909 Bacteria 9608
1006 Ga0496106_0010325 3300048909 Bacteria 6902
1007 Ga0496106_0012413 3300048909 Bacteria 6290
1008 Ga0496106_0034609 3300048909 Bacteria 3774
1009 Ga0496106_0047440 3300048909 Bacteria 3233
1010 Ga0496106_0055581 3300048909 Bacteria 2992
1011 Ga0496106_0227940 3300048909 Bacteria 1487
1012 Ga0496106_0479808 3300048909 Bacteria 999
1013 Ga0496106_0823729 3300048909 Bacteria 735
1014 Ga0496107_0000545 3300048910 Bacteria 21061
1015 Ga0496107_0002007 3300048910 Bacteria 12981
1016 Ga0496107_0012651 3300048910 Bacteria 5892
1017 Ga0496107_0013425 3300048910 Bacteria 5726
1018 Ga0496107_0014162 3300048910 Bacteria 5583
1019 Ga0496107_0017801 3300048910 Bacteria 5000
1020 Ga0496107_0029698 3300048910 Bacteria 3891
1021 Ga0496107_0041450 3300048910 Bacteria 3305
1022 Ga0496107_0299375 3300048910 Bacteria 1197
1023 Ga0496107_0578983 3300048910 Bacteria 830
1024 Ga0496108_0000403 3300048911 Bacteria 35617
1025 Ga0496108_0001800 3300048911 Bacteria 17082
1026 Ga0496108_0009997 3300048911 Bacteria 7690
1027 Ga0496108_0075476 3300048911 Bacteria 2848
1028 Ga0496108_0171854 3300048911 Bacteria 1875
1029 Ga0496108_0203356 3300048911 Bacteria 1719
1030 Ga0496108_0258076 3300048911 Bacteria 1517
1031 Ga0496108_0295580 3300048911 Unclassified 1410
1032 Ga0496108_0525956 3300048911 Bacteria 1032
1033 Ga0496108_1318927 3300048911 Bacteria 606
1034 Ga0496109_0001203 3300048912 Bacteria 21542
1035 Ga0496109_0001324 3300048912 Bacteria 20434
1036 Ga0496109_0002451 3300048912 Bacteria 15544
1037 Ga0496109_0002493 3300048912 Bacteria 15427
1038 Ga0496109_0003464 3300048912 Bacteria 13180
1039 Ga0496109_0023041 3300048912 Bacteria 5521
1040 Ga0496109_0045380 3300048912 Bacteria 3987
1041 Ga0496109_0093792 3300048912 Bacteria 2778
1042 Ga0496109_0171071 3300048912 Bacteria 2038
1043 Ga0496109_0602784 3300048912 Bacteria 1034
1044 Ga0496109_0669972 3300048912 Bacteria 975
1045 Ga0496109_0737659 3300048912 Bacteria 923
1046 Ga0496109_1254325 3300048912 Bacteria 677
1047 Ga0496109_1398681 3300048912 Bacteria 635
1048 Ga0496109_1562503 3300048912 Bacteria 594
1049 Ga0496109_1888947 3300048912 Bacteria 530
1050 Ga0496110_0001093 3300048913 Bacteria 19108
1051 Ga0496110_0004541 3300048913 Bacteria 10773
1052 Ga0496110_0030818 3300048913 Bacteria 4625
1053 Ga0496110_0060428 3300048913 Bacteria 3342
1054 Ga0496110_0079358 3300048913 Bacteria 2922
1055 Ga0496110_0254054 3300048913 Bacteria 1600
1056 Ga0496110_0365085 3300048913 Bacteria 1315
1057 Ga0496111_0003419 3300048914 Bacteria 9822
1058 Ga0496111_0005179 3300048914 Bacteria 8311
1059 Ga0496111_0014563 3300048914 Bacteria 5376
1060 Ga0496111_0083991 3300048914 Unclassified 2327
1061 Ga0496111_0109252 3300048914 Bacteria 2036
1062 Ga0496111_0208267 3300048914 Bacteria 1453
1063 Ga0496111_0236481 3300048914 Bacteria 1357
1064 Ga0496111_0680124 3300048914 Bacteria 749
1065 Ga0496111_0776692 3300048914 Bacteria 694
1066 Ga0496112_0004222 3300048915 Bacteria 12122
1067 Ga0496112_0044728 3300048915 Unclassified 4339
1068 Ga0496112_0063315 3300048915 Bacteria 3648
1069 Ga0496112_0106184 3300048915 Bacteria 2778
1070 Ga0496112_0113533 3300048915 Bacteria 2680
1071 Ga0496112_0132923 3300048915 Bacteria 2459
1072 Ga0496112_0201869 3300048915 Bacteria 1947
1073 Ga0496112_0663892 3300048915 Bacteria 972
1074 Ga0496112_1218657 3300048915 Bacteria 669
1075 Ga0496112_1379663 3300048915 Bacteria 619
1076 Ga0496113_0000452 3300048916 Bacteria 19933
1077 Ga0496113_0030876 3300048916 Bacteria 3883
1078 Ga0496113_0084448 3300048916 Bacteria 2438
1079 Ga0496113_0124353 3300048916 Bacteria 2019
1080 Ga0496113_0210068 3300048916 Bacteria 1549
1081 Ga0496113_0243560 3300048916 Unclassified 1435
1082 Ga0496113_0653831 3300048916 Bacteria 841
1083 Ga0496113_0840575 3300048916 Bacteria 728
1084 Ga0496113_1090558 3300048916 Unclassified 626
1085 Ga0496113_1544248 3300048916 Bacteria 512
1086 Ga0496114_0002175 3300048917 Bacteria 14929
1087 Ga0496114_0003284 3300048917 Bacteria 12414
1088 Ga0496114_0004568 3300048917 Bacteria 10751
1089 Ga0496114_0005710 3300048917 Bacteria 9757
1090 Ga0496114_0021335 3300048917 Bacteria 5269
1091 Ga0496114_0035697 3300048917 Bacteria 4106
1092 Ga0496114_0046848 3300048917 Bacteria 3593
1093 Ga0496114_0059492 3300048917 Bacteria 3192
1094 Ga0496114_0063380 3300048917 Bacteria 3095
1095 Ga0496114_0110909 3300048917 Bacteria 2350
1096 Ga0496114_0149864 3300048917 Bacteria 2023
1097 Ga0496114_0244969 3300048917 Unclassified 1577
1098 Ga0496114_0677448 3300048917 Unclassified 905
1099 Ga0496114_0740192 3300048917 Bacteria 860
1100 Ga0496115_0006641 3300048918 Bacteria 8488
1101 Ga0496115_0008859 3300048918 Bacteria 7458
1102 Ga0496115_0035042 3300048918 Bacteria 3969
1103 Ga0496115_0040254 3300048918 Bacteria 3714
1104 Ga0496115_0084967 3300048918 Bacteria 2580
1105 Ga0496115_0204299 3300048918 Unclassified 1632
1106 Ga0496115_0321374 3300048918 Bacteria 1266
1107 Ga0496115_0343386 3300048918 Bacteria 1218
1108 Ga0496115_0474167 3300048918 Bacteria 1008
1109 Ga0496115_0624300 3300048918 Bacteria 855
1110 Ga0496115_0955186 3300048918 Bacteria 658
1111 Ga0496115_0990980 3300048918 Bacteria 643
1112 Ga0496126_0115479 3300048929 Bacteria 2334
1113 Ga0501031_0007443 3300049568 Bacteria 7133
1114 Ga0501031_0152233 3300049568 Bacteria 1512
1115 Ga0501031_0180339 3300049568 Bacteria 1380
1116 Ga0501031_0976127 3300049568 Bacteria 542
1117 Ga0501032_0087145 3300049569 Bacteria 2074
1118 Ga0501032_0399608 3300049569 Bacteria 883
1119 Ga0501033_0309128 3300049570 Unclassified 1112
1120 Ga0501033_0522589 3300049570 Bacteria 819
1121 Ga0501036_0033834 3300049572 Bacteria 4323
1122 Ga0501036_0775314 3300049572 Bacteria 790
1123 Ga0501037_0083994 3300049573 Bacteria 2307
1124 Ga0501037_0328379 3300049573 Bacteria 1058
1125 Ga0501038_0075297 3300049574 Bacteria 2853
1126 Ga0501038_0191199 3300049574 Unclassified 1647
1127 Ga0501038_0613417 3300049574 Unclassified 822
1128 Ga0501039_0023372 3300049575 Bacteria 4746
1129 Ga0501039_0327233 3300049575 Unclassified 1204
1130 Ga0501039_0353209 3300049575 Bacteria 1155
1131 Ga0501039_1499939 3300049575 Bacteria 518
1132 Ga0501040_0098652 3300049576 Bacteria 2036
1133 Ga0501040_0107694 3300049576 Bacteria 1948
1134 Ga0501040_0118095 3300049576 Bacteria 1859
1135 Ga0501040_0139659 3300049576 Bacteria 1706
1136 Ga0501040_0265364 3300049576 Bacteria 1225
1137 Ga0501040_1106054 3300049576 Bacteria 575
1138 Ga0501041_0224942 3300049577 Unclassified 1178
1139 Ga0501041_0364903 3300049577 Bacteria 913
1140 Ga0501041_0410630 3300049577 Bacteria 858
1141 Ga0501042_0015452 3300049578 Bacteria 5229
1142 Ga0501042_0148649 3300049578 Bacteria 1689
1143 Ga0501042_0277957 3300049578 Bacteria 1209
1144 Ga0501042_0436016 3300049578 Bacteria 950
1145 Ga0501046_0043766 3300049580 Bacteria 3563
1146 Ga0501046_0297225 3300049580 Bacteria 1180
1147 Ga0501048_0004258 3300049582 Bacteria 10904
1148 Ga0501048_0362946 3300049582 Bacteria 1033
1149 Ga0501048_0490254 3300049582 Bacteria 881
1150 Ga0501048_0528803 3300049582 Bacteria 846
1151 Ga0501067_0000414 3300049583 Bacteria 23279
1152 Ga0501067_0169540 3300049583 Bacteria 1216
1153 Ga0501067_0175688 3300049583 Bacteria 1193
1154 Ga0501067_0282360 3300049583 Bacteria 924
1155 Ga0501067_0310057 3300049583 Bacteria 879
1156 Ga0501067_0360618 3300049583 Bacteria 810
1157 Ga0501068_0000406 3300049584 Bacteria 21790
1158 Ga0501068_0194721 3300049584 Bacteria 1285
1159 Ga0501068_0924569 3300049584 Bacteria 574
1160 Ga0501069_0000177 3300049585 Bacteria 28717
1161 Ga0501069_0085439 3300049585 Unclassified 1781
1162 Ga0501069_0223879 3300049585 Bacteria 1094
1163 Ga0501069_0308384 3300049585 Bacteria 929
1164 Ga0501071_0029991 3300049587 Bacteria 3844
1165 Ga0501071_0153776 3300049587 Bacteria 1717
1166 Ga0501071_0776442 3300049587 Bacteria 738
1167 Ga0501071_1085597 3300049587 Bacteria 618
1168 Ga0501072_0002616 3300049588 Bacteria 13483
1169 Ga0501072_0072011 3300049588 Bacteria 2731
1170 Ga0501072_0659371 3300049588 Bacteria 823
1171 Ga0501072_0848036 3300049588 Unclassified 714
1172 Ga0501073_0251544 3300049589 Bacteria 1220
1173 Ga0501073_0706003 3300049589 Bacteria 696
1174 Ga0501074_0050290 3300049590 Bacteria 3009
1175 Ga0501074_0161966 3300049590 Bacteria 1598
1176 Ga0501074_0211353 3300049590 Unclassified 1382
1177 Ga0501074_0464461 3300049590 Bacteria 897
1178 Ga0501075_0037036 3300049591 Bacteria 3642
1179 Ga0501075_0262619 3300049591 Bacteria 1316
1180 Ga0501075_0541623 3300049591 Bacteria 888
1181 Ga0501076_0017096 3300049592 Bacteria 5508
1182 Ga0501076_0248577 3300049592 Bacteria 1455
1183 Ga0501076_0317377 3300049592 Bacteria 1278
1184 Ga0501076_0325394 3300049592 Bacteria 1261
1185 Ga0501077_0041883 3300049593 Bacteria 2914
1186 Ga0501077_0093193 3300049593 Bacteria 1909
1187 Ga0501077_0123020 3300049593 Bacteria 1645
1188 Ga0501077_0314753 3300049593 Bacteria 998
1189 Ga0501079_0098535 3300049741 Bacteria 2266
1190 Ga0501079_0264833 3300049741 Bacteria 1343
1191 Ga0501080_0349084 3300049742 Bacteria 1336
1192 Ga0501080_0851297 3300049742 Bacteria 797
1193 Ga0501080_0949155 3300049742 Bacteria 748
1194 Ga0501081_0158636 3300049743 Bacteria 1629
1195 Ga0501081_0227363 3300049743 Unclassified 1358
1196 Ga0501035_0334585 3300049822 Unclassified 1270
1197 Ga0501045_0046796 3300049824 Bacteria 3150
1198 Ga0501045_0057654 3300049824 Bacteria 2842
1199 Ga0501045_0075657 3300049824 Bacteria 2480
1200 Ga0501045_0307433 3300049824 Bacteria 1180
1201 Ga0501045_0598039 3300049824 Bacteria 817
1202 nmdc:mga03n38_239893_c1 3300050490 Unclassified 953
1203 nmdc:mga0yw44_425689_c1 3300050492 Unclassified 899
1204 nmdc:mga0yw44_770908_c1 3300050492 Unclassified 653
1205 nmdc:mga05p37_172461_c1 3300050507 Unclassified 2637
1206 nmdc:mga05p37_2062688_c1 3300050507 Bacteria 536
1207 nmdc:mga05p37_40551_c1 3300050507 Bacteria 5717
1208 nmdc:mga05p37_8517_c1 3300050507 Bacteria 12121
1209 nmdc:mga09592_1146884_c1 3300050508 Unclassified 644
1210 nmdc:mga06r32_177570_c1 3300050510 Bacteria 2114
1211 nmdc:mga08y16_169430_c1 3300050511 Unclassified 2268
1212 nmdc:mga08y16_302823_c1 3300050511 Unclassified 1647
1213 nmdc:mga0n895_1029091_c1 3300050512 Bacteria 804
1214 nmdc:mga0n895_1270773_c1 3300050512 Unclassified 708
1215 nmdc:mga0n895_2216090_c1 3300050512 Unclassified 505
1216 nmdc:mga0n895_43470_c1 3300050512 Bacteria 4378
1217 nmdc:mga0n895_52992_c1 3300050512 Bacteria 3984
1218 nmdc:mga0n895_536835_c1 3300050512 Bacteria 1176
1219 nmdc:mga0rr50_22888_c1 3300050513 Bacteria 4298
1220 nmdc:mga0rr50_525969_c1 3300050513 Bacteria 1006
1221 nmdc:mga08x19_1154962_c1 3300050514 Bacteria 549
1222 nmdc:mga08x19_93625_c1 3300050514 Bacteria 1986
1223 nmdc:mga0a205_1196825_c1 3300050515 Unclassified 608
1224 nmdc:mga0a205_1318897_c1 3300050515 Unclassified 569
1225 nmdc:mga0a205_351207_c1 3300050515 Bacteria 1342
1226 nmdc:mga0a205_41861_c1 3300050515 Bacteria 4413
1227 Ga0495601_0002246 3300053077 Bacteria 10881
1228 Ga0495601_0045071 3300053077 Bacteria 2772
1229 Ga0495601_0065382 3300053077 Unclassified 2314
1230 Ga0495601_0723403 3300053077 Unclassified 634
1231 Ga0495612_0027656 3300053078 Bacteria 2281
1232 Ga0495595_0002243 3300053084 Bacteria 7518
1233 Ga0495595_0341374 3300053084 Bacteria 755
1234 Ga0495595_0408460 3300053084 Bacteria 688
1235 Ga0495619_0020674 3300053085 Bacteria 4196
