F492345
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1265 | 397 | 1265 | 87 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_1179642|Ga0395905_1179642_15_338 |
| Length | 101 |
| Sequence | VVGGGRVPAVDLLGRGGDDLVADLRLPPTELPRRLSVEAPTVVGALREIDEKWPGLLDRLCSHGPTLRPHIHVYVDGRRAQLEDAIDERSRVDVVAAISGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 208 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 247 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 250 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 251 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 252 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 253 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 254 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 255 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 256 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 257 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 258 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 259 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 260 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 261 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 390 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 397 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.42 |
| Metatranscriptomes | 1.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 13.75 |
| Rhizosphere | 85.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10002884 | 3300002077 | Bacteria | 3515 |
| 2 | JGI24742J22300_10005646 | 3300002244 | Bacteria | 2057 |
| 3 | Ga0070658_10121644 | 3300005327 | Bacteria | 2169 |
| 4 | Ga0070658_11060860 | 3300005327 | Bacteria | 705 |
| 5 | Ga0070683_100113786 | 3300005329 | Bacteria | 2554 |
| 6 | Ga0070683_100319357 | 3300005329 | Bacteria | 1478 |
| 7 | Ga0070683_100382574 | 3300005329 | Bacteria | 1341 |
| 8 | Ga0070683_100598738 | 3300005329 | Bacteria | 1055 |
| 9 | Ga0070683_101665008 | 3300005329 | Bacteria | 613 |
| 10 | Ga0070683_102158758 | 3300005329 | Unclassified | 535 |
| 11 | Ga0070690_100328527 | 3300005330 | Bacteria | 1104 |
| 12 | Ga0070670_101814183 | 3300005331 | Bacteria | 561 |
| 13 | Ga0070677_10107090 | 3300005333 | Bacteria | 1242 |
| 14 | Ga0070680_100010728 | 3300005336 | Bacteria | 7074 |
| 15 | Ga0070680_100046131 | 3300005336 | Bacteria | 3544 |
| 16 | Ga0070680_100101251 | 3300005336 | Bacteria | 2391 |
| 17 | Ga0070680_100992548 | 3300005336 | Bacteria | 725 |
| 18 | Ga0070682_100005203 | 3300005337 | Bacteria | 7237 |
| 19 | Ga0070682_100012014 | 3300005337 | Bacteria | 4954 |
| 20 | Ga0070682_100038562 | 3300005337 | Bacteria | 2930 |
| 21 | Ga0070682_100615740 | 3300005337 | Bacteria | 859 |
| 22 | Ga0070682_101503533 | 3300005337 | Unclassified | 579 |
| 23 | Ga0070682_101702170 | 3300005337 | Bacteria | 548 |
| 24 | Ga0068868_100047501 | 3300005338 | Bacteria | 3365 |
| 25 | Ga0068868_100458818 | 3300005338 | Bacteria | 1109 |
| 26 | Ga0068868_100841141 | 3300005338 | Unclassified | 831 |
| 27 | Ga0070660_100007876 | 3300005339 | Bacteria | 7430 |
| 28 | Ga0070660_100263381 | 3300005339 | Bacteria | 1408 |
| 29 | Ga0070660_100517313 | 3300005339 | Unclassified | 994 |
| 30 | Ga0070660_101322465 | 3300005339 | Bacteria | 612 |
| 31 | Ga0070660_101865784 | 3300005339 | Unclassified | 512 |
| 32 | Ga0070689_100013742 | 3300005340 | Bacteria | 5865 |
| 33 | Ga0070689_100169688 | 3300005340 | Bacteria | 1767 |
| 34 | Ga0070689_100607574 | 3300005340 | Unclassified | 948 |
| 35 | Ga0070687_100904722 | 3300005343 | Bacteria | 633 |
| 36 | Ga0070661_100984439 | 3300005344 | Bacteria | 699 |
| 37 | Ga0070692_10017715 | 3300005345 | Bacteria | 3412 |
| 38 | Ga0070668_101417711 | 3300005347 | Bacteria | 634 |
| 39 | Ga0070669_100359841 | 3300005353 | Bacteria | 1183 |
| 40 | Ga0070675_100065652 | 3300005354 | Bacteria | 3001 |
| 41 | Ga0070675_100975627 | 3300005354 | Bacteria | 778 |
| 42 | Ga0070675_101093248 | 3300005354 | Bacteria | 733 |
| 43 | Ga0070675_101308900 | 3300005354 | Unclassified | 668 |
| 44 | Ga0070671_100043832 | 3300005355 | Bacteria | 3718 |
| 45 | Ga0070671_100050442 | 3300005355 | Bacteria | 3461 |
| 46 | Ga0070671_100199816 | 3300005355 | Bacteria | 1695 |
| 47 | Ga0070671_100581509 | 3300005355 | Bacteria | 967 |
| 48 | Ga0070674_100005302 | 3300005356 | Bacteria | 7427 |
| 49 | Ga0070674_100145759 | 3300005356 | Bacteria | 1782 |
| 50 | Ga0070674_100155400 | 3300005356 | Bacteria | 1730 |
| 51 | Ga0070674_100172688 | 3300005356 | Unclassified | 1650 |
| 52 | Ga0070674_100928816 | 3300005356 | Unclassified | 759 |
| 53 | Ga0070673_101108750 | 3300005364 | Bacteria | 739 |
| 54 | Ga0070688_100008183 | 3300005365 | Bacteria | 5665 |
| 55 | Ga0070688_101080898 | 3300005365 | Bacteria | 640 |
| 56 | Ga0070659_100241562 | 3300005366 | Bacteria | 1495 |
| 57 | Ga0070659_100832331 | 3300005366 | Bacteria | 804 |
| 58 | Ga0070659_100871464 | 3300005366 | Unclassified | 786 |
| 59 | Ga0070667_101336946 | 3300005367 | Unclassified | 672 |
| 60 | Ga0070667_101399362 | 3300005367 | Bacteria | 656 |
| 61 | Ga0070709_10268306 | 3300005434 | Bacteria | 1236 |
| 62 | Ga0070709_10547749 | 3300005434 | Bacteria | 885 |
| 63 | Ga0070709_10611746 | 3300005434 | Unclassified | 840 |
| 64 | Ga0070709_10629416 | 3300005434 | Bacteria | 829 |
| 65 | Ga0070714_100096340 | 3300005435 | Bacteria | 2600 |
| 66 | Ga0070714_100169434 | 3300005435 | Bacteria | 1981 |
| 67 | Ga0070714_100251064 | 3300005435 | Bacteria | 1636 |
| 68 | Ga0070714_100320773 | 3300005435 | Bacteria | 1449 |
| 69 | Ga0070713_100147731 | 3300005436 | Bacteria | 2088 |
| 70 | Ga0070713_100791617 | 3300005436 | Unclassified | 909 |
| 71 | Ga0070713_101981494 | 3300005436 | Bacteria | 565 |
| 72 | Ga0070710_10007082 | 3300005437 | Bacteria | 5414 |
| 73 | Ga0070710_10429532 | 3300005437 | Bacteria | 891 |
| 74 | Ga0070701_10014128 | 3300005438 | Bacteria | 3653 |
| 75 | Ga0070701_10116456 | 3300005438 | Bacteria | 1500 |
| 76 | Ga0070711_100003182 | 3300005439 | Bacteria | 9527 |
| 77 | Ga0070711_100034675 | 3300005439 | Bacteria | 3368 |
| 78 | Ga0070711_100865370 | 3300005439 | Bacteria | 770 |
| 79 | Ga0070705_100023909 | 3300005440 | Bacteria | 3290 |
| 80 | Ga0070700_100001522 | 3300005441 | Bacteria | 11542 |
| 81 | Ga0070700_100024380 | 3300005441 | Bacteria | 3551 |
| 82 | Ga0070700_100477031 | 3300005441 | Unclassified | 955 |
| 83 | Ga0070700_101225522 | 3300005441 | Bacteria | 627 |
| 84 | Ga0070694_100054439 | 3300005444 | Bacteria | 2711 |
| 85 | Ga0070694_100327248 | 3300005444 | Bacteria | 1181 |
| 86 | Ga0070694_100367868 | 3300005444 | Bacteria | 1118 |
| 87 | Ga0070694_100952320 | 3300005444 | Bacteria | 711 |
| 88 | Ga0070708_100238367 | 3300005445 | Bacteria | 1708 |
| 89 | Ga0070708_100928861 | 3300005445 | Unclassified | 816 |
| 90 | Ga0070708_101106228 | 3300005445 | Bacteria | 742 |
| 91 | Ga0070708_101218900 | 3300005445 | Bacteria | 704 |
| 92 | Ga0070663_100007368 | 3300005455 | Bacteria | 6693 |
| 93 | Ga0070663_100129504 | 3300005455 | Bacteria | 1915 |
| 94 | Ga0070663_100745445 | 3300005455 | Bacteria | 836 |
| 95 | Ga0070678_100001885 | 3300005456 | Bacteria | 11318 |
| 96 | Ga0070678_100025558 | 3300005456 | Bacteria | 3975 |
| 97 | Ga0070678_100900165 | 3300005456 | Bacteria | 809 |
| 98 | Ga0070678_101065709 | 3300005456 | Bacteria | 745 |
| 99 | Ga0070678_101556290 | 3300005456 | Bacteria | 620 |
| 100 | Ga0070678_101687957 | 3300005456 | Bacteria | 596 |
| 101 | Ga0070662_100888449 | 3300005457 | Bacteria | 760 |
| 102 | Ga0070662_100948161 | 3300005457 | Unclassified | 735 |
| 103 | Ga0070662_101158666 | 3300005457 | Bacteria | 664 |
| 104 | Ga0070681_10012878 | 3300005458 | Bacteria | 8306 |
| 105 | Ga0070681_10066324 | 3300005458 | Bacteria | 3578 |
| 106 | Ga0070681_10101906 | 3300005458 | Bacteria | 2816 |
| 107 | Ga0070681_10920824 | 3300005458 | Unclassified | 793 |
| 108 | Ga0068867_100002812 | 3300005459 | Bacteria | 12234 |
| 109 | Ga0068867_100322103 | 3300005459 | Bacteria | 1281 |
| 110 | Ga0068867_101609589 | 3300005459 | Bacteria | 607 |
| 111 | Ga0070685_10034706 | 3300005466 | Bacteria | 2842 |
| 112 | Ga0070685_10047068 | 3300005466 | Bacteria | 2479 |
| 113 | Ga0070706_100099647 | 3300005467 | Bacteria | 2699 |
| 114 | Ga0070706_101681800 | 3300005467 | Bacteria | 578 |
| 115 | Ga0070706_101709306 | 3300005467 | Bacteria | 573 |
| 116 | Ga0070707_100020070 | 3300005468 | Bacteria | 6302 |
| 117 | Ga0070707_100971290 | 3300005468 | Unclassified | 815 |
| 118 | Ga0070707_101727840 | 3300005468 | Bacteria | 593 |
| 119 | Ga0070698_100100234 | 3300005471 | Unclassified | 2869 |
| 120 | Ga0070698_100207210 | 3300005471 | Unclassified | 1896 |
| 121 | Ga0070698_100233256 | 3300005471 | Bacteria | 1773 |
| 122 | Ga0070698_100241519 | 3300005471 | Bacteria | 1739 |
| 123 | Ga0070699_100065041 | 3300005518 | Bacteria | 3164 |
| 124 | Ga0070699_100891344 | 3300005518 | Bacteria | 815 |
| 125 | Ga0070679_100044289 | 3300005530 | Bacteria | 4433 |
| 126 | Ga0070679_100057930 | 3300005530 | Bacteria | 3861 |
| 127 | Ga0070679_100260982 | 3300005530 | Bacteria | 1688 |
| 128 | Ga0070679_100780062 | 3300005530 | Bacteria | 899 |
| 129 | Ga0070679_101372135 | 3300005530 | Bacteria | 653 |
| 130 | Ga0070684_100164140 | 3300005535 | Bacteria | 2016 |
| 131 | Ga0070684_100236486 | 3300005535 | Bacteria | 1668 |
| 132 | Ga0070684_100239566 | 3300005535 | Bacteria | 1657 |
| 133 | Ga0070684_100444530 | 3300005535 | Bacteria | 1198 |
| 134 | Ga0070684_100480314 | 3300005535 | Bacteria | 1150 |
| 135 | Ga0070684_100675964 | 3300005535 | Unclassified | 962 |
| 136 | Ga0070684_100952256 | 3300005535 | Bacteria | 805 |
| 137 | Ga0070697_100015513 | 3300005536 | Bacteria | 5981 |
| 138 | Ga0070697_100874373 | 3300005536 | Unclassified | 797 |
| 139 | Ga0070697_101093116 | 3300005536 | Bacteria | 710 |
| 140 | Ga0068853_100010897 | 3300005539 | Bacteria | 7365 |
| 141 | Ga0070672_100100692 | 3300005543 | Unclassified | 2343 |
| 142 | Ga0070672_100551570 | 3300005543 | Bacteria | 1001 |
| 143 | Ga0070672_101535388 | 3300005543 | Bacteria | 597 |
| 144 | Ga0070686_100004420 | 3300005544 | Bacteria | 7758 |
| 145 | Ga0070686_100457101 | 3300005544 | Bacteria | 983 |
| 146 | Ga0070686_101004867 | 3300005544 | Bacteria | 684 |
| 147 | Ga0070686_101704664 | 3300005544 | Unclassified | 535 |
| 148 | Ga0070695_100079175 | 3300005545 | Unclassified | 2168 |
| 149 | Ga0070695_101134292 | 3300005545 | Bacteria | 641 |
| 150 | Ga0070696_100005547 | 3300005546 | Bacteria | 8423 |
| 151 | Ga0070693_100002841 | 3300005547 | Bacteria | 7977 |
| 152 | Ga0070693_100026239 | 3300005547 | Unclassified | 3144 |
| 153 | Ga0070693_100124589 | 3300005547 | Bacteria | 1602 |
| 154 | Ga0070665_100105506 | 3300005548 | Bacteria | 2820 |
| 155 | Ga0070665_100688053 | 3300005548 | Unclassified | 1036 |
| 156 | Ga0070665_101757188 | 3300005548 | Bacteria | 627 |
| 157 | Ga0070665_102187472 | 3300005548 | Bacteria | 557 |
| 158 | Ga0070704_100018433 | 3300005549 | Bacteria | 4464 |
| 159 | Ga0070704_101025894 | 3300005549 | Bacteria | 747 |
| 160 | Ga0070704_102266551 | 3300005549 | Bacteria | 505 |
| 161 | Ga0068855_100108032 | 3300005563 | Bacteria | 3196 |
| 162 | Ga0068855_100215913 | 3300005563 | Bacteria | 2153 |
| 163 | Ga0068855_100391200 | 3300005563 | Bacteria | 1525 |
| 164 | Ga0070664_100417318 | 3300005564 | Unclassified | 1229 |
| 165 | Ga0068854_100733226 | 3300005578 | Bacteria | 856 |
| 166 | Ga0068856_100006334 | 3300005614 | Bacteria | 11609 |
| 167 | Ga0068856_100019097 | 3300005614 | Bacteria | 6653 |
| 168 | Ga0068856_100124975 | 3300005614 | Bacteria | 2575 |
| 169 | Ga0068856_100315940 | 3300005614 | Bacteria | 1579 |
| 170 | Ga0068856_100379374 | 3300005614 | Bacteria | 1433 |
| 171 | Ga0070702_100006871 | 3300005615 | Bacteria | 5417 |
| 172 | Ga0070702_100097384 | 3300005615 | Bacteria | 1797 |
| 173 | Ga0070702_100585912 | 3300005615 | Bacteria | 834 |
| 174 | Ga0068852_100072866 | 3300005616 | Bacteria | 3020 |
| 175 | Ga0068852_101955607 | 3300005616 | Bacteria | 608 |
| 176 | Ga0068852_102801298 | 3300005616 | Bacteria | 506 |
| 177 | Ga0068859_100044009 | 3300005617 | Bacteria | 4487 |
| 178 | Ga0068859_102137476 | 3300005617 | Bacteria | 618 |
| 179 | Ga0068864_100920442 | 3300005618 | Bacteria | 864 |
| 180 | Ga0068864_101029324 | 3300005618 | Bacteria | 817 |
| 181 | Ga0068864_102550393 | 3300005618 | Bacteria | 517 |
| 182 | Ga0068866_10004917 | 3300005718 | Bacteria | 5494 |
| 183 | Ga0068866_10637352 | 3300005718 | Bacteria | 724 |
| 184 | Ga0068866_11113840 | 3300005718 | Bacteria | 566 |
| 185 | Ga0068861_100088714 | 3300005719 | Bacteria | 2436 |
| 186 | Ga0068861_100431878 | 3300005719 | Bacteria | 1176 |
| 187 | Ga0068870_10022453 | 3300005840 | Bacteria | 3101 |
| 188 | Ga0068870_10518789 | 3300005840 | Unclassified | 797 |
| 189 | Ga0068863_100335123 | 3300005841 | Bacteria | 1471 |
| 190 | Ga0068863_101897620 | 3300005841 | Bacteria | 606 |
| 191 | Ga0068860_100221601 | 3300005843 | Unclassified | 1837 |
| 192 | Ga0068860_100398203 | 3300005843 | Bacteria | 1362 |
| 193 | Ga0068860_101038128 | 3300005843 | Unclassified | 838 |
| 194 | Ga0068860_102413470 | 3300005843 | Unclassified | 546 |
| 195 | Ga0081455_10409176 | 3300005937 | Bacteria | 939 |
| 196 | Ga0081539_10142486 | 3300005985 | Bacteria | 1163 |
| 197 | Ga0070717_10007976 | 3300006028 | Bacteria | 7885 |
| 198 | Ga0070717_10032371 | 3300006028 | Bacteria | 4213 |
| 199 | Ga0070717_10762202 | 3300006028 | Bacteria | 880 |
| 200 | Ga0070717_11143804 | 3300006028 | Bacteria | 709 |
| 201 | Ga0070717_11234265 | 3300006028 | Bacteria | 680 |
| 202 | Ga0070717_11376358 | 3300006028 | Unclassified | 641 |
| 203 | Ga0075432_10067820 | 3300006058 | Bacteria | 1278 |
| 204 | Ga0070715_10012087 | 3300006163 | Bacteria | 3128 |
| 205 | Ga0070715_10828576 | 3300006163 | Bacteria | 564 |
| 206 | Ga0070716_100330193 | 3300006173 | Bacteria | 1072 |
| 207 | Ga0070716_101634343 | 3300006173 | Unclassified | 530 |
| 208 | Ga0070712_100078687 | 3300006175 | Bacteria | 2381 |
| 209 | Ga0070712_100098783 | 3300006175 | Bacteria | 2154 |
| 210 | Ga0070712_100492019 | 3300006175 | Bacteria | 1027 |
| 211 | Ga0070712_100732521 | 3300006175 | Bacteria | 845 |
| 212 | Ga0070712_100828983 | 3300006175 | Bacteria | 795 |
| 213 | Ga0075367_10962613 | 3300006178 | Bacteria | 545 |
| 214 | Ga0097621_100208813 | 3300006237 | Bacteria | 1698 |
| 215 | Ga0097621_100462764 | 3300006237 | Bacteria | 1144 |
| 216 | Ga0068871_100013932 | 3300006358 | Bacteria | 5978 |
| 217 | Ga0068871_100102089 | 3300006358 | Bacteria | 2404 |
| 218 | Ga0068871_101327441 | 3300006358 | Bacteria | 677 |
| 219 | Ga0075431_100245114 | 3300006847 | Bacteria | 1822 |
| 220 | Ga0075433_10032954 | 3300006852 | Bacteria | 4439 |
| 221 | Ga0075433_10407006 | 3300006852 | Unclassified | 1200 |
| 222 | Ga0075433_11091582 | 3300006852 | Unclassified | 694 |
| 223 | Ga0075434_100030670 | 3300006871 | Bacteria | 5296 |
| 224 | Ga0075434_100075775 | 3300006871 | Bacteria | 3358 |
| 225 | Ga0075434_100359519 | 3300006871 | Bacteria | 1477 |
| 226 | Ga0075434_100563152 | 3300006871 | Bacteria | 1159 |
| 227 | Ga0075434_100668080 | 3300006871 | Bacteria | 1057 |
| 228 | Ga0075434_101205432 | 3300006871 | Bacteria | 769 |
| 229 | Ga0075434_101491305 | 3300006871 | Unclassified | 686 |
| 230 | Ga0068865_100002447 | 3300006881 | Bacteria | 10981 |
| 231 | Ga0068865_100014363 | 3300006881 | Bacteria | 5031 |
| 232 | Ga0068865_101039587 | 3300006881 | Bacteria | 719 |
| 233 | Ga0068865_101220758 | 3300006881 | Bacteria | 666 |
| 234 | Ga0068865_101277837 | 3300006881 | Bacteria | 652 |
| 235 | Ga0075436_100023051 | 3300006914 | Bacteria | 4275 |
| 236 | Ga0075436_100025415 | 3300006914 | Bacteria | 4076 |
| 237 | Ga0097620_100044009 | 3300006931 | Bacteria | 4487 |
| 238 | Ga0097620_102136633 | 3300006931 | Bacteria | 618 |
| 239 | Ga0075435_100000729 | 3300007076 | Bacteria | 20397 |
| 240 | Ga0075435_100008824 | 3300007076 | Bacteria | 7262 |
| 241 | Ga0075435_101616031 | 3300007076 | Bacteria | 569 |
| 242 | Ga0111539_10007764 | 3300009094 | Bacteria | 13697 |
| 243 | Ga0111539_10950637 | 3300009094 | Bacteria | 999 |
| 244 | Ga0111539_11167054 | 3300009094 | Unclassified | 895 |
| 245 | Ga0105245_10067558 | 3300009098 | Bacteria | 3238 |
| 246 | Ga0105245_10280204 | 3300009098 | Bacteria | 1629 |
| 247 | Ga0105245_10344290 | 3300009098 | Bacteria | 1475 |
| 248 | Ga0105245_10537085 | 3300009098 | Unclassified | 1190 |
| 249 | Ga0105245_11473113 | 3300009098 | Bacteria | 731 |
| 250 | Ga0105245_12625668 | 3300009098 | Unclassified | 557 |
| 251 | Ga0105245_12648972 | 3300009098 | Bacteria | 554 |
| 252 | Ga0105245_12938323 | 3300009098 | Bacteria | 528 |
| 253 | Ga0105247_10246670 | 3300009101 | Unclassified | 1219 |
| 254 | Ga0105247_10481939 | 3300009101 | Bacteria | 900 |
| 255 | Ga0105247_10775271 | 3300009101 | Bacteria | 729 |
| 256 | Ga0105247_11209260 | 3300009101 | Bacteria | 602 |
| 257 | Ga0105247_11618496 | 3300009101 | Bacteria | 532 |
| 258 | Ga0114129_10002432 | 3300009147 | Bacteria | 25835 |
| 259 | Ga0114129_10052442 | 3300009147 | Bacteria | 5724 |
| 260 | Ga0114129_10198068 | 3300009147 | Bacteria | 2722 |
| 261 | Ga0114129_10260979 | 3300009147 | Unclassified | 2322 |
| 262 | Ga0114129_10384421 | 3300009147 | Bacteria | 1853 |
| 263 | Ga0114129_11606517 | 3300009147 | Unclassified | 796 |
| 264 | Ga0114129_12627120 | 3300009147 | Bacteria | 601 |
| 265 | Ga0105243_10003824 | 3300009148 | Bacteria | 12041 |
| 266 | Ga0105243_10028730 | 3300009148 | Bacteria | 4271 |
| 267 | Ga0105243_10145387 | 3300009148 | Bacteria | 2028 |
| 268 | Ga0105243_10594517 | 3300009148 | Unclassified | 1064 |
| 269 | Ga0105243_10880415 | 3300009148 | Unclassified | 889 |
| 270 | Ga0105243_11381352 | 3300009148 | Bacteria | 724 |
| 271 | Ga0105241_10499577 | 3300009174 | Bacteria | 1084 |
| 272 | Ga0105241_12483902 | 3300009174 | Bacteria | 519 |
| 273 | Ga0105242_10003423 | 3300009176 | Bacteria | 12337 |
| 274 | Ga0105242_10033783 | 3300009176 | Bacteria | 4098 |
| 275 | Ga0105242_10366867 | 3300009176 | Bacteria | 1334 |
| 276 | Ga0105242_10503809 | 3300009176 | Bacteria | 1152 |
| 277 | Ga0105242_10514446 | 3300009176 | Bacteria | 1141 |
| 278 | Ga0105242_10679578 | 3300009176 | Unclassified | 1005 |
| 279 | Ga0105242_10864895 | 3300009176 | Bacteria | 901 |
| 280 | Ga0105242_11385119 | 3300009176 | Unclassified | 730 |
| 281 | Ga0105242_13291476 | 3300009176 | Bacteria | 502 |
| 282 | Ga0105248_10012945 | 3300009177 | Bacteria | 9195 |
| 283 | Ga0105248_10290675 | 3300009177 | Bacteria | 1840 |
| 284 | Ga0105248_10325855 | 3300009177 | Bacteria | 1730 |
| 285 | Ga0105248_10515917 | 3300009177 | Bacteria | 1348 |
| 286 | Ga0105248_11446796 | 3300009177 | Bacteria | 778 |
| 287 | Ga0105237_10515948 | 3300009545 | Unclassified | 1202 |
| 288 | Ga0105237_12550279 | 3300009545 | Bacteria | 522 |
| 289 | Ga0105238_10123948 | 3300009551 | Bacteria | 2563 |
| 290 | Ga0105238_11000362 | 3300009551 | Unclassified | 857 |
| 291 | Ga0105238_12568878 | 3300009551 | Bacteria | 545 |
| 292 | Ga0105249_10001792 | 3300009553 | Bacteria | 18700 |
| 293 | Ga0105249_11102300 | 3300009553 | Bacteria | 864 |
| 294 | Ga0105249_11411222 | 3300009553 | Bacteria | 768 |
| 295 | Ga0105249_11439250 | 3300009553 | Bacteria | 761 |
| 296 | Ga0105249_11576452 | 3300009553 | Bacteria | 729 |
| 297 | Ga0105249_13273095 | 3300009553 | Bacteria | 521 |
| 298 | Ga0105239_10006563 | 3300010375 | Bacteria | 13473 |
| 299 | Ga0105239_10661247 | 3300010375 | Unclassified | 1194 |
| 300 | Ga0105239_11510191 | 3300010375 | Bacteria | 776 |
| 301 | Ga0105239_11616860 | 3300010375 | Bacteria | 749 |
| 302 | Ga0105239_12746030 | 3300010375 | Unclassified | 575 |
| 303 | Ga0105239_12994387 | 3300010375 | Unclassified | 551 |
| 304 | Ga0105246_10168375 | 3300011119 | Bacteria | 1676 |
| 305 | Ga0105246_10428207 | 3300011119 | Bacteria | 1106 |
| 306 | Ga0105246_12433871 | 3300011119 | Bacteria | 514 |
| 307 | Ga0157373_10546942 | 3300013100 | Unclassified | 839 |
| 308 | Ga0157373_10755650 | 3300013100 | Bacteria | 715 |
| 309 | Ga0157369_10010968 | 3300013105 | Bacteria | 10315 |
| 310 | Ga0157369_10030270 | 3300013105 | Bacteria | 5972 |
| 311 | Ga0157369_10908364 | 3300013105 | Bacteria | 903 |
| 312 | Ga0157369_11145233 | 3300013105 | Bacteria | 795 |
| 313 | Ga0157374_10012233 | 3300013296 | Bacteria | 7459 |
| 314 | Ga0157374_10575700 | 3300013296 | Unclassified | 1135 |
| 315 | Ga0157374_10661230 | 3300013296 | Bacteria | 1057 |
| 316 | Ga0157374_11958134 | 3300013296 | Bacteria | 612 |
| 317 | Ga0157378_10004712 | 3300013297 | Bacteria | 11959 |
| 318 | Ga0157378_10059956 | 3300013297 | Bacteria | 3396 |
| 319 | Ga0157378_10318789 | 3300013297 | Unclassified | 1510 |
| 320 | Ga0157378_11209026 | 3300013297 | Bacteria | 795 |
| 321 | Ga0157378_13040822 | 3300013297 | Unclassified | 520 |
| 322 | Ga0163162_10005507 | 3300013306 | Bacteria | 12239 |
| 323 | Ga0163162_10220218 | 3300013306 | Bacteria | 2028 |
| 324 | Ga0163162_10878044 | 3300013306 | Unclassified | 1011 |
| 325 | Ga0157372_10499303 | 3300013307 | Bacteria | 1419 |
| 326 | Ga0157372_10550663 | 3300013307 | Unclassified | 1345 |
| 327 | Ga0157375_10327919 | 3300013308 | Unclassified | 1695 |
| 328 | Ga0157375_10926392 | 3300013308 | Bacteria | 1014 |
| 329 | Ga0157375_11404638 | 3300013308 | Bacteria | 822 |