1236 Ga0495619_0196207 3300053085 Bacteria 1397
1237 Ga0495619_1175468 3300053085 Bacteria 509
1238 Ga0501084_0013069 3300054114 Bacteria 6869
1239 Ga0501084_0253608 3300054114 Bacteria 1485
1240 Ga0501084_0317286 3300054114 Unclassified 1316
1241 Ga0501084_0480436 3300054114 Bacteria 1050
1242 Ga0501084_0626674 3300054114 Bacteria 908
1243 Ga0501084_0776315 3300054114 Bacteria 807
1244 Ga0501084_1006671 3300054114 Bacteria 700
1245 Ga0590075_006978 3300059424 Bacteria 2677
1246 Ga0587066_022517 3300059490 Bacteria 1055
1247 Ga0587070_179593 3300059491 Bacteria 550
1248 Ga0587082_111861 3300059504 Bacteria 607
1249 Ga0587085_065683 3300059506 Bacteria 697
1250 Ga0587091_071778 3300059511 Bacteria 759
1251 Ga0587091_135361 3300059511 Bacteria 612
1252 Ga0501082_0025036 3300060353 Bacteria 5141
1253 Ga0501082_0309834 3300060353 Unclassified 1375
1254 Ga0501082_0528625 3300060353 Bacteria 1031
1255 Ga0501082_1261139 3300060353 Bacteria 646
1256 Ga0501082_1615719 3300060353 Bacteria 566
1257 Ga0501082_1994215 3300060353 Bacteria 506
1258 Ga0466962_0024979 3300061719 Unclassified 2868
1259 Ga0466962_0155400 3300061719 Bacteria 1111
1260 Ga0466962_0368004 3300061719 Bacteria 717
1261 Ga0530510_0021443 3300061734 Bacteria 4596
1262 Ga0530510_0103178 3300061734 Bacteria 2086
1263 Ga0530510_0262751 3300061734 Unclassified 1288
1264 Ga0530510_0278887 3300061734 Bacteria 1248
1265 Ga0530510_0995902 3300061734 Bacteria 641

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005437 Ga0070710_10429532 Ga0070710_104295323 77
2 3300005439 Ga0070711_100034675 Ga0070711_1000346751 77
3 3300026023 Ga0207677_10247502 Ga0207677_102475024 77
4 3300037471 Ga0395905_1179642 Ga0395905_1179642_15_338 81
5 3300026075 Ga0207708_10225572 Ga0207708_102255723 82
6 3300047321 Ga0495676_0002012 Ga0495676_0002012_113_376 82
7 3300044693 Ga0466961_0201710 Ga0466961_0201710_219_479 86
8 3300002077 JGI24744J21845_10002884 JGI24744J21845_100028841 87
9 3300002244 JGI24742J22300_10005646 JGI24742J22300_100056461 87
10 3300005327 Ga0070658_10121644 Ga0070658_101216443 87
11 3300005327 Ga0070658_11060860 Ga0070658_110608602 87
12 3300005329 Ga0070683_100113786 Ga0070683_1001137864 87
13 3300005329 Ga0070683_100319357 Ga0070683_1003193572 87
14 3300005329 Ga0070683_100382574 Ga0070683_1003825743 87
15 3300005329 Ga0070683_100598738 Ga0070683_1005987382 87
16 3300005329 Ga0070683_101665008 Ga0070683_1016650081 87
17 3300005329 Ga0070683_102158758 Ga0070683_1021587581 87
18 3300005330 Ga0070690_100328527 Ga0070690_1003285272 87
19 3300005331 Ga0070670_101814183 Ga0070670_1018141832 87
20 3300005333 Ga0070677_10107090 Ga0070677_101070902 87
21 3300005336 Ga0070680_100010728 Ga0070680_1000107282 87
22 3300005336 Ga0070680_100046131 Ga0070680_1000461316 87
23 3300005336 Ga0070680_100101251 Ga0070680_1001012513 87
24 3300005336 Ga0070680_100992548 Ga0070680_1009925481 87
25 3300005337 Ga0070682_100005203 Ga0070682_1000052037 87
26 3300005337 Ga0070682_100012014 Ga0070682_1000120145 87
27 3300005337 Ga0070682_100038562 Ga0070682_1000385623 87
28 3300005337 Ga0070682_100615740 Ga0070682_1006157402 87
29 3300005337 Ga0070682_101503533 Ga0070682_1015035332 87
30 3300005337 Ga0070682_101702170 Ga0070682_1017021702 87
31 3300005338 Ga0068868_100047501 Ga0068868_1000475012 87
32 3300005338 Ga0068868_100458818 Ga0068868_1004588181 87
33 3300005338 Ga0068868_100841141 Ga0068868_1008411412 87
34 3300005339 Ga0070660_100007876 Ga0070660_1000078767 87
35 3300005339 Ga0070660_100263381 Ga0070660_1002633812 87
36 3300005339 Ga0070660_100517313 Ga0070660_1005173132 87
37 3300005339 Ga0070660_101322465 Ga0070660_1013224651 87
38 3300005339 Ga0070660_101865784 Ga0070660_1018657842 87
39 3300005340 Ga0070689_100013742 Ga0070689_1000137427 87
40 3300005340 Ga0070689_100169688 Ga0070689_1001696882 87
41 3300005340 Ga0070689_100607574 Ga0070689_1006075742 87
42 3300005343 Ga0070687_100904722 Ga0070687_1009047222 87
43 3300005344 Ga0070661_100984439 Ga0070661_1009844391 87
44 3300005345 Ga0070692_10017715 Ga0070692_100177152 87
45 3300005347 Ga0070668_101417711 Ga0070668_1014177112 87
46 3300005353 Ga0070669_100359841 Ga0070669_1003598412 87
47 3300005354 Ga0070675_100065652 Ga0070675_1000656523 87
48 3300005354 Ga0070675_100975627 Ga0070675_1009756272 87
49 3300005354 Ga0070675_101093248 Ga0070675_1010932482 87
50 3300005354 Ga0070675_101308900 Ga0070675_1013089002 87
51 3300005355 Ga0070671_100043832 Ga0070671_1000438323 87
52 3300005355 Ga0070671_100050442 Ga0070671_1000504423 87
53 3300005355 Ga0070671_100199816 Ga0070671_1001998163 87
54 3300005355 Ga0070671_100581509 Ga0070671_1005815092 87
55 3300005356 Ga0070674_100005302 Ga0070674_1000053021 87
56 3300005356 Ga0070674_100145759 Ga0070674_1001457593 87
57 3300005356 Ga0070674_100155400 Ga0070674_1001554002 87
58 3300005356 Ga0070674_100172688 Ga0070674_1001726882 87
59 3300005356 Ga0070674_100928816 Ga0070674_1009288162 87
60 3300005364 Ga0070673_101108750 Ga0070673_1011087502 87
61 3300005365 Ga0070688_100008183 Ga0070688_1000081832 87
62 3300005365 Ga0070688_101080898 Ga0070688_1010808981 87
63 3300005366 Ga0070659_100241562 Ga0070659_1002415621 87
64 3300005366 Ga0070659_100832331 Ga0070659_1008323312 87
65 3300005366 Ga0070659_100871464 Ga0070659_1008714642 87
66 3300005367 Ga0070667_101336946 Ga0070667_1013369461 87
67 3300005367 Ga0070667_101399362 Ga0070667_1013993622 87
68 3300005434 Ga0070709_10268306 Ga0070709_102683064 87
69 3300005434 Ga0070709_10547749 Ga0070709_105477492 87
70 3300005434 Ga0070709_10611746 Ga0070709_106117462 87
71 3300005434 Ga0070709_10629416 Ga0070709_106294162 87
72 3300005435 Ga0070714_100096340 Ga0070714_1000963401 87
73 3300005435 Ga0070714_100169434 Ga0070714_1001694343 87
74 3300005435 Ga0070714_100251064 Ga0070714_1002510642 87
75 3300005435 Ga0070714_100320773 Ga0070714_1003207732 87
76 3300005436 Ga0070713_100147731 Ga0070713_1001477314 87
77 3300005436 Ga0070713_100791617 Ga0070713_1007916172 87
78 3300005436 Ga0070713_101981494 Ga0070713_1019814942 87
79 3300005437 Ga0070710_10007082 Ga0070710_100070822 87
80 3300005438 Ga0070701_10014128 Ga0070701_100141282 87
81 3300005438 Ga0070701_10116456 Ga0070701_101164563 87
82 3300005439 Ga0070711_100003182 Ga0070711_1000031827 87
83 3300005439 Ga0070711_100865370 Ga0070711_1008653702 87
84 3300005440 Ga0070705_100023909 Ga0070705_1000239094 87
85 3300005441 Ga0070700_100001522 Ga0070700_1000015227 87
86 3300005441 Ga0070700_100024380 Ga0070700_1000243803 87
87 3300005441 Ga0070700_100477031 Ga0070700_1004770312 87
88 3300005441 Ga0070700_101225522 Ga0070700_1012255222 87
89 3300005444 Ga0070694_100054439 Ga0070694_1000544392 87
90 3300005444 Ga0070694_100327248 Ga0070694_1003272481 87
91 3300005444 Ga0070694_100367868 Ga0070694_1003678682 87
92 3300005444 Ga0070694_100952320 Ga0070694_1009523201 87
93 3300005445 Ga0070708_100238367 Ga0070708_1002383672 87
94 3300005445 Ga0070708_100928861 Ga0070708_1009288611 87
95 3300005445 Ga0070708_101106228 Ga0070708_1011062282 87
96 3300005445 Ga0070708_101218900 Ga0070708_1012189001 87
97 3300005455 Ga0070663_100007368 Ga0070663_1000073686 87
98 3300005455 Ga0070663_100129504 Ga0070663_1001295043 87
99 3300005455 Ga0070663_100745445 Ga0070663_1007454452 87
100 3300005456 Ga0070678_100001885 Ga0070678_1000018859 87
101 3300005456 Ga0070678_100025558 Ga0070678_1000255585 87
102 3300005456 Ga0070678_100900165 Ga0070678_1009001652 87
103 3300005456 Ga0070678_101065709 Ga0070678_1010657092 87
104 3300005456 Ga0070678_101556290 Ga0070678_1015562902 87
105 3300005456 Ga0070678_101687957 Ga0070678_1016879571 87
106 3300005457 Ga0070662_100888449 Ga0070662_1008884492 87
107 3300005457 Ga0070662_100948161 Ga0070662_1009481612 87
108 3300005457 Ga0070662_101158666 Ga0070662_1011586661 87
109 3300005458 Ga0070681_10012878 Ga0070681_100128785 87
110 3300005458 Ga0070681_10066324 Ga0070681_100663242 87
111 3300005458 Ga0070681_10101906 Ga0070681_101019063 87
112 3300005458 Ga0070681_10920824 Ga0070681_109208241 87
113 3300005459 Ga0068867_100002812 Ga0068867_1000028127 87
114 3300005459 Ga0068867_100322103 Ga0068867_1003221032 87
115 3300005459 Ga0068867_101609589 Ga0068867_1016095891 87
116 3300005466 Ga0070685_10034706 Ga0070685_100347064 87
117 3300005466 Ga0070685_10047068 Ga0070685_100470682 87
118 3300005467 Ga0070706_100099647 Ga0070706_1000996472 87
119 3300005467 Ga0070706_101681800 Ga0070706_1016818001 87
120 3300005467 Ga0070706_101709306 Ga0070706_1017093062 87
121 3300005468 Ga0070707_100020070 Ga0070707_1000200706 87
122 3300005468 Ga0070707_100971290 Ga0070707_1009712902 87
123 3300005468 Ga0070707_101727840 Ga0070707_1017278402 87
124 3300005471 Ga0070698_100100234 Ga0070698_1001002343 87
125 3300005471 Ga0070698_100207210 Ga0070698_1002072103 87
126 3300005471 Ga0070698_100233256 Ga0070698_1002332562 87
127 3300005471 Ga0070698_100241519 Ga0070698_1002415193 87
128 3300005518 Ga0070699_100065041 Ga0070699_1000650411 87
129 3300005518 Ga0070699_100891344 Ga0070699_1008913442 87
130 3300005530 Ga0070679_100044289 Ga0070679_1000442896 87
131 3300005530 Ga0070679_100057930 Ga0070679_1000579305 87
132 3300005530 Ga0070679_100260982 Ga0070679_1002609823 87
133 3300005530 Ga0070679_100780062 Ga0070679_1007800621 87
134 3300005530 Ga0070679_101372135 Ga0070679_1013721352 87
135 3300005535 Ga0070684_100164140 Ga0070684_1001641403 87
136 3300005535 Ga0070684_100236486 Ga0070684_1002364863 87
137 3300005535 Ga0070684_100239566 Ga0070684_1002395662 87
138 3300005535 Ga0070684_100444530 Ga0070684_1004445302 87
139 3300005535 Ga0070684_100480314 Ga0070684_1004803142 87
140 3300005535 Ga0070684_100675964 Ga0070684_1006759642 87
141 3300005535 Ga0070684_100952256 Ga0070684_1009522562 87
142 3300005536 Ga0070697_100015513 Ga0070697_1000155134 87
143 3300005536 Ga0070697_100874373 Ga0070697_1008743731 87
144 3300005536 Ga0070697_101093116 Ga0070697_1010931162 87
145 3300005539 Ga0068853_100010897 Ga0068853_1000108973 87
146 3300005543 Ga0070672_100100692 Ga0070672_1001006922 87
147 3300005543 Ga0070672_100551570 Ga0070672_1005515702 87
148 3300005543 Ga0070672_101535388 Ga0070672_1015353881 87
149 3300005544 Ga0070686_100004420 Ga0070686_1000044208 87
150 3300005544 Ga0070686_100457101 Ga0070686_1004571012 87
151 3300005544 Ga0070686_101004867 Ga0070686_1010048672 87
152 3300005544 Ga0070686_101704664 Ga0070686_1017046641 87
153 3300005545 Ga0070695_100079175 Ga0070695_1000791752 87
154 3300005545 Ga0070695_101134292 Ga0070695_1011342921 87
155 3300005546 Ga0070696_100005547 Ga0070696_1000055473 87
156 3300005547 Ga0070693_100002841 Ga0070693_1000028413 87
157 3300005547 Ga0070693_100026239 Ga0070693_1000262393 87
158 3300005547 Ga0070693_100124589 Ga0070693_1001245892 87
159 3300005548 Ga0070665_100105506 Ga0070665_1001055062 87
160 3300005548 Ga0070665_100688053 Ga0070665_1006880532 87
161 3300005548 Ga0070665_101757188 Ga0070665_1017571881 87
162 3300005548 Ga0070665_102187472 Ga0070665_1021874722 87
163 3300005549 Ga0070704_100018433 Ga0070704_1000184333 87
164 3300005549 Ga0070704_101025894 Ga0070704_1010258941 87
165 3300005549 Ga0070704_102266551 Ga0070704_1022665512 87
166 3300005563 Ga0068855_100108032 Ga0068855_1001080322 87
167 3300005563 Ga0068855_100215913 Ga0068855_1002159133 87
168 3300005563 Ga0068855_100391200 Ga0068855_1003912003 87
169 3300005564 Ga0070664_100417318 Ga0070664_1004173182 87
170 3300005578 Ga0068854_100733226 Ga0068854_1007332261 87
171 3300005614 Ga0068856_100006334 Ga0068856_10000633412 87
172 3300005614 Ga0068856_100019097 Ga0068856_1000190973 87
173 3300005614 Ga0068856_100124975 Ga0068856_1001249753 87
174 3300005614 Ga0068856_100315940 Ga0068856_1003159402 87
175 3300005614 Ga0068856_100379374 Ga0068856_1003793742 87
176 3300005615 Ga0070702_100006871 Ga0070702_1000068712 87
177 3300005615 Ga0070702_100097384 Ga0070702_1000973843 87
178 3300005615 Ga0070702_100585912 Ga0070702_1005859122 87
179 3300005616 Ga0068852_100072866 Ga0068852_1000728662 87
180 3300005616 Ga0068852_101955607 Ga0068852_1019556072 87
181 3300005616 Ga0068852_102801298 Ga0068852_1028012981 87
182 3300005617 Ga0068859_100044009 Ga0068859_1000440093 87
183 3300005617 Ga0068859_102137476 Ga0068859_1021374762 87
184 3300005618 Ga0068864_100920442 Ga0068864_1009204422 87
185 3300005618 Ga0068864_101029324 Ga0068864_1010293242 87
186 3300005618 Ga0068864_102550393 Ga0068864_1025503932 87
187 3300005718 Ga0068866_10004917 Ga0068866_100049172 87
188 3300005718 Ga0068866_10637352 Ga0068866_106373521 87
189 3300005718 Ga0068866_11113840 Ga0068866_111138401 87
190 3300005719 Ga0068861_100088714 Ga0068861_1000887142 87
191 3300005719 Ga0068861_100431878 Ga0068861_1004318782 87
192 3300005840 Ga0068870_10022453 Ga0068870_100224533 87
193 3300005840 Ga0068870_10518789 Ga0068870_105187892 87
194 3300005841 Ga0068863_100335123 Ga0068863_1003351233 87
195 3300005841 Ga0068863_101897620 Ga0068863_1018976202 87
196 3300005843 Ga0068860_100221601 Ga0068860_1002216012 87
197 3300005843 Ga0068860_100398203 Ga0068860_1003982032 87
198 3300005843 Ga0068860_101038128 Ga0068860_1010381282 87
199 3300005843 Ga0068860_102413470 Ga0068860_1024134702 87
200 3300005937 Ga0081455_10409176 Ga0081455_104091762 87
201 3300005985 Ga0081539_10142486 Ga0081539_101424862 87
202 3300006028 Ga0070717_10007976 Ga0070717_100079768 87
203 3300006028 Ga0070717_10032371 Ga0070717_100323712 87
204 3300006028 Ga0070717_10762202 Ga0070717_107622022 87
205 3300006028 Ga0070717_11143804 Ga0070717_111438042 87
206 3300006028 Ga0070717_11234265 Ga0070717_112342651 87
207 3300006028 Ga0070717_11376358 Ga0070717_113763582 87
208 3300006058 Ga0075432_10067820 Ga0075432_100678204 87
209 3300006163 Ga0070715_10012087 Ga0070715_100120872 87
210 3300006163 Ga0070715_10828576 Ga0070715_108285761 87
211 3300006173 Ga0070716_100330193 Ga0070716_1003301932 87
212 3300006173 Ga0070716_101634343 Ga0070716_1016343431 87
213 3300006175 Ga0070712_100078687 Ga0070712_1000786874 87
214 3300006175 Ga0070712_100098783 Ga0070712_1000987832 87
215 3300006175 Ga0070712_100492019 Ga0070712_1004920192 87
216 3300006175 Ga0070712_100732521 Ga0070712_1007325212 87
217 3300006175 Ga0070712_100828983 Ga0070712_1008289831 87
218 3300006178 Ga0075367_10962613 Ga0075367_109626131 87
219 3300006237 Ga0097621_100208813 Ga0097621_1002088132 87
220 3300006237 Ga0097621_100462764 Ga0097621_1004627642 87
221 3300006358 Ga0068871_100013932 Ga0068871_1000139323 87
222 3300006358 Ga0068871_100102089 Ga0068871_1001020893 87
223 3300006358 Ga0068871_101327441 Ga0068871_1013274412 87
224 3300006847 Ga0075431_100245114 Ga0075431_1002451142 87
225 3300006852 Ga0075433_10032954 Ga0075433_100329542 87
226 3300006852 Ga0075433_10407006 Ga0075433_104070062 87
227 3300006852 Ga0075433_11091582 Ga0075433_110915822 87
228 3300006871 Ga0075434_100030670 Ga0075434_1000306703 87
229 3300006871 Ga0075434_100075775 Ga0075434_1000757757 87
230 3300006871 Ga0075434_100359519 Ga0075434_1003595192 87
231 3300006871 Ga0075434_100563152 Ga0075434_1005631522 87
232 3300006871 Ga0075434_100668080 Ga0075434_1006680802 87
233 3300006871 Ga0075434_101205432 Ga0075434_1012054322 87
234 3300006871 Ga0075434_101491305 Ga0075434_1014913051 87
235 3300006881 Ga0068865_100002447 Ga0068865_1000024472 87
236 3300006881 Ga0068865_100014363 Ga0068865_1000143635 87
237 3300006881 Ga0068865_101039587 Ga0068865_1010395872 87
238 3300006881 Ga0068865_101220758 Ga0068865_1012207582 87
239 3300006881 Ga0068865_101277837 Ga0068865_1012778372 87
240 3300006914 Ga0075436_100023051 Ga0075436_1000230514 87
241 3300006914 Ga0075436_100025415 Ga0075436_1000254153 87
242 3300006931 Ga0097620_100044009 Ga0097620_1000440093 87
243 3300006931 Ga0097620_102136633 Ga0097620_1021366331 87
244 3300007076 Ga0075435_100000729 Ga0075435_10000072913 87
245 3300007076 Ga0075435_100008824 Ga0075435_1000088246 87
246 3300007076 Ga0075435_101616031 Ga0075435_1016160312 87
247 3300009094 Ga0111539_10007764 Ga0111539_1000776416 87
248 3300009094 Ga0111539_10950637 Ga0111539_109506371 87
249 3300009094 Ga0111539_11167054 Ga0111539_111670542 87
250 3300009098 Ga0105245_10067558 Ga0105245_100675581 87
251 3300009098 Ga0105245_10280204 Ga0105245_102802042 87
252 3300009098 Ga0105245_10344290 Ga0105245_103442902 87
253 3300009098 Ga0105245_10537085 Ga0105245_105370852 87
254 3300009098 Ga0105245_11473113 Ga0105245_114731132 87
255 3300009098 Ga0105245_12625668 Ga0105245_126256682 87
256 3300009098 Ga0105245_12648972 Ga0105245_126489721 87
257 3300009098 Ga0105245_12938323 Ga0105245_129383232 87
258 3300009101 Ga0105247_10246670 Ga0105247_102466702 87
259 3300009101 Ga0105247_10481939 Ga0105247_104819391 87
260 3300009101 Ga0105247_10775271 Ga0105247_107752712 87
261 3300009101 Ga0105247_11209260 Ga0105247_112092601 87
262 3300009101 Ga0105247_11618496 Ga0105247_116184961 87
263 3300009147 Ga0114129_10002432 Ga0114129_1000243211 87
264 3300009147 Ga0114129_10052442 Ga0114129_100524422 87
265 3300009147 Ga0114129_10198068 Ga0114129_101980683 87
266 3300009147 Ga0114129_10260979 Ga0114129_102609793 87
267 3300009147 Ga0114129_10384421 Ga0114129_103844212 87
268 3300009147 Ga0114129_11606517 Ga0114129_116065172 87
269 3300009147 Ga0114129_12627120 Ga0114129_126271202 87
270 3300009148 Ga0105243_10003824 Ga0105243_100038247 87
271 3300009148 Ga0105243_10028730 Ga0105243_100287303 87
272 3300009148 Ga0105243_10145387 Ga0105243_101453872 87
273 3300009148 Ga0105243_10594517 Ga0105243_105945172 87
274 3300009148 Ga0105243_10880415 Ga0105243_108804152 87
275 3300009148 Ga0105243_11381352 Ga0105243_113813521 87
276 3300009174 Ga0105241_10499577 Ga0105241_104995771 87
277 3300009174 Ga0105241_12483902 Ga0105241_124839021 87
278 3300009176 Ga0105242_10003423 Ga0105242_1000342310 87
279 3300009176 Ga0105242_10033783 Ga0105242_100337832 87
280 3300009176 Ga0105242_10366867 Ga0105242_103668672 87
281 3300009176 Ga0105242_10503809 Ga0105242_105038091 87
282 3300009176 Ga0105242_10514446 Ga0105242_105144462 87
283 3300009176 Ga0105242_10679578 Ga0105242_106795783 87
284 3300009176 Ga0105242_10864895 Ga0105242_108648952 87
285 3300009176 Ga0105242_11385119 Ga0105242_113851191 87
286 3300009176 Ga0105242_13291476 Ga0105242_132914761 87
287 3300009177 Ga0105248_10012945 Ga0105248_100129455 87
288 3300009177 Ga0105248_10290675 Ga0105248_102906752 87
289 3300009177 Ga0105248_10325855 Ga0105248_103258552 87
290 3300009177 Ga0105248_10515917 Ga0105248_105159172 87
291 3300009177 Ga0105248_11446796 Ga0105248_114467961 87
292 3300009545 Ga0105237_10515948 Ga0105237_105159482 87
293 3300009545 Ga0105237_12550279 Ga0105237_125502791 87
294 3300009551 Ga0105238_10123948 Ga0105238_101239482 87
295 3300009551 Ga0105238_11000362 Ga0105238_110003622 87
296 3300009551 Ga0105238_12568878 Ga0105238_125688781 87
297 3300009553 Ga0105249_10001792 Ga0105249_100017928 87
298 3300009553 Ga0105249_11102300 Ga0105249_111023002 87
299 3300009553 Ga0105249_11411222 Ga0105249_114112222 87
300 3300009553 Ga0105249_11439250 Ga0105249_114392501 87
301 3300009553 Ga0105249_11576452 Ga0105249_115764522 87
302 3300009553 Ga0105249_13273095 Ga0105249_132730952 87
303 3300010375 Ga0105239_10006563 Ga0105239_1000656315 87
304 3300010375 Ga0105239_10661247 Ga0105239_106612472 87
305 3300010375 Ga0105239_11510191 Ga0105239_115101911 87
306 3300010375 Ga0105239_11616860 Ga0105239_116168602 87
307 3300010375 Ga0105239_12746030 Ga0105239_127460302 87
308 3300010375 Ga0105239_12994387 Ga0105239_129943871 87
309 3300011119 Ga0105246_10168375 Ga0105246_101683752 87
310 3300011119 Ga0105246_10428207 Ga0105246_104282072 87
311 3300011119 Ga0105246_12433871 Ga0105246_124338712 87
312 3300013100 Ga0157373_10546942 Ga0157373_105469422 87
313 3300013100 Ga0157373_10755650 Ga0157373_107556502 87
314 3300013105 Ga0157369_10010968 Ga0157369_100109686 87
315 3300013105 Ga0157369_10030270 Ga0157369_100302702 87
316 3300013105 Ga0157369_10908364 Ga0157369_109083642 87
317 3300013105 Ga0157369_11145233 Ga0157369_111452331 87
318 3300013296 Ga0157374_10012233 Ga0157374_100122332 87
319 3300013296 Ga0157374_10575700 Ga0157374_105757002 87
320 3300013296 Ga0157374_10661230 Ga0157374_106612302 87
321 3300013296 Ga0157374_11958134 Ga0157374_119581341 87
322 3300013297 Ga0157378_10004712 Ga0157378_100047127 87
323 3300013297 Ga0157378_10059956 Ga0157378_100599564 87
324 3300013297 Ga0157378_10318789 Ga0157378_103187892 87
325 3300013297 Ga0157378_11209026 Ga0157378_112090262 87
326 3300013297 Ga0157378_13040822 Ga0157378_130408221 87
327 3300013306 Ga0163162_10005507 Ga0163162_100055078 87
328 3300013306 Ga0163162_10220218 Ga0163162_102202182 87
329 3300013306 Ga0163162_10878044 Ga0163162_108780442 87
330 3300013307 Ga0157372_10499303 Ga0157372_104993032 87
331 3300013307 Ga0157372_10550663 Ga0157372_105506632 87
332 3300013308 Ga0157375_10327919 Ga0157375_103279192 87
333 3300013308 Ga0157375_10926392 Ga0157375_109263922 87
334 3300013308 Ga0157375_11404638 Ga0157375_114046381 87
335 3300013308 Ga0157375_13453507 Ga0157375_134535072 87
336 3300013308 Ga0157375_13737890 Ga0157375_137378902 87
337 3300014325 Ga0163163_10113274 Ga0163163_101132742 87
338 3300014325 Ga0163163_10213174 Ga0163163_102131743 87
339 3300014326 Ga0157380_10008142 Ga0157380_100081426 87
340 3300014326 Ga0157380_10095551 Ga0157380_100955512 87
341 3300014326 Ga0157380_10151368 Ga0157380_101513682 87
342 3300014326 Ga0157380_10259385 Ga0157380_102593852 87
343 3300014326 Ga0157380_12209236 Ga0157380_122092362 87
344 3300014497 Ga0182008_10172015 Ga0182008_101720152 87
345 3300014497 Ga0182008_10423783 Ga0182008_104237832 87
346 3300014745 Ga0157377_10009687 Ga0157377_100096872 87
347 3300014745 Ga0157377_10076540 Ga0157377_100765402 87
348 3300014745 Ga0157377_10252177 Ga0157377_102521773 87
349 3300014745 Ga0157377_10260024 Ga0157377_102600242 87
350 3300014968 Ga0157379_10020906 Ga0157379_100209066 87
351 3300014968 Ga0157379_10361185 Ga0157379_103611852 87
352 3300014968 Ga0157379_10718591 Ga0157379_107185912 87
353 3300014969 Ga0157376_10105712 Ga0157376_101057123 87
354 3300014969 Ga0157376_10740124 Ga0157376_107401242 87
355 3300014969 Ga0157376_10789091 Ga0157376_107890912 87
356 3300014969 Ga0157376_11175458 Ga0157376_111754582 87
357 3300017792 Ga0163161_10087553 Ga0163161_100875532 87
358 3300017792 Ga0163161_10481392 Ga0163161_104813922 87
359 3300020070 Ga0206356_10172331 Ga0206356_101723313 87
360 3300020070 Ga0206356_10678942 Ga0206356_106789422 87
361 3300020070 Ga0206356_10993319 Ga0206356_109933191 87
362 3300020070 Ga0206356_11167277 Ga0206356_111672772 87
363 3300020078 Ga0206352_11292620 Ga0206352_112926202 87
364 3300020081 Ga0206354_10455214 Ga0206354_104552142 87