| 330 | Ga0157375_13453507 | 3300013308 | Bacteria | 526 |
| 331 | Ga0157375_13737890 | 3300013308 | Unclassified | 506 |
| 332 | Ga0163163_10113274 | 3300014325 | Bacteria | 2742 |
| 333 | Ga0163163_10213174 | 3300014325 | Bacteria | 1980 |
| 334 | Ga0157380_10008142 | 3300014326 | Bacteria | 7468 |
| 335 | Ga0157380_10095551 | 3300014326 | Bacteria | 2462 |
| 336 | Ga0157380_10151368 | 3300014326 | Bacteria | 2006 |
| 337 | Ga0157380_10259385 | 3300014326 | Bacteria | 1578 |
| 338 | Ga0157380_12209236 | 3300014326 | Bacteria | 614 |
| 339 | Ga0182008_10172015 | 3300014497 | Bacteria | 1094 |
| 340 | Ga0182008_10423783 | 3300014497 | Bacteria | 719 |
| 341 | Ga0157377_10009687 | 3300014745 | Unclassified | 4739 |
| 342 | Ga0157377_10076540 | 3300014745 | Bacteria | 1946 |
| 343 | Ga0157377_10252177 | 3300014745 | Bacteria | 1144 |
| 344 | Ga0157377_10260024 | 3300014745 | Bacteria | 1129 |
| 345 | Ga0157379_10020906 | 3300014968 | Bacteria | 5791 |
| 346 | Ga0157379_10361185 | 3300014968 | Unclassified | 1331 |
| 347 | Ga0157379_10718591 | 3300014968 | Unclassified | 939 |
| 348 | Ga0157376_10105712 | 3300014969 | Bacteria | 2469 |
| 349 | Ga0157376_10740124 | 3300014969 | Bacteria | 991 |
| 350 | Ga0157376_10789091 | 3300014969 | Unclassified | 962 |
| 351 | Ga0157376_11175458 | 3300014969 | Unclassified | 795 |
| 352 | Ga0163161_10087553 | 3300017792 | Bacteria | 2301 |
| 353 | Ga0163161_10481392 | 3300017792 | Bacteria | 1008 |
| 354 | Ga0206356_10172331 | 3300020070 | Bacteria | 1596 |
| 355 | Ga0206356_10678942 | 3300020070 | Unclassified | 976 |
| 356 | Ga0206356_10993319 | 3300020070 | Bacteria | 645 |
| 357 | Ga0206356_11167277 | 3300020070 | Unclassified | 940 |
| 358 | Ga0206352_11292620 | 3300020078 | Bacteria | 681 |
| 359 | Ga0206354_10455214 | 3300020081 | Bacteria | 2102 |
| 360 | Ga0206354_10676597 | 3300020081 | Bacteria | 2311 |
| 361 | Ga0206353_10102796 | 3300020082 | Bacteria | 615 |
| 362 | Ga0206353_10372582 | 3300020082 | Bacteria | 1946 |
| 363 | Ga0206353_10675843 | 3300020082 | Unclassified | 1175 |
| 364 | Ga0206353_11625761 | 3300020082 | Bacteria | 888 |
| 365 | Ga0224712_10007070 | 3300022467 | Bacteria | 3245 |
| 366 | Ga0224712_10047123 | 3300022467 | Bacteria | 1657 |
| 367 | Ga0224712_10068353 | 3300022467 | Bacteria | 1436 |
| 368 | Ga0207682_10154266 | 3300025893 | Bacteria | 1037 |
| 369 | Ga0207682_10281490 | 3300025893 | Bacteria | 778 |
| 370 | Ga0207692_10055044 | 3300025898 | Bacteria | 2034 |
| 371 | Ga0207692_10661931 | 3300025898 | Bacteria | 675 |
| 372 | Ga0207642_10016714 | 3300025899 | Bacteria | 2772 |
| 373 | Ga0207642_10127453 | 3300025899 | Bacteria | 1323 |
| 374 | Ga0207642_10283039 | 3300025899 | Bacteria | 954 |
| 375 | Ga0207642_11002624 | 3300025899 | Bacteria | 538 |
| 376 | Ga0207710_10028513 | 3300025900 | Bacteria | 2424 |
| 377 | Ga0207710_10067904 | 3300025900 | Bacteria | 1629 |
| 378 | Ga0207688_10002129 | 3300025901 | Bacteria | 10635 |
| 379 | Ga0207680_10644434 | 3300025903 | Unclassified | 758 |
| 380 | Ga0207680_10863525 | 3300025903 | Bacteria | 649 |
| 381 | Ga0207647_10465061 | 3300025904 | Bacteria | 708 |
| 382 | Ga0207685_10126770 | 3300025905 | Bacteria | 1128 |
| 383 | Ga0207685_10665083 | 3300025905 | Bacteria | 564 |
| 384 | Ga0207699_10158681 | 3300025906 | Unclassified | 1504 |
| 385 | Ga0207699_10323969 | 3300025906 | Bacteria | 1082 |
| 386 | Ga0207699_10395806 | 3300025906 | Bacteria | 983 |
| 387 | Ga0207699_10551525 | 3300025906 | Unclassified | 836 |
| 388 | Ga0207699_10685621 | 3300025906 | Bacteria | 750 |
| 389 | Ga0207645_10545046 | 3300025907 | Unclassified | 787 |
| 390 | Ga0207643_10304662 | 3300025908 | Bacteria | 992 |
| 391 | Ga0207643_10571474 | 3300025908 | Unclassified | 726 |
| 392 | Ga0207705_10779298 | 3300025909 | Bacteria | 742 |
| 393 | Ga0207705_11542996 | 3300025909 | Bacteria | 502 |
| 394 | Ga0207684_10898466 | 3300025910 | Bacteria | 745 |
| 395 | Ga0207684_11060235 | 3300025910 | Bacteria | 676 |
| 396 | Ga0207654_10213377 | 3300025911 | Bacteria | 1277 |
| 397 | Ga0207654_11070562 | 3300025911 | Unclassified | 587 |
| 398 | Ga0207707_10009696 | 3300025912 | Bacteria | 8354 |
| 399 | Ga0207707_10063602 | 3300025912 | Bacteria | 3212 |
| 400 | Ga0207707_10174884 | 3300025912 | Unclassified | 1875 |
| 401 | Ga0207707_10260741 | 3300025912 | Bacteria | 1504 |
| 402 | Ga0207707_10516051 | 3300025912 | Bacteria | 1018 |
| 403 | Ga0207707_11118963 | 3300025912 | Bacteria | 641 |
| 404 | Ga0207695_10066320 | 3300025913 | Bacteria | 3708 |
| 405 | Ga0207695_10699672 | 3300025913 | Unclassified | 894 |
| 406 | Ga0207671_10283450 | 3300025914 | Bacteria | 1307 |
| 407 | Ga0207671_10330692 | 3300025914 | Unclassified | 1207 |
| 408 | Ga0207671_10546126 | 3300025914 | Bacteria | 924 |
| 409 | Ga0207693_10011416 | 3300025915 | Bacteria | 7192 |
| 410 | Ga0207693_10062134 | 3300025915 | Bacteria | 2926 |
| 411 | Ga0207693_10092812 | 3300025915 | Bacteria | 2366 |
| 412 | Ga0207693_10225180 | 3300025915 | Bacteria | 1473 |
| 413 | Ga0207663_10005939 | 3300025916 | Bacteria | 6197 |
| 414 | Ga0207663_10284791 | 3300025916 | Bacteria | 1229 |
| 415 | Ga0207663_10387108 | 3300025916 | Bacteria | 1066 |
| 416 | Ga0207663_10517321 | 3300025916 | Bacteria | 929 |
| 417 | Ga0207663_11057398 | 3300025916 | Bacteria | 652 |
| 418 | Ga0207663_11495085 | 3300025916 | Bacteria | 544 |
| 419 | Ga0207660_10018008 | 3300025917 | Bacteria | 4704 |
| 420 | Ga0207660_10054691 | 3300025917 | Bacteria | 2850 |
| 421 | Ga0207660_10505944 | 3300025917 | Bacteria | 980 |
| 422 | Ga0207660_10637437 | 3300025917 | Unclassified | 868 |
| 423 | Ga0207660_11276870 | 3300025917 | Bacteria | 596 |
| 424 | Ga0207662_10093761 | 3300025918 | Bacteria | 1850 |
| 425 | Ga0207657_10000634 | 3300025919 | Bacteria | 37262 |
| 426 | Ga0207657_10020702 | 3300025919 | Bacteria | 6210 |
| 427 | Ga0207657_10039256 | 3300025919 | Bacteria | 4209 |
| 428 | Ga0207657_10258570 | 3300025919 | Bacteria | 1386 |
| 429 | Ga0207657_10577615 | 3300025919 | Unclassified | 878 |
| 430 | Ga0207652_10011117 | 3300025921 | Bacteria | 7255 |
| 431 | Ga0207652_10311665 | 3300025921 | Bacteria | 1420 |
| 432 | Ga0207652_10453012 | 3300025921 | Bacteria | 1156 |
| 433 | Ga0207652_10633063 | 3300025921 | Bacteria | 957 |
| 434 | Ga0207652_10851545 | 3300025921 | Bacteria | 807 |
| 435 | Ga0207652_11322722 | 3300025921 | Unclassified | 623 |
| 436 | Ga0207652_11851358 | 3300025921 | Bacteria | 509 |
| 437 | Ga0207646_10020445 | 3300025922 | Bacteria | 6133 |
| 438 | Ga0207646_10024163 | 3300025922 | Bacteria | 5570 |
| 439 | Ga0207646_10026800 | 3300025922 | Bacteria | 5257 |
| 440 | Ga0207646_10492678 | 3300025922 | Unclassified | 1104 |
| 441 | Ga0207646_10757078 | 3300025922 | Bacteria | 867 |
| 442 | Ga0207646_11937892 | 3300025922 | Bacteria | 501 |
| 443 | Ga0207681_10429477 | 3300025923 | Bacteria | 1072 |
| 444 | Ga0207694_10027888 | 3300025924 | Bacteria | 4303 |
| 445 | Ga0207694_10067468 | 3300025924 | Bacteria | 2792 |
| 446 | Ga0207694_10476609 | 3300025924 | Bacteria | 1043 |
| 447 | Ga0207694_10743848 | 3300025924 | Bacteria | 827 |
| 448 | Ga0207694_11619420 | 3300025924 | Bacteria | 545 |
| 449 | Ga0207650_10553760 | 3300025925 | Unclassified | 964 |
| 450 | Ga0207659_10094951 | 3300025926 | Bacteria | 2235 |
| 451 | Ga0207659_10469800 | 3300025926 | Bacteria | 1061 |
| 452 | Ga0207659_10548498 | 3300025926 | Unclassified | 982 |
| 453 | Ga0207659_10554439 | 3300025926 | Bacteria | 977 |
| 454 | Ga0207659_10997366 | 3300025926 | Bacteria | 720 |
| 455 | Ga0207659_11716208 | 3300025926 | Bacteria | 535 |
| 456 | Ga0207687_10002883 | 3300025927 | Bacteria | 11674 |
| 457 | Ga0207687_10042917 | 3300025927 | Bacteria | 3114 |
| 458 | Ga0207687_10179844 | 3300025927 | Bacteria | 1638 |
| 459 | Ga0207687_10212040 | 3300025927 | Bacteria | 1520 |
| 460 | Ga0207687_10247152 | 3300025927 | Bacteria | 1416 |
| 461 | Ga0207687_10743390 | 3300025927 | Bacteria | 834 |
| 462 | Ga0207687_10836733 | 3300025927 | Bacteria | 786 |
| 463 | Ga0207700_10143507 | 3300025928 | Bacteria | 1965 |
| 464 | Ga0207700_10380517 | 3300025928 | Bacteria | 1234 |
| 465 | Ga0207700_10569667 | 3300025928 | Bacteria | 1006 |
| 466 | Ga0207664_10004970 | 3300025929 | Bacteria | 9047 |
| 467 | Ga0207664_10051918 | 3300025929 | Bacteria | 3240 |
| 468 | Ga0207664_10094481 | 3300025929 | Bacteria | 2457 |
| 469 | Ga0207664_10159922 | 3300025929 | Bacteria | 1920 |
| 470 | Ga0207664_10469645 | 3300025929 | Bacteria | 1124 |
| 471 | Ga0207664_10563018 | 3300025929 | Bacteria | 1023 |
| 472 | Ga0207664_10756441 | 3300025929 | Unclassified | 874 |
| 473 | Ga0207644_10053241 | 3300025931 | Bacteria | 2912 |
| 474 | Ga0207644_10079005 | 3300025931 | Unclassified | 2426 |
| 475 | Ga0207644_10231332 | 3300025931 | Unclassified | 1469 |
| 476 | Ga0207644_10685979 | 3300025931 | Bacteria | 854 |
| 477 | Ga0207644_11114024 | 3300025931 | Bacteria | 663 |
| 478 | Ga0207644_11443525 | 3300025931 | Bacteria | 578 |
| 479 | Ga0207690_10062330 | 3300025932 | Bacteria | 2538 |
| 480 | Ga0207690_10601228 | 3300025932 | Bacteria | 898 |
| 481 | Ga0207690_10758794 | 3300025932 | Unclassified | 800 |
| 482 | Ga0207690_11382477 | 3300025932 | Unclassified | 589 |
| 483 | Ga0207706_10301561 | 3300025933 | Bacteria | 1396 |
| 484 | Ga0207706_10534891 | 3300025933 | Bacteria | 1010 |
| 485 | Ga0207706_10807827 | 3300025933 | Unclassified | 796 |
| 486 | Ga0207706_11487915 | 3300025933 | Unclassified | 553 |
| 487 | Ga0207686_10055329 | 3300025934 | Bacteria | 2489 |
| 488 | Ga0207686_10093475 | 3300025934 | Bacteria | 1991 |
| 489 | Ga0207686_10330075 | 3300025934 | Bacteria | 1142 |
| 490 | Ga0207686_10536197 | 3300025934 | Bacteria | 913 |
| 491 | Ga0207686_11121636 | 3300025934 | Bacteria | 642 |
| 492 | Ga0207686_11168308 | 3300025934 | Unclassified | 629 |
| 493 | Ga0207709_10002377 | 3300025935 | Bacteria | 11868 |
| 494 | Ga0207709_10151080 | 3300025935 | Bacteria | 1609 |
| 495 | Ga0207709_10394647 | 3300025935 | Unclassified | 1056 |
| 496 | Ga0207709_10717423 | 3300025935 | Bacteria | 801 |
| 497 | Ga0207709_10952123 | 3300025935 | Bacteria | 700 |
| 498 | Ga0207670_10081500 | 3300025936 | Bacteria | 2265 |
| 499 | Ga0207670_10107535 | 3300025936 | Bacteria | 2003 |
| 500 | Ga0207670_10151429 | 3300025936 | Unclassified | 1722 |
| 501 | Ga0207670_11727551 | 3300025936 | Unclassified | 532 |
| 502 | Ga0207669_10029874 | 3300025937 | Bacteria | 3020 |
| 503 | Ga0207669_10063387 | 3300025937 | Bacteria | 2282 |
| 504 | Ga0207669_10178905 | 3300025937 | Bacteria | 1518 |
| 505 | Ga0207669_10269703 | 3300025937 | Bacteria | 1278 |
| 506 | Ga0207669_10382403 | 3300025937 | Unclassified | 1097 |
| 507 | Ga0207669_11040327 | 3300025937 | Bacteria | 689 |
| 508 | Ga0207669_11065469 | 3300025937 | Bacteria | 681 |
| 509 | Ga0207669_11438889 | 3300025937 | Bacteria | 587 |
| 510 | Ga0207704_10002110 | 3300025938 | Bacteria | 8920 |
| 511 | Ga0207704_10083955 | 3300025938 | Bacteria | 2069 |
| 512 | Ga0207704_11259563 | 3300025938 | Bacteria | 632 |
| 513 | Ga0207665_10047629 | 3300025939 | Bacteria | 2875 |
| 514 | Ga0207665_11688697 | 3300025939 | Unclassified | 501 |
| 515 | Ga0207691_10170188 | 3300025940 | Unclassified | 1908 |
| 516 | Ga0207691_10412639 | 3300025940 | Bacteria | 1151 |
| 517 | Ga0207711_10188004 | 3300025941 | Bacteria | 1881 |
| 518 | Ga0207711_10284621 | 3300025941 | Bacteria | 1523 |
| 519 | Ga0207711_10304497 | 3300025941 | Bacteria | 1470 |
| 520 | Ga0207711_10977781 | 3300025941 | Bacteria | 786 |
| 521 | Ga0207711_11364419 | 3300025941 | Unclassified | 651 |
| 522 | Ga0207689_10064532 | 3300025942 | Bacteria | 3013 |
| 523 | Ga0207689_10153100 | 3300025942 | Bacteria | 1901 |
| 524 | Ga0207689_11443332 | 3300025942 | Bacteria | 576 |
| 525 | Ga0207661_10007239 | 3300025944 | Bacteria | 7889 |
| 526 | Ga0207661_10398856 | 3300025944 | Unclassified | 1247 |
| 527 | Ga0207661_10522415 | 3300025944 | Bacteria | 1086 |
| 528 | Ga0207661_10786654 | 3300025944 | Bacteria | 876 |
| 529 | Ga0207661_10797259 | 3300025944 | Bacteria | 870 |
| 530 | Ga0207661_11114765 | 3300025944 | Unclassified | 727 |
| 531 | Ga0207661_11497688 | 3300025944 | Bacteria | 618 |
| 532 | Ga0207679_10131913 | 3300025945 | Bacteria | 2006 |
| 533 | Ga0207679_10734981 | 3300025945 | Bacteria | 897 |
| 534 | Ga0207679_11149697 | 3300025945 | Bacteria | 712 |
| 535 | Ga0207679_12005472 | 3300025945 | Bacteria | 527 |
| 536 | Ga0207667_10014735 | 3300025949 | Bacteria | 8897 |
| 537 | Ga0207667_10071035 | 3300025949 | Bacteria | 3622 |
| 538 | Ga0207667_10278952 | 3300025949 | Unclassified | 1708 |
| 539 | Ga0207667_10381461 | 3300025949 | Bacteria | 1436 |
| 540 | Ga0207667_10472124 | 3300025949 | Unclassified | 1274 |
| 541 | Ga0207667_10652743 | 3300025949 | Unclassified | 1058 |
| 542 | Ga0207651_10257990 | 3300025960 | Bacteria | 1430 |
| 543 | Ga0207651_10328927 | 3300025960 | Bacteria | 1280 |
| 544 | Ga0207651_10854940 | 3300025960 | Bacteria | 809 |
| 545 | Ga0207651_10986231 | 3300025960 | Unclassified | 752 |
| 546 | Ga0207651_11570052 | 3300025960 | Bacteria | 593 |
| 547 | Ga0207712_10049053 | 3300025961 | Bacteria | 2940 |
| 548 | Ga0207712_10751797 | 3300025961 | Bacteria | 854 |
| 549 | Ga0207712_10831429 | 3300025961 | Bacteria | 813 |
| 550 | Ga0207712_11031570 | 3300025961 | Bacteria | 730 |
| 551 | Ga0207712_11409175 | 3300025961 | Unclassified | 624 |
| 552 | Ga0207668_10422558 | 3300025972 | Bacteria | 1132 |
| 553 | Ga0207640_10035199 | 3300025981 | Bacteria | 3132 |
| 554 | Ga0207640_10209330 | 3300025981 | Unclassified | 1484 |
| 555 | Ga0207640_10320503 | 3300025981 | Bacteria | 1234 |
| 556 | Ga0207640_10473701 | 3300025981 | Bacteria | 1037 |
| 557 | Ga0207640_10503988 | 3300025981 | Bacteria | 1009 |
| 558 | Ga0207640_10616488 | 3300025981 | Bacteria | 920 |
| 559 | Ga0207640_11648689 | 3300025981 | Bacteria | 578 |
| 560 | Ga0207658_11052806 | 3300025986 | Unclassified | 743 |
| 561 | Ga0207658_12037101 | 3300025986 | Unclassified | 522 |
| 562 | Ga0207677_10029819 | 3300026023 | Bacteria | 3473 |
| 563 | Ga0207677_10041071 | 3300026023 | Bacteria | 3055 |
| 564 | Ga0207677_10134929 | 3300026023 | Unclassified | 1880 |
| 565 | Ga0207677_10247502 | 3300026023 | Bacteria | 1446 |
| 566 | Ga0207703_10054226 | 3300026035 | Bacteria | 3260 |
| 567 | Ga0207703_10194060 | 3300026035 | Unclassified | 1801 |
| 568 | Ga0207703_11038658 | 3300026035 | Bacteria | 787 |
| 569 | Ga0207639_10168366 | 3300026041 | Unclassified | 1853 |
| 570 | Ga0207639_10412337 | 3300026041 | Bacteria | 1219 |
| 571 | Ga0207639_11178178 | 3300026041 | Bacteria | 719 |
| 572 | Ga0207678_10028844 | 3300026067 | Unclassified | 4845 |
| 573 | Ga0207678_10461043 | 3300026067 | Bacteria | 1105 |
| 574 | Ga0207678_10572544 | 3300026067 | Bacteria | 989 |
| 575 | Ga0207678_10860238 | 3300026067 | Bacteria | 801 |
| 576 | Ga0207708_10001783 | 3300026075 | Bacteria | 15882 |
| 577 | Ga0207708_10022225 | 3300026075 | Bacteria | 4789 |
| 578 | Ga0207708_10225572 | 3300026075 | Unclassified | 1503 |
| 579 | Ga0207708_10449974 | 3300026075 | Bacteria | 1072 |
| 580 | Ga0207708_10726645 | 3300026075 | Bacteria | 851 |
| 581 | Ga0207702_10006756 | 3300026078 | Bacteria | 9845 |
| 582 | Ga0207702_10029006 | 3300026078 | Unclassified | 4602 |
| 583 | Ga0207702_10043354 | 3300026078 | Bacteria | 3777 |
| 584 | Ga0207702_10108322 | 3300026078 | Bacteria | 2465 |
| 585 | Ga0207702_10120971 | 3300026078 | Bacteria | 2343 |
| 586 | Ga0207702_10251169 | 3300026078 | Bacteria | 1661 |
| 587 | Ga0207702_10499984 | 3300026078 | Unclassified | 1185 |
| 588 | Ga0207641_10505792 | 3300026088 | Bacteria | 1174 |
| 589 | Ga0207641_11012330 | 3300026088 | Bacteria | 828 |
| 590 | Ga0207648_10002707 | 3300026089 | Bacteria | 18858 |
| 591 | Ga0207648_10147193 | 3300026089 | Bacteria | 2078 |
| 592 | Ga0207648_10279515 | 3300026089 | Bacteria | 1493 |
| 593 | Ga0207648_10380207 | 3300026089 | Bacteria | 1277 |
| 594 | Ga0207648_11128089 | 3300026089 | Bacteria | 736 |
| 595 | Ga0207648_11488528 | 3300026089 | Bacteria | 636 |
| 596 | Ga0207676_10810236 | 3300026095 | Bacteria | 914 |
| 597 | Ga0207676_10904023 | 3300026095 | Bacteria | 866 |
| 598 | Ga0207676_12378160 | 3300026095 | Unclassified | 527 |
| 599 | Ga0207674_11861390 | 3300026116 | Bacteria | 568 |
| 600 | Ga0207675_100319986 | 3300026118 | Bacteria | 1514 |
| 601 | Ga0207675_100708291 | 3300026118 | Bacteria | 1016 |
| 602 | Ga0207675_101319701 | 3300026118 | Unclassified | 742 |
| 603 | Ga0207683_10000699 | 3300026121 | Bacteria | 30634 |
| 604 | Ga0207683_10020326 | 3300026121 | Bacteria | 5677 |
| 605 | Ga0207683_10038254 | 3300026121 | Bacteria | 4180 |
| 606 | Ga0207683_10042579 | 3300026121 | Bacteria | 3966 |
| 607 | Ga0207683_10095111 | 3300026121 | Bacteria | 2656 |
| 608 | Ga0207683_10149892 | 3300026121 | Bacteria | 2105 |
| 609 | Ga0207683_11027164 | 3300026121 | Bacteria | 765 |
| 610 | Ga0207683_11451711 | 3300026121 | Bacteria | 634 |
| 611 | Ga0207683_11610444 | 3300026121 | Bacteria | 599 |
| 612 | Ga0207683_12009757 | 3300026121 | Bacteria | 526 |
| 613 | Ga0207698_10095146 | 3300026142 | Bacteria | 2451 |
| 614 | Ga0207698_10149617 | 3300026142 | Bacteria | 2024 |
| 615 | Ga0268266_10093455 | 3300028379 | Bacteria | 2639 |
| 616 | Ga0268266_11662482 | 3300028379 | Unclassified | 614 |
| 617 | Ga0268265_10248599 | 3300028380 | Bacteria | 1574 |
| 618 | Ga0268265_10280885 | 3300028380 | Bacteria | 1490 |
| 619 | Ga0268264_10166989 | 3300028381 | Unclassified | 1988 |
| 620 | Ga0268264_10174346 | 3300028381 | Bacteria | 1948 |
| 621 | Ga0268264_10278200 | 3300028381 | Bacteria | 1566 |
| 622 | Ga0268264_11772661 | 3300028381 | Unclassified | 628 |
| 623 | Ga0265326_10004431 | 3300028558 | Bacteria | 4499 |
| 624 | Ga0265319_1039859 | 3300028563 | Bacteria | 1590 |
| 625 | Ga0265319_1183755 | 3300028563 | Unclassified | 644 |
| 626 | Ga0265334_10002745 | 3300028573 | Bacteria | 8136 |
| 627 | Ga0265334_10063249 | 3300028573 | Bacteria | 1391 |
| 628 | Ga0265318_10003154 | 3300028577 | Bacteria | 8431 |
| 629 | Ga0265323_10052375 | 3300028653 | Bacteria | 1444 |
| 630 | Ga0265338_10011051 | 3300028800 | Bacteria | 10473 |
| 631 | Ga0265338_10049930 | 3300028800 | Bacteria | 3786 |
| 632 | Ga0265338_10252698 | 3300028800 | Unclassified | 1300 |
| 633 | Ga0265324_10047255 | 3300029957 | Bacteria | 1481 |
| 634 | Ga0265330_10003366 | 3300031235 | Bacteria | 8386 |
| 635 | Ga0265332_10015422 | 3300031238 | Bacteria | 3372 |
| 636 | Ga0265332_10496749 | 3300031238 | Unclassified | 505 |
| 637 | Ga0265328_10004140 | 3300031239 | Bacteria | 6325 |
| 638 | Ga0265320_10291301 | 3300031240 | Unclassified | 722 |
| 639 | Ga0265325_10007375 | 3300031241 | Bacteria | 6585 |
| 640 | Ga0265329_10010827 | 3300031242 | Bacteria | 3335 |
| 641 | Ga0265340_10003923 | 3300031247 | Bacteria | 8377 |
| 642 | Ga0265331_10032605 | 3300031250 | Bacteria | 2580 |
| 643 | Ga0265327_10008410 | 3300031251 | Bacteria | 7691 |
| 644 | Ga0265327_10141872 | 3300031251 | Bacteria | 1122 |
| 645 | Ga0265316_10069891 | 3300031344 | Bacteria | 2709 |
| 646 | Ga0307408_100562109 | 3300031548 | Bacteria | 1008 |
| 647 | Ga0307408_102093537 | 3300031548 | Bacteria | 545 |
| 648 | Ga0265313_10005872 | 3300031595 | Bacteria | 8903 |
| 649 | Ga0265314_10076599 | 3300031711 | Bacteria | 2221 |
| 650 | Ga0265342_10060378 | 3300031712 | Bacteria | 2236 |
| 651 | Ga0265342_10082671 | 3300031712 | Bacteria | 1852 |
| 652 | Ga0307405_10309853 | 3300031731 | Bacteria | 1201 |
| 653 | Ga0307413_10150376 | 3300031824 | Bacteria | 1621 |
| 654 | Ga0307410_10133577 | 3300031852 | Bacteria | 1826 |
| 655 | Ga0307406_10890562 | 3300031901 | Bacteria | 757 |
| 656 | Ga0307406_11806593 | 3300031901 | Bacteria | 543 |
| 657 | Ga0307407_10079347 | 3300031903 | Bacteria | 1980 |
| 658 | Ga0307412_11090809 | 3300031911 | Bacteria | 710 |
| 659 | Ga0307409_100060984 | 3300031995 | Bacteria | 2945 |
| 660 | Ga0307409_100390166 | 3300031995 | Bacteria | 1326 |
| 661 | Ga0307409_101091193 | 3300031995 | Bacteria | 819 |
| 662 | Ga0307416_100777964 | 3300032002 | Bacteria | 1051 |
| 663 | Ga0307416_102108532 | 3300032002 | Bacteria | 666 |
| 664 | Ga0307416_103728462 | 3300032002 | Bacteria | 510 |
| 665 | Ga0373934_0063858 | 3300035086 | Unclassified | 1469 |
| 666 | Ga0373940_0320095 | 3300035088 | Bacteria | 538 |
| 667 | Ga0373944_0006456 | 3300035089 | Bacteria | 3116 |
| 668 | Ga0373923_0023565 | 3300035111 | Bacteria | 2423 |
| 669 | Ga0373932_0405959 | 3300035112 | Unclassified | 528 |
| 670 | Ga0373936_0026574 | 3300035113 | Bacteria | 2267 |
| 671 | Ga0373941_0097663 | 3300035115 | Unclassified | 1018 |
| 672 | Ga0373941_0403348 | 3300035115 | Bacteria | 566 |
| 673 | Ga0373945_0005948 | 3300035116 | Bacteria | 3918 |
| 674 | Ga0373945_0347016 | 3300035116 | Bacteria | 643 |
| 675 | Ga0373956_0060749 | 3300035119 | Unclassified | 1712 |
| 676 | Ga0373943_0001876 | 3300035170 | Bacteria | 9505 |
| 677 | Ga0373943_0055277 | 3300035170 | Bacteria | 1966 |
| 678 | Ga0373943_0574757 | 3300035170 | Bacteria | 662 |
| 679 | Ga0373946_0061295 | 3300035171 | Unclassified | 1601 |
| 680 | Ga0373955_0316646 | 3300035172 | Unclassified | 942 |
| 681 | Ga0373942_0311451 | 3300035207 | Unclassified | 549 |
| 682 | Ga0373924_0022475 | 3300035410 | Bacteria | 2466 |
| 683 | Ga0373931_1287311 | 3300035691 | Bacteria | 503 |
| 684 | Ga0373935_0023556 | 3300035692 | Bacteria | 3784 |
| 685 | Ga0373935_0811979 | 3300035692 | Unclassified | 691 |
| 686 | Ga0373927_0015218 | 3300035695 | Bacteria | 5084 |
| 687 | Ga0373927_0461873 | 3300035695 | Bacteria | 839 |
| 688 | Ga0373933_0172615 | 3300035724 | Bacteria | 1376 |
| 689 | Ga0373947_0005562 | 3300035725 | Bacteria | 7344 |
| 690 | Ga0373947_0188339 | 3300035725 | Bacteria | 1346 |
| 691 | Ga0373947_0467779 | 3300035725 | Bacteria | 855 |
| 692 | Ga0373947_0741252 | 3300035725 | Unclassified | 670 |
| 693 | Ga0373937_0030848 | 3300036401 | Bacteria | 4855 |
| 694 | Ga0373925_0006097 | 3300037068 | Bacteria | 8917 |
| 695 | Ga0373925_0077407 | 3300037068 | Bacteria | 2524 |
| 696 | Ga0395899_0006013 | 3300037312 | Bacteria | 9421 |
| 697 | Ga0395899_0010325 | 3300037312 | Bacteria | 7159 |
| 698 | Ga0395899_0018595 | 3300037312 | Bacteria | 5280 |
| 699 | Ga0395899_0019784 | 3300037312 | Bacteria | 5109 |
| 700 | Ga0395899_0021385 | 3300037312 | Bacteria | 4906 |
| 701 | Ga0395899_0034223 | 3300037312 | Bacteria | 3814 |
| 702 | Ga0395899_0919223 | 3300037312 | Bacteria | 532 |
| 703 | Ga0395900_0005086 | 3300037418 | Bacteria | 13803 |
| 704 | Ga0395900_0030800 | 3300037418 | Bacteria | 5509 |
| 705 | Ga0395900_0040417 | 3300037418 | Bacteria | 4806 |
| 706 | Ga0395900_0071158 | 3300037418 | Bacteria | 3575 |
| 707 | Ga0395900_0105601 | 3300037418 | Bacteria | 2894 |
| 708 | Ga0395900_0123245 | 3300037418 | Bacteria | 2658 |
| 709 | Ga0395900_0141996 | 3300037418 | Bacteria | 2458 |
| 710 | Ga0395900_0519651 | 3300037418 | Bacteria | 1139 |
| 711 | Ga0395900_0581837 | 3300037418 | Bacteria | 1061 |
| 712 | Ga0395900_0885359 | 3300037418 | Unclassified | 817 |
| 713 | Ga0395900_1785947 | 3300037418 | Bacteria | 525 |
| 714 | Ga0395898_0004841 | 3300037466 | Bacteria | 14635 |
| 715 | Ga0395898_0015334 | 3300037466 | Bacteria | 7859 |
| 716 | Ga0395898_0015934 | 3300037466 | Bacteria | 7703 |
| 717 | Ga0395898_0052076 | 3300037466 | Bacteria | 4000 |
| 718 | Ga0395898_0060561 | 3300037466 | Bacteria | 3678 |
| 719 | Ga0395898_0230569 | 3300037466 | Bacteria | 1766 |
| 720 | Ga0395898_0389713 | 3300037466 | Bacteria | 1328 |
| 721 | Ga0395898_1352261 | 3300037466 | Bacteria | 641 |
| 722 | Ga0395898_1646242 | 3300037466 | Unclassified | 565 |
| 723 | Ga0395898_1718011 | 3300037466 | Bacteria | 550 |
| 724 | Ga0395905_0006168 | 3300037471 | Bacteria | 12099 |
| 725 | Ga0395905_0011152 | 3300037471 | Bacteria | 8690 |
| 726 | Ga0395905_0027947 | 3300037471 | Bacteria | 5319 |
| 727 | Ga0395905_0064124 | 3300037471 | Bacteria | 3437 |
| 728 | Ga0395905_0088822 | 3300037471 | Bacteria | 2896 |
| 729 | Ga0395905_0131753 | 3300037471 | Bacteria | 2351 |
| 730 | Ga0395905_0146092 | 3300037471 | Bacteria | 2225 |
| 731 | Ga0395905_0162955 | 3300037471 | Unclassified | 2095 |
| 732 | Ga0395905_0286674 | 3300037471 | Unclassified | 1533 |
| 733 | Ga0395905_0378826 | 3300037471 | Bacteria | 1309 |
| 734 | Ga0395905_0476674 | 3300037471 | Unclassified | 1147 |
| 735 | Ga0395905_0570849 | 3300037471 | Bacteria | 1032 |
| 736 | Ga0395905_1179642 | 3300037471 | Bacteria | 669 |
| 737 | Ga0395905_1557512 | 3300037471 | Unclassified | 565 |
| 738 | Ga0395901_0002976 | 3300038443 | Bacteria | 17087 |
| 739 | Ga0395901_0004555 | 3300038443 | Bacteria | 13988 |
| 740 | Ga0395901_0012209 | 3300038443 | Bacteria | 8718 |
| 741 | Ga0395901_0032039 | 3300038443 | Bacteria | 5423 |
| 742 | Ga0395901_0074131 | 3300038443 | Bacteria | 3550 |
| 743 | Ga0395901_0126740 | 3300038443 | Bacteria | 2683 |
| 744 | Ga0395901_0137165 | 3300038443 | Bacteria | 2571 |
| 745 | Ga0395901_0138741 | 3300038443 | Bacteria | 2555 |
| 746 | Ga0395901_0149601 | 3300038443 | Bacteria | 2453 |
| 747 | Ga0395901_0269273 | 3300038443 | Unclassified | 1772 |
| 748 | Ga0395901_0285109 | 3300038443 | Bacteria | 1715 |
| 749 | Ga0395901_1501230 | 3300038443 | Unclassified | 630 |
| 750 | Ga0395901_1670391 | 3300038443 | Bacteria | 589 |
| 751 | Ga0436360_1209873 | 3300039438 | Bacteria | 8972 |
| 752 | Ga0436361_0026300 | 3300039447 | Bacteria | 515 |
| 753 | Ga0436363_0518779 | 3300039450 | Unclassified | 546 |
| 754 | Ga0451789_0380733 | 3300041443 | Bacteria | 502 |
| 755 | Ga0451793_1706676 | 3300041452 | Bacteria | 594 |
| 756 | Ga0451802_0705323 | 3300041460 | Bacteria | 627 |
| 757 | Ga0451835_0621129 | 3300041492 | Unclassified | 686 |
| 758 | Ga0451839_1641712 | 3300041496 | Bacteria | 620 |
| 759 | Ga0451853_0117807 | 3300041512 | Unclassified | 504 |
| 760 | Ga0451853_3775861 | 3300041512 | Bacteria | 679 |
| 761 | Ga0439441_014949 | 3300042001 | Bacteria | 1367 |
| 762 | Ga0439448_0173777 | 3300042005 | Bacteria | 752 |
| 763 | Ga0450920_121881 | 3300042122 | Bacteria | 547 |
| 764 | Ga0450907_025673 | 3300042146 | Bacteria | 996 |
| 765 | Ga0439464_0251447 | 3300042439 | Unclassified | 571 |
| 766 | Ga0451577_1463288 | 3300042876 | Unclassified | 605 |
| 767 | Ga0466969_0019364 | 3300044656 | Bacteria | 3540 |
| 768 | Ga0466969_0042798 | 3300044656 | Unclassified | 2258 |
| 769 | Ga0466969_0106436 | 3300044656 | Unclassified | 1316 |
| 770 | Ga0466972_0273988 | 3300044658 | Bacteria | 789 |
| 771 | Ga0466965_0604843 | 3300044683 | Unclassified | 623 |
| 772 | Ga0466966_0101649 | 3300044684 | Bacteria | 1777 |
| 773 | Ga0466966_0203378 | 3300044684 | Unclassified | 1198 |
| 774 | Ga0466966_0273398 | 3300044684 | Unclassified | 1016 |
| 775 | Ga0466966_0790636 | 3300044684 | Bacteria | 572 |
| 776 | Ga0466961_0072060 | 3300044693 | Bacteria | 2192 |
| 777 | Ga0466961_0149887 | 3300044693 | Bacteria | 1456 |
| 778 | Ga0466961_0201710 | 3300044693 | Unclassified | 1230 |
| 779 | Ga0466961_0755438 | 3300044693 | Bacteria | 581 |
| 780 | Ga0466963_0009099 | 3300044694 | Bacteria | 5970 |
| 781 | Ga0466963_0490667 | 3300044694 | Unclassified | 867 |
| 782 | Ga0466964_0079595 | 3300044706 | Bacteria | 1404 |
| 783 | Ga0466964_0194053 | 3300044706 | Bacteria | 971 |
| 784 | Ga0453684_1382627 | 3300044712 | Bacteria | 731 |
| 785 | Ga0466971_0116994 | 3300044719 | Unclassified | 1232 |
| 786 | Ga0466968_0024836 | 3300044735 | Bacteria | 2451 |
| 787 | Ga0466968_0325614 | 3300044735 | Unclassified | 743 |
| 788 | Ga0466957_0088704 | 3300044842 | Bacteria | 1935 |
| 789 | Ga0466960_0152888 | 3300044901 | Bacteria | 1234 |
| 790 | Ga0466960_0515195 | 3300044901 | Bacteria | 702 |
| 791 | Ga0466959_0014947 | 3300045049 | Bacteria | 5656 |
| 792 | Ga0466959_0037335 | 3300045049 | Bacteria | 3589 |
| 793 | Ga0466959_0205622 | 3300045049 | Bacteria | 1369 |
| 794 | Ga0451576_1824563 | 3300045051 | Bacteria | 628 |
| 795 | Ga0466958_0029671 | 3300045836 | Bacteria | 3245 |
| 796 | Ga0466958_0037298 | 3300045836 | Bacteria | 2913 |
| 797 | Ga0466967_0020616 | 3300045976 | Bacteria | 5333 |
| 798 | Ga0466967_0036183 | 3300045976 | Bacteria | 4212 |
| 799 | Ga0466967_0038364 | 3300045976 | Bacteria | 4108 |
| 800 | Ga0466967_0044354 | 3300045976 | Bacteria | 3857 |
| 801 | Ga0466967_0085141 | 3300045976 | Bacteria | 2862 |
| 802 | Ga0466967_0167800 | 3300045976 | Bacteria | 2063 |
| 803 | Ga0466967_0194932 | 3300045976 | Bacteria | 1916 |
| 804 | Ga0466967_2451757 | 3300045976 | Unclassified | 517 |
| 805 | Ga0495592_0092780 | 3300046454 | Bacteria | 2163 |
| 806 | Ga0495592_0371206 | 3300046454 | Bacteria | 913 |
| 807 | Ga0495603_0051729 | 3300046455 | Unclassified | 2440 |
| 808 | Ga0495603_0387355 | 3300046455 | Bacteria | 801 |
| 809 | Ga0495629_0027827 | 3300046459 | Bacteria | 4015 |
| 810 | Ga0495629_0135213 | 3300046459 | Bacteria | 1716 |
| 811 | Ga0495629_0165592 | 3300046459 | Bacteria | 1535 |
| 812 | Ga0495629_0252963 | 3300046459 | Bacteria | 1212 |
| 813 | Ga0495629_1022820 | 3300046459 | Unclassified | 537 |
| 814 | Ga0495629_1028762 | 3300046459 | Unclassified | 535 |
| 815 | Ga0495641_0003765 | 3300046461 | Bacteria | 11150 |
| 816 | Ga0495641_0107080 | 3300046461 | Bacteria | 1247 |
| 817 | Ga0495641_0122006 | 3300046461 | Bacteria | 1163 |
| 818 | Ga0495651_0095140 | 3300046462 | Bacteria | 2228 |
| 819 | Ga0495651_0404239 | 3300046462 | Bacteria | 891 |
| 820 | Ga0495651_0683285 | 3300046462 | Bacteria | 641 |
| 821 | Ga0495653_0005235 | 3300046463 | Bacteria | 10547 |
| 822 | Ga0495580_0326341 | 3300046472 | Bacteria | 1043 |
| 823 | Ga0495580_0788469 | 3300046472 | Bacteria | 617 |
| 824 | Ga0495582_0002392 | 3300046473 | Bacteria | 10485 |
| 825 | Ga0495582_0061575 | 3300046473 | Bacteria | 2072 |
| 826 | Ga0495582_0148979 | 3300046473 | Bacteria | 1328 |
| 827 | Ga0495582_0149991 | 3300046473 | Bacteria | 1323 |
| 828 | Ga0495582_0431465 | 3300046473 | Unclassified | 760 |
| 829 | Ga0495582_0768032 | 3300046473 | Unclassified | 558 |
| 830 | Ga0495605_0226241 | 3300046474 | Bacteria | 807 |
| 831 | Ga0495605_0233847 | 3300046474 | Unclassified | 791 |
| 832 | Ga0495639_0002167 | 3300046475 | Bacteria | 8650 |
| 833 | Ga0495639_0042740 | 3300046475 | Bacteria | 2045 |
| 834 | Ga0495639_0613859 | 3300046475 | Bacteria | 559 |
| 835 | Ga0495662_0032603 | 3300046476 | Bacteria | 2517 |
| 836 | Ga0495662_0104749 | 3300046476 | Bacteria | 1384 |
| 837 | Ga0495662_0440127 | 3300046476 | Bacteria | 640 |
| 838 | Ga0495664_0107281 | 3300046477 | Unclassified | 1685 |
| 839 | Ga0495584_0120605 | 3300046491 | Unclassified | 1328 |
| 840 | Ga0495584_0253988 | 3300046491 | Bacteria | 894 |
| 841 | Ga0495585_0143746 | 3300046492 | Bacteria | 1248 |
| 842 | Ga0495594_0004059 | 3300046499 | Bacteria | 7526 |
| 843 | Ga0495594_0109794 | 3300046499 | Unclassified | 1555 |
| 844 | Ga0495594_0136226 | 3300046499 | Unclassified | 1392 |
| 845 | Ga0495594_0649606 | 3300046499 | Bacteria | 597 |
| 846 | Ga0495594_0810808 | 3300046499 | Bacteria | 527 |
| 847 | Ga0495608_0006095 | 3300046511 | Bacteria | 8553 |
| 848 | Ga0495618_0004507 | 3300046514 | Bacteria | 8560 |
| 849 | Ga0495628_0072630 | 3300046516 | Bacteria | 2681 |
| 850 | Ga0495628_0388405 | 3300046516 | Bacteria | 1021 |
| 851 | Ga0495630_0003907 | 3300046517 | Bacteria | 10421 |
| 852 | Ga0495630_0051113 | 3300046517 | Bacteria | 3093 |
| 853 | Ga0495630_0221660 | 3300046517 | Bacteria | 1444 |
| 854 | Ga0495630_1186127 | 3300046517 | Bacteria | 577 |
| 855 | Ga0495631_0175973 | 3300046518 | Unclassified | 917 |
| 856 | Ga0495631_0458531 | 3300046518 | Bacteria | 543 |
| 857 | Ga0495644_0120273 | 3300046523 | Unclassified | 999 |
| 858 | Ga0495644_0207396 | 3300046523 | Unclassified | 756 |
| 859 | Ga0495644_0407523 | 3300046523 | Bacteria | 539 |
| 860 | Ga0495666_0091585 | 3300046526 | Bacteria | 1434 |
| 861 | Ga0495666_0192538 | 3300046526 | Unclassified | 939 |
| 862 | Ga0495642_0252935 | 3300046528 | Bacteria | 770 |
| 863 | Ga0495652_0116556 | 3300046529 | Bacteria | 2138 |
| 864 | Ga0495652_0200275 | 3300046529 | Bacteria | 1516 |
| 865 | Ga0495665_0001485 | 3300046531 | Bacteria | 12559 |
| 866 | Ga0495665_0014212 | 3300046531 | Bacteria | 4295 |
| 867 | Ga0495640_0003074 | 3300046533 | Bacteria | 13442 |
| 868 | Ga0495640_0228717 | 3300046533 | Bacteria | 1170 |
| 869 | Ga0495640_0441513 | 3300046533 | Unclassified | 796 |
| 870 | Ga0495587_0043290 | 3300046536 | Bacteria | 2681 |
| 871 | Ga0495598_0170055 | 3300046537 | Bacteria | 772 |
| 872 | Ga0495598_0361835 | 3300046537 | Unclassified | 560 |
| 873 | Ga0495609_0089082 | 3300046538 | Unclassified | 1343 |
| 874 | Ga0495645_0200585 | 3300046543 | Bacteria | 1354 |
| 875 | Ga0495645_0225258 | 3300046543 | Unclassified | 1259 |
| 876 | Ga0495622_0169833 | 3300046557 | Bacteria | 981 |
| 877 | Ga0495667_0006817 | 3300046559 | Bacteria | 7753 |
| 878 | Ga0495667_0968678 | 3300046559 | Unclassified | 520 |
| 879 | Ga0495656_0098949 | 3300046615 | Unclassified | 1346 |
| 880 | Ga0495656_0198459 | 3300046615 | Bacteria | 994 |
| 881 | Ga0495656_0426621 | 3300046615 | Bacteria | 696 |
| 882 | Ga0495656_0460713 | 3300046615 | Bacteria | 671 |
| 883 | Ga0495656_0479664 | 3300046615 | Bacteria | 658 |
| 884 | Ga0495668_0639610 | 3300046616 | Bacteria | 588 |
| 885 | Ga0495634_0003097 | 3300046642 | Bacteria | 13519 |
| 886 | Ga0495634_0014856 | 3300046642 | Bacteria | 5599 |
| 887 | Ga0495634_0031690 | 3300046642 | Unclassified | 3640 |
| 888 | Ga0495634_0505940 | 3300046642 | Bacteria | 708 |
| 889 | Ga0495635_0022878 | 3300046663 | Bacteria | 4356 |
| 890 | Ga0495635_0067755 | 3300046663 | Bacteria | 2448 |
| 891 | Ga0495635_0131446 | 3300046663 | Unclassified | 1706 |
| 892 | Ga0495661_0220203 | 3300046665 | Unclassified | 984 |
| 893 | Ga0495588_0017098 | 3300046674 | Bacteria | 3515 |
| 894 | Ga0495588_0085922 | 3300046674 | Unclassified | 1645 |
| 895 | Ga0495588_0199384 | 3300046674 | Bacteria | 1057 |
| 896 | Ga0495588_0439639 | 3300046674 | Bacteria | 684 |
| 897 | Ga0495657_0122511 | 3300046675 | Bacteria | 1636 |
| 898 | Ga0495599_0172079 | 3300046678 | Unclassified | 1336 |
| 899 | Ga0495623_0078324 | 3300046679 | Bacteria | 2049 |
| 900 | Ga0495623_0575252 | 3300046679 | Bacteria | 587 |
| 901 | Ga0495647_0000597 | 3300046681 | Bacteria | 10685 |
| 902 | Ga0495647_0012783 | 3300046681 | Bacteria | 2896 |
| 903 | Ga0495647_0099549 | 3300046681 | Bacteria | 1202 |
| 904 | Ga0495647_0212570 | 3300046681 | Unclassified | 851 |
| 905 | Ga0495647_0425018 | 3300046681 | Unclassified | 613 |
| 906 | Ga0495658_0012490 | 3300046683 | Bacteria | 4304 |
| 907 | Ga0495658_0534938 | 3300046683 | Bacteria | 750 |
| 908 | Ga0495613_0005558 | 3300046689 | Bacteria | 9465 |
| 909 | Ga0495613_0043999 | 3300046689 | Bacteria | 3304 |
| 910 | Ga0495613_0173605 | 3300046689 | Bacteria | 1529 |
| 911 | Ga0495624_0006496 | 3300046690 | Bacteria | 8290 |
| 912 | Ga0495624_0011613 | 3300046690 | Bacteria | 6050 |
| 913 | Ga0495624_0416550 | 3300046690 | Unclassified | 806 |
| 914 | Ga0495624_0539623 | 3300046690 | Bacteria | 697 |
| 915 | Ga0495670_0247954 | 3300046691 | Bacteria | 949 |
| 916 | Ga0495670_0511229 | 3300046691 | Bacteria | 653 |
| 917 | Ga0495671_0176532 | 3300046692 | Bacteria | 1038 |
| 918 | Ga0495589_0467220 | 3300046794 | Bacteria | 577 |
| 919 | Ga0495600_0003143 | 3300046809 | Bacteria | 9663 |
| 920 | Ga0495581_0001437 | 3300047315 | Bacteria | 13221 |
| 921 | Ga0495581_0003775 | 3300047315 | Bacteria | 8717 |
| 922 | Ga0495581_0032656 | 3300047315 | Bacteria | 3014 |
| 923 | Ga0495581_0068099 | 3300047315 | Bacteria | 2058 |
| 924 | Ga0495604_0018043 | 3300047317 | Bacteria | 5647 |
| 925 | Ga0495674_0004046 | 3300047319 | Bacteria | 14189 |
| 926 | Ga0495674_0029902 | 3300047319 | Bacteria | 4956 |
| 927 | Ga0495676_0002012 | 3300047321 | Bacteria | 17904 |
| 928 | Ga0495676_0016250 | 3300047321 | Bacteria | 6609 |
| 929 | Ga0495676_0017412 | 3300047321 | Bacteria | 6355 |
| 930 | Ga0495676_0083518 | 3300047321 | Bacteria | 2413 |
| 931 | Ga0495676_1076645 | 3300047321 | Unclassified | 511 |
| 932 | Ga0495680_0012939 | 3300047322 | Bacteria | 7310 |
| 933 | Ga0495680_0189204 | 3300047322 | Bacteria | 1481 |
| 934 | Ga0495677_0218850 | 3300047445 | Bacteria | 742 |
| 935 | Ga0495684_0002922 | 3300047471 | Bacteria | 13450 |
| 936 | Ga0495684_0265396 | 3300047471 | Bacteria | 1244 |
| 937 | Ga0495593_0005440 | 3300047673 | Bacteria | 7524 |
| 938 | Ga0495602_0549458 | 3300048088 | Bacteria | 801 |
| 939 | Ga0495602_0602377 | 3300048088 | Unclassified | 755 |
| 940 | Ga0495614_0007485 | 3300048089 | Bacteria | 4861 |
| 941 | Ga0496100_0001463 | 3300048903 | Bacteria | 11564 |
| 942 | Ga0496100_0001838 | 3300048903 | Bacteria | 10605 |
| 943 | Ga0496100_0016897 | 3300048903 | Bacteria | 4293 |
| 944 | Ga0496100_0030771 | 3300048903 | Bacteria | 3332 |
| 945 | Ga0496100_0057468 | 3300048903 | Bacteria | 2548 |
| 946 | Ga0496100_0086650 | 3300048903 | Bacteria | 2128 |
| 947 | Ga0496100_0103101 | 3300048903 | Bacteria | 1969 |
| 948 | Ga0496100_0299958 | 3300048903 | Bacteria | 1202 |
| 949 | Ga0496100_0812803 | 3300048903 | Bacteria | 733 |
| 950 | Ga0496101_0001319 | 3300048904 | Bacteria | 14841 |
| 951 | Ga0496101_0003443 | 3300048904 | Bacteria | 9876 |
| 952 | Ga0496101_0008890 | 3300048904 | Bacteria | 6577 |
| 953 | Ga0496101_0010095 | 3300048904 | Bacteria | 6225 |
| 954 | Ga0496101_0011879 | 3300048904 | Bacteria | 5797 |
| 955 | Ga0496101_0014879 | 3300048904 | Bacteria | 5236 |
| 956 | Ga0496101_0017205 | 3300048904 | Bacteria | 4899 |
| 957 | Ga0496101_0034788 | 3300048904 | Bacteria | 3561 |
| 958 | Ga0496101_0264692 | 3300048904 | Unclassified | 1341 |
| 959 | Ga0496101_0685391 | 3300048904 | Bacteria | 809 |
| 960 | Ga0496101_0984644 | 3300048904 | Bacteria | 663 |
| 961 | Ga0496101_1292166 | 3300048904 | Bacteria | 571 |
| 962 | Ga0496102_0002028 | 3300048905 | Bacteria | 17499 |
| 963 | Ga0496102_0002197 | 3300048905 | Bacteria | 16755 |
| 964 | Ga0496102_0009883 | 3300048905 | Bacteria | 8204 |
| 965 | Ga0496102_0021038 | 3300048905 | Bacteria | 5769 |
| 966 | Ga0496102_0034991 | 3300048905 | Bacteria | 4521 |
| 967 | Ga0496102_0038224 | 3300048905 | Bacteria | 4330 |
| 968 | Ga0496102_0123627 | 3300048905 | Bacteria | 2418 |
| 969 | Ga0496102_0209187 | 3300048905 | Bacteria | 1839 |
| 970 | Ga0496102_0459717 | 3300048905 | Bacteria | 1194 |
| 971 | Ga0496102_0640824 | 3300048905 | Bacteria | 986 |
| 972 | Ga0496102_0747895 | 3300048905 | Bacteria | 900 |
| 973 | Ga0496102_1419754 | 3300048905 | Bacteria | 613 |
| 974 | Ga0496102_1756911 | 3300048905 | Bacteria | 538 |
| 975 | Ga0496103_0002459 | 3300048906 | Bacteria | 11640 |
| 976 | Ga0496103_0005119 | 3300048906 | Bacteria | 7892 |
| 977 | Ga0496103_0042072 | 3300048906 | Bacteria | 2810 |
| 978 | Ga0496103_0050758 | 3300048906 | Bacteria | 2566 |
| 979 | Ga0496103_0109477 | 3300048906 | Unclassified | 1754 |
| 980 | Ga0496103_0203559 | 3300048906 | Unclassified | 1273 |
| 981 | Ga0496104_0002034 | 3300048907 | Bacteria | 17569 |
| 982 | Ga0496104_0009484 | 3300048907 | Bacteria | 8662 |
| 983 | Ga0496104_0027989 | 3300048907 | Bacteria | 5220 |
| 984 | Ga0496104_0050038 | 3300048907 | Bacteria | 3942 |
| 985 | Ga0496104_0076590 | 3300048907 | Bacteria | 3186 |
| 986 | Ga0496104_0093795 | 3300048907 | Bacteria | 2872 |
| 987 | Ga0496104_0137476 | 3300048907 | Bacteria | 2347 |
| 988 | Ga0496104_0157532 | 3300048907 | Bacteria | 2179 |
| 989 | Ga0496104_0157545 | 3300048907 | Bacteria | 2179 |
| 990 | Ga0496104_0216653 | 3300048907 | Bacteria | 1826 |
| 991 | Ga0496104_0317370 | 3300048907 | Unclassified | 1471 |
| 992 | Ga0496104_0694903 | 3300048907 | Bacteria | 925 |
| 993 | Ga0496105_0000050 | 3300048908 | Bacteria | 93402 |
| 994 | Ga0496105_0005525 | 3300048908 | Bacteria | 9592 |
| 995 | Ga0496105_0017579 | 3300048908 | Bacteria | 5736 |
| 996 | Ga0496105_0020971 | 3300048908 | Bacteria | 5285 |
| 997 | Ga0496105_0021711 | 3300048908 | Bacteria | 5195 |
| 998 | Ga0496105_0074654 | 3300048908 | Bacteria | 2801 |
| 999 | Ga0496105_0266566 | 3300048908 | Bacteria | 1384 |
| 1000 | Ga0496105_0292343 | 3300048908 | Bacteria | 1311 |
| 1001 | Ga0496105_1030859 | 3300048908 | Bacteria | 614 |
| 1002 | Ga0496105_1069247 | 3300048908 | Bacteria | 600 |
| 1003 | Ga0496106_0002042 | 3300048909 | Bacteria | 15175 |
| 1004 | Ga0496106_0004053 | 3300048909 | Bacteria | 10936 |
| 1005 | Ga0496106_0005239 | 3300048909 | Bacteria | 9608 |
| 1006 | Ga0496106_0010325 | 3300048909 | Bacteria | 6902 |
| 1007 | Ga0496106_0012413 | 3300048909 | Bacteria | 6290 |
| 1008 | Ga0496106_0034609 | 3300048909 | Bacteria | 3774 |
| 1009 | Ga0496106_0047440 | 3300048909 | Bacteria | 3233 |
| 1010 | Ga0496106_0055581 | 3300048909 | Bacteria | 2992 |
| 1011 | Ga0496106_0227940 | 3300048909 | Bacteria | 1487 |
| 1012 | Ga0496106_0479808 | 3300048909 | Bacteria | 999 |
| 1013 | Ga0496106_0823729 | 3300048909 | Bacteria | 735 |
| 1014 | Ga0496107_0000545 | 3300048910 | Bacteria | 21061 |
| 1015 | Ga0496107_0002007 | 3300048910 | Bacteria | 12981 |
| 1016 | Ga0496107_0012651 | 3300048910 | Bacteria | 5892 |
| 1017 | Ga0496107_0013425 | 3300048910 | Bacteria | 5726 |
| 1018 | Ga0496107_0014162 | 3300048910 | Bacteria | 5583 |
| 1019 | Ga0496107_0017801 | 3300048910 | Bacteria | 5000 |
| 1020 | Ga0496107_0029698 | 3300048910 | Bacteria | 3891 |
| 1021 | Ga0496107_0041450 | 3300048910 | Bacteria | 3305 |
| 1022 | Ga0496107_0299375 | 3300048910 | Bacteria | 1197 |
| 1023 | Ga0496107_0578983 | 3300048910 | Bacteria | 830 |
| 1024 | Ga0496108_0000403 | 3300048911 | Bacteria | 35617 |
| 1025 | Ga0496108_0001800 | 3300048911 | Bacteria | 17082 |
| 1026 | Ga0496108_0009997 | 3300048911 | Bacteria | 7690 |
| 1027 | Ga0496108_0075476 | 3300048911 | Bacteria | 2848 |
| 1028 | Ga0496108_0171854 | 3300048911 | Bacteria | 1875 |
| 1029 | Ga0496108_0203356 | 3300048911 | Bacteria | 1719 |
| 1030 | Ga0496108_0258076 | 3300048911 | Bacteria | 1517 |
| 1031 | Ga0496108_0295580 | 3300048911 | Unclassified | 1410 |
| 1032 | Ga0496108_0525956 | 3300048911 | Bacteria | 1032 |
| 1033 | Ga0496108_1318927 | 3300048911 | Bacteria | 606 |
| 1034 | Ga0496109_0001203 | 3300048912 | Bacteria | 21542 |
| 1035 | Ga0496109_0001324 | 3300048912 | Bacteria | 20434 |
| 1036 | Ga0496109_0002451 | 3300048912 | Bacteria | 15544 |
| 1037 | Ga0496109_0002493 | 3300048912 | Bacteria | 15427 |
| 1038 | Ga0496109_0003464 | 3300048912 | Bacteria | 13180 |
| 1039 | Ga0496109_0023041 | 3300048912 | Bacteria | 5521 |
| 1040 | Ga0496109_0045380 | 3300048912 | Bacteria | 3987 |
| 1041 | Ga0496109_0093792 | 3300048912 | Bacteria | 2778 |