365 3300020081 Ga0206354_10676597 Ga0206354_106765972 87
366 3300020082 Ga0206353_10102796 Ga0206353_101027962 87
367 3300020082 Ga0206353_10372582 Ga0206353_103725822 87
368 3300020082 Ga0206353_10675843 Ga0206353_106758432 87
369 3300020082 Ga0206353_11625761 Ga0206353_116257612 87
370 3300022467 Ga0224712_10007070 Ga0224712_100070703 87
371 3300022467 Ga0224712_10047123 Ga0224712_100471231 87
372 3300022467 Ga0224712_10068353 Ga0224712_100683532 87
373 3300025893 Ga0207682_10154266 Ga0207682_101542661 87
374 3300025893 Ga0207682_10281490 Ga0207682_102814902 87
375 3300025898 Ga0207692_10055044 Ga0207692_100550442 87
376 3300025898 Ga0207692_10661931 Ga0207692_106619312 87
377 3300025899 Ga0207642_10016714 Ga0207642_100167142 87
378 3300025899 Ga0207642_10127453 Ga0207642_101274532 87
379 3300025899 Ga0207642_10283039 Ga0207642_102830392 87
380 3300025899 Ga0207642_11002624 Ga0207642_110026241 87
381 3300025900 Ga0207710_10028513 Ga0207710_100285133 87
382 3300025900 Ga0207710_10067904 Ga0207710_100679043 87
383 3300025901 Ga0207688_10002129 Ga0207688_100021296 87
384 3300025903 Ga0207680_10644434 Ga0207680_106444342 87
385 3300025903 Ga0207680_10863525 Ga0207680_108635251 87
386 3300025904 Ga0207647_10465061 Ga0207647_104650613 87
387 3300025905 Ga0207685_10126770 Ga0207685_101267702 87
388 3300025905 Ga0207685_10665083 Ga0207685_106650832 87
389 3300025906 Ga0207699_10158681 Ga0207699_101586812 87
390 3300025906 Ga0207699_10323969 Ga0207699_103239692 87
391 3300025906 Ga0207699_10395806 Ga0207699_103958061 87
392 3300025906 Ga0207699_10551525 Ga0207699_105515252 87
393 3300025906 Ga0207699_10685621 Ga0207699_106856212 87
394 3300025907 Ga0207645_10545046 Ga0207645_105450462 87
395 3300025908 Ga0207643_10304662 Ga0207643_103046622 87
396 3300025908 Ga0207643_10571474 Ga0207643_105714742 87
397 3300025909 Ga0207705_10779298 Ga0207705_107792982 87
398 3300025909 Ga0207705_11542996 Ga0207705_115429961 87
399 3300025910 Ga0207684_10898466 Ga0207684_108984662 87
400 3300025910 Ga0207684_11060235 Ga0207684_110602351 87
401 3300025911 Ga0207654_10213377 Ga0207654_102133773 87
402 3300025911 Ga0207654_11070562 Ga0207654_110705622 87
403 3300025912 Ga0207707_10009696 Ga0207707_100096965 87
404 3300025912 Ga0207707_10063602 Ga0207707_100636023 87
405 3300025912 Ga0207707_10174884 Ga0207707_101748842 87
406 3300025912 Ga0207707_10260741 Ga0207707_102607412 87
407 3300025912 Ga0207707_10516051 Ga0207707_105160512 87
408 3300025912 Ga0207707_11118963 Ga0207707_111189632 87
409 3300025913 Ga0207695_10066320 Ga0207695_100663202 87
410 3300025913 Ga0207695_10699672 Ga0207695_106996722 87
411 3300025914 Ga0207671_10283450 Ga0207671_102834502 87
412 3300025914 Ga0207671_10330692 Ga0207671_103306922 87
413 3300025914 Ga0207671_10546126 Ga0207671_105461261 87
414 3300025915 Ga0207693_10011416 Ga0207693_100114162 87
415 3300025915 Ga0207693_10062134 Ga0207693_100621343 87
416 3300025915 Ga0207693_10092812 Ga0207693_100928122 87
417 3300025915 Ga0207693_10225180 Ga0207693_102251804 87
418 3300025916 Ga0207663_10005939 Ga0207663_100059395 87
419 3300025916 Ga0207663_10284791 Ga0207663_102847912 87
420 3300025916 Ga0207663_10387108 Ga0207663_103871082 87
421 3300025916 Ga0207663_10517321 Ga0207663_105173211 87
422 3300025916 Ga0207663_11057398 Ga0207663_110573982 87
423 3300025916 Ga0207663_11495085 Ga0207663_114950852 87
424 3300025917 Ga0207660_10018008 Ga0207660_100180088 87
425 3300025917 Ga0207660_10054691 Ga0207660_100546913 87
426 3300025917 Ga0207660_10505944 Ga0207660_105059441 87
427 3300025917 Ga0207660_10637437 Ga0207660_106374372 87
428 3300025917 Ga0207660_11276870 Ga0207660_112768701 87
429 3300025918 Ga0207662_10093761 Ga0207662_100937612 87
430 3300025919 Ga0207657_10000634 Ga0207657_1000063422 87
431 3300025919 Ga0207657_10020702 Ga0207657_100207027 87
432 3300025919 Ga0207657_10039256 Ga0207657_100392565 87
433 3300025919 Ga0207657_10258570 Ga0207657_102585702 87
434 3300025919 Ga0207657_10577615 Ga0207657_105776152 87
435 3300025921 Ga0207652_10011117 Ga0207652_100111175 87
436 3300025921 Ga0207652_10311665 Ga0207652_103116653 87
437 3300025921 Ga0207652_10453012 Ga0207652_104530123 87
438 3300025921 Ga0207652_10633063 Ga0207652_106330632 87
439 3300025921 Ga0207652_10851545 Ga0207652_108515452 87
440 3300025921 Ga0207652_11322722 Ga0207652_113227222 87
441 3300025921 Ga0207652_11851358 Ga0207652_118513582 87
442 3300025922 Ga0207646_10020445 Ga0207646_100204456 87
443 3300025922 Ga0207646_10024163 Ga0207646_100241639 87
444 3300025922 Ga0207646_10026800 Ga0207646_100268003 87
445 3300025922 Ga0207646_10492678 Ga0207646_104926782 87
446 3300025922 Ga0207646_10757078 Ga0207646_107570782 87
447 3300025922 Ga0207646_11937892 Ga0207646_119378922 87
448 3300025923 Ga0207681_10429477 Ga0207681_104294772 87
449 3300025924 Ga0207694_10027888 Ga0207694_100278882 87
450 3300025924 Ga0207694_10067468 Ga0207694_100674684 87
451 3300025924 Ga0207694_10476609 Ga0207694_104766092 87
452 3300025924 Ga0207694_10743848 Ga0207694_107438482 87
453 3300025924 Ga0207694_11619420 Ga0207694_116194201 87
454 3300025925 Ga0207650_10553760 Ga0207650_105537602 87
455 3300025926 Ga0207659_10094951 Ga0207659_100949512 87
456 3300025926 Ga0207659_10469800 Ga0207659_104698002 87
457 3300025926 Ga0207659_10548498 Ga0207659_105484982 87
458 3300025926 Ga0207659_10554439 Ga0207659_105544392 87
459 3300025926 Ga0207659_10997366 Ga0207659_109973661 87
460 3300025926 Ga0207659_11716208 Ga0207659_117162082 87
461 3300025927 Ga0207687_10002883 Ga0207687_100028832 87
462 3300025927 Ga0207687_10042917 Ga0207687_100429172 87
463 3300025927 Ga0207687_10179844 Ga0207687_101798441 87
464 3300025927 Ga0207687_10212040 Ga0207687_102120402 87
465 3300025927 Ga0207687_10247152 Ga0207687_102471522 87
466 3300025927 Ga0207687_10743390 Ga0207687_107433903 87
467 3300025927 Ga0207687_10836733 Ga0207687_108367332 87
468 3300025928 Ga0207700_10143507 Ga0207700_101435072 87
469 3300025928 Ga0207700_10380517 Ga0207700_103805172 87
470 3300025928 Ga0207700_10569667 Ga0207700_105696672 87
471 3300025929 Ga0207664_10004970 Ga0207664_1000497013 87
472 3300025929 Ga0207664_10051918 Ga0207664_100519183 87
473 3300025929 Ga0207664_10094481 Ga0207664_100944812 87
474 3300025929 Ga0207664_10159922 Ga0207664_101599221 87
475 3300025929 Ga0207664_10469645 Ga0207664_104696452 87
476 3300025929 Ga0207664_10563018 Ga0207664_105630181 87
477 3300025929 Ga0207664_10756441 Ga0207664_107564412 87
478 3300025931 Ga0207644_10053241 Ga0207644_100532413 87
479 3300025931 Ga0207644_10079005 Ga0207644_100790053 87
480 3300025931 Ga0207644_10231332 Ga0207644_102313322 87
481 3300025931 Ga0207644_10685979 Ga0207644_106859792 87
482 3300025931 Ga0207644_11114024 Ga0207644_111140242 87
483 3300025931 Ga0207644_11443525 Ga0207644_114435251 87
484 3300025932 Ga0207690_10062330 Ga0207690_100623302 87
485 3300025932 Ga0207690_10601228 Ga0207690_106012281 87
486 3300025932 Ga0207690_10758794 Ga0207690_107587941 87
487 3300025932 Ga0207690_11382477 Ga0207690_113824772 87
488 3300025933 Ga0207706_10301561 Ga0207706_103015612 87
489 3300025933 Ga0207706_10534891 Ga0207706_105348912 87
490 3300025933 Ga0207706_10807827 Ga0207706_108078272 87
491 3300025933 Ga0207706_11487915 Ga0207706_114879152 87
492 3300025934 Ga0207686_10055329 Ga0207686_100553293 87
493 3300025934 Ga0207686_10093475 Ga0207686_100934752 87
494 3300025934 Ga0207686_10330075 Ga0207686_103300752 87
495 3300025934 Ga0207686_10536197 Ga0207686_105361972 87
496 3300025934 Ga0207686_11121636 Ga0207686_111216362 87
497 3300025934 Ga0207686_11168308 Ga0207686_111683081 87
498 3300025935 Ga0207709_10002377 Ga0207709_100023779 87
499 3300025935 Ga0207709_10151080 Ga0207709_101510801 87
500 3300025935 Ga0207709_10394647 Ga0207709_103946472 87
501 3300025935 Ga0207709_10717423 Ga0207709_107174232 87
502 3300025935 Ga0207709_10952123 Ga0207709_109521231 87
503 3300025936 Ga0207670_10081500 Ga0207670_100815002 87
504 3300025936 Ga0207670_10107535 Ga0207670_101075353 87
505 3300025936 Ga0207670_10151429 Ga0207670_101514292 87
506 3300025936 Ga0207670_11727551 Ga0207670_117275511 87
507 3300025937 Ga0207669_10029874 Ga0207669_100298742 87
508 3300025937 Ga0207669_10063387 Ga0207669_100633872 87
509 3300025937 Ga0207669_10178905 Ga0207669_101789052 87
510 3300025937 Ga0207669_10269703 Ga0207669_102697032 87
511 3300025937 Ga0207669_10382403 Ga0207669_103824032 87
512 3300025937 Ga0207669_11040327 Ga0207669_110403271 87
513 3300025937 Ga0207669_11065469 Ga0207669_110654692 87
514 3300025937 Ga0207669_11438889 Ga0207669_114388891 87
515 3300025938 Ga0207704_10002110 Ga0207704_100021109 87
516 3300025938 Ga0207704_10083955 Ga0207704_100839552 87
517 3300025938 Ga0207704_11259563 Ga0207704_112595632 87
518 3300025939 Ga0207665_10047629 Ga0207665_100476293 87
519 3300025939 Ga0207665_11688697 Ga0207665_116886971 87
520 3300025940 Ga0207691_10170188 Ga0207691_101701882 87
521 3300025940 Ga0207691_10412639 Ga0207691_104126393 87
522 3300025941 Ga0207711_10188004 Ga0207711_101880042 87
523 3300025941 Ga0207711_10284621 Ga0207711_102846211 87
524 3300025941 Ga0207711_10304497 Ga0207711_103044973 87
525 3300025941 Ga0207711_10977781 Ga0207711_109777811 87
526 3300025941 Ga0207711_11364419 Ga0207711_113644191 87
527 3300025942 Ga0207689_10064532 Ga0207689_100645322 87
528 3300025942 Ga0207689_10153100 Ga0207689_101531001 87
529 3300025942 Ga0207689_11443332 Ga0207689_114433321 87
530 3300025944 Ga0207661_10007239 Ga0207661_100072396 87
531 3300025944 Ga0207661_10398856 Ga0207661_103988563 87
532 3300025944 Ga0207661_10522415 Ga0207661_105224152 87
533 3300025944 Ga0207661_10786654 Ga0207661_107866542 87
534 3300025944 Ga0207661_10797259 Ga0207661_107972592 87
535 3300025944 Ga0207661_11114765 Ga0207661_111147652 87
536 3300025944 Ga0207661_11497688 Ga0207661_114976881 87
537 3300025945 Ga0207679_10131913 Ga0207679_101319132 87
538 3300025945 Ga0207679_10734981 Ga0207679_107349812 87
539 3300025945 Ga0207679_11149697 Ga0207679_111496972 87
540 3300025945 Ga0207679_12005472 Ga0207679_120054721 87
541 3300025949 Ga0207667_10014735 Ga0207667_100147355 87
542 3300025949 Ga0207667_10071035 Ga0207667_100710352 87
543 3300025949 Ga0207667_10278952 Ga0207667_102789522 87
544 3300025949 Ga0207667_10381461 Ga0207667_103814612 87
545 3300025949 Ga0207667_10472124 Ga0207667_104721242 87
546 3300025949 Ga0207667_10652743 Ga0207667_106527432 87
547 3300025960 Ga0207651_10257990 Ga0207651_102579901 87
548 3300025960 Ga0207651_10328927 Ga0207651_103289272 87
549 3300025960 Ga0207651_10854940 Ga0207651_108549402 87
550 3300025960 Ga0207651_10986231 Ga0207651_109862312 87
551 3300025960 Ga0207651_11570052 Ga0207651_115700521 87
552 3300025961 Ga0207712_10049053 Ga0207712_100490532 87
553 3300025961 Ga0207712_10751797 Ga0207712_107517972 87
554 3300025961 Ga0207712_10831429 Ga0207712_108314291 87
555 3300025961 Ga0207712_11031570 Ga0207712_110315702 87
556 3300025961 Ga0207712_11409175 Ga0207712_114091752 87
557 3300025972 Ga0207668_10422558 Ga0207668_104225582 87
558 3300025981 Ga0207640_10035199 Ga0207640_100351992 87
559 3300025981 Ga0207640_10209330 Ga0207640_102093302 87
560 3300025981 Ga0207640_10320503 Ga0207640_103205032 87
561 3300025981 Ga0207640_10473701 Ga0207640_104737011 87
562 3300025981 Ga0207640_10503988 Ga0207640_105039881 87