| 1042 | Ga0496109_0171071 | 3300048912 | Bacteria | 2038 |
| 1043 | Ga0496109_0602784 | 3300048912 | Bacteria | 1034 |
| 1044 | Ga0496109_0669972 | 3300048912 | Bacteria | 975 |
| 1045 | Ga0496109_0737659 | 3300048912 | Bacteria | 923 |
| 1046 | Ga0496109_1254325 | 3300048912 | Bacteria | 677 |
| 1047 | Ga0496109_1398681 | 3300048912 | Bacteria | 635 |
| 1048 | Ga0496109_1562503 | 3300048912 | Bacteria | 594 |
| 1049 | Ga0496109_1888947 | 3300048912 | Bacteria | 530 |
| 1050 | Ga0496110_0001093 | 3300048913 | Bacteria | 19108 |
| 1051 | Ga0496110_0004541 | 3300048913 | Bacteria | 10773 |
| 1052 | Ga0496110_0030818 | 3300048913 | Bacteria | 4625 |
| 1053 | Ga0496110_0060428 | 3300048913 | Bacteria | 3342 |
| 1054 | Ga0496110_0079358 | 3300048913 | Bacteria | 2922 |
| 1055 | Ga0496110_0254054 | 3300048913 | Bacteria | 1600 |
| 1056 | Ga0496110_0365085 | 3300048913 | Bacteria | 1315 |
| 1057 | Ga0496111_0003419 | 3300048914 | Bacteria | 9822 |
| 1058 | Ga0496111_0005179 | 3300048914 | Bacteria | 8311 |
| 1059 | Ga0496111_0014563 | 3300048914 | Bacteria | 5376 |
| 1060 | Ga0496111_0083991 | 3300048914 | Unclassified | 2327 |
| 1061 | Ga0496111_0109252 | 3300048914 | Bacteria | 2036 |
| 1062 | Ga0496111_0208267 | 3300048914 | Bacteria | 1453 |
| 1063 | Ga0496111_0236481 | 3300048914 | Bacteria | 1357 |
| 1064 | Ga0496111_0680124 | 3300048914 | Bacteria | 749 |
| 1065 | Ga0496111_0776692 | 3300048914 | Bacteria | 694 |
| 1066 | Ga0496112_0004222 | 3300048915 | Bacteria | 12122 |
| 1067 | Ga0496112_0044728 | 3300048915 | Unclassified | 4339 |
| 1068 | Ga0496112_0063315 | 3300048915 | Bacteria | 3648 |
| 1069 | Ga0496112_0106184 | 3300048915 | Bacteria | 2778 |
| 1070 | Ga0496112_0113533 | 3300048915 | Bacteria | 2680 |
| 1071 | Ga0496112_0132923 | 3300048915 | Bacteria | 2459 |
| 1072 | Ga0496112_0201869 | 3300048915 | Bacteria | 1947 |
| 1073 | Ga0496112_0663892 | 3300048915 | Bacteria | 972 |
| 1074 | Ga0496112_1218657 | 3300048915 | Bacteria | 669 |
| 1075 | Ga0496112_1379663 | 3300048915 | Bacteria | 619 |
| 1076 | Ga0496113_0000452 | 3300048916 | Bacteria | 19933 |
| 1077 | Ga0496113_0030876 | 3300048916 | Bacteria | 3883 |
| 1078 | Ga0496113_0084448 | 3300048916 | Bacteria | 2438 |
| 1079 | Ga0496113_0124353 | 3300048916 | Bacteria | 2019 |
| 1080 | Ga0496113_0210068 | 3300048916 | Bacteria | 1549 |
| 1081 | Ga0496113_0243560 | 3300048916 | Unclassified | 1435 |
| 1082 | Ga0496113_0653831 | 3300048916 | Bacteria | 841 |
| 1083 | Ga0496113_0840575 | 3300048916 | Bacteria | 728 |
| 1084 | Ga0496113_1090558 | 3300048916 | Unclassified | 626 |
| 1085 | Ga0496113_1544248 | 3300048916 | Bacteria | 512 |
| 1086 | Ga0496114_0002175 | 3300048917 | Bacteria | 14929 |
| 1087 | Ga0496114_0003284 | 3300048917 | Bacteria | 12414 |
| 1088 | Ga0496114_0004568 | 3300048917 | Bacteria | 10751 |
| 1089 | Ga0496114_0005710 | 3300048917 | Bacteria | 9757 |
| 1090 | Ga0496114_0021335 | 3300048917 | Bacteria | 5269 |
| 1091 | Ga0496114_0035697 | 3300048917 | Bacteria | 4106 |
| 1092 | Ga0496114_0046848 | 3300048917 | Bacteria | 3593 |
| 1093 | Ga0496114_0059492 | 3300048917 | Bacteria | 3192 |
| 1094 | Ga0496114_0063380 | 3300048917 | Bacteria | 3095 |
| 1095 | Ga0496114_0110909 | 3300048917 | Bacteria | 2350 |
| 1096 | Ga0496114_0149864 | 3300048917 | Bacteria | 2023 |
| 1097 | Ga0496114_0244969 | 3300048917 | Unclassified | 1577 |
| 1098 | Ga0496114_0677448 | 3300048917 | Unclassified | 905 |
| 1099 | Ga0496114_0740192 | 3300048917 | Bacteria | 860 |
| 1100 | Ga0496115_0006641 | 3300048918 | Bacteria | 8488 |
| 1101 | Ga0496115_0008859 | 3300048918 | Bacteria | 7458 |
| 1102 | Ga0496115_0035042 | 3300048918 | Bacteria | 3969 |
| 1103 | Ga0496115_0040254 | 3300048918 | Bacteria | 3714 |
| 1104 | Ga0496115_0084967 | 3300048918 | Bacteria | 2580 |
| 1105 | Ga0496115_0204299 | 3300048918 | Unclassified | 1632 |
| 1106 | Ga0496115_0321374 | 3300048918 | Bacteria | 1266 |
| 1107 | Ga0496115_0343386 | 3300048918 | Bacteria | 1218 |
| 1108 | Ga0496115_0474167 | 3300048918 | Bacteria | 1008 |
| 1109 | Ga0496115_0624300 | 3300048918 | Bacteria | 855 |
| 1110 | Ga0496115_0955186 | 3300048918 | Bacteria | 658 |
| 1111 | Ga0496115_0990980 | 3300048918 | Bacteria | 643 |
| 1112 | Ga0496126_0115479 | 3300048929 | Bacteria | 2334 |
| 1113 | Ga0501031_0007443 | 3300049568 | Bacteria | 7133 |
| 1114 | Ga0501031_0152233 | 3300049568 | Bacteria | 1512 |
| 1115 | Ga0501031_0180339 | 3300049568 | Bacteria | 1380 |
| 1116 | Ga0501031_0976127 | 3300049568 | Bacteria | 542 |
| 1117 | Ga0501032_0087145 | 3300049569 | Bacteria | 2074 |
| 1118 | Ga0501032_0399608 | 3300049569 | Bacteria | 883 |
| 1119 | Ga0501033_0309128 | 3300049570 | Unclassified | 1112 |
| 1120 | Ga0501033_0522589 | 3300049570 | Bacteria | 819 |
| 1121 | Ga0501036_0033834 | 3300049572 | Bacteria | 4323 |
| 1122 | Ga0501036_0775314 | 3300049572 | Bacteria | 790 |
| 1123 | Ga0501037_0083994 | 3300049573 | Bacteria | 2307 |
| 1124 | Ga0501037_0328379 | 3300049573 | Bacteria | 1058 |
| 1125 | Ga0501038_0075297 | 3300049574 | Bacteria | 2853 |
| 1126 | Ga0501038_0191199 | 3300049574 | Unclassified | 1647 |
| 1127 | Ga0501038_0613417 | 3300049574 | Unclassified | 822 |
| 1128 | Ga0501039_0023372 | 3300049575 | Bacteria | 4746 |
| 1129 | Ga0501039_0327233 | 3300049575 | Unclassified | 1204 |
| 1130 | Ga0501039_0353209 | 3300049575 | Bacteria | 1155 |
| 1131 | Ga0501039_1499939 | 3300049575 | Bacteria | 518 |
| 1132 | Ga0501040_0098652 | 3300049576 | Bacteria | 2036 |
| 1133 | Ga0501040_0107694 | 3300049576 | Bacteria | 1948 |
| 1134 | Ga0501040_0118095 | 3300049576 | Bacteria | 1859 |
| 1135 | Ga0501040_0139659 | 3300049576 | Bacteria | 1706 |
| 1136 | Ga0501040_0265364 | 3300049576 | Bacteria | 1225 |
| 1137 | Ga0501040_1106054 | 3300049576 | Bacteria | 575 |
| 1138 | Ga0501041_0224942 | 3300049577 | Unclassified | 1178 |
| 1139 | Ga0501041_0364903 | 3300049577 | Bacteria | 913 |
| 1140 | Ga0501041_0410630 | 3300049577 | Bacteria | 858 |
| 1141 | Ga0501042_0015452 | 3300049578 | Bacteria | 5229 |
| 1142 | Ga0501042_0148649 | 3300049578 | Bacteria | 1689 |
| 1143 | Ga0501042_0277957 | 3300049578 | Bacteria | 1209 |
| 1144 | Ga0501042_0436016 | 3300049578 | Bacteria | 950 |
| 1145 | Ga0501046_0043766 | 3300049580 | Bacteria | 3563 |
| 1146 | Ga0501046_0297225 | 3300049580 | Bacteria | 1180 |
| 1147 | Ga0501048_0004258 | 3300049582 | Bacteria | 10904 |
| 1148 | Ga0501048_0362946 | 3300049582 | Bacteria | 1033 |
| 1149 | Ga0501048_0490254 | 3300049582 | Bacteria | 881 |
| 1150 | Ga0501048_0528803 | 3300049582 | Bacteria | 846 |
| 1151 | Ga0501067_0000414 | 3300049583 | Bacteria | 23279 |
| 1152 | Ga0501067_0169540 | 3300049583 | Bacteria | 1216 |
| 1153 | Ga0501067_0175688 | 3300049583 | Bacteria | 1193 |
| 1154 | Ga0501067_0282360 | 3300049583 | Bacteria | 924 |
| 1155 | Ga0501067_0310057 | 3300049583 | Bacteria | 879 |
| 1156 | Ga0501067_0360618 | 3300049583 | Bacteria | 810 |
| 1157 | Ga0501068_0000406 | 3300049584 | Bacteria | 21790 |
| 1158 | Ga0501068_0194721 | 3300049584 | Bacteria | 1285 |
| 1159 | Ga0501068_0924569 | 3300049584 | Bacteria | 574 |
| 1160 | Ga0501069_0000177 | 3300049585 | Bacteria | 28717 |
| 1161 | Ga0501069_0085439 | 3300049585 | Unclassified | 1781 |
| 1162 | Ga0501069_0223879 | 3300049585 | Bacteria | 1094 |
| 1163 | Ga0501069_0308384 | 3300049585 | Bacteria | 929 |
| 1164 | Ga0501071_0029991 | 3300049587 | Bacteria | 3844 |
| 1165 | Ga0501071_0153776 | 3300049587 | Bacteria | 1717 |
| 1166 | Ga0501071_0776442 | 3300049587 | Bacteria | 738 |
| 1167 | Ga0501071_1085597 | 3300049587 | Bacteria | 618 |
| 1168 | Ga0501072_0002616 | 3300049588 | Bacteria | 13483 |
| 1169 | Ga0501072_0072011 | 3300049588 | Bacteria | 2731 |
| 1170 | Ga0501072_0659371 | 3300049588 | Bacteria | 823 |
| 1171 | Ga0501072_0848036 | 3300049588 | Unclassified | 714 |
| 1172 | Ga0501073_0251544 | 3300049589 | Bacteria | 1220 |
| 1173 | Ga0501073_0706003 | 3300049589 | Bacteria | 696 |
| 1174 | Ga0501074_0050290 | 3300049590 | Bacteria | 3009 |
| 1175 | Ga0501074_0161966 | 3300049590 | Bacteria | 1598 |
| 1176 | Ga0501074_0211353 | 3300049590 | Unclassified | 1382 |
| 1177 | Ga0501074_0464461 | 3300049590 | Bacteria | 897 |
| 1178 | Ga0501075_0037036 | 3300049591 | Bacteria | 3642 |
| 1179 | Ga0501075_0262619 | 3300049591 | Bacteria | 1316 |
| 1180 | Ga0501075_0541623 | 3300049591 | Bacteria | 888 |
| 1181 | Ga0501076_0017096 | 3300049592 | Bacteria | 5508 |
| 1182 | Ga0501076_0248577 | 3300049592 | Bacteria | 1455 |
| 1183 | Ga0501076_0317377 | 3300049592 | Bacteria | 1278 |
| 1184 | Ga0501076_0325394 | 3300049592 | Bacteria | 1261 |
| 1185 | Ga0501077_0041883 | 3300049593 | Bacteria | 2914 |
| 1186 | Ga0501077_0093193 | 3300049593 | Bacteria | 1909 |
| 1187 | Ga0501077_0123020 | 3300049593 | Bacteria | 1645 |
| 1188 | Ga0501077_0314753 | 3300049593 | Bacteria | 998 |
| 1189 | Ga0501079_0098535 | 3300049741 | Bacteria | 2266 |
| 1190 | Ga0501079_0264833 | 3300049741 | Bacteria | 1343 |
| 1191 | Ga0501080_0349084 | 3300049742 | Bacteria | 1336 |
| 1192 | Ga0501080_0851297 | 3300049742 | Bacteria | 797 |
| 1193 | Ga0501080_0949155 | 3300049742 | Bacteria | 748 |
| 1194 | Ga0501081_0158636 | 3300049743 | Bacteria | 1629 |
| 1195 | Ga0501081_0227363 | 3300049743 | Unclassified | 1358 |
| 1196 | Ga0501035_0334585 | 3300049822 | Unclassified | 1270 |
| 1197 | Ga0501045_0046796 | 3300049824 | Bacteria | 3150 |
| 1198 | Ga0501045_0057654 | 3300049824 | Bacteria | 2842 |
| 1199 | Ga0501045_0075657 | 3300049824 | Bacteria | 2480 |
| 1200 | Ga0501045_0307433 | 3300049824 | Bacteria | 1180 |
| 1201 | Ga0501045_0598039 | 3300049824 | Bacteria | 817 |
| 1202 | nmdc:mga03n38_239893_c1 | 3300050490 | Unclassified | 953 |
| 1203 | nmdc:mga0yw44_425689_c1 | 3300050492 | Unclassified | 899 |
| 1204 | nmdc:mga0yw44_770908_c1 | 3300050492 | Unclassified | 653 |
| 1205 | nmdc:mga05p37_172461_c1 | 3300050507 | Unclassified | 2637 |
| 1206 | nmdc:mga05p37_2062688_c1 | 3300050507 | Bacteria | 536 |
| 1207 | nmdc:mga05p37_40551_c1 | 3300050507 | Bacteria | 5717 |
| 1208 | nmdc:mga05p37_8517_c1 | 3300050507 | Bacteria | 12121 |
| 1209 | nmdc:mga09592_1146884_c1 | 3300050508 | Unclassified | 644 |
| 1210 | nmdc:mga06r32_177570_c1 | 3300050510 | Bacteria | 2114 |
| 1211 | nmdc:mga08y16_169430_c1 | 3300050511 | Unclassified | 2268 |
| 1212 | nmdc:mga08y16_302823_c1 | 3300050511 | Unclassified | 1647 |
| 1213 | nmdc:mga0n895_1029091_c1 | 3300050512 | Bacteria | 804 |
| 1214 | nmdc:mga0n895_1270773_c1 | 3300050512 | Unclassified | 708 |
| 1215 | nmdc:mga0n895_2216090_c1 | 3300050512 | Unclassified | 505 |
| 1216 | nmdc:mga0n895_43470_c1 | 3300050512 | Bacteria | 4378 |
| 1217 | nmdc:mga0n895_52992_c1 | 3300050512 | Bacteria | 3984 |
| 1218 | nmdc:mga0n895_536835_c1 | 3300050512 | Bacteria | 1176 |
| 1219 | nmdc:mga0rr50_22888_c1 | 3300050513 | Bacteria | 4298 |
| 1220 | nmdc:mga0rr50_525969_c1 | 3300050513 | Bacteria | 1006 |
| 1221 | nmdc:mga08x19_1154962_c1 | 3300050514 | Bacteria | 549 |
| 1222 | nmdc:mga08x19_93625_c1 | 3300050514 | Bacteria | 1986 |
| 1223 | nmdc:mga0a205_1196825_c1 | 3300050515 | Unclassified | 608 |
| 1224 | nmdc:mga0a205_1318897_c1 | 3300050515 | Unclassified | 569 |
| 1225 | nmdc:mga0a205_351207_c1 | 3300050515 | Bacteria | 1342 |
| 1226 | nmdc:mga0a205_41861_c1 | 3300050515 | Bacteria | 4413 |
| 1227 | Ga0495601_0002246 | 3300053077 | Bacteria | 10881 |
| 1228 | Ga0495601_0045071 | 3300053077 | Bacteria | 2772 |
| 1229 | Ga0495601_0065382 | 3300053077 | Unclassified | 2314 |
| 1230 | Ga0495601_0723403 | 3300053077 | Unclassified | 634 |
| 1231 | Ga0495612_0027656 | 3300053078 | Bacteria | 2281 |
| 1232 | Ga0495595_0002243 | 3300053084 | Bacteria | 7518 |
| 1233 | Ga0495595_0341374 | 3300053084 | Bacteria | 755 |
| 1234 | Ga0495595_0408460 | 3300053084 | Bacteria | 688 |
| 1235 | Ga0495619_0020674 | 3300053085 | Bacteria | 4196 |
| 1236 | Ga0495619_0196207 | 3300053085 | Bacteria | 1397 |
| 1237 | Ga0495619_1175468 | 3300053085 | Bacteria | 509 |
| 1238 | Ga0501084_0013069 | 3300054114 | Bacteria | 6869 |
| 1239 | Ga0501084_0253608 | 3300054114 | Bacteria | 1485 |
| 1240 | Ga0501084_0317286 | 3300054114 | Unclassified | 1316 |
| 1241 | Ga0501084_0480436 | 3300054114 | Bacteria | 1050 |
| 1242 | Ga0501084_0626674 | 3300054114 | Bacteria | 908 |
| 1243 | Ga0501084_0776315 | 3300054114 | Bacteria | 807 |
| 1244 | Ga0501084_1006671 | 3300054114 | Bacteria | 700 |
| 1245 | Ga0590075_006978 | 3300059424 | Bacteria | 2677 |
| 1246 | Ga0587066_022517 | 3300059490 | Bacteria | 1055 |
| 1247 | Ga0587070_179593 | 3300059491 | Bacteria | 550 |
| 1248 | Ga0587082_111861 | 3300059504 | Bacteria | 607 |
| 1249 | Ga0587085_065683 | 3300059506 | Bacteria | 697 |
| 1250 | Ga0587091_071778 | 3300059511 | Bacteria | 759 |
| 1251 | Ga0587091_135361 | 3300059511 | Bacteria | 612 |
| 1252 | Ga0501082_0025036 | 3300060353 | Bacteria | 5141 |
| 1253 | Ga0501082_0309834 | 3300060353 | Unclassified | 1375 |
| 1254 | Ga0501082_0528625 | 3300060353 | Bacteria | 1031 |
| 1255 | Ga0501082_1261139 | 3300060353 | Bacteria | 646 |
| 1256 | Ga0501082_1615719 | 3300060353 | Bacteria | 566 |
| 1257 | Ga0501082_1994215 | 3300060353 | Bacteria | 506 |
| 1258 | Ga0466962_0024979 | 3300061719 | Unclassified | 2868 |
| 1259 | Ga0466962_0155400 | 3300061719 | Bacteria | 1111 |
| 1260 | Ga0466962_0368004 | 3300061719 | Bacteria | 717 |
| 1261 | Ga0530510_0021443 | 3300061734 | Bacteria | 4596 |
| 1262 | Ga0530510_0103178 | 3300061734 | Bacteria | 2086 |
| 1263 | Ga0530510_0262751 | 3300061734 | Unclassified | 1288 |
| 1264 | Ga0530510_0278887 | 3300061734 | Bacteria | 1248 |
| 1265 | Ga0530510_0995902 | 3300061734 | Bacteria | 641 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005437 | Ga0070710_10429532 | Ga0070710_104295323 | 77 |
| 2 | 3300005439 | Ga0070711_100034675 | Ga0070711_1000346751 | 77 |
| 3 | 3300026023 | Ga0207677_10247502 | Ga0207677_102475024 | 77 |
| 4 | 3300037471 | Ga0395905_1179642 | Ga0395905_1179642_15_338 | 81 |
| 5 | 3300026075 | Ga0207708_10225572 | Ga0207708_102255723 | 82 |
| 6 | 3300047321 | Ga0495676_0002012 | Ga0495676_0002012_113_376 | 82 |
| 7 | 3300044693 | Ga0466961_0201710 | Ga0466961_0201710_219_479 | 86 |
| 8 | 3300002077 | JGI24744J21845_10002884 | JGI24744J21845_100028841 | 87 |
| 9 | 3300002244 | JGI24742J22300_10005646 | JGI24742J22300_100056461 | 87 |
| 10 | 3300005327 | Ga0070658_10121644 | Ga0070658_101216443 | 87 |
| 11 | 3300005327 | Ga0070658_11060860 | Ga0070658_110608602 | 87 |
| 12 | 3300005329 | Ga0070683_100113786 | Ga0070683_1001137864 | 87 |
| 13 | 3300005329 | Ga0070683_100319357 | Ga0070683_1003193572 | 87 |
| 14 | 3300005329 | Ga0070683_100382574 | Ga0070683_1003825743 | 87 |
| 15 | 3300005329 | Ga0070683_100598738 | Ga0070683_1005987382 | 87 |
| 16 | 3300005329 | Ga0070683_101665008 | Ga0070683_1016650081 | 87 |
| 17 | 3300005329 | Ga0070683_102158758 | Ga0070683_1021587581 | 87 |
| 18 | 3300005330 | Ga0070690_100328527 | Ga0070690_1003285272 | 87 |
| 19 | 3300005331 | Ga0070670_101814183 | Ga0070670_1018141832 | 87 |
| 20 | 3300005333 | Ga0070677_10107090 | Ga0070677_101070902 | 87 |
| 21 | 3300005336 | Ga0070680_100010728 | Ga0070680_1000107282 | 87 |
| 22 | 3300005336 | Ga0070680_100046131 | Ga0070680_1000461316 | 87 |
| 23 | 3300005336 | Ga0070680_100101251 | Ga0070680_1001012513 | 87 |
| 24 | 3300005336 | Ga0070680_100992548 | Ga0070680_1009925481 | 87 |
| 25 | 3300005337 | Ga0070682_100005203 | Ga0070682_1000052037 | 87 |
| 26 | 3300005337 | Ga0070682_100012014 | Ga0070682_1000120145 | 87 |
| 27 | 3300005337 | Ga0070682_100038562 | Ga0070682_1000385623 | 87 |
| 28 | 3300005337 | Ga0070682_100615740 | Ga0070682_1006157402 | 87 |
| 29 | 3300005337 | Ga0070682_101503533 | Ga0070682_1015035332 | 87 |
| 30 | 3300005337 | Ga0070682_101702170 | Ga0070682_1017021702 | 87 |
| 31 | 3300005338 | Ga0068868_100047501 | Ga0068868_1000475012 | 87 |
| 32 | 3300005338 | Ga0068868_100458818 | Ga0068868_1004588181 | 87 |
| 33 | 3300005338 | Ga0068868_100841141 | Ga0068868_1008411412 | 87 |
| 34 | 3300005339 | Ga0070660_100007876 | Ga0070660_1000078767 | 87 |
| 35 | 3300005339 | Ga0070660_100263381 | Ga0070660_1002633812 | 87 |
| 36 | 3300005339 | Ga0070660_100517313 | Ga0070660_1005173132 | 87 |
| 37 | 3300005339 | Ga0070660_101322465 | Ga0070660_1013224651 | 87 |
| 38 | 3300005339 | Ga0070660_101865784 | Ga0070660_1018657842 | 87 |
| 39 | 3300005340 | Ga0070689_100013742 | Ga0070689_1000137427 | 87 |
| 40 | 3300005340 | Ga0070689_100169688 | Ga0070689_1001696882 | 87 |
| 41 | 3300005340 | Ga0070689_100607574 | Ga0070689_1006075742 | 87 |
| 42 | 3300005343 | Ga0070687_100904722 | Ga0070687_1009047222 | 87 |
| 43 | 3300005344 | Ga0070661_100984439 | Ga0070661_1009844391 | 87 |
| 44 | 3300005345 | Ga0070692_10017715 | Ga0070692_100177152 | 87 |
| 45 | 3300005347 | Ga0070668_101417711 | Ga0070668_1014177112 | 87 |
| 46 | 3300005353 | Ga0070669_100359841 | Ga0070669_1003598412 | 87 |
| 47 | 3300005354 | Ga0070675_100065652 | Ga0070675_1000656523 | 87 |
| 48 | 3300005354 | Ga0070675_100975627 | Ga0070675_1009756272 | 87 |
| 49 | 3300005354 | Ga0070675_101093248 | Ga0070675_1010932482 | 87 |
| 50 | 3300005354 | Ga0070675_101308900 | Ga0070675_1013089002 | 87 |
| 51 | 3300005355 | Ga0070671_100043832 | Ga0070671_1000438323 | 87 |
| 52 | 3300005355 | Ga0070671_100050442 | Ga0070671_1000504423 | 87 |
| 53 | 3300005355 | Ga0070671_100199816 | Ga0070671_1001998163 | 87 |
| 54 | 3300005355 | Ga0070671_100581509 | Ga0070671_1005815092 | 87 |
| 55 | 3300005356 | Ga0070674_100005302 | Ga0070674_1000053021 | 87 |
| 56 | 3300005356 | Ga0070674_100145759 | Ga0070674_1001457593 | 87 |
| 57 | 3300005356 | Ga0070674_100155400 | Ga0070674_1001554002 | 87 |
| 58 | 3300005356 | Ga0070674_100172688 | Ga0070674_1001726882 | 87 |
| 59 | 3300005356 | Ga0070674_100928816 | Ga0070674_1009288162 | 87 |
| 60 | 3300005364 | Ga0070673_101108750 | Ga0070673_1011087502 | 87 |
| 61 | 3300005365 | Ga0070688_100008183 | Ga0070688_1000081832 | 87 |
| 62 | 3300005365 | Ga0070688_101080898 | Ga0070688_1010808981 | 87 |
| 63 | 3300005366 | Ga0070659_100241562 | Ga0070659_1002415621 | 87 |
| 64 | 3300005366 | Ga0070659_100832331 | Ga0070659_1008323312 | 87 |
| 65 | 3300005366 | Ga0070659_100871464 | Ga0070659_1008714642 | 87 |
| 66 | 3300005367 | Ga0070667_101336946 | Ga0070667_1013369461 | 87 |
| 67 | 3300005367 | Ga0070667_101399362 | Ga0070667_1013993622 | 87 |
| 68 | 3300005434 | Ga0070709_10268306 | Ga0070709_102683064 | 87 |
| 69 | 3300005434 | Ga0070709_10547749 | Ga0070709_105477492 | 87 |
| 70 | 3300005434 | Ga0070709_10611746 | Ga0070709_106117462 | 87 |
| 71 | 3300005434 | Ga0070709_10629416 | Ga0070709_106294162 | 87 |
| 72 | 3300005435 | Ga0070714_100096340 | Ga0070714_1000963401 | 87 |
| 73 | 3300005435 | Ga0070714_100169434 | Ga0070714_1001694343 | 87 |
| 74 | 3300005435 | Ga0070714_100251064 | Ga0070714_1002510642 | 87 |
| 75 | 3300005435 | Ga0070714_100320773 | Ga0070714_1003207732 | 87 |
| 76 | 3300005436 | Ga0070713_100147731 | Ga0070713_1001477314 | 87 |
| 77 | 3300005436 | Ga0070713_100791617 | Ga0070713_1007916172 | 87 |
| 78 | 3300005436 | Ga0070713_101981494 | Ga0070713_1019814942 | 87 |
| 79 | 3300005437 | Ga0070710_10007082 | Ga0070710_100070822 | 87 |
| 80 | 3300005438 | Ga0070701_10014128 | Ga0070701_100141282 | 87 |
| 81 | 3300005438 | Ga0070701_10116456 | Ga0070701_101164563 | 87 |
| 82 | 3300005439 | Ga0070711_100003182 | Ga0070711_1000031827 | 87 |
| 83 | 3300005439 | Ga0070711_100865370 | Ga0070711_1008653702 | 87 |
| 84 | 3300005440 | Ga0070705_100023909 | Ga0070705_1000239094 | 87 |
| 85 | 3300005441 | Ga0070700_100001522 | Ga0070700_1000015227 | 87 |
| 86 | 3300005441 | Ga0070700_100024380 | Ga0070700_1000243803 | 87 |
| 87 | 3300005441 | Ga0070700_100477031 | Ga0070700_1004770312 | 87 |
| 88 | 3300005441 | Ga0070700_101225522 | Ga0070700_1012255222 | 87 |
| 89 | 3300005444 | Ga0070694_100054439 | Ga0070694_1000544392 | 87 |
| 90 | 3300005444 | Ga0070694_100327248 | Ga0070694_1003272481 | 87 |
| 91 | 3300005444 | Ga0070694_100367868 | Ga0070694_1003678682 | 87 |
| 92 | 3300005444 | Ga0070694_100952320 | Ga0070694_1009523201 | 87 |
| 93 | 3300005445 | Ga0070708_100238367 | Ga0070708_1002383672 | 87 |
| 94 | 3300005445 | Ga0070708_100928861 | Ga0070708_1009288611 | 87 |
| 95 | 3300005445 | Ga0070708_101106228 | Ga0070708_1011062282 | 87 |
| 96 | 3300005445 | Ga0070708_101218900 | Ga0070708_1012189001 | 87 |
| 97 | 3300005455 | Ga0070663_100007368 | Ga0070663_1000073686 | 87 |
| 98 | 3300005455 | Ga0070663_100129504 | Ga0070663_1001295043 | 87 |
| 99 | 3300005455 | Ga0070663_100745445 | Ga0070663_1007454452 | 87 |
| 100 | 3300005456 | Ga0070678_100001885 | Ga0070678_1000018859 | 87 |
| 101 | 3300005456 | Ga0070678_100025558 | Ga0070678_1000255585 | 87 |
| 102 | 3300005456 | Ga0070678_100900165 | Ga0070678_1009001652 | 87 |
| 103 | 3300005456 | Ga0070678_101065709 | Ga0070678_1010657092 | 87 |
| 104 | 3300005456 | Ga0070678_101556290 | Ga0070678_1015562902 | 87 |
| 105 | 3300005456 | Ga0070678_101687957 | Ga0070678_1016879571 | 87 |
| 106 | 3300005457 | Ga0070662_100888449 | Ga0070662_1008884492 | 87 |
| 107 | 3300005457 | Ga0070662_100948161 | Ga0070662_1009481612 | 87 |
| 108 | 3300005457 | Ga0070662_101158666 | Ga0070662_1011586661 | 87 |
| 109 | 3300005458 | Ga0070681_10012878 | Ga0070681_100128785 | 87 |
| 110 | 3300005458 | Ga0070681_10066324 | Ga0070681_100663242 | 87 |
| 111 | 3300005458 | Ga0070681_10101906 | Ga0070681_101019063 | 87 |
| 112 | 3300005458 | Ga0070681_10920824 | Ga0070681_109208241 | 87 |
| 113 | 3300005459 | Ga0068867_100002812 | Ga0068867_1000028127 | 87 |
| 114 | 3300005459 | Ga0068867_100322103 | Ga0068867_1003221032 | 87 |
| 115 | 3300005459 | Ga0068867_101609589 | Ga0068867_1016095891 | 87 |
| 116 | 3300005466 | Ga0070685_10034706 | Ga0070685_100347064 | 87 |
| 117 | 3300005466 | Ga0070685_10047068 | Ga0070685_100470682 | 87 |
| 118 | 3300005467 | Ga0070706_100099647 | Ga0070706_1000996472 | 87 |
| 119 | 3300005467 | Ga0070706_101681800 | Ga0070706_1016818001 | 87 |
| 120 | 3300005467 | Ga0070706_101709306 | Ga0070706_1017093062 | 87 |
| 121 | 3300005468 | Ga0070707_100020070 | Ga0070707_1000200706 | 87 |
| 122 | 3300005468 | Ga0070707_100971290 | Ga0070707_1009712902 | 87 |
| 123 | 3300005468 | Ga0070707_101727840 | Ga0070707_1017278402 | 87 |
| 124 | 3300005471 | Ga0070698_100100234 | Ga0070698_1001002343 | 87 |
| 125 | 3300005471 | Ga0070698_100207210 | Ga0070698_1002072103 | 87 |
| 126 | 3300005471 | Ga0070698_100233256 | Ga0070698_1002332562 | 87 |
| 127 | 3300005471 | Ga0070698_100241519 | Ga0070698_1002415193 | 87 |
| 128 | 3300005518 | Ga0070699_100065041 | Ga0070699_1000650411 | 87 |
| 129 | 3300005518 | Ga0070699_100891344 | Ga0070699_1008913442 | 87 |
| 130 | 3300005530 | Ga0070679_100044289 | Ga0070679_1000442896 | 87 |
| 131 | 3300005530 | Ga0070679_100057930 | Ga0070679_1000579305 | 87 |
| 132 | 3300005530 | Ga0070679_100260982 | Ga0070679_1002609823 | 87 |
| 133 | 3300005530 | Ga0070679_100780062 | Ga0070679_1007800621 | 87 |
| 134 | 3300005530 | Ga0070679_101372135 | Ga0070679_1013721352 | 87 |
| 135 | 3300005535 | Ga0070684_100164140 | Ga0070684_1001641403 | 87 |
| 136 | 3300005535 | Ga0070684_100236486 | Ga0070684_1002364863 | 87 |
| 137 | 3300005535 | Ga0070684_100239566 | Ga0070684_1002395662 | 87 |
| 138 | 3300005535 | Ga0070684_100444530 | Ga0070684_1004445302 | 87 |
| 139 | 3300005535 | Ga0070684_100480314 | Ga0070684_1004803142 | 87 |
| 140 | 3300005535 | Ga0070684_100675964 | Ga0070684_1006759642 | 87 |
| 141 | 3300005535 | Ga0070684_100952256 | Ga0070684_1009522562 | 87 |
| 142 | 3300005536 | Ga0070697_100015513 | Ga0070697_1000155134 | 87 |
| 143 | 3300005536 | Ga0070697_100874373 | Ga0070697_1008743731 | 87 |
| 144 | 3300005536 | Ga0070697_101093116 | Ga0070697_1010931162 | 87 |
| 145 | 3300005539 | Ga0068853_100010897 | Ga0068853_1000108973 | 87 |
| 146 | 3300005543 | Ga0070672_100100692 | Ga0070672_1001006922 | 87 |
| 147 | 3300005543 | Ga0070672_100551570 | Ga0070672_1005515702 | 87 |
| 148 | 3300005543 | Ga0070672_101535388 | Ga0070672_1015353881 | 87 |
| 149 | 3300005544 | Ga0070686_100004420 | Ga0070686_1000044208 | 87 |
| 150 | 3300005544 | Ga0070686_100457101 | Ga0070686_1004571012 | 87 |
| 151 | 3300005544 | Ga0070686_101004867 | Ga0070686_1010048672 | 87 |
| 152 | 3300005544 | Ga0070686_101704664 | Ga0070686_1017046641 | 87 |
| 153 | 3300005545 | Ga0070695_100079175 | Ga0070695_1000791752 | 87 |
| 154 | 3300005545 | Ga0070695_101134292 | Ga0070695_1011342921 | 87 |
| 155 | 3300005546 | Ga0070696_100005547 | Ga0070696_1000055473 | 87 |
| 156 | 3300005547 | Ga0070693_100002841 | Ga0070693_1000028413 | 87 |
| 157 | 3300005547 | Ga0070693_100026239 | Ga0070693_1000262393 | 87 |
| 158 | 3300005547 | Ga0070693_100124589 | Ga0070693_1001245892 | 87 |
| 159 | 3300005548 | Ga0070665_100105506 | Ga0070665_1001055062 | 87 |
| 160 | 3300005548 | Ga0070665_100688053 | Ga0070665_1006880532 | 87 |
| 161 | 3300005548 | Ga0070665_101757188 | Ga0070665_1017571881 | 87 |
| 162 | 3300005548 | Ga0070665_102187472 | Ga0070665_1021874722 | 87 |
| 163 | 3300005549 | Ga0070704_100018433 | Ga0070704_1000184333 | 87 |
| 164 | 3300005549 | Ga0070704_101025894 | Ga0070704_1010258941 | 87 |
| 165 | 3300005549 | Ga0070704_102266551 | Ga0070704_1022665512 | 87 |
| 166 | 3300005563 | Ga0068855_100108032 | Ga0068855_1001080322 | 87 |
| 167 | 3300005563 | Ga0068855_100215913 | Ga0068855_1002159133 | 87 |
| 168 | 3300005563 | Ga0068855_100391200 | Ga0068855_1003912003 | 87 |
| 169 | 3300005564 | Ga0070664_100417318 | Ga0070664_1004173182 | 87 |
| 170 | 3300005578 | Ga0068854_100733226 | Ga0068854_1007332261 | 87 |
| 171 | 3300005614 | Ga0068856_100006334 | Ga0068856_10000633412 | 87 |
| 172 | 3300005614 | Ga0068856_100019097 | Ga0068856_1000190973 | 87 |
| 173 | 3300005614 | Ga0068856_100124975 | Ga0068856_1001249753 | 87 |
| 174 | 3300005614 | Ga0068856_100315940 | Ga0068856_1003159402 | 87 |
| 175 | 3300005614 | Ga0068856_100379374 | Ga0068856_1003793742 | 87 |
| 176 | 3300005615 | Ga0070702_100006871 | Ga0070702_1000068712 | 87 |
| 177 | 3300005615 | Ga0070702_100097384 | Ga0070702_1000973843 | 87 |
| 178 | 3300005615 | Ga0070702_100585912 | Ga0070702_1005859122 | 87 |
| 179 | 3300005616 | Ga0068852_100072866 | Ga0068852_1000728662 | 87 |
| 180 | 3300005616 | Ga0068852_101955607 | Ga0068852_1019556072 | 87 |
| 181 | 3300005616 | Ga0068852_102801298 | Ga0068852_1028012981 | 87 |
| 182 | 3300005617 | Ga0068859_100044009 | Ga0068859_1000440093 | 87 |
| 183 | 3300005617 | Ga0068859_102137476 | Ga0068859_1021374762 | 87 |
| 184 | 3300005618 | Ga0068864_100920442 | Ga0068864_1009204422 | 87 |
| 185 | 3300005618 | Ga0068864_101029324 | Ga0068864_1010293242 | 87 |
| 186 | 3300005618 | Ga0068864_102550393 | Ga0068864_1025503932 | 87 |
| 187 | 3300005718 | Ga0068866_10004917 | Ga0068866_100049172 | 87 |
| 188 | 3300005718 | Ga0068866_10637352 | Ga0068866_106373521 | 87 |
| 189 | 3300005718 | Ga0068866_11113840 | Ga0068866_111138401 | 87 |
| 190 | 3300005719 | Ga0068861_100088714 | Ga0068861_1000887142 | 87 |
| 191 | 3300005719 | Ga0068861_100431878 | Ga0068861_1004318782 | 87 |
| 192 | 3300005840 | Ga0068870_10022453 | Ga0068870_100224533 | 87 |
| 193 | 3300005840 | Ga0068870_10518789 | Ga0068870_105187892 | 87 |
| 194 | 3300005841 | Ga0068863_100335123 | Ga0068863_1003351233 | 87 |
| 195 | 3300005841 | Ga0068863_101897620 | Ga0068863_1018976202 | 87 |
| 196 | 3300005843 | Ga0068860_100221601 | Ga0068860_1002216012 | 87 |
| 197 | 3300005843 | Ga0068860_100398203 | Ga0068860_1003982032 | 87 |
| 198 | 3300005843 | Ga0068860_101038128 | Ga0068860_1010381282 | 87 |
| 199 | 3300005843 | Ga0068860_102413470 | Ga0068860_1024134702 | 87 |
| 200 | 3300005937 | Ga0081455_10409176 | Ga0081455_104091762 | 87 |
| 201 | 3300005985 | Ga0081539_10142486 | Ga0081539_101424862 | 87 |
| 202 | 3300006028 | Ga0070717_10007976 | Ga0070717_100079768 | 87 |
| 203 | 3300006028 | Ga0070717_10032371 | Ga0070717_100323712 | 87 |
| 204 | 3300006028 | Ga0070717_10762202 | Ga0070717_107622022 | 87 |
| 205 | 3300006028 | Ga0070717_11143804 | Ga0070717_111438042 | 87 |
| 206 | 3300006028 | Ga0070717_11234265 | Ga0070717_112342651 | 87 |
| 207 | 3300006028 | Ga0070717_11376358 | Ga0070717_113763582 | 87 |
| 208 | 3300006058 | Ga0075432_10067820 | Ga0075432_100678204 | 87 |
| 209 | 3300006163 | Ga0070715_10012087 | Ga0070715_100120872 | 87 |
| 210 | 3300006163 | Ga0070715_10828576 | Ga0070715_108285761 | 87 |
| 211 | 3300006173 | Ga0070716_100330193 | Ga0070716_1003301932 | 87 |
| 212 | 3300006173 | Ga0070716_101634343 | Ga0070716_1016343431 | 87 |
| 213 | 3300006175 | Ga0070712_100078687 | Ga0070712_1000786874 | 87 |
| 214 | 3300006175 | Ga0070712_100098783 | Ga0070712_1000987832 | 87 |
| 215 | 3300006175 | Ga0070712_100492019 | Ga0070712_1004920192 | 87 |
| 216 | 3300006175 | Ga0070712_100732521 | Ga0070712_1007325212 | 87 |
| 217 | 3300006175 | Ga0070712_100828983 | Ga0070712_1008289831 | 87 |
| 218 | 3300006178 | Ga0075367_10962613 | Ga0075367_109626131 | 87 |
| 219 | 3300006237 | Ga0097621_100208813 | Ga0097621_1002088132 | 87 |
| 220 | 3300006237 | Ga0097621_100462764 | Ga0097621_1004627642 | 87 |
| 221 | 3300006358 | Ga0068871_100013932 | Ga0068871_1000139323 | 87 |
| 222 | 3300006358 | Ga0068871_100102089 | Ga0068871_1001020893 | 87 |
| 223 | 3300006358 | Ga0068871_101327441 | Ga0068871_1013274412 | 87 |
| 224 | 3300006847 | Ga0075431_100245114 | Ga0075431_1002451142 | 87 |
| 225 | 3300006852 | Ga0075433_10032954 | Ga0075433_100329542 | 87 |
| 226 | 3300006852 | Ga0075433_10407006 | Ga0075433_104070062 | 87 |
| 227 | 3300006852 | Ga0075433_11091582 | Ga0075433_110915822 | 87 |
| 228 | 3300006871 | Ga0075434_100030670 | Ga0075434_1000306703 | 87 |
| 229 | 3300006871 | Ga0075434_100075775 | Ga0075434_1000757757 | 87 |
| 230 | 3300006871 | Ga0075434_100359519 | Ga0075434_1003595192 | 87 |
| 231 | 3300006871 | Ga0075434_100563152 | Ga0075434_1005631522 | 87 |
| 232 | 3300006871 | Ga0075434_100668080 | Ga0075434_1006680802 | 87 |
| 233 | 3300006871 | Ga0075434_101205432 | Ga0075434_1012054322 | 87 |
| 234 | 3300006871 | Ga0075434_101491305 | Ga0075434_1014913051 | 87 |
| 235 | 3300006881 | Ga0068865_100002447 | Ga0068865_1000024472 | 87 |
| 236 | 3300006881 | Ga0068865_100014363 | Ga0068865_1000143635 | 87 |
| 237 | 3300006881 | Ga0068865_101039587 | Ga0068865_1010395872 | 87 |
| 238 | 3300006881 | Ga0068865_101220758 | Ga0068865_1012207582 | 87 |
| 239 | 3300006881 | Ga0068865_101277837 | Ga0068865_1012778372 | 87 |
| 240 | 3300006914 | Ga0075436_100023051 | Ga0075436_1000230514 | 87 |
| 241 | 3300006914 | Ga0075436_100025415 | Ga0075436_1000254153 | 87 |
| 242 | 3300006931 | Ga0097620_100044009 | Ga0097620_1000440093 | 87 |
| 243 | 3300006931 | Ga0097620_102136633 | Ga0097620_1021366331 | 87 |
| 244 | 3300007076 | Ga0075435_100000729 | Ga0075435_10000072913 | 87 |
| 245 | 3300007076 | Ga0075435_100008824 | Ga0075435_1000088246 | 87 |
| 246 | 3300007076 | Ga0075435_101616031 | Ga0075435_1016160312 | 87 |
| 247 | 3300009094 | Ga0111539_10007764 | Ga0111539_1000776416 | 87 |
| 248 | 3300009094 | Ga0111539_10950637 | Ga0111539_109506371 | 87 |
| 249 | 3300009094 | Ga0111539_11167054 | Ga0111539_111670542 | 87 |
| 250 | 3300009098 | Ga0105245_10067558 | Ga0105245_100675581 | 87 |
| 251 | 3300009098 | Ga0105245_10280204 | Ga0105245_102802042 | 87 |
| 252 | 3300009098 | Ga0105245_10344290 | Ga0105245_103442902 | 87 |
| 253 | 3300009098 | Ga0105245_10537085 | Ga0105245_105370852 | 87 |
| 254 | 3300009098 | Ga0105245_11473113 | Ga0105245_114731132 | 87 |
| 255 | 3300009098 | Ga0105245_12625668 | Ga0105245_126256682 | 87 |
| 256 | 3300009098 | Ga0105245_12648972 | Ga0105245_126489721 | 87 |
| 257 | 3300009098 | Ga0105245_12938323 | Ga0105245_129383232 | 87 |
| 258 | 3300009101 | Ga0105247_10246670 | Ga0105247_102466702 | 87 |
| 259 | 3300009101 | Ga0105247_10481939 | Ga0105247_104819391 | 87 |
| 260 | 3300009101 | Ga0105247_10775271 | Ga0105247_107752712 | 87 |
| 261 | 3300009101 | Ga0105247_11209260 | Ga0105247_112092601 | 87 |
| 262 | 3300009101 | Ga0105247_11618496 | Ga0105247_116184961 | 87 |
| 263 | 3300009147 | Ga0114129_10002432 | Ga0114129_1000243211 | 87 |
| 264 | 3300009147 | Ga0114129_10052442 | Ga0114129_100524422 | 87 |
| 265 | 3300009147 | Ga0114129_10198068 | Ga0114129_101980683 | 87 |
| 266 | 3300009147 | Ga0114129_10260979 | Ga0114129_102609793 | 87 |
| 267 | 3300009147 | Ga0114129_10384421 | Ga0114129_103844212 | 87 |
| 268 | 3300009147 | Ga0114129_11606517 | Ga0114129_116065172 | 87 |
| 269 | 3300009147 | Ga0114129_12627120 | Ga0114129_126271202 | 87 |
| 270 | 3300009148 | Ga0105243_10003824 | Ga0105243_100038247 | 87 |
| 271 | 3300009148 | Ga0105243_10028730 | Ga0105243_100287303 | 87 |
| 272 | 3300009148 | Ga0105243_10145387 | Ga0105243_101453872 | 87 |
| 273 | 3300009148 | Ga0105243_10594517 | Ga0105243_105945172 | 87 |
| 274 | 3300009148 | Ga0105243_10880415 | Ga0105243_108804152 | 87 |
| 275 | 3300009148 | Ga0105243_11381352 | Ga0105243_113813521 | 87 |
| 276 | 3300009174 | Ga0105241_10499577 | Ga0105241_104995771 | 87 |
| 277 | 3300009174 | Ga0105241_12483902 | Ga0105241_124839021 | 87 |
| 278 | 3300009176 | Ga0105242_10003423 | Ga0105242_1000342310 | 87 |
| 279 | 3300009176 | Ga0105242_10033783 | Ga0105242_100337832 | 87 |
| 280 | 3300009176 | Ga0105242_10366867 | Ga0105242_103668672 | 87 |
| 281 | 3300009176 | Ga0105242_10503809 | Ga0105242_105038091 | 87 |
| 282 | 3300009176 | Ga0105242_10514446 | Ga0105242_105144462 | 87 |
| 283 | 3300009176 | Ga0105242_10679578 | Ga0105242_106795783 | 87 |
| 284 | 3300009176 | Ga0105242_10864895 | Ga0105242_108648952 | 87 |
| 285 | 3300009176 | Ga0105242_11385119 | Ga0105242_113851191 | 87 |
| 286 | 3300009176 | Ga0105242_13291476 | Ga0105242_132914761 | 87 |
| 287 | 3300009177 | Ga0105248_10012945 | Ga0105248_100129455 | 87 |
| 288 | 3300009177 | Ga0105248_10290675 | Ga0105248_102906752 | 87 |
| 289 | 3300009177 | Ga0105248_10325855 | Ga0105248_103258552 | 87 |
| 290 | 3300009177 | Ga0105248_10515917 | Ga0105248_105159172 | 87 |
| 291 | 3300009177 | Ga0105248_11446796 | Ga0105248_114467961 | 87 |
| 292 | 3300009545 | Ga0105237_10515948 | Ga0105237_105159482 | 87 |
| 293 | 3300009545 | Ga0105237_12550279 | Ga0105237_125502791 | 87 |
| 294 | 3300009551 | Ga0105238_10123948 | Ga0105238_101239482 | 87 |
| 295 | 3300009551 | Ga0105238_11000362 | Ga0105238_110003622 | 87 |
| 296 | 3300009551 | Ga0105238_12568878 | Ga0105238_125688781 | 87 |
| 297 | 3300009553 | Ga0105249_10001792 | Ga0105249_100017928 | 87 |
| 298 | 3300009553 | Ga0105249_11102300 | Ga0105249_111023002 | 87 |
| 299 | 3300009553 | Ga0105249_11411222 | Ga0105249_114112222 | 87 |
| 300 | 3300009553 | Ga0105249_11439250 | Ga0105249_114392501 | 87 |
| 301 | 3300009553 | Ga0105249_11576452 | Ga0105249_115764522 | 87 |
| 302 | 3300009553 | Ga0105249_13273095 | Ga0105249_132730952 | 87 |
| 303 | 3300010375 | Ga0105239_10006563 | Ga0105239_1000656315 | 87 |
| 304 | 3300010375 | Ga0105239_10661247 | Ga0105239_106612472 | 87 |
| 305 | 3300010375 | Ga0105239_11510191 | Ga0105239_115101911 | 87 |
| 306 | 3300010375 | Ga0105239_11616860 | Ga0105239_116168602 | 87 |
| 307 | 3300010375 | Ga0105239_12746030 | Ga0105239_127460302 | 87 |
| 308 | 3300010375 | Ga0105239_12994387 | Ga0105239_129943871 | 87 |
| 309 | 3300011119 | Ga0105246_10168375 | Ga0105246_101683752 | 87 |
| 310 | 3300011119 | Ga0105246_10428207 | Ga0105246_104282072 | 87 |
| 311 | 3300011119 | Ga0105246_12433871 | Ga0105246_124338712 | 87 |
| 312 | 3300013100 | Ga0157373_10546942 | Ga0157373_105469422 | 87 |
| 313 | 3300013100 | Ga0157373_10755650 | Ga0157373_107556502 | 87 |
| 314 | 3300013105 | Ga0157369_10010968 | Ga0157369_100109686 | 87 |
| 315 | 3300013105 | Ga0157369_10030270 | Ga0157369_100302702 | 87 |
| 316 | 3300013105 | Ga0157369_10908364 | Ga0157369_109083642 | 87 |
| 317 | 3300013105 | Ga0157369_11145233 | Ga0157369_111452331 | 87 |
| 318 | 3300013296 | Ga0157374_10012233 | Ga0157374_100122332 | 87 |
| 319 | 3300013296 | Ga0157374_10575700 | Ga0157374_105757002 | 87 |
| 320 | 3300013296 | Ga0157374_10661230 | Ga0157374_106612302 | 87 |
| 321 | 3300013296 | Ga0157374_11958134 | Ga0157374_119581341 | 87 |
| 322 | 3300013297 | Ga0157378_10004712 | Ga0157378_100047127 | 87 |
| 323 | 3300013297 | Ga0157378_10059956 | Ga0157378_100599564 | 87 |
| 324 | 3300013297 | Ga0157378_10318789 | Ga0157378_103187892 | 87 |
| 325 | 3300013297 | Ga0157378_11209026 | Ga0157378_112090262 | 87 |
| 326 | 3300013297 | Ga0157378_13040822 | Ga0157378_130408221 | 87 |
| 327 | 3300013306 | Ga0163162_10005507 | Ga0163162_100055078 | 87 |
| 328 | 3300013306 | Ga0163162_10220218 | Ga0163162_102202182 | 87 |
| 329 | 3300013306 | Ga0163162_10878044 | Ga0163162_108780442 | 87 |
| 330 | 3300013307 | Ga0157372_10499303 | Ga0157372_104993032 | 87 |
| 331 | 3300013307 | Ga0157372_10550663 | Ga0157372_105506632 | 87 |
| 332 | 3300013308 | Ga0157375_10327919 | Ga0157375_103279192 | 87 |
| 333 | 3300013308 | Ga0157375_10926392 | Ga0157375_109263922 | 87 |
| 334 | 3300013308 | Ga0157375_11404638 | Ga0157375_114046381 | 87 |
| 335 | 3300013308 | Ga0157375_13453507 | Ga0157375_134535072 | 87 |
| 336 | 3300013308 | Ga0157375_13737890 | Ga0157375_137378902 | 87 |
| 337 | 3300014325 | Ga0163163_10113274 | Ga0163163_101132742 | 87 |
| 338 | 3300014325 | Ga0163163_10213174 | Ga0163163_102131743 | 87 |
| 339 | 3300014326 | Ga0157380_10008142 | Ga0157380_100081426 | 87 |
| 340 | 3300014326 | Ga0157380_10095551 | Ga0157380_100955512 | 87 |
| 341 | 3300014326 | Ga0157380_10151368 | Ga0157380_101513682 | 87 |
| 342 | 3300014326 | Ga0157380_10259385 | Ga0157380_102593852 | 87 |
| 343 | 3300014326 | Ga0157380_12209236 | Ga0157380_122092362 | 87 |
| 344 | 3300014497 | Ga0182008_10172015 | Ga0182008_101720152 | 87 |
| 345 | 3300014497 | Ga0182008_10423783 | Ga0182008_104237832 | 87 |
| 346 | 3300014745 | Ga0157377_10009687 | Ga0157377_100096872 | 87 |
| 347 | 3300014745 | Ga0157377_10076540 | Ga0157377_100765402 | 87 |
| 348 | 3300014745 | Ga0157377_10252177 | Ga0157377_102521773 | 87 |
| 349 | 3300014745 | Ga0157377_10260024 | Ga0157377_102600242 | 87 |
| 350 | 3300014968 | Ga0157379_10020906 | Ga0157379_100209066 | 87 |
| 351 | 3300014968 | Ga0157379_10361185 | Ga0157379_103611852 | 87 |
| 352 | 3300014968 | Ga0157379_10718591 | Ga0157379_107185912 | 87 |
| 353 | 3300014969 | Ga0157376_10105712 | Ga0157376_101057123 | 87 |
| 354 | 3300014969 | Ga0157376_10740124 | Ga0157376_107401242 | 87 |
| 355 | 3300014969 | Ga0157376_10789091 | Ga0157376_107890912 | 87 |
| 356 | 3300014969 | Ga0157376_11175458 | Ga0157376_111754582 | 87 |
| 357 | 3300017792 | Ga0163161_10087553 | Ga0163161_100875532 | 87 |
| 358 | 3300017792 | Ga0163161_10481392 | Ga0163161_104813922 | 87 |
| 359 | 3300020070 | Ga0206356_10172331 | Ga0206356_101723313 | 87 |
| 360 | 3300020070 | Ga0206356_10678942 | Ga0206356_106789422 | 87 |
| 361 | 3300020070 | Ga0206356_10993319 | Ga0206356_109933191 | 87 |
| 362 | 3300020070 | Ga0206356_11167277 | Ga0206356_111672772 | 87 |
| 363 | 3300020078 | Ga0206352_11292620 | Ga0206352_112926202 | 87 |
| 364 | 3300020081 | Ga0206354_10455214 | Ga0206354_104552142 | 87 |
| 365 | 3300020081 | Ga0206354_10676597 | Ga0206354_106765972 | 87 |
| 366 | 3300020082 | Ga0206353_10102796 | Ga0206353_101027962 | 87 |
| 367 | 3300020082 | Ga0206353_10372582 | Ga0206353_103725822 | 87 |
| 368 | 3300020082 | Ga0206353_10675843 | Ga0206353_106758432 | 87 |
| 369 | 3300020082 | Ga0206353_11625761 | Ga0206353_116257612 | 87 |
| 370 | 3300022467 | Ga0224712_10007070 | Ga0224712_100070703 | 87 |
| 371 | 3300022467 | Ga0224712_10047123 | Ga0224712_100471231 | 87 |
| 372 | 3300022467 | Ga0224712_10068353 | Ga0224712_100683532 | 87 |
| 373 | 3300025893 | Ga0207682_10154266 | Ga0207682_101542661 | 87 |
| 374 | 3300025893 | Ga0207682_10281490 | Ga0207682_102814902 | 87 |
| 375 | 3300025898 | Ga0207692_10055044 | Ga0207692_100550442 | 87 |
| 376 | 3300025898 | Ga0207692_10661931 | Ga0207692_106619312 | 87 |
| 377 | 3300025899 | Ga0207642_10016714 | Ga0207642_100167142 | 87 |
| 378 | 3300025899 | Ga0207642_10127453 | Ga0207642_101274532 | 87 |
| 379 | 3300025899 | Ga0207642_10283039 | Ga0207642_102830392 | 87 |
| 380 | 3300025899 | Ga0207642_11002624 | Ga0207642_110026241 | 87 |
| 381 | 3300025900 | Ga0207710_10028513 | Ga0207710_100285133 | 87 |
| 382 | 3300025900 | Ga0207710_10067904 | Ga0207710_100679043 | 87 |
| 383 | 3300025901 | Ga0207688_10002129 | Ga0207688_100021296 | 87 |
| 384 | 3300025903 | Ga0207680_10644434 | Ga0207680_106444342 | 87 |
| 385 | 3300025903 | Ga0207680_10863525 | Ga0207680_108635251 | 87 |
| 386 | 3300025904 | Ga0207647_10465061 | Ga0207647_104650613 | 87 |
| 387 | 3300025905 | Ga0207685_10126770 | Ga0207685_101267702 | 87 |
| 388 | 3300025905 | Ga0207685_10665083 | Ga0207685_106650832 | 87 |
| 389 | 3300025906 | Ga0207699_10158681 | Ga0207699_101586812 | 87 |
| 390 | 3300025906 | Ga0207699_10323969 | Ga0207699_103239692 | 87 |
| 391 | 3300025906 | Ga0207699_10395806 | Ga0207699_103958061 | 87 |
| 392 | 3300025906 | Ga0207699_10551525 | Ga0207699_105515252 | 87 |
| 393 | 3300025906 | Ga0207699_10685621 | Ga0207699_106856212 | 87 |
| 394 | 3300025907 | Ga0207645_10545046 | Ga0207645_105450462 | 87 |
| 395 | 3300025908 | Ga0207643_10304662 | Ga0207643_103046622 | 87 |
| 396 | 3300025908 | Ga0207643_10571474 | Ga0207643_105714742 | 87 |
| 397 | 3300025909 | Ga0207705_10779298 | Ga0207705_107792982 | 87 |
| 398 | 3300025909 | Ga0207705_11542996 | Ga0207705_115429961 | 87 |
| 399 | 3300025910 | Ga0207684_10898466 | Ga0207684_108984662 | 87 |
| 400 | 3300025910 | Ga0207684_11060235 | Ga0207684_110602351 | 87 |
| 401 | 3300025911 | Ga0207654_10213377 | Ga0207654_102133773 | 87 |
| 402 | 3300025911 | Ga0207654_11070562 | Ga0207654_110705622 | 87 |
| 403 | 3300025912 | Ga0207707_10009696 | Ga0207707_100096965 | 87 |
| 404 | 3300025912 | Ga0207707_10063602 | Ga0207707_100636023 | 87 |
| 405 | 3300025912 | Ga0207707_10174884 | Ga0207707_101748842 | 87 |
| 406 | 3300025912 | Ga0207707_10260741 | Ga0207707_102607412 | 87 |
| 407 | 3300025912 | Ga0207707_10516051 | Ga0207707_105160512 | 87 |
| 408 | 3300025912 | Ga0207707_11118963 | Ga0207707_111189632 | 87 |
| 409 | 3300025913 | Ga0207695_10066320 | Ga0207695_100663202 | 87 |
| 410 | 3300025913 | Ga0207695_10699672 | Ga0207695_106996722 | 87 |
| 411 | 3300025914 | Ga0207671_10283450 | Ga0207671_102834502 | 87 |
| 412 | 3300025914 | Ga0207671_10330692 | Ga0207671_103306922 | 87 |
| 413 | 3300025914 | Ga0207671_10546126 | Ga0207671_105461261 | 87 |
| 414 | 3300025915 | Ga0207693_10011416 | Ga0207693_100114162 | 87 |
| 415 | 3300025915 | Ga0207693_10062134 | Ga0207693_100621343 | 87 |
| 416 | 3300025915 | Ga0207693_10092812 | Ga0207693_100928122 | 87 |