563 3300025981 Ga0207640_10616488 Ga0207640_106164881 87
564 3300025981 Ga0207640_11648689 Ga0207640_116486892 87
565 3300025986 Ga0207658_11052806 Ga0207658_110528062 87
566 3300025986 Ga0207658_12037101 Ga0207658_120371012 87
567 3300026023 Ga0207677_10029819 Ga0207677_100298192 87
568 3300026023 Ga0207677_10041071 Ga0207677_100410714 87
569 3300026023 Ga0207677_10134929 Ga0207677_101349292 87
570 3300026035 Ga0207703_10054226 Ga0207703_100542264 87
571 3300026035 Ga0207703_10194060 Ga0207703_101940602 87
572 3300026035 Ga0207703_11038658 Ga0207703_110386582 87
573 3300026041 Ga0207639_10168366 Ga0207639_101683662 87
574 3300026041 Ga0207639_10412337 Ga0207639_104123372 87
575 3300026041 Ga0207639_11178178 Ga0207639_111781782 87
576 3300026067 Ga0207678_10028844 Ga0207678_100288442 87
577 3300026067 Ga0207678_10461043 Ga0207678_104610432 87
578 3300026067 Ga0207678_10572544 Ga0207678_105725442 87
579 3300026067 Ga0207678_10860238 Ga0207678_108602382 87
580 3300026075 Ga0207708_10001783 Ga0207708_100017838 87
581 3300026075 Ga0207708_10022225 Ga0207708_100222254 87
582 3300026075 Ga0207708_10449974 Ga0207708_104499742 87
583 3300026075 Ga0207708_10726645 Ga0207708_107266452 87
584 3300026078 Ga0207702_10006756 Ga0207702_100067569 87
585 3300026078 Ga0207702_10029006 Ga0207702_100290063 87
586 3300026078 Ga0207702_10043354 Ga0207702_100433544 87
587 3300026078 Ga0207702_10108322 Ga0207702_101083224 87
588 3300026078 Ga0207702_10120971 Ga0207702_101209712 87
589 3300026078 Ga0207702_10251169 Ga0207702_102511692 87
590 3300026078 Ga0207702_10499984 Ga0207702_104999843 87
591 3300026088 Ga0207641_10505792 Ga0207641_105057922 87
592 3300026088 Ga0207641_11012330 Ga0207641_110123302 87
593 3300026089 Ga0207648_10002707 Ga0207648_100027079 87
594 3300026089 Ga0207648_10147193 Ga0207648_101471933 87
595 3300026089 Ga0207648_10279515 Ga0207648_102795153 87
596 3300026089 Ga0207648_10380207 Ga0207648_103802072 87
597 3300026089 Ga0207648_11128089 Ga0207648_111280892 87
598 3300026089 Ga0207648_11488528 Ga0207648_114885282 87
599 3300026095 Ga0207676_10810236 Ga0207676_108102361 87
600 3300026095 Ga0207676_10904023 Ga0207676_109040231 87
601 3300026095 Ga0207676_12378160 Ga0207676_123781602 87
602 3300026116 Ga0207674_11861390 Ga0207674_118613901 87
603 3300026118 Ga0207675_100319986 Ga0207675_1003199862 87
604 3300026118 Ga0207675_100708291 Ga0207675_1007082911 87
605 3300026118 Ga0207675_101319701 Ga0207675_1013197012 87
606 3300026121 Ga0207683_10000699 Ga0207683_1000069928 87
607 3300026121 Ga0207683_10020326 Ga0207683_100203265 87
608 3300026121 Ga0207683_10038254 Ga0207683_100382549 87
609 3300026121 Ga0207683_10042579 Ga0207683_100425795 87
610 3300026121 Ga0207683_10095111 Ga0207683_100951113 87
611 3300026121 Ga0207683_10149892 Ga0207683_101498921 87
612 3300026121 Ga0207683_11027164 Ga0207683_110271642 87
613 3300026121 Ga0207683_11451711 Ga0207683_114517111 87
614 3300026121 Ga0207683_11610444 Ga0207683_116104442 87
615 3300026121 Ga0207683_12009757 Ga0207683_120097572 87
616 3300026142 Ga0207698_10095146 Ga0207698_100951463 87
617 3300026142 Ga0207698_10149617 Ga0207698_101496174 87
618 3300028379 Ga0268266_10093455 Ga0268266_100934552 87
619 3300028379 Ga0268266_11662482 Ga0268266_116624821 87
620 3300028380 Ga0268265_10248599 Ga0268265_102485992 87
621 3300028380 Ga0268265_10280885 Ga0268265_102808852 87
622 3300028381 Ga0268264_10166989 Ga0268264_101669892 87
623 3300028381 Ga0268264_10174346 Ga0268264_101743463 87
624 3300028381 Ga0268264_10278200 Ga0268264_102782002 87
625 3300028381 Ga0268264_11772661 Ga0268264_117726612 87
626 3300028558 Ga0265326_10004431 Ga0265326_100044312 87
627 3300028563 Ga0265319_1039859 Ga0265319_10398591 87
628 3300028563 Ga0265319_1183755 Ga0265319_11837552 87
629 3300028573 Ga0265334_10002745 Ga0265334_100027453 87
630 3300028573 Ga0265334_10063249 Ga0265334_100632493 87
631 3300028577 Ga0265318_10003154 Ga0265318_100031548 87
632 3300028653 Ga0265323_10052375 Ga0265323_100523751 87
633 3300028800 Ga0265338_10011051 Ga0265338_100110515 87
634 3300028800 Ga0265338_10049930 Ga0265338_100499301 87
635 3300028800 Ga0265338_10252698 Ga0265338_102526982 87
636 3300029957 Ga0265324_10047255 Ga0265324_100472552 87
637 3300031235 Ga0265330_10003366 Ga0265330_100033669 87
638 3300031238 Ga0265332_10015422 Ga0265332_100154225 87
639 3300031238 Ga0265332_10496749 Ga0265332_104967491 87
640 3300031239 Ga0265328_10004140 Ga0265328_100041402 87
641 3300031240 Ga0265320_10291301 Ga0265320_102913012 87
642 3300031241 Ga0265325_10007375 Ga0265325_100073752 87
643 3300031242 Ga0265329_10010827 Ga0265329_100108274 87
644 3300031247 Ga0265340_10003923 Ga0265340_100039234 87
645 3300031250 Ga0265331_10032605 Ga0265331_100326052 87
646 3300031251 Ga0265327_10008410 Ga0265327_100084103 87
647 3300031251 Ga0265327_10141872 Ga0265327_101418721 87
648 3300031344 Ga0265316_10069891 Ga0265316_100698914 87
649 3300031548 Ga0307408_100562109 Ga0307408_1005621091 87
650 3300031548 Ga0307408_102093537 Ga0307408_1020935372 87
651 3300031595 Ga0265313_10005872 Ga0265313_100058729 87
652 3300031711 Ga0265314_10076599 Ga0265314_100765994 87
653 3300031712 Ga0265342_10060378 Ga0265342_100603782 87
654 3300031712 Ga0265342_10082671 Ga0265342_100826711 87
655 3300031731 Ga0307405_10309853 Ga0307405_103098532 87
656 3300031824 Ga0307413_10150376 Ga0307413_101503762 87
657 3300031852 Ga0307410_10133577 Ga0307410_101335773 87
658 3300031901 Ga0307406_10890562 Ga0307406_108905622 87
659 3300031901 Ga0307406_11806593 Ga0307406_118065932 87
660 3300031903 Ga0307407_10079347 Ga0307407_100793472 87
661 3300031911 Ga0307412_11090809 Ga0307412_110908092 87
662 3300031995 Ga0307409_100060984 Ga0307409_1000609842 87
663 3300031995 Ga0307409_100390166 Ga0307409_1003901662 87
664 3300031995 Ga0307409_101091193 Ga0307409_1010911931 87
665 3300032002 Ga0307416_100777964 Ga0307416_1007779642 87
666 3300032002 Ga0307416_102108532 Ga0307416_1021085322 87
667 3300032002 Ga0307416_103728462 Ga0307416_1037284622 87
668 3300035086 Ga0373934_0063858 Ga0373934_0063858_853_1116 87
669 3300035088 Ga0373940_0320095 Ga0373940_0320095_141_404 87
670 3300035089 Ga0373944_0006456 Ga0373944_0006456_1738_2001 87
671 3300035111 Ga0373923_0023565 Ga0373923_0023565_186_449 87
672 3300035112 Ga0373932_0405959 Ga0373932_0405959_251_514 87
673 3300035113 Ga0373936_0026574 Ga0373936_0026574_295_558 87
674 3300035115 Ga0373941_0097663 Ga0373941_0097663_736_999 87
675 3300035115 Ga0373941_0403348 Ga0373941_0403348_36_299 87
676 3300035116 Ga0373945_0005948 Ga0373945_0005948_1069_1332 87
677 3300035116 Ga0373945_0347016 Ga0373945_0347016_265_528 87
678 3300035119 Ga0373956_0060749 Ga0373956_0060749_10_273 87
679 3300035170 Ga0373943_0001876 Ga0373943_0001876_1226_1489 87
680 3300035170 Ga0373943_0055277 Ga0373943_0055277_1201_1464 87
681 3300035170 Ga0373943_0574757 Ga0373943_0574757_304_567 87
682 3300035171 Ga0373946_0061295 Ga0373946_0061295_13_276 87
683 3300035172 Ga0373955_0316646 Ga0373955_0316646_61_324 87
684 3300035207 Ga0373942_0311451 Ga0373942_0311451_243_506 87
685 3300035410 Ga0373924_0022475 Ga0373924_0022475_495_758 87
686 3300035691 Ga0373931_1287311 Ga0373931_1287311_222_485 87
687 3300035692 Ga0373935_0023556 Ga0373935_0023556_585_848 87
688 3300035692 Ga0373935_0811979 Ga0373935_0811979_14_277 87
689 3300035695 Ga0373927_0015218 Ga0373927_0015218_516_779 87
690 3300035695 Ga0373927_0461873 Ga0373927_0461873_46_309 87
691 3300035724 Ga0373933_0172615 Ga0373933_0172615_114_377 87
692 3300035725 Ga0373947_0005562 Ga0373947_0005562_1157_1420 87
693 3300035725 Ga0373947_0188339 Ga0373947_0188339_925_1188 87
694 3300035725 Ga0373947_0467779 Ga0373947_0467779_217_480 87
695 3300035725 Ga0373947_0741252 Ga0373947_0741252_287_550 87
696 3300036401 Ga0373937_0030848 Ga0373937_0030848_4485_4748 87
697 3300037068 Ga0373925_0006097 Ga0373925_0006097_5821_6084 87
698 3300037068 Ga0373925_0077407 Ga0373925_0077407_1211_1474 87
699 3300037312 Ga0395899_0006013 Ga0395899_0006013_8649_8912 87
700 3300037312 Ga0395899_0010325 Ga0395899_0010325_6509_6772 87
701 3300037312 Ga0395899_0018595 Ga0395899_0018595_860_1123 87
702 3300037312 Ga0395899_0019784 Ga0395899_0019784_1591_1854 87
703 3300037312 Ga0395899_0021385 Ga0395899_0021385_1090_1353 87
704 3300037312 Ga0395899_0034223 Ga0395899_0034223_3279_3542 87
705 3300037312 Ga0395899_0919223 Ga0395899_0919223_203_466 87
706 3300037418 Ga0395900_0005086 Ga0395900_0005086_1130_1393 87
707 3300037418 Ga0395900_0030800 Ga0395900_0030800_4279_4542 87
708 3300037418 Ga0395900_0040417 Ga0395900_0040417_2912_3175 87
709 3300037418 Ga0395900_0071158 Ga0395900_0071158_1804_2067 87
710 3300037418 Ga0395900_0105601 Ga0395900_0105601_2214_2477 87
711 3300037418 Ga0395900_0123245 Ga0395900_0123245_2082_2345 87
712 3300037418 Ga0395900_0141996 Ga0395900_0141996_757_1026 87
713 3300037418 Ga0395900_0519651 Ga0395900_0519651_194_457 87
714 3300037418 Ga0395900_0581837 Ga0395900_0581837_661_924 87
715 3300037418 Ga0395900_0885359 Ga0395900_0885359_413_676 87
716 3300037418 Ga0395900_1785947 Ga0395900_1785947_173_436 87
717 3300037466 Ga0395898_0004841 Ga0395898_0004841_4644_4907 87
718 3300037466 Ga0395898_0015334 Ga0395898_0015334_1481_1744 87
719 3300037466 Ga0395898_0015934 Ga0395898_0015934_7262_7525 87
720 3300037466 Ga0395898_0052076 Ga0395898_0052076_2416_2679 87
721 3300037466 Ga0395898_0060561 Ga0395898_0060561_501_764 87
722 3300037466 Ga0395898_0230569 Ga0395898_0230569_495_758 87
723 3300037466 Ga0395898_0389713 Ga0395898_0389713_625_888 87
724 3300037466 Ga0395898_1352261 Ga0395898_1352261_246_509 87
725 3300037466 Ga0395898_1646242 Ga0395898_1646242_45_308 87
726 3300037466 Ga0395898_1718011 Ga0395898_1718011_144_407 87
727 3300037471 Ga0395905_0006168 Ga0395905_0006168_11078_11341 87
728 3300037471 Ga0395905_0011152 Ga0395905_0011152_245_508 87
729 3300037471 Ga0395905_0027947 Ga0395905_0027947_3623_3886 87
730 3300037471 Ga0395905_0064124 Ga0395905_0064124_840_1103 87
731 3300037471 Ga0395905_0088822 Ga0395905_0088822_1445_1714 87
732 3300037471 Ga0395905_0131753 Ga0395905_0131753_804_1067 87
733 3300037471 Ga0395905_0146092 Ga0395905_0146092_270_533 87
734 3300037471 Ga0395905_0162955 Ga0395905_0162955_111_374 87
735 3300037471 Ga0395905_0286674 Ga0395905_0286674_1062_1325 87
736 3300037471 Ga0395905_0378826 Ga0395905_0378826_343_606 87
737 3300037471 Ga0395905_0476674 Ga0395905_0476674_857_1120 87
738 3300037471 Ga0395905_0570849 Ga0395905_0570849_680_943 87
739 3300037471 Ga0395905_1557512 Ga0395905_1557512_213_476 87
740 3300038443 Ga0395901_0002976 Ga0395901_0002976_1068_1331 87
741 3300038443 Ga0395901_0004555 Ga0395901_0004555_9686_9949 87
742 3300038443 Ga0395901_0012209 Ga0395901_0012209_2402_2665 87
743 3300038443 Ga0395901_0032039 Ga0395901_0032039_1163_1426 87
744 3300038443 Ga0395901_0074131 Ga0395901_0074131_2653_2916 87
745 3300038443 Ga0395901_0126740 Ga0395901_0126740_2365_2628 87
746 3300038443 Ga0395901_0137165 Ga0395901_0137165_1352_1615 87
747 3300038443 Ga0395901_0138741 Ga0395901_0138741_2149_2418 87
748 3300038443 Ga0395901_0149601 Ga0395901_0149601_209_472 87
749 3300038443 Ga0395901_0269273 Ga0395901_0269273_1232_1507 87
750 3300038443 Ga0395901_0285109 Ga0395901_0285109_1265_1528 87
751 3300038443 Ga0395901_1501230 Ga0395901_1501230_135_398 87