| 417 | 3300025915 | Ga0207693_10225180 | Ga0207693_102251804 | 87 |
| 418 | 3300025916 | Ga0207663_10005939 | Ga0207663_100059395 | 87 |
| 419 | 3300025916 | Ga0207663_10284791 | Ga0207663_102847912 | 87 |
| 420 | 3300025916 | Ga0207663_10387108 | Ga0207663_103871082 | 87 |
| 421 | 3300025916 | Ga0207663_10517321 | Ga0207663_105173211 | 87 |
| 422 | 3300025916 | Ga0207663_11057398 | Ga0207663_110573982 | 87 |
| 423 | 3300025916 | Ga0207663_11495085 | Ga0207663_114950852 | 87 |
| 424 | 3300025917 | Ga0207660_10018008 | Ga0207660_100180088 | 87 |
| 425 | 3300025917 | Ga0207660_10054691 | Ga0207660_100546913 | 87 |
| 426 | 3300025917 | Ga0207660_10505944 | Ga0207660_105059441 | 87 |
| 427 | 3300025917 | Ga0207660_10637437 | Ga0207660_106374372 | 87 |
| 428 | 3300025917 | Ga0207660_11276870 | Ga0207660_112768701 | 87 |
| 429 | 3300025918 | Ga0207662_10093761 | Ga0207662_100937612 | 87 |
| 430 | 3300025919 | Ga0207657_10000634 | Ga0207657_1000063422 | 87 |
| 431 | 3300025919 | Ga0207657_10020702 | Ga0207657_100207027 | 87 |
| 432 | 3300025919 | Ga0207657_10039256 | Ga0207657_100392565 | 87 |
| 433 | 3300025919 | Ga0207657_10258570 | Ga0207657_102585702 | 87 |
| 434 | 3300025919 | Ga0207657_10577615 | Ga0207657_105776152 | 87 |
| 435 | 3300025921 | Ga0207652_10011117 | Ga0207652_100111175 | 87 |
| 436 | 3300025921 | Ga0207652_10311665 | Ga0207652_103116653 | 87 |
| 437 | 3300025921 | Ga0207652_10453012 | Ga0207652_104530123 | 87 |
| 438 | 3300025921 | Ga0207652_10633063 | Ga0207652_106330632 | 87 |
| 439 | 3300025921 | Ga0207652_10851545 | Ga0207652_108515452 | 87 |
| 440 | 3300025921 | Ga0207652_11322722 | Ga0207652_113227222 | 87 |
| 441 | 3300025921 | Ga0207652_11851358 | Ga0207652_118513582 | 87 |
| 442 | 3300025922 | Ga0207646_10020445 | Ga0207646_100204456 | 87 |
| 443 | 3300025922 | Ga0207646_10024163 | Ga0207646_100241639 | 87 |
| 444 | 3300025922 | Ga0207646_10026800 | Ga0207646_100268003 | 87 |
| 445 | 3300025922 | Ga0207646_10492678 | Ga0207646_104926782 | 87 |
| 446 | 3300025922 | Ga0207646_10757078 | Ga0207646_107570782 | 87 |
| 447 | 3300025922 | Ga0207646_11937892 | Ga0207646_119378922 | 87 |
| 448 | 3300025923 | Ga0207681_10429477 | Ga0207681_104294772 | 87 |
| 449 | 3300025924 | Ga0207694_10027888 | Ga0207694_100278882 | 87 |
| 450 | 3300025924 | Ga0207694_10067468 | Ga0207694_100674684 | 87 |
| 451 | 3300025924 | Ga0207694_10476609 | Ga0207694_104766092 | 87 |
| 452 | 3300025924 | Ga0207694_10743848 | Ga0207694_107438482 | 87 |
| 453 | 3300025924 | Ga0207694_11619420 | Ga0207694_116194201 | 87 |
| 454 | 3300025925 | Ga0207650_10553760 | Ga0207650_105537602 | 87 |
| 455 | 3300025926 | Ga0207659_10094951 | Ga0207659_100949512 | 87 |
| 456 | 3300025926 | Ga0207659_10469800 | Ga0207659_104698002 | 87 |
| 457 | 3300025926 | Ga0207659_10548498 | Ga0207659_105484982 | 87 |
| 458 | 3300025926 | Ga0207659_10554439 | Ga0207659_105544392 | 87 |
| 459 | 3300025926 | Ga0207659_10997366 | Ga0207659_109973661 | 87 |
| 460 | 3300025926 | Ga0207659_11716208 | Ga0207659_117162082 | 87 |
| 461 | 3300025927 | Ga0207687_10002883 | Ga0207687_100028832 | 87 |
| 462 | 3300025927 | Ga0207687_10042917 | Ga0207687_100429172 | 87 |
| 463 | 3300025927 | Ga0207687_10179844 | Ga0207687_101798441 | 87 |
| 464 | 3300025927 | Ga0207687_10212040 | Ga0207687_102120402 | 87 |
| 465 | 3300025927 | Ga0207687_10247152 | Ga0207687_102471522 | 87 |
| 466 | 3300025927 | Ga0207687_10743390 | Ga0207687_107433903 | 87 |
| 467 | 3300025927 | Ga0207687_10836733 | Ga0207687_108367332 | 87 |
| 468 | 3300025928 | Ga0207700_10143507 | Ga0207700_101435072 | 87 |
| 469 | 3300025928 | Ga0207700_10380517 | Ga0207700_103805172 | 87 |
| 470 | 3300025928 | Ga0207700_10569667 | Ga0207700_105696672 | 87 |
| 471 | 3300025929 | Ga0207664_10004970 | Ga0207664_1000497013 | 87 |
| 472 | 3300025929 | Ga0207664_10051918 | Ga0207664_100519183 | 87 |
| 473 | 3300025929 | Ga0207664_10094481 | Ga0207664_100944812 | 87 |
| 474 | 3300025929 | Ga0207664_10159922 | Ga0207664_101599221 | 87 |
| 475 | 3300025929 | Ga0207664_10469645 | Ga0207664_104696452 | 87 |
| 476 | 3300025929 | Ga0207664_10563018 | Ga0207664_105630181 | 87 |
| 477 | 3300025929 | Ga0207664_10756441 | Ga0207664_107564412 | 87 |
| 478 | 3300025931 | Ga0207644_10053241 | Ga0207644_100532413 | 87 |
| 479 | 3300025931 | Ga0207644_10079005 | Ga0207644_100790053 | 87 |
| 480 | 3300025931 | Ga0207644_10231332 | Ga0207644_102313322 | 87 |
| 481 | 3300025931 | Ga0207644_10685979 | Ga0207644_106859792 | 87 |
| 482 | 3300025931 | Ga0207644_11114024 | Ga0207644_111140242 | 87 |
| 483 | 3300025931 | Ga0207644_11443525 | Ga0207644_114435251 | 87 |
| 484 | 3300025932 | Ga0207690_10062330 | Ga0207690_100623302 | 87 |
| 485 | 3300025932 | Ga0207690_10601228 | Ga0207690_106012281 | 87 |
| 486 | 3300025932 | Ga0207690_10758794 | Ga0207690_107587941 | 87 |
| 487 | 3300025932 | Ga0207690_11382477 | Ga0207690_113824772 | 87 |
| 488 | 3300025933 | Ga0207706_10301561 | Ga0207706_103015612 | 87 |
| 489 | 3300025933 | Ga0207706_10534891 | Ga0207706_105348912 | 87 |
| 490 | 3300025933 | Ga0207706_10807827 | Ga0207706_108078272 | 87 |
| 491 | 3300025933 | Ga0207706_11487915 | Ga0207706_114879152 | 87 |
| 492 | 3300025934 | Ga0207686_10055329 | Ga0207686_100553293 | 87 |
| 493 | 3300025934 | Ga0207686_10093475 | Ga0207686_100934752 | 87 |
| 494 | 3300025934 | Ga0207686_10330075 | Ga0207686_103300752 | 87 |
| 495 | 3300025934 | Ga0207686_10536197 | Ga0207686_105361972 | 87 |
| 496 | 3300025934 | Ga0207686_11121636 | Ga0207686_111216362 | 87 |
| 497 | 3300025934 | Ga0207686_11168308 | Ga0207686_111683081 | 87 |
| 498 | 3300025935 | Ga0207709_10002377 | Ga0207709_100023779 | 87 |
| 499 | 3300025935 | Ga0207709_10151080 | Ga0207709_101510801 | 87 |
| 500 | 3300025935 | Ga0207709_10394647 | Ga0207709_103946472 | 87 |
| 501 | 3300025935 | Ga0207709_10717423 | Ga0207709_107174232 | 87 |
| 502 | 3300025935 | Ga0207709_10952123 | Ga0207709_109521231 | 87 |
| 503 | 3300025936 | Ga0207670_10081500 | Ga0207670_100815002 | 87 |
| 504 | 3300025936 | Ga0207670_10107535 | Ga0207670_101075353 | 87 |
| 505 | 3300025936 | Ga0207670_10151429 | Ga0207670_101514292 | 87 |
| 506 | 3300025936 | Ga0207670_11727551 | Ga0207670_117275511 | 87 |
| 507 | 3300025937 | Ga0207669_10029874 | Ga0207669_100298742 | 87 |
| 508 | 3300025937 | Ga0207669_10063387 | Ga0207669_100633872 | 87 |
| 509 | 3300025937 | Ga0207669_10178905 | Ga0207669_101789052 | 87 |
| 510 | 3300025937 | Ga0207669_10269703 | Ga0207669_102697032 | 87 |
| 511 | 3300025937 | Ga0207669_10382403 | Ga0207669_103824032 | 87 |
| 512 | 3300025937 | Ga0207669_11040327 | Ga0207669_110403271 | 87 |
| 513 | 3300025937 | Ga0207669_11065469 | Ga0207669_110654692 | 87 |
| 514 | 3300025937 | Ga0207669_11438889 | Ga0207669_114388891 | 87 |
| 515 | 3300025938 | Ga0207704_10002110 | Ga0207704_100021109 | 87 |
| 516 | 3300025938 | Ga0207704_10083955 | Ga0207704_100839552 | 87 |
| 517 | 3300025938 | Ga0207704_11259563 | Ga0207704_112595632 | 87 |
| 518 | 3300025939 | Ga0207665_10047629 | Ga0207665_100476293 | 87 |
| 519 | 3300025939 | Ga0207665_11688697 | Ga0207665_116886971 | 87 |
| 520 | 3300025940 | Ga0207691_10170188 | Ga0207691_101701882 | 87 |
| 521 | 3300025940 | Ga0207691_10412639 | Ga0207691_104126393 | 87 |
| 522 | 3300025941 | Ga0207711_10188004 | Ga0207711_101880042 | 87 |
| 523 | 3300025941 | Ga0207711_10284621 | Ga0207711_102846211 | 87 |
| 524 | 3300025941 | Ga0207711_10304497 | Ga0207711_103044973 | 87 |
| 525 | 3300025941 | Ga0207711_10977781 | Ga0207711_109777811 | 87 |
| 526 | 3300025941 | Ga0207711_11364419 | Ga0207711_113644191 | 87 |
| 527 | 3300025942 | Ga0207689_10064532 | Ga0207689_100645322 | 87 |
| 528 | 3300025942 | Ga0207689_10153100 | Ga0207689_101531001 | 87 |
| 529 | 3300025942 | Ga0207689_11443332 | Ga0207689_114433321 | 87 |
| 530 | 3300025944 | Ga0207661_10007239 | Ga0207661_100072396 | 87 |
| 531 | 3300025944 | Ga0207661_10398856 | Ga0207661_103988563 | 87 |
| 532 | 3300025944 | Ga0207661_10522415 | Ga0207661_105224152 | 87 |
| 533 | 3300025944 | Ga0207661_10786654 | Ga0207661_107866542 | 87 |
| 534 | 3300025944 | Ga0207661_10797259 | Ga0207661_107972592 | 87 |
| 535 | 3300025944 | Ga0207661_11114765 | Ga0207661_111147652 | 87 |
| 536 | 3300025944 | Ga0207661_11497688 | Ga0207661_114976881 | 87 |
| 537 | 3300025945 | Ga0207679_10131913 | Ga0207679_101319132 | 87 |
| 538 | 3300025945 | Ga0207679_10734981 | Ga0207679_107349812 | 87 |
| 539 | 3300025945 | Ga0207679_11149697 | Ga0207679_111496972 | 87 |
| 540 | 3300025945 | Ga0207679_12005472 | Ga0207679_120054721 | 87 |
| 541 | 3300025949 | Ga0207667_10014735 | Ga0207667_100147355 | 87 |
| 542 | 3300025949 | Ga0207667_10071035 | Ga0207667_100710352 | 87 |
| 543 | 3300025949 | Ga0207667_10278952 | Ga0207667_102789522 | 87 |
| 544 | 3300025949 | Ga0207667_10381461 | Ga0207667_103814612 | 87 |
| 545 | 3300025949 | Ga0207667_10472124 | Ga0207667_104721242 | 87 |
| 546 | 3300025949 | Ga0207667_10652743 | Ga0207667_106527432 | 87 |
| 547 | 3300025960 | Ga0207651_10257990 | Ga0207651_102579901 | 87 |
| 548 | 3300025960 | Ga0207651_10328927 | Ga0207651_103289272 | 87 |
| 549 | 3300025960 | Ga0207651_10854940 | Ga0207651_108549402 | 87 |
| 550 | 3300025960 | Ga0207651_10986231 | Ga0207651_109862312 | 87 |
| 551 | 3300025960 | Ga0207651_11570052 | Ga0207651_115700521 | 87 |
| 552 | 3300025961 | Ga0207712_10049053 | Ga0207712_100490532 | 87 |
| 553 | 3300025961 | Ga0207712_10751797 | Ga0207712_107517972 | 87 |
| 554 | 3300025961 | Ga0207712_10831429 | Ga0207712_108314291 | 87 |
| 555 | 3300025961 | Ga0207712_11031570 | Ga0207712_110315702 | 87 |
| 556 | 3300025961 | Ga0207712_11409175 | Ga0207712_114091752 | 87 |
| 557 | 3300025972 | Ga0207668_10422558 | Ga0207668_104225582 | 87 |
| 558 | 3300025981 | Ga0207640_10035199 | Ga0207640_100351992 | 87 |
| 559 | 3300025981 | Ga0207640_10209330 | Ga0207640_102093302 | 87 |
| 560 | 3300025981 | Ga0207640_10320503 | Ga0207640_103205032 | 87 |
| 561 | 3300025981 | Ga0207640_10473701 | Ga0207640_104737011 | 87 |
| 562 | 3300025981 | Ga0207640_10503988 | Ga0207640_105039881 | 87 |
| 563 | 3300025981 | Ga0207640_10616488 | Ga0207640_106164881 | 87 |
| 564 | 3300025981 | Ga0207640_11648689 | Ga0207640_116486892 | 87 |
| 565 | 3300025986 | Ga0207658_11052806 | Ga0207658_110528062 | 87 |
| 566 | 3300025986 | Ga0207658_12037101 | Ga0207658_120371012 | 87 |
| 567 | 3300026023 | Ga0207677_10029819 | Ga0207677_100298192 | 87 |
| 568 | 3300026023 | Ga0207677_10041071 | Ga0207677_100410714 | 87 |
| 569 | 3300026023 | Ga0207677_10134929 | Ga0207677_101349292 | 87 |
| 570 | 3300026035 | Ga0207703_10054226 | Ga0207703_100542264 | 87 |
| 571 | 3300026035 | Ga0207703_10194060 | Ga0207703_101940602 | 87 |
| 572 | 3300026035 | Ga0207703_11038658 | Ga0207703_110386582 | 87 |
| 573 | 3300026041 | Ga0207639_10168366 | Ga0207639_101683662 | 87 |
| 574 | 3300026041 | Ga0207639_10412337 | Ga0207639_104123372 | 87 |
| 575 | 3300026041 | Ga0207639_11178178 | Ga0207639_111781782 | 87 |
| 576 | 3300026067 | Ga0207678_10028844 | Ga0207678_100288442 | 87 |
| 577 | 3300026067 | Ga0207678_10461043 | Ga0207678_104610432 | 87 |
| 578 | 3300026067 | Ga0207678_10572544 | Ga0207678_105725442 | 87 |
| 579 | 3300026067 | Ga0207678_10860238 | Ga0207678_108602382 | 87 |
| 580 | 3300026075 | Ga0207708_10001783 | Ga0207708_100017838 | 87 |
| 581 | 3300026075 | Ga0207708_10022225 | Ga0207708_100222254 | 87 |
| 582 | 3300026075 | Ga0207708_10449974 | Ga0207708_104499742 | 87 |
| 583 | 3300026075 | Ga0207708_10726645 | Ga0207708_107266452 | 87 |
| 584 | 3300026078 | Ga0207702_10006756 | Ga0207702_100067569 | 87 |
| 585 | 3300026078 | Ga0207702_10029006 | Ga0207702_100290063 | 87 |
| 586 | 3300026078 | Ga0207702_10043354 | Ga0207702_100433544 | 87 |
| 587 | 3300026078 | Ga0207702_10108322 | Ga0207702_101083224 | 87 |
| 588 | 3300026078 | Ga0207702_10120971 | Ga0207702_101209712 | 87 |
| 589 | 3300026078 | Ga0207702_10251169 | Ga0207702_102511692 | 87 |
| 590 | 3300026078 | Ga0207702_10499984 | Ga0207702_104999843 | 87 |
| 591 | 3300026088 | Ga0207641_10505792 | Ga0207641_105057922 | 87 |
| 592 | 3300026088 | Ga0207641_11012330 | Ga0207641_110123302 | 87 |
| 593 | 3300026089 | Ga0207648_10002707 | Ga0207648_100027079 | 87 |
| 594 | 3300026089 | Ga0207648_10147193 | Ga0207648_101471933 | 87 |
| 595 | 3300026089 | Ga0207648_10279515 | Ga0207648_102795153 | 87 |
| 596 | 3300026089 | Ga0207648_10380207 | Ga0207648_103802072 | 87 |
| 597 | 3300026089 | Ga0207648_11128089 | Ga0207648_111280892 | 87 |
| 598 | 3300026089 | Ga0207648_11488528 | Ga0207648_114885282 | 87 |
| 599 | 3300026095 | Ga0207676_10810236 | Ga0207676_108102361 | 87 |
| 600 | 3300026095 | Ga0207676_10904023 | Ga0207676_109040231 | 87 |
| 601 | 3300026095 | Ga0207676_12378160 | Ga0207676_123781602 | 87 |
| 602 | 3300026116 | Ga0207674_11861390 | Ga0207674_118613901 | 87 |
| 603 | 3300026118 | Ga0207675_100319986 | Ga0207675_1003199862 | 87 |
| 604 | 3300026118 | Ga0207675_100708291 | Ga0207675_1007082911 | 87 |
| 605 | 3300026118 | Ga0207675_101319701 | Ga0207675_1013197012 | 87 |
| 606 | 3300026121 | Ga0207683_10000699 | Ga0207683_1000069928 | 87 |
| 607 | 3300026121 | Ga0207683_10020326 | Ga0207683_100203265 | 87 |
| 608 | 3300026121 | Ga0207683_10038254 | Ga0207683_100382549 | 87 |
| 609 | 3300026121 | Ga0207683_10042579 | Ga0207683_100425795 | 87 |
| 610 | 3300026121 | Ga0207683_10095111 | Ga0207683_100951113 | 87 |
| 611 | 3300026121 | Ga0207683_10149892 | Ga0207683_101498921 | 87 |
| 612 | 3300026121 | Ga0207683_11027164 | Ga0207683_110271642 | 87 |
| 613 | 3300026121 | Ga0207683_11451711 | Ga0207683_114517111 | 87 |
| 614 | 3300026121 | Ga0207683_11610444 | Ga0207683_116104442 | 87 |
| 615 | 3300026121 | Ga0207683_12009757 | Ga0207683_120097572 | 87 |
| 616 | 3300026142 | Ga0207698_10095146 | Ga0207698_100951463 | 87 |
| 617 | 3300026142 | Ga0207698_10149617 | Ga0207698_101496174 | 87 |
| 618 | 3300028379 | Ga0268266_10093455 | Ga0268266_100934552 | 87 |
| 619 | 3300028379 | Ga0268266_11662482 | Ga0268266_116624821 | 87 |
| 620 | 3300028380 | Ga0268265_10248599 | Ga0268265_102485992 | 87 |
| 621 | 3300028380 | Ga0268265_10280885 | Ga0268265_102808852 | 87 |
| 622 | 3300028381 | Ga0268264_10166989 | Ga0268264_101669892 | 87 |
| 623 | 3300028381 | Ga0268264_10174346 | Ga0268264_101743463 | 87 |
| 624 | 3300028381 | Ga0268264_10278200 | Ga0268264_102782002 | 87 |
| 625 | 3300028381 | Ga0268264_11772661 | Ga0268264_117726612 | 87 |
| 626 | 3300028558 | Ga0265326_10004431 | Ga0265326_100044312 | 87 |
| 627 | 3300028563 | Ga0265319_1039859 | Ga0265319_10398591 | 87 |
| 628 | 3300028563 | Ga0265319_1183755 | Ga0265319_11837552 | 87 |
| 629 | 3300028573 | Ga0265334_10002745 | Ga0265334_100027453 | 87 |
| 630 | 3300028573 | Ga0265334_10063249 | Ga0265334_100632493 | 87 |
| 631 | 3300028577 | Ga0265318_10003154 | Ga0265318_100031548 | 87 |
| 632 | 3300028653 | Ga0265323_10052375 | Ga0265323_100523751 | 87 |
| 633 | 3300028800 | Ga0265338_10011051 | Ga0265338_100110515 | 87 |
| 634 | 3300028800 | Ga0265338_10049930 | Ga0265338_100499301 | 87 |
| 635 | 3300028800 | Ga0265338_10252698 | Ga0265338_102526982 | 87 |
| 636 | 3300029957 | Ga0265324_10047255 | Ga0265324_100472552 | 87 |
| 637 | 3300031235 | Ga0265330_10003366 | Ga0265330_100033669 | 87 |
| 638 | 3300031238 | Ga0265332_10015422 | Ga0265332_100154225 | 87 |
| 639 | 3300031238 | Ga0265332_10496749 | Ga0265332_104967491 | 87 |
| 640 | 3300031239 | Ga0265328_10004140 | Ga0265328_100041402 | 87 |
| 641 | 3300031240 | Ga0265320_10291301 | Ga0265320_102913012 | 87 |
| 642 | 3300031241 | Ga0265325_10007375 | Ga0265325_100073752 | 87 |
| 643 | 3300031242 | Ga0265329_10010827 | Ga0265329_100108274 | 87 |
| 644 | 3300031247 | Ga0265340_10003923 | Ga0265340_100039234 | 87 |
| 645 | 3300031250 | Ga0265331_10032605 | Ga0265331_100326052 | 87 |
| 646 | 3300031251 | Ga0265327_10008410 | Ga0265327_100084103 | 87 |
| 647 | 3300031251 | Ga0265327_10141872 | Ga0265327_101418721 | 87 |
| 648 | 3300031344 | Ga0265316_10069891 | Ga0265316_100698914 | 87 |
| 649 | 3300031548 | Ga0307408_100562109 | Ga0307408_1005621091 | 87 |
| 650 | 3300031548 | Ga0307408_102093537 | Ga0307408_1020935372 | 87 |
| 651 | 3300031595 | Ga0265313_10005872 | Ga0265313_100058729 | 87 |
| 652 | 3300031711 | Ga0265314_10076599 | Ga0265314_100765994 | 87 |
| 653 | 3300031712 | Ga0265342_10060378 | Ga0265342_100603782 | 87 |
| 654 | 3300031712 | Ga0265342_10082671 | Ga0265342_100826711 | 87 |
| 655 | 3300031731 | Ga0307405_10309853 | Ga0307405_103098532 | 87 |
| 656 | 3300031824 | Ga0307413_10150376 | Ga0307413_101503762 | 87 |
| 657 | 3300031852 | Ga0307410_10133577 | Ga0307410_101335773 | 87 |
| 658 | 3300031901 | Ga0307406_10890562 | Ga0307406_108905622 | 87 |
| 659 | 3300031901 | Ga0307406_11806593 | Ga0307406_118065932 | 87 |
| 660 | 3300031903 | Ga0307407_10079347 | Ga0307407_100793472 | 87 |
| 661 | 3300031911 | Ga0307412_11090809 | Ga0307412_110908092 | 87 |
| 662 | 3300031995 | Ga0307409_100060984 | Ga0307409_1000609842 | 87 |
| 663 | 3300031995 | Ga0307409_100390166 | Ga0307409_1003901662 | 87 |
| 664 | 3300031995 | Ga0307409_101091193 | Ga0307409_1010911931 | 87 |
| 665 | 3300032002 | Ga0307416_100777964 | Ga0307416_1007779642 | 87 |
| 666 | 3300032002 | Ga0307416_102108532 | Ga0307416_1021085322 | 87 |
| 667 | 3300032002 | Ga0307416_103728462 | Ga0307416_1037284622 | 87 |
| 668 | 3300035086 | Ga0373934_0063858 | Ga0373934_0063858_853_1116 | 87 |
| 669 | 3300035088 | Ga0373940_0320095 | Ga0373940_0320095_141_404 | 87 |
| 670 | 3300035089 | Ga0373944_0006456 | Ga0373944_0006456_1738_2001 | 87 |
| 671 | 3300035111 | Ga0373923_0023565 | Ga0373923_0023565_186_449 | 87 |
| 672 | 3300035112 | Ga0373932_0405959 | Ga0373932_0405959_251_514 | 87 |
| 673 | 3300035113 | Ga0373936_0026574 | Ga0373936_0026574_295_558 | 87 |
| 674 | 3300035115 | Ga0373941_0097663 | Ga0373941_0097663_736_999 | 87 |
| 675 | 3300035115 | Ga0373941_0403348 | Ga0373941_0403348_36_299 | 87 |
| 676 | 3300035116 | Ga0373945_0005948 | Ga0373945_0005948_1069_1332 | 87 |
| 677 | 3300035116 | Ga0373945_0347016 | Ga0373945_0347016_265_528 | 87 |
| 678 | 3300035119 | Ga0373956_0060749 | Ga0373956_0060749_10_273 | 87 |
| 679 | 3300035170 | Ga0373943_0001876 | Ga0373943_0001876_1226_1489 | 87 |
| 680 | 3300035170 | Ga0373943_0055277 | Ga0373943_0055277_1201_1464 | 87 |
| 681 | 3300035170 | Ga0373943_0574757 | Ga0373943_0574757_304_567 | 87 |
| 682 | 3300035171 | Ga0373946_0061295 | Ga0373946_0061295_13_276 | 87 |
| 683 | 3300035172 | Ga0373955_0316646 | Ga0373955_0316646_61_324 | 87 |
| 684 | 3300035207 | Ga0373942_0311451 | Ga0373942_0311451_243_506 | 87 |
| 685 | 3300035410 | Ga0373924_0022475 | Ga0373924_0022475_495_758 | 87 |
| 686 | 3300035691 | Ga0373931_1287311 | Ga0373931_1287311_222_485 | 87 |
| 687 | 3300035692 | Ga0373935_0023556 | Ga0373935_0023556_585_848 | 87 |
| 688 | 3300035692 | Ga0373935_0811979 | Ga0373935_0811979_14_277 | 87 |
| 689 | 3300035695 | Ga0373927_0015218 | Ga0373927_0015218_516_779 | 87 |
| 690 | 3300035695 | Ga0373927_0461873 | Ga0373927_0461873_46_309 | 87 |
| 691 | 3300035724 | Ga0373933_0172615 | Ga0373933_0172615_114_377 | 87 |
| 692 | 3300035725 | Ga0373947_0005562 | Ga0373947_0005562_1157_1420 | 87 |
| 693 | 3300035725 | Ga0373947_0188339 | Ga0373947_0188339_925_1188 | 87 |
| 694 | 3300035725 | Ga0373947_0467779 | Ga0373947_0467779_217_480 | 87 |
| 695 | 3300035725 | Ga0373947_0741252 | Ga0373947_0741252_287_550 | 87 |
| 696 | 3300036401 | Ga0373937_0030848 | Ga0373937_0030848_4485_4748 | 87 |
| 697 | 3300037068 | Ga0373925_0006097 | Ga0373925_0006097_5821_6084 | 87 |
| 698 | 3300037068 | Ga0373925_0077407 | Ga0373925_0077407_1211_1474 | 87 |
| 699 | 3300037312 | Ga0395899_0006013 | Ga0395899_0006013_8649_8912 | 87 |
| 700 | 3300037312 | Ga0395899_0010325 | Ga0395899_0010325_6509_6772 | 87 |
| 701 | 3300037312 | Ga0395899_0018595 | Ga0395899_0018595_860_1123 | 87 |
| 702 | 3300037312 | Ga0395899_0019784 | Ga0395899_0019784_1591_1854 | 87 |
| 703 | 3300037312 | Ga0395899_0021385 | Ga0395899_0021385_1090_1353 | 87 |
| 704 | 3300037312 | Ga0395899_0034223 | Ga0395899_0034223_3279_3542 | 87 |
| 705 | 3300037312 | Ga0395899_0919223 | Ga0395899_0919223_203_466 | 87 |
| 706 | 3300037418 | Ga0395900_0005086 | Ga0395900_0005086_1130_1393 | 87 |
| 707 | 3300037418 | Ga0395900_0030800 | Ga0395900_0030800_4279_4542 | 87 |
| 708 | 3300037418 | Ga0395900_0040417 | Ga0395900_0040417_2912_3175 | 87 |
| 709 | 3300037418 | Ga0395900_0071158 | Ga0395900_0071158_1804_2067 | 87 |
| 710 | 3300037418 | Ga0395900_0105601 | Ga0395900_0105601_2214_2477 | 87 |
| 711 | 3300037418 | Ga0395900_0123245 | Ga0395900_0123245_2082_2345 | 87 |
| 712 | 3300037418 | Ga0395900_0141996 | Ga0395900_0141996_757_1026 | 87 |
| 713 | 3300037418 | Ga0395900_0519651 | Ga0395900_0519651_194_457 | 87 |
| 714 | 3300037418 | Ga0395900_0581837 | Ga0395900_0581837_661_924 | 87 |
| 715 | 3300037418 | Ga0395900_0885359 | Ga0395900_0885359_413_676 | 87 |
| 716 | 3300037418 | Ga0395900_1785947 | Ga0395900_1785947_173_436 | 87 |
| 717 | 3300037466 | Ga0395898_0004841 | Ga0395898_0004841_4644_4907 | 87 |
| 718 | 3300037466 | Ga0395898_0015334 | Ga0395898_0015334_1481_1744 | 87 |
| 719 | 3300037466 | Ga0395898_0015934 | Ga0395898_0015934_7262_7525 | 87 |
| 720 | 3300037466 | Ga0395898_0052076 | Ga0395898_0052076_2416_2679 | 87 |
| 721 | 3300037466 | Ga0395898_0060561 | Ga0395898_0060561_501_764 | 87 |
| 722 | 3300037466 | Ga0395898_0230569 | Ga0395898_0230569_495_758 | 87 |
| 723 | 3300037466 | Ga0395898_0389713 | Ga0395898_0389713_625_888 | 87 |
| 724 | 3300037466 | Ga0395898_1352261 | Ga0395898_1352261_246_509 | 87 |
| 725 | 3300037466 | Ga0395898_1646242 | Ga0395898_1646242_45_308 | 87 |
| 726 | 3300037466 | Ga0395898_1718011 | Ga0395898_1718011_144_407 | 87 |
| 727 | 3300037471 | Ga0395905_0006168 | Ga0395905_0006168_11078_11341 | 87 |
| 728 | 3300037471 | Ga0395905_0011152 | Ga0395905_0011152_245_508 | 87 |
| 729 | 3300037471 | Ga0395905_0027947 | Ga0395905_0027947_3623_3886 | 87 |
| 730 | 3300037471 | Ga0395905_0064124 | Ga0395905_0064124_840_1103 | 87 |
| 731 | 3300037471 | Ga0395905_0088822 | Ga0395905_0088822_1445_1714 | 87 |
| 732 | 3300037471 | Ga0395905_0131753 | Ga0395905_0131753_804_1067 | 87 |
| 733 | 3300037471 | Ga0395905_0146092 | Ga0395905_0146092_270_533 | 87 |
| 734 | 3300037471 | Ga0395905_0162955 | Ga0395905_0162955_111_374 | 87 |
| 735 | 3300037471 | Ga0395905_0286674 | Ga0395905_0286674_1062_1325 | 87 |
| 736 | 3300037471 | Ga0395905_0378826 | Ga0395905_0378826_343_606 | 87 |
| 737 | 3300037471 | Ga0395905_0476674 | Ga0395905_0476674_857_1120 | 87 |
| 738 | 3300037471 | Ga0395905_0570849 | Ga0395905_0570849_680_943 | 87 |
| 739 | 3300037471 | Ga0395905_1557512 | Ga0395905_1557512_213_476 | 87 |
| 740 | 3300038443 | Ga0395901_0002976 | Ga0395901_0002976_1068_1331 | 87 |
| 741 | 3300038443 | Ga0395901_0004555 | Ga0395901_0004555_9686_9949 | 87 |
| 742 | 3300038443 | Ga0395901_0012209 | Ga0395901_0012209_2402_2665 | 87 |
| 743 | 3300038443 | Ga0395901_0032039 | Ga0395901_0032039_1163_1426 | 87 |
| 744 | 3300038443 | Ga0395901_0074131 | Ga0395901_0074131_2653_2916 | 87 |
| 745 | 3300038443 | Ga0395901_0126740 | Ga0395901_0126740_2365_2628 | 87 |
| 746 | 3300038443 | Ga0395901_0137165 | Ga0395901_0137165_1352_1615 | 87 |
| 747 | 3300038443 | Ga0395901_0138741 | Ga0395901_0138741_2149_2418 | 87 |
| 748 | 3300038443 | Ga0395901_0149601 | Ga0395901_0149601_209_472 | 87 |
| 749 | 3300038443 | Ga0395901_0269273 | Ga0395901_0269273_1232_1507 | 87 |
| 750 | 3300038443 | Ga0395901_0285109 | Ga0395901_0285109_1265_1528 | 87 |
| 751 | 3300038443 | Ga0395901_1501230 | Ga0395901_1501230_135_398 | 87 |
| 752 | 3300038443 | Ga0395901_1670391 | Ga0395901_1670391_40_303 | 87 |
| 753 | 3300039438 | Ga0436360_1209873 | Ga0436360_1209873_256_519 | 87 |
| 754 | 3300039447 | Ga0436361_0026300 | Ga0436361_0026300_223_486 | 87 |
| 755 | 3300039450 | Ga0436363_0518779 | Ga0436363_0518779_256_519 | 87 |
| 756 | 3300041443 | Ga0451789_0380733 | Ga0451789_0380733_121_384 | 87 |
| 757 | 3300041452 | Ga0451793_1706676 | Ga0451793_1706676_212_475 | 87 |
| 758 | 3300041460 | Ga0451802_0705323 | Ga0451802_0705323_231_494 | 87 |
| 759 | 3300041492 | Ga0451835_0621129 | Ga0451835_0621129_12_275 | 87 |
| 760 | 3300041496 | Ga0451839_1641712 | Ga0451839_1641712_159_422 | 87 |
| 761 | 3300041512 | Ga0451853_0117807 | Ga0451853_0117807_122_388 | 87 |
| 762 | 3300041512 | Ga0451853_3775861 | Ga0451853_3775861_344_607 | 87 |
| 763 | 3300042001 | Ga0439441_014949 | Ga0439441_014949_348_611 | 87 |
| 764 | 3300042005 | Ga0439448_0173777 | Ga0439448_0173777_102_365 | 87 |
| 765 | 3300042122 | Ga0450920_121881 | Ga0450920_121881_149_412 | 87 |
| 766 | 3300042146 | Ga0450907_025673 | Ga0450907_025673_681_944 | 87 |
| 767 | 3300042439 | Ga0439464_0251447 | Ga0439464_0251447_277_540 | 87 |
| 768 | 3300042876 | Ga0451577_1463288 | Ga0451577_1463288_160_423 | 87 |
| 769 | 3300044656 | Ga0466969_0019364 | Ga0466969_0019364_2970_3233 | 87 |
| 770 | 3300044656 | Ga0466969_0042798 | Ga0466969_0042798_951_1214 | 87 |
| 771 | 3300044656 | Ga0466969_0106436 | Ga0466969_0106436_826_1089 | 87 |
| 772 | 3300044658 | Ga0466972_0273988 | Ga0466972_0273988_298_561 | 87 |
| 773 | 3300044683 | Ga0466965_0604843 | Ga0466965_0604843_133_396 | 87 |
| 774 | 3300044684 | Ga0466966_0101649 | Ga0466966_0101649_1465_1728 | 87 |
| 775 | 3300044684 | Ga0466966_0203378 | Ga0466966_0203378_134_400 | 87 |
| 776 | 3300044684 | Ga0466966_0273398 | Ga0466966_0273398_720_983 | 87 |
| 777 | 3300044684 | Ga0466966_0790636 | Ga0466966_0790636_192_455 | 87 |
| 778 | 3300044693 | Ga0466961_0072060 | Ga0466961_0072060_1022_1285 | 87 |
| 779 | 3300044693 | Ga0466961_0149887 | Ga0466961_0149887_816_1079 | 87 |
| 780 | 3300044693 | Ga0466961_0755438 | Ga0466961_0755438_154_417 | 87 |
| 781 | 3300044694 | Ga0466963_0009099 | Ga0466963_0009099_4518_4781 | 87 |
| 782 | 3300044694 | Ga0466963_0490667 | Ga0466963_0490667_486_749 | 87 |
| 783 | 3300044706 | Ga0466964_0079595 | Ga0466964_0079595_658_924 | 87 |
| 784 | 3300044706 | Ga0466964_0194053 | Ga0466964_0194053_277_540 | 87 |
| 785 | 3300044712 | Ga0453684_1382627 | Ga0453684_1382627_439_702 | 87 |
| 786 | 3300044719 | Ga0466971_0116994 | Ga0466971_0116994_875_1138 | 87 |
| 787 | 3300044735 | Ga0466968_0024836 | Ga0466968_0024836_370_633 | 87 |
| 788 | 3300044735 | Ga0466968_0325614 | Ga0466968_0325614_168_431 | 87 |
| 789 | 3300044842 | Ga0466957_0088704 | Ga0466957_0088704_1644_1907 | 87 |
| 790 | 3300044901 | Ga0466960_0152888 | Ga0466960_0152888_85_348 | 87 |
| 791 | 3300044901 | Ga0466960_0515195 | Ga0466960_0515195_393_659 | 87 |
| 792 | 3300045049 | Ga0466959_0014947 | Ga0466959_0014947_528_791 | 87 |
| 793 | 3300045049 | Ga0466959_0037335 | Ga0466959_0037335_303_566 | 87 |
| 794 | 3300045049 | Ga0466959_0205622 | Ga0466959_0205622_35_298 | 87 |
| 795 | 3300045051 | Ga0451576_1824563 | Ga0451576_1824563_182_445 | 87 |
| 796 | 3300045836 | Ga0466958_0029671 | Ga0466958_0029671_1243_1506 | 87 |
| 797 | 3300045836 | Ga0466958_0037298 | Ga0466958_0037298_1357_1620 | 87 |
| 798 | 3300045976 | Ga0466967_0020616 | Ga0466967_0020616_238_501 | 87 |
| 799 | 3300045976 | Ga0466967_0036183 | Ga0466967_0036183_89_352 | 87 |
| 800 | 3300045976 | Ga0466967_0038364 | Ga0466967_0038364_171_434 | 87 |
| 801 | 3300045976 | Ga0466967_0044354 | Ga0466967_0044354_2530_2793 | 87 |
| 802 | 3300045976 | Ga0466967_0085141 | Ga0466967_0085141_1915_2178 | 87 |
| 803 | 3300045976 | Ga0466967_0167800 | Ga0466967_0167800_203_466 | 87 |
| 804 | 3300045976 | Ga0466967_0194932 | Ga0466967_0194932_1577_1840 | 87 |
| 805 | 3300045976 | Ga0466967_2451757 | Ga0466967_2451757_25_291 | 87 |
| 806 | 3300046454 | Ga0495592_0092780 | Ga0495592_0092780_1725_1988 | 87 |
| 807 | 3300046454 | Ga0495592_0371206 | Ga0495592_0371206_107_370 | 87 |
| 808 | 3300046455 | Ga0495603_0051729 | Ga0495603_0051729_1864_2127 | 87 |
| 809 | 3300046455 | Ga0495603_0387355 | Ga0495603_0387355_82_345 | 87 |
| 810 | 3300046459 | Ga0495629_0027827 | Ga0495629_0027827_274_537 | 87 |
| 811 | 3300046459 | Ga0495629_0135213 | Ga0495629_0135213_948_1211 | 87 |
| 812 | 3300046459 | Ga0495629_0165592 | Ga0495629_0165592_51_314 | 87 |
| 813 | 3300046459 | Ga0495629_0252963 | Ga0495629_0252963_521_784 | 87 |
| 814 | 3300046459 | Ga0495629_1022820 | Ga0495629_1022820_252_515 | 87 |
| 815 | 3300046459 | Ga0495629_1028762 | Ga0495629_1028762_15_278 | 87 |
| 816 | 3300046461 | Ga0495641_0003765 | Ga0495641_0003765_5502_5765 | 87 |
| 817 | 3300046461 | Ga0495641_0107080 | Ga0495641_0107080_686_949 | 87 |
| 818 | 3300046461 | Ga0495641_0122006 | Ga0495641_0122006_63_326 | 87 |
| 819 | 3300046462 | Ga0495651_0095140 | Ga0495651_0095140_922_1185 | 87 |
| 820 | 3300046462 | Ga0495651_0404239 | Ga0495651_0404239_552_815 | 87 |
| 821 | 3300046462 | Ga0495651_0683285 | Ga0495651_0683285_241_504 | 87 |
| 822 | 3300046463 | Ga0495653_0005235 | Ga0495653_0005235_6018_6281 | 87 |
| 823 | 3300046472 | Ga0495580_0326341 | Ga0495580_0326341_87_350 | 87 |
| 824 | 3300046472 | Ga0495580_0788469 | Ga0495580_0788469_274_537 | 87 |
| 825 | 3300046473 | Ga0495582_0002392 | Ga0495582_0002392_4438_4701 | 87 |
| 826 | 3300046473 | Ga0495582_0061575 | Ga0495582_0061575_1601_1864 | 87 |
| 827 | 3300046473 | Ga0495582_0148979 | Ga0495582_0148979_70_333 | 87 |
| 828 | 3300046473 | Ga0495582_0149991 | Ga0495582_0149991_92_355 | 87 |
| 829 | 3300046473 | Ga0495582_0431465 | Ga0495582_0431465_13_276 | 87 |
| 830 | 3300046473 | Ga0495582_0768032 | Ga0495582_0768032_15_278 | 87 |
| 831 | 3300046474 | Ga0495605_0226241 | Ga0495605_0226241_437_700 | 87 |
| 832 | 3300046474 | Ga0495605_0233847 | Ga0495605_0233847_505_768 | 87 |
| 833 | 3300046475 | Ga0495639_0002167 | Ga0495639_0002167_6939_7202 | 87 |
| 834 | 3300046475 | Ga0495639_0042740 | Ga0495639_0042740_798_1061 | 87 |
| 835 | 3300046475 | Ga0495639_0613859 | Ga0495639_0613859_144_407 | 87 |
| 836 | 3300046476 | Ga0495662_0032603 | Ga0495662_0032603_994_1257 | 87 |
| 837 | 3300046476 | Ga0495662_0104749 | Ga0495662_0104749_710_973 | 87 |
| 838 | 3300046476 | Ga0495662_0440127 | Ga0495662_0440127_261_524 | 87 |
| 839 | 3300046477 | Ga0495664_0107281 | Ga0495664_0107281_931_1194 | 87 |
| 840 | 3300046491 | Ga0495584_0120605 | Ga0495584_0120605_355_618 | 87 |
| 841 | 3300046491 | Ga0495584_0253988 | Ga0495584_0253988_497_820 | 87 |
| 842 | 3300046492 | Ga0495585_0143746 | Ga0495585_0143746_56_319 | 87 |
| 843 | 3300046499 | Ga0495594_0004059 | Ga0495594_0004059_438_701 | 87 |
| 844 | 3300046499 | Ga0495594_0109794 | Ga0495594_0109794_704_967 | 87 |
| 845 | 3300046499 | Ga0495594_0136226 | Ga0495594_0136226_379_642 | 87 |
| 846 | 3300046499 | Ga0495594_0649606 | Ga0495594_0649606_34_297 | 87 |
| 847 | 3300046499 | Ga0495594_0810808 | Ga0495594_0810808_208_471 | 87 |
| 848 | 3300046511 | Ga0495608_0006095 | Ga0495608_0006095_6567_6830 | 87 |
| 849 | 3300046514 | Ga0495618_0004507 | Ga0495618_0004507_1184_1447 | 87 |
| 850 | 3300046516 | Ga0495628_0072630 | Ga0495628_0072630_2281_2544 | 87 |
| 851 | 3300046516 | Ga0495628_0388405 | Ga0495628_0388405_436_699 | 87 |
| 852 | 3300046517 | Ga0495630_0003907 | Ga0495630_0003907_5593_5856 | 87 |
| 853 | 3300046517 | Ga0495630_0051113 | Ga0495630_0051113_2463_2726 | 87 |
| 854 | 3300046517 | Ga0495630_0221660 | Ga0495630_0221660_85_348 | 87 |
| 855 | 3300046517 | Ga0495630_1186127 | Ga0495630_1186127_270_533 | 87 |
| 856 | 3300046518 | Ga0495631_0175973 | Ga0495631_0175973_576_839 | 87 |
| 857 | 3300046518 | Ga0495631_0458531 | Ga0495631_0458531_202_465 | 87 |
| 858 | 3300046523 | Ga0495644_0120273 | Ga0495644_0120273_293_556 | 87 |
| 859 | 3300046523 | Ga0495644_0207396 | Ga0495644_0207396_345_608 | 87 |
| 860 | 3300046523 | Ga0495644_0407523 | Ga0495644_0407523_50_313 | 87 |
| 861 | 3300046526 | Ga0495666_0091585 | Ga0495666_0091585_536_799 | 87 |
| 862 | 3300046526 | Ga0495666_0192538 | Ga0495666_0192538_617_880 | 87 |
| 863 | 3300046528 | Ga0495642_0252935 | Ga0495642_0252935_188_451 | 87 |
| 864 | 3300046529 | Ga0495652_0116556 | Ga0495652_0116556_522_785 | 87 |
| 865 | 3300046529 | Ga0495652_0200275 | Ga0495652_0200275_493_756 | 87 |
| 866 | 3300046531 | Ga0495665_0001485 | Ga0495665_0001485_9900_10163 | 87 |
| 867 | 3300046531 | Ga0495665_0014212 | Ga0495665_0014212_2993_3256 | 87 |
| 868 | 3300046533 | Ga0495640_0003074 | Ga0495640_0003074_5492_5755 | 87 |
| 869 | 3300046533 | Ga0495640_0228717 | Ga0495640_0228717_429_692 | 87 |
| 870 | 3300046533 | Ga0495640_0441513 | Ga0495640_0441513_401_664 | 87 |
| 871 | 3300046536 | Ga0495587_0043290 | Ga0495587_0043290_383_646 | 87 |
| 872 | 3300046537 | Ga0495598_0170055 | Ga0495598_0170055_41_304 | 87 |
| 873 | 3300046537 | Ga0495598_0361835 | Ga0495598_0361835_38_301 | 87 |
| 874 | 3300046538 | Ga0495609_0089082 | Ga0495609_0089082_458_721 | 87 |
| 875 | 3300046543 | Ga0495645_0200585 | Ga0495645_0200585_110_373 | 87 |
| 876 | 3300046543 | Ga0495645_0225258 | Ga0495645_0225258_589_852 | 87 |
| 877 | 3300046557 | Ga0495622_0169833 | Ga0495622_0169833_199_462 | 87 |
| 878 | 3300046559 | Ga0495667_0006817 | Ga0495667_0006817_5043_5306 | 87 |
| 879 | 3300046559 | Ga0495667_0968678 | Ga0495667_0968678_149_412 | 87 |
| 880 | 3300046615 | Ga0495656_0098949 | Ga0495656_0098949_1009_1272 | 87 |
| 881 | 3300046615 | Ga0495656_0198459 | Ga0495656_0198459_582_845 | 87 |
| 882 | 3300046615 | Ga0495656_0426621 | Ga0495656_0426621_158_421 | 87 |
| 883 | 3300046615 | Ga0495656_0460713 | Ga0495656_0460713_261_524 | 87 |
| 884 | 3300046615 | Ga0495656_0479664 | Ga0495656_0479664_220_483 | 87 |
| 885 | 3300046616 | Ga0495668_0639610 | Ga0495668_0639610_116_379 | 87 |
| 886 | 3300046642 | Ga0495634_0003097 | Ga0495634_0003097_6136_6399 | 87 |
| 887 | 3300046642 | Ga0495634_0014856 | Ga0495634_0014856_1014_1277 | 87 |
| 888 | 3300046642 | Ga0495634_0031690 | Ga0495634_0031690_1221_1484 | 87 |
| 889 | 3300046642 | Ga0495634_0505940 | Ga0495634_0505940_288_551 | 87 |
| 890 | 3300046663 | Ga0495635_0022878 | Ga0495635_0022878_1153_1416 | 87 |
| 891 | 3300046663 | Ga0495635_0067755 | Ga0495635_0067755_122_385 | 87 |
| 892 | 3300046663 | Ga0495635_0131446 | Ga0495635_0131446_1002_1265 | 87 |
| 893 | 3300046665 | Ga0495661_0220203 | Ga0495661_0220203_617_880 | 87 |
| 894 | 3300046674 | Ga0495588_0017098 | Ga0495588_0017098_2137_2400 | 87 |
| 895 | 3300046674 | Ga0495588_0085922 | Ga0495588_0085922_495_758 | 87 |
| 896 | 3300046674 | Ga0495588_0199384 | Ga0495588_0199384_640_903 | 87 |
| 897 | 3300046674 | Ga0495588_0439639 | Ga0495588_0439639_265_528 | 87 |
| 898 | 3300046675 | Ga0495657_0122511 | Ga0495657_0122511_1144_1407 | 87 |
| 899 | 3300046678 | Ga0495599_0172079 | Ga0495599_0172079_627_890 | 87 |
| 900 | 3300046679 | Ga0495623_0078324 | Ga0495623_0078324_1099_1362 | 87 |
| 901 | 3300046679 | Ga0495623_0575252 | Ga0495623_0575252_286_549 | 87 |
| 902 | 3300046681 | Ga0495647_0000597 | Ga0495647_0000597_9967_10230 | 87 |
| 903 | 3300046681 | Ga0495647_0012783 | Ga0495647_0012783_1030_1293 | 87 |
| 904 | 3300046681 | Ga0495647_0099549 | Ga0495647_0099549_340_603 | 87 |
| 905 | 3300046681 | Ga0495647_0212570 | Ga0495647_0212570_453_716 | 87 |
| 906 | 3300046681 | Ga0495647_0425018 | Ga0495647_0425018_328_591 | 87 |
| 907 | 3300046683 | Ga0495658_0012490 | Ga0495658_0012490_3068_3331 | 87 |
| 908 | 3300046683 | Ga0495658_0534938 | Ga0495658_0534938_463_726 | 87 |
| 909 | 3300046689 | Ga0495613_0005558 | Ga0495613_0005558_3817_4080 | 87 |
| 910 | 3300046689 | Ga0495613_0043999 | Ga0495613_0043999_712_975 | 87 |
| 911 | 3300046689 | Ga0495613_0173605 | Ga0495613_0173605_491_754 | 87 |
| 912 | 3300046690 | Ga0495624_0006496 | Ga0495624_0006496_914_1177 | 87 |
| 913 | 3300046690 | Ga0495624_0011613 | Ga0495624_0011613_5350_5613 | 87 |
| 914 | 3300046690 | Ga0495624_0416550 | Ga0495624_0416550_151_414 | 87 |
| 915 | 3300046690 | Ga0495624_0539623 | Ga0495624_0539623_264_527 | 87 |
| 916 | 3300046691 | Ga0495670_0247954 | Ga0495670_0247954_450_713 | 87 |
| 917 | 3300046691 | Ga0495670_0511229 | Ga0495670_0511229_87_350 | 87 |
| 918 | 3300046692 | Ga0495671_0176532 | Ga0495671_0176532_263_526 | 87 |
| 919 | 3300046794 | Ga0495589_0467220 | Ga0495589_0467220_85_348 | 87 |
| 920 | 3300046809 | Ga0495600_0003143 | Ga0495600_0003143_8412_8675 | 87 |
| 921 | 3300047315 | Ga0495581_0001437 | Ga0495581_0001437_3537_3800 | 87 |
| 922 | 3300047315 | Ga0495581_0003775 | Ga0495581_0003775_5386_5649 | 87 |
| 923 | 3300047315 | Ga0495581_0032656 | Ga0495581_0032656_968_1231 | 87 |
| 924 | 3300047315 | Ga0495581_0068099 | Ga0495581_0068099_1250_1513 | 87 |
| 925 | 3300047317 | Ga0495604_0018043 | Ga0495604_0018043_2939_3202 | 87 |
| 926 | 3300047319 | Ga0495674_0004046 | Ga0495674_0004046_6955_7218 | 87 |
| 927 | 3300047319 | Ga0495674_0029902 | Ga0495674_0029902_110_373 | 87 |
| 928 | 3300047321 | Ga0495676_0016250 | Ga0495676_0016250_3455_3718 | 87 |
| 929 | 3300047321 | Ga0495676_0017412 | Ga0495676_0017412_4272_4535 | 87 |
| 930 | 3300047321 | Ga0495676_0083518 | Ga0495676_0083518_1232_1495 | 87 |
| 931 | 3300047321 | Ga0495676_1076645 | Ga0495676_1076645_79_342 | 87 |
| 932 | 3300047322 | Ga0495680_0012939 | Ga0495680_0012939_2118_2381 | 87 |
| 933 | 3300047322 | Ga0495680_0189204 | Ga0495680_0189204_932_1195 | 87 |
| 934 | 3300047445 | Ga0495677_0218850 | Ga0495677_0218850_121_384 | 87 |
| 935 | 3300047471 | Ga0495684_0002922 | Ga0495684_0002922_12382_12645 | 87 |
| 936 | 3300047471 | Ga0495684_0265396 | Ga0495684_0265396_527_790 | 87 |
| 937 | 3300047673 | Ga0495593_0005440 | Ga0495593_0005440_2941_3204 | 87 |
| 938 | 3300048088 | Ga0495602_0549458 | Ga0495602_0549458_404_667 | 87 |
| 939 | 3300048088 | Ga0495602_0602377 | Ga0495602_0602377_387_650 | 87 |
| 940 | 3300048089 | Ga0495614_0007485 | Ga0495614_0007485_4221_4484 | 87 |
| 941 | 3300048903 | Ga0496100_0001463 | Ga0496100_0001463_5413_5676 | 87 |
| 942 | 3300048903 | Ga0496100_0001838 | Ga0496100_0001838_7221_7484 | 87 |
| 943 | 3300048903 | Ga0496100_0016897 | Ga0496100_0016897_3212_3475 | 87 |
| 944 | 3300048903 | Ga0496100_0030771 | Ga0496100_0030771_2622_2885 | 87 |
| 945 | 3300048903 | Ga0496100_0057468 | Ga0496100_0057468_2219_2482 | 87 |
| 946 | 3300048903 | Ga0496100_0086650 | Ga0496100_0086650_1750_2013 | 87 |
| 947 | 3300048903 | Ga0496100_0103101 | Ga0496100_0103101_1130_1393 | 87 |
| 948 | 3300048903 | Ga0496100_0299958 | Ga0496100_0299958_746_1009 | 87 |
| 949 | 3300048903 | Ga0496100_0812803 | Ga0496100_0812803_305_568 | 87 |
| 950 | 3300048904 | Ga0496101_0001319 | Ga0496101_0001319_4832_5095 | 87 |
| 951 | 3300048904 | Ga0496101_0003443 | Ga0496101_0003443_3961_4224 | 87 |
| 952 | 3300048904 | Ga0496101_0008890 | Ga0496101_0008890_1744_2007 | 87 |
| 953 | 3300048904 | Ga0496101_0010095 | Ga0496101_0010095_2942_3205 | 87 |
| 954 | 3300048904 | Ga0496101_0011879 | Ga0496101_0011879_2866_3129 | 87 |
| 955 | 3300048904 | Ga0496101_0014879 | Ga0496101_0014879_2805_3068 | 87 |
| 956 | 3300048904 | Ga0496101_0017205 | Ga0496101_0017205_212_475 | 87 |
| 957 | 3300048904 | Ga0496101_0034788 | Ga0496101_0034788_2082_2345 | 87 |
| 958 | 3300048904 | Ga0496101_0264692 | Ga0496101_0264692_787_1050 | 87 |
| 959 | 3300048904 | Ga0496101_0685391 | Ga0496101_0685391_174_437 | 87 |
| 960 | 3300048904 | Ga0496101_0984644 | Ga0496101_0984644_268_531 | 87 |
| 961 | 3300048904 | Ga0496101_1292166 | Ga0496101_1292166_27_290 | 87 |
| 962 | 3300048905 | Ga0496102_0002028 | Ga0496102_0002028_4397_4660 | 87 |
| 963 | 3300048905 | Ga0496102_0002197 | Ga0496102_0002197_12415_12678 | 87 |
| 964 | 3300048905 | Ga0496102_0009883 | Ga0496102_0009883_1358_1621 | 87 |
| 965 | 3300048905 | Ga0496102_0021038 | Ga0496102_0021038_1922_2185 | 87 |
| 966 | 3300048905 | Ga0496102_0034991 | Ga0496102_0034991_1282_1545 | 87 |
| 967 | 3300048905 | Ga0496102_0038224 | Ga0496102_0038224_1165_1428 | 87 |
| 968 | 3300048905 | Ga0496102_0123627 | Ga0496102_0123627_2092_2355 | 87 |
| 969 | 3300048905 | Ga0496102_0209187 | Ga0496102_0209187_207_470 | 87 |
| 970 | 3300048905 | Ga0496102_0459717 | Ga0496102_0459717_533_796 | 87 |
| 971 | 3300048905 | Ga0496102_0640824 | Ga0496102_0640824_678_941 | 87 |
| 972 | 3300048905 | Ga0496102_0747895 | Ga0496102_0747895_254_517 | 87 |
| 973 | 3300048905 | Ga0496102_1419754 | Ga0496102_1419754_161_424 | 87 |
| 974 | 3300048905 | Ga0496102_1756911 | Ga0496102_1756911_172_435 | 87 |
| 975 | 3300048906 | Ga0496103_0002459 | Ga0496103_0002459_6225_6488 | 87 |
| 976 | 3300048906 | Ga0496103_0005119 | Ga0496103_0005119_6432_6695 | 87 |
| 977 | 3300048906 | Ga0496103_0042072 | Ga0496103_0042072_2457_2720 | 87 |
| 978 | 3300048906 | Ga0496103_0050758 | Ga0496103_0050758_39_302 | 87 |
| 979 | 3300048906 | Ga0496103_0109477 | Ga0496103_0109477_1172_1435 | 87 |
| 980 | 3300048906 | Ga0496103_0203559 | Ga0496103_0203559_789_1052 | 87 |
| 981 | 3300048907 | Ga0496104_0002034 | Ga0496104_0002034_7564_7827 | 87 |
| 982 | 3300048907 | Ga0496104_0009484 | Ga0496104_0009484_1713_1976 | 87 |
| 983 | 3300048907 | Ga0496104_0027989 | Ga0496104_0027989_4400_4663 | 87 |
| 984 | 3300048907 | Ga0496104_0050038 | Ga0496104_0050038_1573_1836 | 87 |
| 985 | 3300048907 | Ga0496104_0076590 | Ga0496104_0076590_1300_1563 | 87 |
| 986 | 3300048907 | Ga0496104_0093795 | Ga0496104_0093795_839_1102 | 87 |
| 987 | 3300048907 | Ga0496104_0137476 | Ga0496104_0137476_643_906 | 87 |
| 988 | 3300048907 | Ga0496104_0157532 | Ga0496104_0157532_1004_1267 | 87 |
| 989 | 3300048907 | Ga0496104_0157545 | Ga0496104_0157545_788_1051 | 87 |
| 990 | 3300048907 | Ga0496104_0216653 | Ga0496104_0216653_786_1049 | 87 |
| 991 | 3300048907 | Ga0496104_0317370 | Ga0496104_0317370_105_368 | 87 |
| 992 | 3300048907 | Ga0496104_0694903 | Ga0496104_0694903_445_723 | 87 |
| 993 | 3300048908 | Ga0496105_0000050 | Ga0496105_0000050_13532_13795 | 87 |
| 994 | 3300048908 | Ga0496105_0005525 | Ga0496105_0005525_8333_8596 | 87 |
| 995 | 3300048908 | Ga0496105_0017579 | Ga0496105_0017579_4912_5175 | 87 |
| 996 | 3300048908 | Ga0496105_0020971 | Ga0496105_0020971_4101_4364 | 87 |
| 997 | 3300048908 | Ga0496105_0021711 | Ga0496105_0021711_3391_3654 | 87 |
| 998 | 3300048908 | Ga0496105_0074654 | Ga0496105_0074654_900_1163 | 87 |
| 999 | 3300048908 | Ga0496105_0266566 | Ga0496105_0266566_731_994 | 87 |
| 1000 | 3300048908 | Ga0496105_0292343 | Ga0496105_0292343_728_991 | 87 |
| 1001 | 3300048908 | Ga0496105_1030859 | Ga0496105_1030859_70_333 | 87 |
| 1002 | 3300048908 | Ga0496105_1069247 | Ga0496105_1069247_121_384 | 87 |
| 1003 | 3300048909 | Ga0496106_0002042 | Ga0496106_0002042_4757_5020 | 87 |
| 1004 | 3300048909 | Ga0496106_0004053 | Ga0496106_0004053_8038_8301 | 87 |
| 1005 | 3300048909 | Ga0496106_0005239 | Ga0496106_0005239_8755_9018 | 87 |
| 1006 | 3300048909 | Ga0496106_0010325 | Ga0496106_0010325_659_922 | 87 |
| 1007 | 3300048909 | Ga0496106_0012413 | Ga0496106_0012413_439_702 | 87 |