752 3300038443 Ga0395901_1670391 Ga0395901_1670391_40_303 87
753 3300039438 Ga0436360_1209873 Ga0436360_1209873_256_519 87
754 3300039447 Ga0436361_0026300 Ga0436361_0026300_223_486 87
755 3300039450 Ga0436363_0518779 Ga0436363_0518779_256_519 87
756 3300041443 Ga0451789_0380733 Ga0451789_0380733_121_384 87
757 3300041452 Ga0451793_1706676 Ga0451793_1706676_212_475 87
758 3300041460 Ga0451802_0705323 Ga0451802_0705323_231_494 87
759 3300041492 Ga0451835_0621129 Ga0451835_0621129_12_275 87
760 3300041496 Ga0451839_1641712 Ga0451839_1641712_159_422 87
761 3300041512 Ga0451853_0117807 Ga0451853_0117807_122_388 87
762 3300041512 Ga0451853_3775861 Ga0451853_3775861_344_607 87
763 3300042001 Ga0439441_014949 Ga0439441_014949_348_611 87
764 3300042005 Ga0439448_0173777 Ga0439448_0173777_102_365 87
765 3300042122 Ga0450920_121881 Ga0450920_121881_149_412 87
766 3300042146 Ga0450907_025673 Ga0450907_025673_681_944 87
767 3300042439 Ga0439464_0251447 Ga0439464_0251447_277_540 87
768 3300042876 Ga0451577_1463288 Ga0451577_1463288_160_423 87
769 3300044656 Ga0466969_0019364 Ga0466969_0019364_2970_3233 87
770 3300044656 Ga0466969_0042798 Ga0466969_0042798_951_1214 87
771 3300044656 Ga0466969_0106436 Ga0466969_0106436_826_1089 87
772 3300044658 Ga0466972_0273988 Ga0466972_0273988_298_561 87
773 3300044683 Ga0466965_0604843 Ga0466965_0604843_133_396 87
774 3300044684 Ga0466966_0101649 Ga0466966_0101649_1465_1728 87
775 3300044684 Ga0466966_0203378 Ga0466966_0203378_134_400 87
776 3300044684 Ga0466966_0273398 Ga0466966_0273398_720_983 87
777 3300044684 Ga0466966_0790636 Ga0466966_0790636_192_455 87
778 3300044693 Ga0466961_0072060 Ga0466961_0072060_1022_1285 87
779 3300044693 Ga0466961_0149887 Ga0466961_0149887_816_1079 87
780 3300044693 Ga0466961_0755438 Ga0466961_0755438_154_417 87
781 3300044694 Ga0466963_0009099 Ga0466963_0009099_4518_4781 87
782 3300044694 Ga0466963_0490667 Ga0466963_0490667_486_749 87
783 3300044706 Ga0466964_0079595 Ga0466964_0079595_658_924 87
784 3300044706 Ga0466964_0194053 Ga0466964_0194053_277_540 87
785 3300044712 Ga0453684_1382627 Ga0453684_1382627_439_702 87
786 3300044719 Ga0466971_0116994 Ga0466971_0116994_875_1138 87
787 3300044735 Ga0466968_0024836 Ga0466968_0024836_370_633 87
788 3300044735 Ga0466968_0325614 Ga0466968_0325614_168_431 87
789 3300044842 Ga0466957_0088704 Ga0466957_0088704_1644_1907 87
790 3300044901 Ga0466960_0152888 Ga0466960_0152888_85_348 87
791 3300044901 Ga0466960_0515195 Ga0466960_0515195_393_659 87
792 3300045049 Ga0466959_0014947 Ga0466959_0014947_528_791 87
793 3300045049 Ga0466959_0037335 Ga0466959_0037335_303_566 87
794 3300045049 Ga0466959_0205622 Ga0466959_0205622_35_298 87
795 3300045051 Ga0451576_1824563 Ga0451576_1824563_182_445 87
796 3300045836 Ga0466958_0029671 Ga0466958_0029671_1243_1506 87
797 3300045836 Ga0466958_0037298 Ga0466958_0037298_1357_1620 87
798 3300045976 Ga0466967_0020616 Ga0466967_0020616_238_501 87
799 3300045976 Ga0466967_0036183 Ga0466967_0036183_89_352 87
800 3300045976 Ga0466967_0038364 Ga0466967_0038364_171_434 87
801 3300045976 Ga0466967_0044354 Ga0466967_0044354_2530_2793 87
802 3300045976 Ga0466967_0085141 Ga0466967_0085141_1915_2178 87
803 3300045976 Ga0466967_0167800 Ga0466967_0167800_203_466 87
804 3300045976 Ga0466967_0194932 Ga0466967_0194932_1577_1840 87
805 3300045976 Ga0466967_2451757 Ga0466967_2451757_25_291 87
806 3300046454 Ga0495592_0092780 Ga0495592_0092780_1725_1988 87
807 3300046454 Ga0495592_0371206 Ga0495592_0371206_107_370 87
808 3300046455 Ga0495603_0051729 Ga0495603_0051729_1864_2127 87
809 3300046455 Ga0495603_0387355 Ga0495603_0387355_82_345 87
810 3300046459 Ga0495629_0027827 Ga0495629_0027827_274_537 87
811 3300046459 Ga0495629_0135213 Ga0495629_0135213_948_1211 87
812 3300046459 Ga0495629_0165592 Ga0495629_0165592_51_314 87
813 3300046459 Ga0495629_0252963 Ga0495629_0252963_521_784 87
814 3300046459 Ga0495629_1022820 Ga0495629_1022820_252_515 87
815 3300046459 Ga0495629_1028762 Ga0495629_1028762_15_278 87
816 3300046461 Ga0495641_0003765 Ga0495641_0003765_5502_5765 87
817 3300046461 Ga0495641_0107080 Ga0495641_0107080_686_949 87
818 3300046461 Ga0495641_0122006 Ga0495641_0122006_63_326 87
819 3300046462 Ga0495651_0095140 Ga0495651_0095140_922_1185 87
820 3300046462 Ga0495651_0404239 Ga0495651_0404239_552_815 87
821 3300046462 Ga0495651_0683285 Ga0495651_0683285_241_504 87
822 3300046463 Ga0495653_0005235 Ga0495653_0005235_6018_6281 87
823 3300046472 Ga0495580_0326341 Ga0495580_0326341_87_350 87
824 3300046472 Ga0495580_0788469 Ga0495580_0788469_274_537 87
825 3300046473 Ga0495582_0002392 Ga0495582_0002392_4438_4701 87
826 3300046473 Ga0495582_0061575 Ga0495582_0061575_1601_1864 87
827 3300046473 Ga0495582_0148979 Ga0495582_0148979_70_333 87
828 3300046473 Ga0495582_0149991 Ga0495582_0149991_92_355 87
829 3300046473 Ga0495582_0431465 Ga0495582_0431465_13_276 87
830 3300046473 Ga0495582_0768032 Ga0495582_0768032_15_278 87
831 3300046474 Ga0495605_0226241 Ga0495605_0226241_437_700 87
832 3300046474 Ga0495605_0233847 Ga0495605_0233847_505_768 87
833 3300046475 Ga0495639_0002167 Ga0495639_0002167_6939_7202 87
834 3300046475 Ga0495639_0042740 Ga0495639_0042740_798_1061 87
835 3300046475 Ga0495639_0613859 Ga0495639_0613859_144_407 87
836 3300046476 Ga0495662_0032603 Ga0495662_0032603_994_1257 87
837 3300046476 Ga0495662_0104749 Ga0495662_0104749_710_973 87
838 3300046476 Ga0495662_0440127 Ga0495662_0440127_261_524 87
839 3300046477 Ga0495664_0107281 Ga0495664_0107281_931_1194 87
840 3300046491 Ga0495584_0120605 Ga0495584_0120605_355_618 87
841 3300046491 Ga0495584_0253988 Ga0495584_0253988_497_820 87
842 3300046492 Ga0495585_0143746 Ga0495585_0143746_56_319 87
843 3300046499 Ga0495594_0004059 Ga0495594_0004059_438_701 87
844 3300046499 Ga0495594_0109794 Ga0495594_0109794_704_967 87
845 3300046499 Ga0495594_0136226 Ga0495594_0136226_379_642 87
846 3300046499 Ga0495594_0649606 Ga0495594_0649606_34_297 87
847 3300046499 Ga0495594_0810808 Ga0495594_0810808_208_471 87
848 3300046511 Ga0495608_0006095 Ga0495608_0006095_6567_6830 87
849 3300046514 Ga0495618_0004507 Ga0495618_0004507_1184_1447 87
850 3300046516 Ga0495628_0072630 Ga0495628_0072630_2281_2544 87
851 3300046516 Ga0495628_0388405 Ga0495628_0388405_436_699 87
852 3300046517 Ga0495630_0003907 Ga0495630_0003907_5593_5856 87
853 3300046517 Ga0495630_0051113 Ga0495630_0051113_2463_2726 87
854 3300046517 Ga0495630_0221660 Ga0495630_0221660_85_348 87
855 3300046517 Ga0495630_1186127 Ga0495630_1186127_270_533 87
856 3300046518 Ga0495631_0175973 Ga0495631_0175973_576_839 87
857 3300046518 Ga0495631_0458531 Ga0495631_0458531_202_465 87
858 3300046523 Ga0495644_0120273 Ga0495644_0120273_293_556 87
859 3300046523 Ga0495644_0207396 Ga0495644_0207396_345_608 87
860 3300046523 Ga0495644_0407523 Ga0495644_0407523_50_313 87
861 3300046526 Ga0495666_0091585 Ga0495666_0091585_536_799 87
862 3300046526 Ga0495666_0192538 Ga0495666_0192538_617_880 87
863 3300046528 Ga0495642_0252935 Ga0495642_0252935_188_451 87
864 3300046529 Ga0495652_0116556 Ga0495652_0116556_522_785 87
865 3300046529 Ga0495652_0200275 Ga0495652_0200275_493_756 87
866 3300046531 Ga0495665_0001485 Ga0495665_0001485_9900_10163 87
867 3300046531 Ga0495665_0014212 Ga0495665_0014212_2993_3256 87
868 3300046533 Ga0495640_0003074 Ga0495640_0003074_5492_5755 87
869 3300046533 Ga0495640_0228717 Ga0495640_0228717_429_692 87
870 3300046533 Ga0495640_0441513 Ga0495640_0441513_401_664 87
871 3300046536 Ga0495587_0043290 Ga0495587_0043290_383_646 87
872 3300046537 Ga0495598_0170055 Ga0495598_0170055_41_304 87
873 3300046537 Ga0495598_0361835 Ga0495598_0361835_38_301 87
874 3300046538 Ga0495609_0089082 Ga0495609_0089082_458_721 87
875 3300046543 Ga0495645_0200585 Ga0495645_0200585_110_373 87
876 3300046543 Ga0495645_0225258 Ga0495645_0225258_589_852 87
877 3300046557 Ga0495622_0169833 Ga0495622_0169833_199_462 87
878 3300046559 Ga0495667_0006817 Ga0495667_0006817_5043_5306 87
879 3300046559 Ga0495667_0968678 Ga0495667_0968678_149_412 87
880 3300046615 Ga0495656_0098949 Ga0495656_0098949_1009_1272 87
881 3300046615 Ga0495656_0198459 Ga0495656_0198459_582_845 87
882 3300046615 Ga0495656_0426621 Ga0495656_0426621_158_421 87
883 3300046615 Ga0495656_0460713 Ga0495656_0460713_261_524 87
884 3300046615 Ga0495656_0479664 Ga0495656_0479664_220_483 87
885 3300046616 Ga0495668_0639610 Ga0495668_0639610_116_379 87
886 3300046642 Ga0495634_0003097 Ga0495634_0003097_6136_6399 87
887 3300046642 Ga0495634_0014856 Ga0495634_0014856_1014_1277 87
888 3300046642 Ga0495634_0031690 Ga0495634_0031690_1221_1484 87
889 3300046642 Ga0495634_0505940 Ga0495634_0505940_288_551 87
890 3300046663 Ga0495635_0022878 Ga0495635_0022878_1153_1416 87
891 3300046663 Ga0495635_0067755 Ga0495635_0067755_122_385 87
892 3300046663 Ga0495635_0131446 Ga0495635_0131446_1002_1265 87
893 3300046665 Ga0495661_0220203 Ga0495661_0220203_617_880 87
894 3300046674 Ga0495588_0017098 Ga0495588_0017098_2137_2400 87
895 3300046674 Ga0495588_0085922 Ga0495588_0085922_495_758 87
896 3300046674 Ga0495588_0199384 Ga0495588_0199384_640_903 87
897 3300046674 Ga0495588_0439639 Ga0495588_0439639_265_528 87
898 3300046675 Ga0495657_0122511 Ga0495657_0122511_1144_1407 87
899 3300046678 Ga0495599_0172079 Ga0495599_0172079_627_890 87
900 3300046679 Ga0495623_0078324 Ga0495623_0078324_1099_1362 87
901 3300046679 Ga0495623_0575252 Ga0495623_0575252_286_549 87
902 3300046681 Ga0495647_0000597 Ga0495647_0000597_9967_10230 87
903 3300046681 Ga0495647_0012783 Ga0495647_0012783_1030_1293 87
904 3300046681 Ga0495647_0099549 Ga0495647_0099549_340_603 87
905 3300046681 Ga0495647_0212570 Ga0495647_0212570_453_716 87
906 3300046681 Ga0495647_0425018 Ga0495647_0425018_328_591 87
907 3300046683 Ga0495658_0012490 Ga0495658_0012490_3068_3331 87
908 3300046683 Ga0495658_0534938 Ga0495658_0534938_463_726 87
909 3300046689 Ga0495613_0005558 Ga0495613_0005558_3817_4080 87
910 3300046689 Ga0495613_0043999 Ga0495613_0043999_712_975 87
911 3300046689 Ga0495613_0173605 Ga0495613_0173605_491_754 87
912 3300046690 Ga0495624_0006496 Ga0495624_0006496_914_1177 87
913 3300046690 Ga0495624_0011613 Ga0495624_0011613_5350_5613 87
914 3300046690 Ga0495624_0416550 Ga0495624_0416550_151_414 87
915 3300046690 Ga0495624_0539623 Ga0495624_0539623_264_527 87
916 3300046691 Ga0495670_0247954 Ga0495670_0247954_450_713 87
917 3300046691 Ga0495670_0511229 Ga0495670_0511229_87_350 87
918 3300046692 Ga0495671_0176532 Ga0495671_0176532_263_526 87
919 3300046794 Ga0495589_0467220 Ga0495589_0467220_85_348 87
920 3300046809 Ga0495600_0003143 Ga0495600_0003143_8412_8675 87
921 3300047315 Ga0495581_0001437 Ga0495581_0001437_3537_3800 87
922 3300047315 Ga0495581_0003775 Ga0495581_0003775_5386_5649 87
923 3300047315 Ga0495581_0032656 Ga0495581_0032656_968_1231 87
924 3300047315 Ga0495581_0068099 Ga0495581_0068099_1250_1513 87
925 3300047317 Ga0495604_0018043 Ga0495604_0018043_2939_3202 87
926 3300047319 Ga0495674_0004046 Ga0495674_0004046_6955_7218 87
927 3300047319 Ga0495674_0029902 Ga0495674_0029902_110_373 87
928 3300047321 Ga0495676_0016250 Ga0495676_0016250_3455_3718 87
929 3300047321 Ga0495676_0017412 Ga0495676_0017412_4272_4535 87
930 3300047321 Ga0495676_0083518 Ga0495676_0083518_1232_1495 87
931 3300047321 Ga0495676_1076645 Ga0495676_1076645_79_342 87
932 3300047322 Ga0495680_0012939 Ga0495680_0012939_2118_2381 87
933 3300047322 Ga0495680_0189204 Ga0495680_0189204_932_1195 87
934 3300047445 Ga0495677_0218850 Ga0495677_0218850_121_384 87
935 3300047471 Ga0495684_0002922 Ga0495684_0002922_12382_12645 87
936 3300047471 Ga0495684_0265396 Ga0495684_0265396_527_790 87
937 3300047673 Ga0495593_0005440 Ga0495593_0005440_2941_3204 87
938 3300048088 Ga0495602_0549458 Ga0495602_0549458_404_667 87
939 3300048088 Ga0495602_0602377 Ga0495602_0602377_387_650 87
940 3300048089 Ga0495614_0007485 Ga0495614_0007485_4221_4484 87
941 3300048903 Ga0496100_0001463 Ga0496100_0001463_5413_5676 87
942 3300048903 Ga0496100_0001838 Ga0496100_0001838_7221_7484 87
943 3300048903 Ga0496100_0016897 Ga0496100_0016897_3212_3475 87
944 3300048903 Ga0496100_0030771 Ga0496100_0030771_2622_2885 87
945 3300048903 Ga0496100_0057468 Ga0496100_0057468_2219_2482 87
946 3300048903 Ga0496100_0086650 Ga0496100_0086650_1750_2013 87
947 3300048903 Ga0496100_0103101 Ga0496100_0103101_1130_1393 87
948 3300048903 Ga0496100_0299958 Ga0496100_0299958_746_1009 87
949 3300048903 Ga0496100_0812803 Ga0496100_0812803_305_568 87
950 3300048904 Ga0496101_0001319 Ga0496101_0001319_4832_5095 87
951 3300048904 Ga0496101_0003443 Ga0496101_0003443_3961_4224 87
952 3300048904 Ga0496101_0008890 Ga0496101_0008890_1744_2007 87
953 3300048904 Ga0496101_0010095 Ga0496101_0010095_2942_3205 87
954 3300048904 Ga0496101_0011879 Ga0496101_0011879_2866_3129 87
955 3300048904 Ga0496101_0014879 Ga0496101_0014879_2805_3068 87
956 3300048904 Ga0496101_0017205 Ga0496101_0017205_212_475 87
957 3300048904 Ga0496101_0034788 Ga0496101_0034788_2082_2345 87
958 3300048904 Ga0496101_0264692 Ga0496101_0264692_787_1050 87
959 3300048904 Ga0496101_0685391 Ga0496101_0685391_174_437 87
960 3300048904 Ga0496101_0984644 Ga0496101_0984644_268_531 87
961 3300048904 Ga0496101_1292166 Ga0496101_1292166_27_290 87
962 3300048905 Ga0496102_0002028 Ga0496102_0002028_4397_4660 87
963 3300048905 Ga0496102_0002197 Ga0496102_0002197_12415_12678 87
964 3300048905 Ga0496102_0009883 Ga0496102_0009883_1358_1621 87
965 3300048905 Ga0496102_0021038 Ga0496102_0021038_1922_2185 87
966 3300048905 Ga0496102_0034991 Ga0496102_0034991_1282_1545 87
967 3300048905 Ga0496102_0038224 Ga0496102_0038224_1165_1428 87
968 3300048905 Ga0496102_0123627 Ga0496102_0123627_2092_2355 87
969 3300048905 Ga0496102_0209187 Ga0496102_0209187_207_470 87
970 3300048905 Ga0496102_0459717 Ga0496102_0459717_533_796 87
971 3300048905 Ga0496102_0640824 Ga0496102_0640824_678_941 87
972 3300048905 Ga0496102_0747895 Ga0496102_0747895_254_517 87
973 3300048905 Ga0496102_1419754 Ga0496102_1419754_161_424 87
974 3300048905 Ga0496102_1756911 Ga0496102_1756911_172_435 87
975 3300048906 Ga0496103_0002459 Ga0496103_0002459_6225_6488 87
976 3300048906 Ga0496103_0005119 Ga0496103_0005119_6432_6695 87
977 3300048906 Ga0496103_0042072 Ga0496103_0042072_2457_2720 87
978 3300048906 Ga0496103_0050758 Ga0496103_0050758_39_302 87
979 3300048906 Ga0496103_0109477 Ga0496103_0109477_1172_1435 87
980 3300048906 Ga0496103_0203559 Ga0496103_0203559_789_1052 87
981 3300048907 Ga0496104_0002034 Ga0496104_0002034_7564_7827 87
982 3300048907 Ga0496104_0009484 Ga0496104_0009484_1713_1976 87
983 3300048907 Ga0496104_0027989 Ga0496104_0027989_4400_4663 87
984 3300048907 Ga0496104_0050038 Ga0496104_0050038_1573_1836 87
985 3300048907 Ga0496104_0076590 Ga0496104_0076590_1300_1563 87
986 3300048907 Ga0496104_0093795 Ga0496104_0093795_839_1102 87
987 3300048907 Ga0496104_0137476 Ga0496104_0137476_643_906 87
988 3300048907 Ga0496104_0157532 Ga0496104_0157532_1004_1267 87
989 3300048907 Ga0496104_0157545 Ga0496104_0157545_788_1051 87
990 3300048907 Ga0496104_0216653 Ga0496104_0216653_786_1049 87
991 3300048907 Ga0496104_0317370 Ga0496104_0317370_105_368 87
992 3300048907 Ga0496104_0694903 Ga0496104_0694903_445_723 87
993 3300048908 Ga0496105_0000050 Ga0496105_0000050_13532_13795 87
994 3300048908 Ga0496105_0005525 Ga0496105_0005525_8333_8596 87
995 3300048908 Ga0496105_0017579 Ga0496105_0017579_4912_5175 87
996 3300048908 Ga0496105_0020971 Ga0496105_0020971_4101_4364 87
997 3300048908 Ga0496105_0021711 Ga0496105_0021711_3391_3654 87
998 3300048908 Ga0496105_0074654 Ga0496105_0074654_900_1163 87
999 3300048908 Ga0496105_0266566 Ga0496105_0266566_731_994 87
1000 3300048908 Ga0496105_0292343 Ga0496105_0292343_728_991 87
1001 3300048908 Ga0496105_1030859 Ga0496105_1030859_70_333 87
1002 3300048908 Ga0496105_1069247 Ga0496105_1069247_121_384 87
1003 3300048909 Ga0496106_0002042 Ga0496106_0002042_4757_5020 87
1004 3300048909 Ga0496106_0004053 Ga0496106_0004053_8038_8301 87
1005 3300048909 Ga0496106_0005239 Ga0496106_0005239_8755_9018 87
1006 3300048909 Ga0496106_0010325 Ga0496106_0010325_659_922 87
1007 3300048909 Ga0496106_0012413 Ga0496106_0012413_439_702 87
1008 3300048909 Ga0496106_0034609 Ga0496106_0034609_3075_3338 87
1009 3300048909 Ga0496106_0047440 Ga0496106_0047440_47_310 87
1010 3300048909 Ga0496106_0055581 Ga0496106_0055581_1971_2234 87
1011 3300048909 Ga0496106_0227940 Ga0496106_0227940_522_785 87
1012 3300048909 Ga0496106_0479808 Ga0496106_0479808_411_674 87
1013 3300048909 Ga0496106_0823729 Ga0496106_0823729_67_330 87
1014 3300048910 Ga0496107_0000545 Ga0496107_0000545_9976_10239 87
1015 3300048910 Ga0496107_0002007 Ga0496107_0002007_3934_4197 87
1016 3300048910 Ga0496107_0012651 Ga0496107_0012651_2806_3069 87
1017 3300048910 Ga0496107_0013425 Ga0496107_0013425_3563_3826 87
1018 3300048910 Ga0496107_0014162 Ga0496107_0014162_1142_1405 87
1019 3300048910 Ga0496107_0017801 Ga0496107_0017801_4300_4563 87
1020 3300048910 Ga0496107_0029698 Ga0496107_0029698_568_831 87
1021 3300048910 Ga0496107_0041450 Ga0496107_0041450_2952_3215 87
1022 3300048910 Ga0496107_0299375 Ga0496107_0299375_149_412 87
1023 3300048910 Ga0496107_0578983 Ga0496107_0578983_71_334 87
1024 3300048911 Ga0496108_0000403 Ga0496108_0000403_19243_19506 87
1025 3300048911 Ga0496108_0001800 Ga0496108_0001800_6081_6344 87
1026 3300048911 Ga0496108_0009997 Ga0496108_0009997_5954_6217 87
1027 3300048911 Ga0496108_0075476 Ga0496108_0075476_2045_2308 87
1028 3300048911 Ga0496108_0171854 Ga0496108_0171854_1469_1732 87
1029 3300048911 Ga0496108_0203356 Ga0496108_0203356_216_479 87
1030 3300048911 Ga0496108_0258076 Ga0496108_0258076_505_768 87
1031 3300048911 Ga0496108_0295580 Ga0496108_0295580_445_708 87
1032 3300048911 Ga0496108_0525956 Ga0496108_0525956_107_370 87
1033 3300048911 Ga0496108_1318927 Ga0496108_1318927_251_514 87
1034 3300048912 Ga0496109_0001203 Ga0496109_0001203_20764_21027 87
1035 3300048912 Ga0496109_0001324 Ga0496109_0001324_1590_1853 87
1036 3300048912 Ga0496109_0002451 Ga0496109_0002451_158_421 87
1037 3300048912 Ga0496109_0002493 Ga0496109_0002493_6860_7123 87
1038 3300048912 Ga0496109_0003464 Ga0496109_0003464_5137_5400 87
1039 3300048912 Ga0496109_0023041 Ga0496109_0023041_5138_5401 87
1040 3300048912 Ga0496109_0045380 Ga0496109_0045380_3022_3285 87
1041 3300048912 Ga0496109_0093792 Ga0496109_0093792_2094_2357 87
1042 3300048912 Ga0496109_0171071 Ga0496109_0171071_517_780 87
1043 3300048912 Ga0496109_0602784 Ga0496109_0602784_613_876 87
1044 3300048912 Ga0496109_0669972 Ga0496109_0669972_532_795 87
1045 3300048912 Ga0496109_0737659 Ga0496109_0737659_38_301 87
1046 3300048912 Ga0496109_1254325 Ga0496109_1254325_118_381 87
1047 3300048912 Ga0496109_1398681 Ga0496109_1398681_233_496 87
1048 3300048912 Ga0496109_1562503 Ga0496109_1562503_175_453 87
1049 3300048912 Ga0496109_1888947 Ga0496109_1888947_230_493 87
1050 3300048913 Ga0496110_0001093 Ga0496110_0001093_9841_10104 87
1051 3300048913 Ga0496110_0004541 Ga0496110_0004541_7413_7676 87
1052 3300048913 Ga0496110_0030818 Ga0496110_0030818_2786_3049 87
1053 3300048913 Ga0496110_0060428 Ga0496110_0060428_1290_1553 87
1054 3300048913 Ga0496110_0079358 Ga0496110_0079358_1556_1819 87
1055 3300048913 Ga0496110_0254054 Ga0496110_0254054_763_1026 87
1056 3300048913 Ga0496110_0365085 Ga0496110_0365085_52_315 87
1057 3300048914 Ga0496111_0003419 Ga0496111_0003419_4032_4295 87
1058 3300048914 Ga0496111_0005179 Ga0496111_0005179_451_714 87
1059 3300048914 Ga0496111_0014563 Ga0496111_0014563_124_387 87
1060 3300048914 Ga0496111_0083991 Ga0496111_0083991_361_624 87
1061 3300048914 Ga0496111_0109252 Ga0496111_0109252_1736_1999 87
1062 3300048914 Ga0496111_0208267 Ga0496111_0208267_924_1187 87
1063 3300048914 Ga0496111_0236481 Ga0496111_0236481_942_1205 87
1064 3300048914 Ga0496111_0680124 Ga0496111_0680124_64_342 87
1065 3300048914 Ga0496111_0776692 Ga0496111_0776692_62_325 87
1066 3300048915 Ga0496112_0004222 Ga0496112_0004222_10885_11148 87
1067 3300048915 Ga0496112_0044728 Ga0496112_0044728_3639_3902 87
1068 3300048915 Ga0496112_0063315 Ga0496112_0063315_823_1101 87
1069 3300048915 Ga0496112_0106184 Ga0496112_0106184_820_1083 87
1070 3300048915 Ga0496112_0113533 Ga0496112_0113533_1507_1770 87
1071 3300048915 Ga0496112_0132923 Ga0496112_0132923_1308_1571 87
1072 3300048915 Ga0496112_0201869 Ga0496112_0201869_1670_1933 87
1073 3300048915 Ga0496112_0663892 Ga0496112_0663892_684_947 87
1074 3300048915 Ga0496112_1218657 Ga0496112_1218657_82_345 87
1075 3300048915 Ga0496112_1379663 Ga0496112_1379663_235_498 87
1076 3300048916 Ga0496113_0000452 Ga0496113_0000452_10542_10805 87
1077 3300048916 Ga0496113_0030876 Ga0496113_0030876_2015_2278 87
1078 3300048916 Ga0496113_0084448 Ga0496113_0084448_2090_2368 87
1079 3300048916 Ga0496113_0124353 Ga0496113_0124353_428_691 87
1080 3300048916 Ga0496113_0210068 Ga0496113_0210068_1214_1477 87
1081 3300048916 Ga0496113_0243560 Ga0496113_0243560_365_628 87
1082 3300048916 Ga0496113_0653831 Ga0496113_0653831_160_423 87
1083 3300048916 Ga0496113_0840575 Ga0496113_0840575_430_693 87
1084 3300048916 Ga0496113_1090558 Ga0496113_1090558_10_273 87
1085 3300048916 Ga0496113_1544248 Ga0496113_1544248_56_319 87
1086 3300048917 Ga0496114_0002175 Ga0496114_0002175_956_1219 87
1087 3300048917 Ga0496114_0003284 Ga0496114_0003284_5646_5909 87
1088 3300048917 Ga0496114_0004568 Ga0496114_0004568_5938_6201 87
1089 3300048917 Ga0496114_0005710 Ga0496114_0005710_3968_4231 87
1090 3300048917 Ga0496114_0021335 Ga0496114_0021335_437_700 87
1091 3300048917 Ga0496114_0035697 Ga0496114_0035697_859_1122 87
1092 3300048917 Ga0496114_0046848 Ga0496114_0046848_22_285 87
1093 3300048917 Ga0496114_0059492 Ga0496114_0059492_1731_1994 87
1094 3300048917 Ga0496114_0063380 Ga0496114_0063380_1813_2076 87
1095 3300048917 Ga0496114_0110909 Ga0496114_0110909_92_355 87
1096 3300048917 Ga0496114_0149864 Ga0496114_0149864_21_284 87
1097 3300048917 Ga0496114_0244969 Ga0496114_0244969_425_688 87
1098 3300048917 Ga0496114_0677448 Ga0496114_0677448_15_278 87
1099 3300048917 Ga0496114_0740192 Ga0496114_0740192_113_376 87
1100 3300048918 Ga0496115_0006641 Ga0496115_0006641_6399_6662 87
1101 3300048918 Ga0496115_0008859 Ga0496115_0008859_6600_6863 87
1102 3300048918 Ga0496115_0035042 Ga0496115_0035042_3298_3561 87
1103 3300048918 Ga0496115_0040254 Ga0496115_0040254_1676_1939 87
1104 3300048918 Ga0496115_0084967 Ga0496115_0084967_1344_1607 87
1105 3300048918 Ga0496115_0204299 Ga0496115_0204299_1202_1465 87
1106 3300048918 Ga0496115_0321374 Ga0496115_0321374_939_1202 87
1107 3300048918 Ga0496115_0343386 Ga0496115_0343386_806_1069 87
1108 3300048918 Ga0496115_0474167 Ga0496115_0474167_451_714 87
1109 3300048918 Ga0496115_0624300 Ga0496115_0624300_255_518 87
1110 3300048918 Ga0496115_0955186 Ga0496115_0955186_180_443 87
1111 3300048918 Ga0496115_0990980 Ga0496115_0990980_61_324 87
1112 3300048929 Ga0496126_0115479 Ga0496126_0115479_881_1144 87
1113 3300049568 Ga0501031_0007443 Ga0501031_0007443_2476_2739 87
1114 3300049568 Ga0501031_0152233 Ga0501031_0152233_52_315 87
1115 3300049568 Ga0501031_0180339 Ga0501031_0180339_1059_1322 87
1116 3300049568 Ga0501031_0976127 Ga0501031_0976127_262_525 87
1117 3300049569 Ga0501032_0087145 Ga0501032_0087145_1718_1981 87
1118 3300049569 Ga0501032_0399608 Ga0501032_0399608_396_659 87
1119 3300049570 Ga0501033_0309128 Ga0501033_0309128_493_756 87
1120 3300049570 Ga0501033_0522589 Ga0501033_0522589_385_648 87
1121 3300049572 Ga0501036_0033834 Ga0501036_0033834_1959_2222 87
1122 3300049572 Ga0501036_0775314 Ga0501036_0775314_165_428 87
1123 3300049573 Ga0501037_0083994 Ga0501037_0083994_1381_1644 87
1124 3300049573 Ga0501037_0328379 Ga0501037_0328379_142_405 87
1125 3300049574 Ga0501038_0075297 Ga0501038_0075297_1930_2193 87
1126 3300049574 Ga0501038_0191199 Ga0501038_0191199_493_756 87
1127 3300049574 Ga0501038_0613417 Ga0501038_0613417_365_628 87
1128 3300049575 Ga0501039_0023372 Ga0501039_0023372_4330_4593 87
1129 3300049575 Ga0501039_0327233 Ga0501039_0327233_269_532 87
1130 3300049575 Ga0501039_0353209 Ga0501039_0353209_133_396 87
1131 3300049575 Ga0501039_1499939 Ga0501039_1499939_203_466 87
1132 3300049576 Ga0501040_0098652 Ga0501040_0098652_1086_1349 87
1133 3300049576 Ga0501040_0107694 Ga0501040_0107694_1085_1348 87
1134 3300049576 Ga0501040_0118095 Ga0501040_0118095_1149_1412 87
1135 3300049576 Ga0501040_0139659 Ga0501040_0139659_144_407 87
1136 3300049576 Ga0501040_0265364 Ga0501040_0265364_149_412 87
1137 3300049576 Ga0501040_1106054 Ga0501040_1106054_49_312 87
1138 3300049577 Ga0501041_0224942 Ga0501041_0224942_439_702 87
1139 3300049577 Ga0501041_0364903 Ga0501041_0364903_58_321 87
1140 3300049577 Ga0501041_0410630 Ga0501041_0410630_329_592 87
1141 3300049578 Ga0501042_0015452 Ga0501042_0015452_4459_4722 87
1142 3300049578 Ga0501042_0148649 Ga0501042_0148649_413_676 87
1143 3300049578 Ga0501042_0277957 Ga0501042_0277957_353_616 87
1144 3300049578 Ga0501042_0436016 Ga0501042_0436016_131_394 87
1145 3300049580 Ga0501046_0043766 Ga0501046_0043766_2387_2650 87
1146 3300049580 Ga0501046_0297225 Ga0501046_0297225_121_384 87
1147 3300049582 Ga0501048_0004258 Ga0501048_0004258_5729_5992 87
1148 3300049582 Ga0501048_0362946 Ga0501048_0362946_44_307 87
1149 3300049582 Ga0501048_0490254 Ga0501048_0490254_583_846 87
1150 3300049582 Ga0501048_0528803 Ga0501048_0528803_476_739 87
1151 3300049583 Ga0501067_0000414 Ga0501067_0000414_8218_8481 87
1152 3300049583 Ga0501067_0169540 Ga0501067_0169540_126_389 87
1153 3300049583 Ga0501067_0175688 Ga0501067_0175688_859_1122 87
1154 3300049583 Ga0501067_0282360 Ga0501067_0282360_249_512 87
1155 3300049583 Ga0501067_0310057 Ga0501067_0310057_440_703 87
1156 3300049583 Ga0501067_0360618 Ga0501067_0360618_232_510 87
1157 3300049584 Ga0501068_0000406 Ga0501068_0000406_2473_2736 87
1158 3300049584 Ga0501068_0194721 Ga0501068_0194721_549_827 87
1159 3300049584 Ga0501068_0924569 Ga0501068_0924569_69_332 87
1160 3300049585 Ga0501069_0000177 Ga0501069_0000177_27584_27847 87
1161 3300049585 Ga0501069_0085439 Ga0501069_0085439_869_1132 87
1162 3300049585 Ga0501069_0223879 Ga0501069_0223879_659_922 87
1163 3300049585 Ga0501069_0308384 Ga0501069_0308384_378_656 87
1164 3300049587 Ga0501071_0029991 Ga0501071_0029991_176_439 87
1165 3300049587 Ga0501071_0153776 Ga0501071_0153776_1423_1686 87
1166 3300049587 Ga0501071_0776442 Ga0501071_0776442_122_385 87
1167 3300049587 Ga0501071_1085597 Ga0501071_1085597_171_434 87
1168 3300049588 Ga0501072_0002616 Ga0501072_0002616_3532_3795 87
1169 3300049588 Ga0501072_0072011 Ga0501072_0072011_33_296 87
1170 3300049588 Ga0501072_0659371 Ga0501072_0659371_399_662 87
1171 3300049588 Ga0501072_0848036 Ga0501072_0848036_39_302 87
1172 3300049589 Ga0501073_0251544 Ga0501073_0251544_664_927 87
1173 3300049589 Ga0501073_0706003 Ga0501073_0706003_334_597 87
1174 3300049590 Ga0501074_0050290 Ga0501074_0050290_534_797 87
1175 3300049590 Ga0501074_0161966 Ga0501074_0161966_44_307 87
1176 3300049590 Ga0501074_0211353 Ga0501074_0211353_732_995 87
1177 3300049590 Ga0501074_0464461 Ga0501074_0464461_52_315 87
1178 3300049591 Ga0501075_0037036 Ga0501075_0037036_2569_2832 87
1179 3300049591 Ga0501075_0262619 Ga0501075_0262619_484_747 87
1180 3300049591 Ga0501075_0541623 Ga0501075_0541623_413_676 87
1181 3300049592 Ga0501076_0017096 Ga0501076_0017096_234_497 87
1182 3300049592 Ga0501076_0248577 Ga0501076_0248577_1003_1266 87
1183 3300049592 Ga0501076_0317377 Ga0501076_0317377_605_868 87
1184 3300049592 Ga0501076_0325394 Ga0501076_0325394_68_331 87
1185 3300049593 Ga0501077_0041883 Ga0501077_0041883_1847_2110 87
1186 3300049593 Ga0501077_0093193 Ga0501077_0093193_1630_1893 87
1187 3300049593 Ga0501077_0123020 Ga0501077_0123020_813_1076 87
1188 3300049593 Ga0501077_0314753 Ga0501077_0314753_167_430 87
1189 3300049741 Ga0501079_0098535 Ga0501079_0098535_523_786 87
1190 3300049741 Ga0501079_0264833 Ga0501079_0264833_953_1216 87
1191 3300049742 Ga0501080_0349084 Ga0501080_0349084_631_894 87
1192 3300049742 Ga0501080_0851297 Ga0501080_0851297_241_504 87
1193 3300049742 Ga0501080_0949155 Ga0501080_0949155_441_704 87
1194 3300049743 Ga0501081_0158636 Ga0501081_0158636_830_1093 87
1195 3300049743 Ga0501081_0227363 Ga0501081_0227363_488_751 87
1196 3300049822 Ga0501035_0334585 Ga0501035_0334585_570_833 87
1197 3300049824 Ga0501045_0046796 Ga0501045_0046796_2567_2830 87
1198 3300049824 Ga0501045_0057654 Ga0501045_0057654_723_986 87
1199 3300049824 Ga0501045_0075657 Ga0501045_0075657_491_754 87
1200 3300049824 Ga0501045_0307433 Ga0501045_0307433_711_974 87
1201 3300049824 Ga0501045_0598039 Ga0501045_0598039_115_378 87
1202 3300050490 nmdc:mga03n38_239893_c1 nmdc:mga03n38_239893_c1_332_595 87
1203 3300050492 nmdc:mga0yw44_425689_c1 nmdc:mga0yw44_425689_c1_312_575 87
1204 3300050492 nmdc:mga0yw44_770908_c1 nmdc:mga0yw44_770908_c1_356_619 87
1205 3300050507 nmdc:mga05p37_172461_c1 nmdc:mga05p37_172461_c1_1220_1483 87
1206 3300050507 nmdc:mga05p37_2062688_c1 nmdc:mga05p37_2062688_c1_155_418 87
1207 3300050507 nmdc:mga05p37_40551_c1 nmdc:mga05p37_40551_c1_749_1012 87
1208 3300050507 nmdc:mga05p37_8517_c1 nmdc:mga05p37_8517_c1_565_828 87
1209 3300050508 nmdc:mga09592_1146884_c1 nmdc:mga09592_1146884_c1_155_418 87
1210 3300050510 nmdc:mga06r32_177570_c1 nmdc:mga06r32_177570_c1_134_397 87
1211 3300050511 nmdc:mga08y16_169430_c1 nmdc:mga08y16_169430_c1_1877_2140 87
1212 3300050511 nmdc:mga08y16_302823_c1 nmdc:mga08y16_302823_c1_1227_1490 87
1213 3300050512 nmdc:mga0n895_1029091_c1 nmdc:mga0n895_1029091_c1_306_569 87
1214 3300050512 nmdc:mga0n895_1270773_c1 nmdc:mga0n895_1270773_c1_152_415 87
1215 3300050512 nmdc:mga0n895_2216090_c1 nmdc:mga0n895_2216090_c1_61_324 87
1216 3300050512 nmdc:mga0n895_43470_c1 nmdc:mga0n895_43470_c1_2812_3075 87
1217 3300050512 nmdc:mga0n895_52992_c1 nmdc:mga0n895_52992_c1_1374_1637 87
1218 3300050512 nmdc:mga0n895_536835_c1 nmdc:mga0n895_536835_c1_292_570 87
1219 3300050513 nmdc:mga0rr50_22888_c1 nmdc:mga0rr50_22888_c1_3863_4126 87
1220 3300050513 nmdc:mga0rr50_525969_c1 nmdc:mga0rr50_525969_c1_561_824 87
1221 3300050514 nmdc:mga08x19_1154962_c1 nmdc:mga08x19_1154962_c1_182_445 87
1222 3300050514 nmdc:mga08x19_93625_c1 nmdc:mga08x19_93625_c1_1133_1396 87
1223 3300050515 nmdc:mga0a205_1196825_c1 nmdc:mga0a205_1196825_c1_91_354 87
1224 3300050515 nmdc:mga0a205_1318897_c1 nmdc:mga0a205_1318897_c1_218_481 87
1225 3300050515 nmdc:mga0a205_351207_c1 nmdc:mga0a205_351207_c1_234_497 87
1226 3300050515 nmdc:mga0a205_41861_c1 nmdc:mga0a205_41861_c1_2704_2967 87
1227 3300053077 Ga0495601_0002246 Ga0495601_0002246_5344_5607 87
1228 3300053077 Ga0495601_0045071 Ga0495601_0045071_445_708 87
1229 3300053077 Ga0495601_0065382 Ga0495601_0065382_1537_1800 87
1230 3300053077 Ga0495601_0723403 Ga0495601_0723403_182_445 87
1231 3300053078 Ga0495612_0027656 Ga0495612_0027656_423_686 87
1232 3300053084 Ga0495595_0002243 Ga0495595_0002243_4328_4591 87
1233 3300053084 Ga0495595_0341374 Ga0495595_0341374_426_689 87
1234 3300053084 Ga0495595_0408460 Ga0495595_0408460_117_380 87
1235 3300053085 Ga0495619_0020674 Ga0495619_0020674_3404_3667 87
1236 3300053085 Ga0495619_0196207 Ga0495619_0196207_989_1252 87
1237 3300053085 Ga0495619_1175468 Ga0495619_1175468_219_482 87
1238 3300054114 Ga0501084_0013069 Ga0501084_0013069_5506_5769 87
1239 3300054114 Ga0501084_0253608 Ga0501084_0253608_812_1075 87
1240 3300054114 Ga0501084_0317286 Ga0501084_0317286_136_399 87
1241 3300054114 Ga0501084_0480436 Ga0501084_0480436_58_321 87
1242 3300054114 Ga0501084_0626674 Ga0501084_0626674_324_587 87
1243 3300054114 Ga0501084_0776315 Ga0501084_0776315_167_430 87
1244 3300054114 Ga0501084_1006671 Ga0501084_1006671_174_437 87
1245 3300059424 Ga0590075_006978 Ga0590075_006978_129_392 87
1246 3300059490 Ga0587066_022517 Ga0587066_022517_718_981 87
1247 3300059491 Ga0587070_179593 Ga0587070_179593_83_346 87
1248 3300059504 Ga0587082_111861 Ga0587082_111861_41_304 87
1249 3300059506 Ga0587085_065683 Ga0587085_065683_11_274 87
1250 3300059511 Ga0587091_071778 Ga0587091_071778_182_445 87
1251 3300059511 Ga0587091_135361 Ga0587091_135361_311_574 87
1252 3300060353 Ga0501082_0025036 Ga0501082_0025036_105_368 87
1253 3300060353 Ga0501082_0309834 Ga0501082_0309834_538_801 87
1254 3300060353 Ga0501082_0528625 Ga0501082_0528625_550_813 87
1255 3300060353 Ga0501082_1261139 Ga0501082_1261139_36_299 87
1256 3300060353 Ga0501082_1615719 Ga0501082_1615719_190_453 87
1257 3300060353 Ga0501082_1994215 Ga0501082_1994215_141_404 87
1258 3300061719 Ga0466962_0024979 Ga0466962_0024979_991_1254 87
1259 3300061719 Ga0466962_0155400 Ga0466962_0155400_25_291 87
1260 3300061719 Ga0466962_0368004 Ga0466962_0368004_402_665 87
1261 3300061734 Ga0530510_0021443 Ga0530510_0021443_4199_4462 87
1262 3300061734 Ga0530510_0103178 Ga0530510_0103178_1223_1486 87
1263 3300061734 Ga0530510_0262751 Ga0530510_0262751_110_373 87
1264 3300061734 Ga0530510_0278887 Ga0530510_0278887_235_498 87
1265 3300061734 Ga0530510_0995902 Ga0530510_0995902_283_546 87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.8739 1 84
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.846 1 87
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.8375 1 84
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.8371 1 87
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8292 3 85
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.846 1 87 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8371 1 87 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8148 3 82 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8019 2 87 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7859 2 87 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A529I7N5-F1-model_v4 MoaD/ThiS family protein 0.978 2 73
AF-A0A0A0D3P6-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9767 3 73
AF-A0A5C7NWK1-F1-model_v4 deleted 0.9644 2 87
AF-A0A5S9PX83-F1-model_v4 Sulfur carrier protein CysO 0.9628 2 87
AF-A0A541C2T2-F1-model_v4 MoaD/ThiS family protein 0.9603 2 87

Feature Viewer

pLDDT pTM Quality
91.97 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map