| 1008 | 3300048909 | Ga0496106_0034609 | Ga0496106_0034609_3075_3338 | 87 |
| 1009 | 3300048909 | Ga0496106_0047440 | Ga0496106_0047440_47_310 | 87 |
| 1010 | 3300048909 | Ga0496106_0055581 | Ga0496106_0055581_1971_2234 | 87 |
| 1011 | 3300048909 | Ga0496106_0227940 | Ga0496106_0227940_522_785 | 87 |
| 1012 | 3300048909 | Ga0496106_0479808 | Ga0496106_0479808_411_674 | 87 |
| 1013 | 3300048909 | Ga0496106_0823729 | Ga0496106_0823729_67_330 | 87 |
| 1014 | 3300048910 | Ga0496107_0000545 | Ga0496107_0000545_9976_10239 | 87 |
| 1015 | 3300048910 | Ga0496107_0002007 | Ga0496107_0002007_3934_4197 | 87 |
| 1016 | 3300048910 | Ga0496107_0012651 | Ga0496107_0012651_2806_3069 | 87 |
| 1017 | 3300048910 | Ga0496107_0013425 | Ga0496107_0013425_3563_3826 | 87 |
| 1018 | 3300048910 | Ga0496107_0014162 | Ga0496107_0014162_1142_1405 | 87 |
| 1019 | 3300048910 | Ga0496107_0017801 | Ga0496107_0017801_4300_4563 | 87 |
| 1020 | 3300048910 | Ga0496107_0029698 | Ga0496107_0029698_568_831 | 87 |
| 1021 | 3300048910 | Ga0496107_0041450 | Ga0496107_0041450_2952_3215 | 87 |
| 1022 | 3300048910 | Ga0496107_0299375 | Ga0496107_0299375_149_412 | 87 |
| 1023 | 3300048910 | Ga0496107_0578983 | Ga0496107_0578983_71_334 | 87 |
| 1024 | 3300048911 | Ga0496108_0000403 | Ga0496108_0000403_19243_19506 | 87 |
| 1025 | 3300048911 | Ga0496108_0001800 | Ga0496108_0001800_6081_6344 | 87 |
| 1026 | 3300048911 | Ga0496108_0009997 | Ga0496108_0009997_5954_6217 | 87 |
| 1027 | 3300048911 | Ga0496108_0075476 | Ga0496108_0075476_2045_2308 | 87 |
| 1028 | 3300048911 | Ga0496108_0171854 | Ga0496108_0171854_1469_1732 | 87 |
| 1029 | 3300048911 | Ga0496108_0203356 | Ga0496108_0203356_216_479 | 87 |
| 1030 | 3300048911 | Ga0496108_0258076 | Ga0496108_0258076_505_768 | 87 |
| 1031 | 3300048911 | Ga0496108_0295580 | Ga0496108_0295580_445_708 | 87 |
| 1032 | 3300048911 | Ga0496108_0525956 | Ga0496108_0525956_107_370 | 87 |
| 1033 | 3300048911 | Ga0496108_1318927 | Ga0496108_1318927_251_514 | 87 |
| 1034 | 3300048912 | Ga0496109_0001203 | Ga0496109_0001203_20764_21027 | 87 |
| 1035 | 3300048912 | Ga0496109_0001324 | Ga0496109_0001324_1590_1853 | 87 |
| 1036 | 3300048912 | Ga0496109_0002451 | Ga0496109_0002451_158_421 | 87 |
| 1037 | 3300048912 | Ga0496109_0002493 | Ga0496109_0002493_6860_7123 | 87 |
| 1038 | 3300048912 | Ga0496109_0003464 | Ga0496109_0003464_5137_5400 | 87 |
| 1039 | 3300048912 | Ga0496109_0023041 | Ga0496109_0023041_5138_5401 | 87 |
| 1040 | 3300048912 | Ga0496109_0045380 | Ga0496109_0045380_3022_3285 | 87 |
| 1041 | 3300048912 | Ga0496109_0093792 | Ga0496109_0093792_2094_2357 | 87 |
| 1042 | 3300048912 | Ga0496109_0171071 | Ga0496109_0171071_517_780 | 87 |
| 1043 | 3300048912 | Ga0496109_0602784 | Ga0496109_0602784_613_876 | 87 |
| 1044 | 3300048912 | Ga0496109_0669972 | Ga0496109_0669972_532_795 | 87 |
| 1045 | 3300048912 | Ga0496109_0737659 | Ga0496109_0737659_38_301 | 87 |
| 1046 | 3300048912 | Ga0496109_1254325 | Ga0496109_1254325_118_381 | 87 |
| 1047 | 3300048912 | Ga0496109_1398681 | Ga0496109_1398681_233_496 | 87 |
| 1048 | 3300048912 | Ga0496109_1562503 | Ga0496109_1562503_175_453 | 87 |
| 1049 | 3300048912 | Ga0496109_1888947 | Ga0496109_1888947_230_493 | 87 |
| 1050 | 3300048913 | Ga0496110_0001093 | Ga0496110_0001093_9841_10104 | 87 |
| 1051 | 3300048913 | Ga0496110_0004541 | Ga0496110_0004541_7413_7676 | 87 |
| 1052 | 3300048913 | Ga0496110_0030818 | Ga0496110_0030818_2786_3049 | 87 |
| 1053 | 3300048913 | Ga0496110_0060428 | Ga0496110_0060428_1290_1553 | 87 |
| 1054 | 3300048913 | Ga0496110_0079358 | Ga0496110_0079358_1556_1819 | 87 |
| 1055 | 3300048913 | Ga0496110_0254054 | Ga0496110_0254054_763_1026 | 87 |
| 1056 | 3300048913 | Ga0496110_0365085 | Ga0496110_0365085_52_315 | 87 |
| 1057 | 3300048914 | Ga0496111_0003419 | Ga0496111_0003419_4032_4295 | 87 |
| 1058 | 3300048914 | Ga0496111_0005179 | Ga0496111_0005179_451_714 | 87 |
| 1059 | 3300048914 | Ga0496111_0014563 | Ga0496111_0014563_124_387 | 87 |
| 1060 | 3300048914 | Ga0496111_0083991 | Ga0496111_0083991_361_624 | 87 |
| 1061 | 3300048914 | Ga0496111_0109252 | Ga0496111_0109252_1736_1999 | 87 |
| 1062 | 3300048914 | Ga0496111_0208267 | Ga0496111_0208267_924_1187 | 87 |
| 1063 | 3300048914 | Ga0496111_0236481 | Ga0496111_0236481_942_1205 | 87 |
| 1064 | 3300048914 | Ga0496111_0680124 | Ga0496111_0680124_64_342 | 87 |
| 1065 | 3300048914 | Ga0496111_0776692 | Ga0496111_0776692_62_325 | 87 |
| 1066 | 3300048915 | Ga0496112_0004222 | Ga0496112_0004222_10885_11148 | 87 |
| 1067 | 3300048915 | Ga0496112_0044728 | Ga0496112_0044728_3639_3902 | 87 |
| 1068 | 3300048915 | Ga0496112_0063315 | Ga0496112_0063315_823_1101 | 87 |
| 1069 | 3300048915 | Ga0496112_0106184 | Ga0496112_0106184_820_1083 | 87 |
| 1070 | 3300048915 | Ga0496112_0113533 | Ga0496112_0113533_1507_1770 | 87 |
| 1071 | 3300048915 | Ga0496112_0132923 | Ga0496112_0132923_1308_1571 | 87 |
| 1072 | 3300048915 | Ga0496112_0201869 | Ga0496112_0201869_1670_1933 | 87 |
| 1073 | 3300048915 | Ga0496112_0663892 | Ga0496112_0663892_684_947 | 87 |
| 1074 | 3300048915 | Ga0496112_1218657 | Ga0496112_1218657_82_345 | 87 |
| 1075 | 3300048915 | Ga0496112_1379663 | Ga0496112_1379663_235_498 | 87 |
| 1076 | 3300048916 | Ga0496113_0000452 | Ga0496113_0000452_10542_10805 | 87 |
| 1077 | 3300048916 | Ga0496113_0030876 | Ga0496113_0030876_2015_2278 | 87 |
| 1078 | 3300048916 | Ga0496113_0084448 | Ga0496113_0084448_2090_2368 | 87 |
| 1079 | 3300048916 | Ga0496113_0124353 | Ga0496113_0124353_428_691 | 87 |
| 1080 | 3300048916 | Ga0496113_0210068 | Ga0496113_0210068_1214_1477 | 87 |
| 1081 | 3300048916 | Ga0496113_0243560 | Ga0496113_0243560_365_628 | 87 |
| 1082 | 3300048916 | Ga0496113_0653831 | Ga0496113_0653831_160_423 | 87 |
| 1083 | 3300048916 | Ga0496113_0840575 | Ga0496113_0840575_430_693 | 87 |
| 1084 | 3300048916 | Ga0496113_1090558 | Ga0496113_1090558_10_273 | 87 |
| 1085 | 3300048916 | Ga0496113_1544248 | Ga0496113_1544248_56_319 | 87 |
| 1086 | 3300048917 | Ga0496114_0002175 | Ga0496114_0002175_956_1219 | 87 |
| 1087 | 3300048917 | Ga0496114_0003284 | Ga0496114_0003284_5646_5909 | 87 |
| 1088 | 3300048917 | Ga0496114_0004568 | Ga0496114_0004568_5938_6201 | 87 |
| 1089 | 3300048917 | Ga0496114_0005710 | Ga0496114_0005710_3968_4231 | 87 |
| 1090 | 3300048917 | Ga0496114_0021335 | Ga0496114_0021335_437_700 | 87 |
| 1091 | 3300048917 | Ga0496114_0035697 | Ga0496114_0035697_859_1122 | 87 |
| 1092 | 3300048917 | Ga0496114_0046848 | Ga0496114_0046848_22_285 | 87 |
| 1093 | 3300048917 | Ga0496114_0059492 | Ga0496114_0059492_1731_1994 | 87 |
| 1094 | 3300048917 | Ga0496114_0063380 | Ga0496114_0063380_1813_2076 | 87 |
| 1095 | 3300048917 | Ga0496114_0110909 | Ga0496114_0110909_92_355 | 87 |
| 1096 | 3300048917 | Ga0496114_0149864 | Ga0496114_0149864_21_284 | 87 |
| 1097 | 3300048917 | Ga0496114_0244969 | Ga0496114_0244969_425_688 | 87 |
| 1098 | 3300048917 | Ga0496114_0677448 | Ga0496114_0677448_15_278 | 87 |
| 1099 | 3300048917 | Ga0496114_0740192 | Ga0496114_0740192_113_376 | 87 |
| 1100 | 3300048918 | Ga0496115_0006641 | Ga0496115_0006641_6399_6662 | 87 |
| 1101 | 3300048918 | Ga0496115_0008859 | Ga0496115_0008859_6600_6863 | 87 |
| 1102 | 3300048918 | Ga0496115_0035042 | Ga0496115_0035042_3298_3561 | 87 |
| 1103 | 3300048918 | Ga0496115_0040254 | Ga0496115_0040254_1676_1939 | 87 |
| 1104 | 3300048918 | Ga0496115_0084967 | Ga0496115_0084967_1344_1607 | 87 |
| 1105 | 3300048918 | Ga0496115_0204299 | Ga0496115_0204299_1202_1465 | 87 |
| 1106 | 3300048918 | Ga0496115_0321374 | Ga0496115_0321374_939_1202 | 87 |
| 1107 | 3300048918 | Ga0496115_0343386 | Ga0496115_0343386_806_1069 | 87 |
| 1108 | 3300048918 | Ga0496115_0474167 | Ga0496115_0474167_451_714 | 87 |
| 1109 | 3300048918 | Ga0496115_0624300 | Ga0496115_0624300_255_518 | 87 |
| 1110 | 3300048918 | Ga0496115_0955186 | Ga0496115_0955186_180_443 | 87 |
| 1111 | 3300048918 | Ga0496115_0990980 | Ga0496115_0990980_61_324 | 87 |
| 1112 | 3300048929 | Ga0496126_0115479 | Ga0496126_0115479_881_1144 | 87 |
| 1113 | 3300049568 | Ga0501031_0007443 | Ga0501031_0007443_2476_2739 | 87 |
| 1114 | 3300049568 | Ga0501031_0152233 | Ga0501031_0152233_52_315 | 87 |
| 1115 | 3300049568 | Ga0501031_0180339 | Ga0501031_0180339_1059_1322 | 87 |
| 1116 | 3300049568 | Ga0501031_0976127 | Ga0501031_0976127_262_525 | 87 |
| 1117 | 3300049569 | Ga0501032_0087145 | Ga0501032_0087145_1718_1981 | 87 |
| 1118 | 3300049569 | Ga0501032_0399608 | Ga0501032_0399608_396_659 | 87 |
| 1119 | 3300049570 | Ga0501033_0309128 | Ga0501033_0309128_493_756 | 87 |
| 1120 | 3300049570 | Ga0501033_0522589 | Ga0501033_0522589_385_648 | 87 |
| 1121 | 3300049572 | Ga0501036_0033834 | Ga0501036_0033834_1959_2222 | 87 |
| 1122 | 3300049572 | Ga0501036_0775314 | Ga0501036_0775314_165_428 | 87 |
| 1123 | 3300049573 | Ga0501037_0083994 | Ga0501037_0083994_1381_1644 | 87 |
| 1124 | 3300049573 | Ga0501037_0328379 | Ga0501037_0328379_142_405 | 87 |
| 1125 | 3300049574 | Ga0501038_0075297 | Ga0501038_0075297_1930_2193 | 87 |
| 1126 | 3300049574 | Ga0501038_0191199 | Ga0501038_0191199_493_756 | 87 |
| 1127 | 3300049574 | Ga0501038_0613417 | Ga0501038_0613417_365_628 | 87 |
| 1128 | 3300049575 | Ga0501039_0023372 | Ga0501039_0023372_4330_4593 | 87 |
| 1129 | 3300049575 | Ga0501039_0327233 | Ga0501039_0327233_269_532 | 87 |
| 1130 | 3300049575 | Ga0501039_0353209 | Ga0501039_0353209_133_396 | 87 |
| 1131 | 3300049575 | Ga0501039_1499939 | Ga0501039_1499939_203_466 | 87 |
| 1132 | 3300049576 | Ga0501040_0098652 | Ga0501040_0098652_1086_1349 | 87 |
| 1133 | 3300049576 | Ga0501040_0107694 | Ga0501040_0107694_1085_1348 | 87 |
| 1134 | 3300049576 | Ga0501040_0118095 | Ga0501040_0118095_1149_1412 | 87 |
| 1135 | 3300049576 | Ga0501040_0139659 | Ga0501040_0139659_144_407 | 87 |
| 1136 | 3300049576 | Ga0501040_0265364 | Ga0501040_0265364_149_412 | 87 |
| 1137 | 3300049576 | Ga0501040_1106054 | Ga0501040_1106054_49_312 | 87 |
| 1138 | 3300049577 | Ga0501041_0224942 | Ga0501041_0224942_439_702 | 87 |
| 1139 | 3300049577 | Ga0501041_0364903 | Ga0501041_0364903_58_321 | 87 |
| 1140 | 3300049577 | Ga0501041_0410630 | Ga0501041_0410630_329_592 | 87 |
| 1141 | 3300049578 | Ga0501042_0015452 | Ga0501042_0015452_4459_4722 | 87 |
| 1142 | 3300049578 | Ga0501042_0148649 | Ga0501042_0148649_413_676 | 87 |
| 1143 | 3300049578 | Ga0501042_0277957 | Ga0501042_0277957_353_616 | 87 |
| 1144 | 3300049578 | Ga0501042_0436016 | Ga0501042_0436016_131_394 | 87 |
| 1145 | 3300049580 | Ga0501046_0043766 | Ga0501046_0043766_2387_2650 | 87 |
| 1146 | 3300049580 | Ga0501046_0297225 | Ga0501046_0297225_121_384 | 87 |
| 1147 | 3300049582 | Ga0501048_0004258 | Ga0501048_0004258_5729_5992 | 87 |
| 1148 | 3300049582 | Ga0501048_0362946 | Ga0501048_0362946_44_307 | 87 |
| 1149 | 3300049582 | Ga0501048_0490254 | Ga0501048_0490254_583_846 | 87 |
| 1150 | 3300049582 | Ga0501048_0528803 | Ga0501048_0528803_476_739 | 87 |
| 1151 | 3300049583 | Ga0501067_0000414 | Ga0501067_0000414_8218_8481 | 87 |
| 1152 | 3300049583 | Ga0501067_0169540 | Ga0501067_0169540_126_389 | 87 |
| 1153 | 3300049583 | Ga0501067_0175688 | Ga0501067_0175688_859_1122 | 87 |
| 1154 | 3300049583 | Ga0501067_0282360 | Ga0501067_0282360_249_512 | 87 |
| 1155 | 3300049583 | Ga0501067_0310057 | Ga0501067_0310057_440_703 | 87 |
| 1156 | 3300049583 | Ga0501067_0360618 | Ga0501067_0360618_232_510 | 87 |
| 1157 | 3300049584 | Ga0501068_0000406 | Ga0501068_0000406_2473_2736 | 87 |
| 1158 | 3300049584 | Ga0501068_0194721 | Ga0501068_0194721_549_827 | 87 |
| 1159 | 3300049584 | Ga0501068_0924569 | Ga0501068_0924569_69_332 | 87 |
| 1160 | 3300049585 | Ga0501069_0000177 | Ga0501069_0000177_27584_27847 | 87 |
| 1161 | 3300049585 | Ga0501069_0085439 | Ga0501069_0085439_869_1132 | 87 |
| 1162 | 3300049585 | Ga0501069_0223879 | Ga0501069_0223879_659_922 | 87 |
| 1163 | 3300049585 | Ga0501069_0308384 | Ga0501069_0308384_378_656 | 87 |
| 1164 | 3300049587 | Ga0501071_0029991 | Ga0501071_0029991_176_439 | 87 |
| 1165 | 3300049587 | Ga0501071_0153776 | Ga0501071_0153776_1423_1686 | 87 |
| 1166 | 3300049587 | Ga0501071_0776442 | Ga0501071_0776442_122_385 | 87 |
| 1167 | 3300049587 | Ga0501071_1085597 | Ga0501071_1085597_171_434 | 87 |
| 1168 | 3300049588 | Ga0501072_0002616 | Ga0501072_0002616_3532_3795 | 87 |
| 1169 | 3300049588 | Ga0501072_0072011 | Ga0501072_0072011_33_296 | 87 |
| 1170 | 3300049588 | Ga0501072_0659371 | Ga0501072_0659371_399_662 | 87 |
| 1171 | 3300049588 | Ga0501072_0848036 | Ga0501072_0848036_39_302 | 87 |
| 1172 | 3300049589 | Ga0501073_0251544 | Ga0501073_0251544_664_927 | 87 |
| 1173 | 3300049589 | Ga0501073_0706003 | Ga0501073_0706003_334_597 | 87 |
| 1174 | 3300049590 | Ga0501074_0050290 | Ga0501074_0050290_534_797 | 87 |
| 1175 | 3300049590 | Ga0501074_0161966 | Ga0501074_0161966_44_307 | 87 |
| 1176 | 3300049590 | Ga0501074_0211353 | Ga0501074_0211353_732_995 | 87 |
| 1177 | 3300049590 | Ga0501074_0464461 | Ga0501074_0464461_52_315 | 87 |
| 1178 | 3300049591 | Ga0501075_0037036 | Ga0501075_0037036_2569_2832 | 87 |
| 1179 | 3300049591 | Ga0501075_0262619 | Ga0501075_0262619_484_747 | 87 |
| 1180 | 3300049591 | Ga0501075_0541623 | Ga0501075_0541623_413_676 | 87 |
| 1181 | 3300049592 | Ga0501076_0017096 | Ga0501076_0017096_234_497 | 87 |
| 1182 | 3300049592 | Ga0501076_0248577 | Ga0501076_0248577_1003_1266 | 87 |
| 1183 | 3300049592 | Ga0501076_0317377 | Ga0501076_0317377_605_868 | 87 |
| 1184 | 3300049592 | Ga0501076_0325394 | Ga0501076_0325394_68_331 | 87 |
| 1185 | 3300049593 | Ga0501077_0041883 | Ga0501077_0041883_1847_2110 | 87 |
| 1186 | 3300049593 | Ga0501077_0093193 | Ga0501077_0093193_1630_1893 | 87 |
| 1187 | 3300049593 | Ga0501077_0123020 | Ga0501077_0123020_813_1076 | 87 |
| 1188 | 3300049593 | Ga0501077_0314753 | Ga0501077_0314753_167_430 | 87 |
| 1189 | 3300049741 | Ga0501079_0098535 | Ga0501079_0098535_523_786 | 87 |
| 1190 | 3300049741 | Ga0501079_0264833 | Ga0501079_0264833_953_1216 | 87 |
| 1191 | 3300049742 | Ga0501080_0349084 | Ga0501080_0349084_631_894 | 87 |
| 1192 | 3300049742 | Ga0501080_0851297 | Ga0501080_0851297_241_504 | 87 |
| 1193 | 3300049742 | Ga0501080_0949155 | Ga0501080_0949155_441_704 | 87 |
| 1194 | 3300049743 | Ga0501081_0158636 | Ga0501081_0158636_830_1093 | 87 |
| 1195 | 3300049743 | Ga0501081_0227363 | Ga0501081_0227363_488_751 | 87 |
| 1196 | 3300049822 | Ga0501035_0334585 | Ga0501035_0334585_570_833 | 87 |
| 1197 | 3300049824 | Ga0501045_0046796 | Ga0501045_0046796_2567_2830 | 87 |
| 1198 | 3300049824 | Ga0501045_0057654 | Ga0501045_0057654_723_986 | 87 |
| 1199 | 3300049824 | Ga0501045_0075657 | Ga0501045_0075657_491_754 | 87 |
| 1200 | 3300049824 | Ga0501045_0307433 | Ga0501045_0307433_711_974 | 87 |
| 1201 | 3300049824 | Ga0501045_0598039 | Ga0501045_0598039_115_378 | 87 |
| 1202 | 3300050490 | nmdc:mga03n38_239893_c1 | nmdc:mga03n38_239893_c1_332_595 | 87 |
| 1203 | 3300050492 | nmdc:mga0yw44_425689_c1 | nmdc:mga0yw44_425689_c1_312_575 | 87 |
| 1204 | 3300050492 | nmdc:mga0yw44_770908_c1 | nmdc:mga0yw44_770908_c1_356_619 | 87 |
| 1205 | 3300050507 | nmdc:mga05p37_172461_c1 | nmdc:mga05p37_172461_c1_1220_1483 | 87 |
| 1206 | 3300050507 | nmdc:mga05p37_2062688_c1 | nmdc:mga05p37_2062688_c1_155_418 | 87 |
| 1207 | 3300050507 | nmdc:mga05p37_40551_c1 | nmdc:mga05p37_40551_c1_749_1012 | 87 |
| 1208 | 3300050507 | nmdc:mga05p37_8517_c1 | nmdc:mga05p37_8517_c1_565_828 | 87 |
| 1209 | 3300050508 | nmdc:mga09592_1146884_c1 | nmdc:mga09592_1146884_c1_155_418 | 87 |
| 1210 | 3300050510 | nmdc:mga06r32_177570_c1 | nmdc:mga06r32_177570_c1_134_397 | 87 |
| 1211 | 3300050511 | nmdc:mga08y16_169430_c1 | nmdc:mga08y16_169430_c1_1877_2140 | 87 |
| 1212 | 3300050511 | nmdc:mga08y16_302823_c1 | nmdc:mga08y16_302823_c1_1227_1490 | 87 |
| 1213 | 3300050512 | nmdc:mga0n895_1029091_c1 | nmdc:mga0n895_1029091_c1_306_569 | 87 |
| 1214 | 3300050512 | nmdc:mga0n895_1270773_c1 | nmdc:mga0n895_1270773_c1_152_415 | 87 |
| 1215 | 3300050512 | nmdc:mga0n895_2216090_c1 | nmdc:mga0n895_2216090_c1_61_324 | 87 |
| 1216 | 3300050512 | nmdc:mga0n895_43470_c1 | nmdc:mga0n895_43470_c1_2812_3075 | 87 |
| 1217 | 3300050512 | nmdc:mga0n895_52992_c1 | nmdc:mga0n895_52992_c1_1374_1637 | 87 |
| 1218 | 3300050512 | nmdc:mga0n895_536835_c1 | nmdc:mga0n895_536835_c1_292_570 | 87 |
| 1219 | 3300050513 | nmdc:mga0rr50_22888_c1 | nmdc:mga0rr50_22888_c1_3863_4126 | 87 |
| 1220 | 3300050513 | nmdc:mga0rr50_525969_c1 | nmdc:mga0rr50_525969_c1_561_824 | 87 |
| 1221 | 3300050514 | nmdc:mga08x19_1154962_c1 | nmdc:mga08x19_1154962_c1_182_445 | 87 |
| 1222 | 3300050514 | nmdc:mga08x19_93625_c1 | nmdc:mga08x19_93625_c1_1133_1396 | 87 |
| 1223 | 3300050515 | nmdc:mga0a205_1196825_c1 | nmdc:mga0a205_1196825_c1_91_354 | 87 |
| 1224 | 3300050515 | nmdc:mga0a205_1318897_c1 | nmdc:mga0a205_1318897_c1_218_481 | 87 |
| 1225 | 3300050515 | nmdc:mga0a205_351207_c1 | nmdc:mga0a205_351207_c1_234_497 | 87 |
| 1226 | 3300050515 | nmdc:mga0a205_41861_c1 | nmdc:mga0a205_41861_c1_2704_2967 | 87 |
| 1227 | 3300053077 | Ga0495601_0002246 | Ga0495601_0002246_5344_5607 | 87 |
| 1228 | 3300053077 | Ga0495601_0045071 | Ga0495601_0045071_445_708 | 87 |
| 1229 | 3300053077 | Ga0495601_0065382 | Ga0495601_0065382_1537_1800 | 87 |
| 1230 | 3300053077 | Ga0495601_0723403 | Ga0495601_0723403_182_445 | 87 |
| 1231 | 3300053078 | Ga0495612_0027656 | Ga0495612_0027656_423_686 | 87 |
| 1232 | 3300053084 | Ga0495595_0002243 | Ga0495595_0002243_4328_4591 | 87 |
| 1233 | 3300053084 | Ga0495595_0341374 | Ga0495595_0341374_426_689 | 87 |
| 1234 | 3300053084 | Ga0495595_0408460 | Ga0495595_0408460_117_380 | 87 |
| 1235 | 3300053085 | Ga0495619_0020674 | Ga0495619_0020674_3404_3667 | 87 |
| 1236 | 3300053085 | Ga0495619_0196207 | Ga0495619_0196207_989_1252 | 87 |
| 1237 | 3300053085 | Ga0495619_1175468 | Ga0495619_1175468_219_482 | 87 |
| 1238 | 3300054114 | Ga0501084_0013069 | Ga0501084_0013069_5506_5769 | 87 |
| 1239 | 3300054114 | Ga0501084_0253608 | Ga0501084_0253608_812_1075 | 87 |
| 1240 | 3300054114 | Ga0501084_0317286 | Ga0501084_0317286_136_399 | 87 |
| 1241 | 3300054114 | Ga0501084_0480436 | Ga0501084_0480436_58_321 | 87 |
| 1242 | 3300054114 | Ga0501084_0626674 | Ga0501084_0626674_324_587 | 87 |
| 1243 | 3300054114 | Ga0501084_0776315 | Ga0501084_0776315_167_430 | 87 |
| 1244 | 3300054114 | Ga0501084_1006671 | Ga0501084_1006671_174_437 | 87 |
| 1245 | 3300059424 | Ga0590075_006978 | Ga0590075_006978_129_392 | 87 |
| 1246 | 3300059490 | Ga0587066_022517 | Ga0587066_022517_718_981 | 87 |
| 1247 | 3300059491 | Ga0587070_179593 | Ga0587070_179593_83_346 | 87 |
| 1248 | 3300059504 | Ga0587082_111861 | Ga0587082_111861_41_304 | 87 |
| 1249 | 3300059506 | Ga0587085_065683 | Ga0587085_065683_11_274 | 87 |
| 1250 | 3300059511 | Ga0587091_071778 | Ga0587091_071778_182_445 | 87 |
| 1251 | 3300059511 | Ga0587091_135361 | Ga0587091_135361_311_574 | 87 |
| 1252 | 3300060353 | Ga0501082_0025036 | Ga0501082_0025036_105_368 | 87 |
| 1253 | 3300060353 | Ga0501082_0309834 | Ga0501082_0309834_538_801 | 87 |
| 1254 | 3300060353 | Ga0501082_0528625 | Ga0501082_0528625_550_813 | 87 |
| 1255 | 3300060353 | Ga0501082_1261139 | Ga0501082_1261139_36_299 | 87 |
| 1256 | 3300060353 | Ga0501082_1615719 | Ga0501082_1615719_190_453 | 87 |
| 1257 | 3300060353 | Ga0501082_1994215 | Ga0501082_1994215_141_404 | 87 |
| 1258 | 3300061719 | Ga0466962_0024979 | Ga0466962_0024979_991_1254 | 87 |
| 1259 | 3300061719 | Ga0466962_0155400 | Ga0466962_0155400_25_291 | 87 |
| 1260 | 3300061719 | Ga0466962_0368004 | Ga0466962_0368004_402_665 | 87 |
| 1261 | 3300061734 | Ga0530510_0021443 | Ga0530510_0021443_4199_4462 | 87 |
| 1262 | 3300061734 | Ga0530510_0103178 | Ga0530510_0103178_1223_1486 | 87 |
| 1263 | 3300061734 | Ga0530510_0262751 | Ga0530510_0262751_110_373 | 87 |
| 1264 | 3300061734 | Ga0530510_0278887 | Ga0530510_0278887_235_498 | 87 |
| 1265 | 3300061734 | Ga0530510_0995902 | Ga0530510_0995902_283_546 | 87 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dwm-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis cyso, an antigen | 0.8739 | 1 | 84 |
| 4n6e-assembly1.cif.gz_B-2 | crystal structure of amycolatopsis orientalis bexx/cyso complex | 0.846 | 1 | 87 |
| 3dwm-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis cyso, an antigen | 0.8375 | 1 | 84 |
| 4n6e-assembly1.cif.gz_B-2 | crystal structure of amycolatopsis orientalis bexx/cyso complex | 0.8371 | 1 | 87 |
| 1v8c-assembly1.cif.gz_A | crystal structure of moad related protein from thermus thermophilus hb8 | 0.8292 | 3 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n6eB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.846 | 1 | 87 | 3.10.20.30 |
| 4n6eB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8371 | 1 | 87 | 3.10.20.30 |
| 1v8cB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8148 | 3 | 82 | 3.10.20.30 |
| 2l52A00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8019 | 2 | 87 | 3.10.20.30 |
| 2l52A00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.7859 | 2 | 87 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529I7N5-F1-model_v4 | MoaD/ThiS family protein | 0.978 | 2 | 73 |
|
| AF-A0A0A0D3P6-F1-model_v4 | Thiamine biosynthesis protein ThiS | 0.9767 | 3 | 73 |
|
| AF-A0A5C7NWK1-F1-model_v4 | deleted | 0.9644 | 2 | 87 |
|
| AF-A0A5S9PX83-F1-model_v4 | Sulfur carrier protein CysO | 0.9628 | 2 | 87 |
|
| AF-A0A541C2T2-F1-model_v4 | MoaD/ThiS family protein | 0.9603 | 2 | 87 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar