F492425
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1272 | 254 | 2544 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300044719|Ga0466971_0130762|Ga0466971_0130762_163_831 |
| Length | 222 |
| Sequence | VPKGAAAFVSWCAKSPVSERCRKLTGIGVSSRAMATVIPFEERAVAHLRDRLGEAQEANEDLIAFARGHSGAVASIHEAVLAAIAADGVEGLLHVVTQEWPLILGIDAVALSLVVAGKGFRADGSGIQLVDPSILRRAIEGVDGVEMRKVDRGHPLFGPACDLIRAEALIRIECEPPLPSGLLALGQRAELSLDGRHGSELLMFLGRSLAAMIRKWLTHPQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 180 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 197 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 198 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 199 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 200 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 201 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 202 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 203 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 204 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 205 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.48 |
| Rhizosphere | 95.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466971_0130762 | 3300044719 | Bacteria | 1165 |
| 2 | JGI24741J21665_1000751 | 3300001915 | Bacteria | 9748 |
| 3 | JGI24741J21665_1002561 | 3300001915 | Bacteria | 4675 |
| 4 | JGI24741J21665_1013932 | 3300001915 | Bacteria | 1352 |
| 5 | JGI24741J21665_1016512 | 3300001915 | Bacteria | 1204 |
| 6 | JGI24752J21851_1004462 | 3300001976 | Bacteria | 1834 |
| 7 | JGI24740J21852_10000589 | 3300001979 | Bacteria | 15669 |
| 8 | JGI24740J21852_10023570 | 3300001979 | Bacteria | 2100 |
| 9 | JGI24740J21852_10070242 | 3300001979 | Bacteria | 940 |
| 10 | JGI24739J22299_10015404 | 3300001989 | Bacteria | 2777 |
| 11 | JGI24739J22299_10025322 | 3300001989 | Bacteria | 2087 |
| 12 | JGI24739J22299_10026653 | 3300001989 | Bacteria | 2026 |
| 13 | JGI24739J22299_10037051 | 3300001989 | Bacteria | 1644 |
| 14 | JGI24739J22299_10052660 | 3300001989 | Bacteria | 1308 |
| 15 | JGI24737J22298_10001716 | 3300001990 | Bacteria | 7812 |
| 16 | JGI24737J22298_10002005 | 3300001990 | Bacteria | 7268 |
| 17 | JGI24737J22298_10002883 | 3300001990 | Bacteria | 6101 |
| 18 | JGI24737J22298_10058965 | 3300001990 | Bacteria | 1157 |
| 19 | JGI24737J22298_10080683 | 3300001990 | Bacteria | 968 |
| 20 | JGI24735J21928_10002872 | 3300002067 | Bacteria | 5940 |
| 21 | JGI24735J21928_10005019 | 3300002067 | Bacteria | 4406 |
| 22 | JGI24735J21928_10007110 | 3300002067 | Bacteria | 3655 |
| 23 | JGI24735J21928_10012028 | 3300002067 | Bacteria | 2738 |
| 24 | JGI24738J21930_10001169 | 3300002075 | Bacteria | 7396 |
| 25 | JGI24738J21930_10030199 | 3300002075 | Bacteria | 1107 |
| 26 | JGI24034J26672_10014367 | 3300002239 | Bacteria | 1208 |
| 27 | Ga0065712_10001212 | 3300005290 | Bacteria | 6465 |
| 28 | Ga0065712_10151657 | 3300005290 | Bacteria | 1365 |
| 29 | Ga0065715_10535567 | 3300005293 | Bacteria | 752 |
| 30 | Ga0070658_10000205 | 3300005327 | Bacteria | 52211 |
| 31 | Ga0070658_10003017 | 3300005327 | Bacteria | 13928 |
| 32 | Ga0070658_10007898 | 3300005327 | Bacteria | 8568 |
| 33 | Ga0070658_10009387 | 3300005327 | Bacteria | 7857 |
| 34 | Ga0070658_10010244 | 3300005327 | Bacteria | 7517 |
| 35 | Ga0070658_10021879 | 3300005327 | Bacteria | 5127 |
| 36 | Ga0070658_10028103 | 3300005327 | Bacteria | 4515 |
| 37 | Ga0070658_10044420 | 3300005327 | Bacteria | 3591 |
| 38 | Ga0070658_10094746 | 3300005327 | Bacteria | 2464 |
| 39 | Ga0070658_10238921 | 3300005327 | Unclassified | 1539 |
| 40 | Ga0070658_10297736 | 3300005327 | Bacteria | 1375 |
| 41 | Ga0070658_10584484 | 3300005327 | Bacteria | 967 |
| 42 | Ga0070658_10761109 | 3300005327 | Bacteria | 841 |
| 43 | Ga0070676_10157268 | 3300005328 | Bacteria | 1460 |
| 44 | Ga0070676_10332507 | 3300005328 | Bacteria | 1039 |
| 45 | Ga0070683_100000969 | 3300005329 | Bacteria | 21372 |
| 46 | Ga0070683_100010316 | 3300005329 | Bacteria | 8033 |
| 47 | Ga0070683_100071546 | 3300005329 | Bacteria | 3236 |
| 48 | Ga0070683_100086204 | 3300005329 | Bacteria | 2944 |
| 49 | Ga0070683_100140169 | 3300005329 | Bacteria | 2291 |
| 50 | Ga0070683_100158009 | 3300005329 | Bacteria | 2150 |
| 51 | Ga0070683_100184166 | 3300005329 | Bacteria | 1982 |
| 52 | Ga0070683_100320538 | 3300005329 | Bacteria | 1475 |
| 53 | Ga0070683_100421336 | 3300005329 | Bacteria | 1274 |
| 54 | Ga0070683_100642504 | 3300005329 | Bacteria | 1016 |
| 55 | Ga0070683_100881740 | 3300005329 | Bacteria | 858 |
| 56 | Ga0070690_100001273 | 3300005330 | Bacteria | 13096 |
| 57 | Ga0070690_100131443 | 3300005330 | Bacteria | 1691 |
| 58 | Ga0070670_100003010 | 3300005331 | Bacteria | 13948 |
| 59 | Ga0070670_100003116 | 3300005331 | Bacteria | 13718 |
| 60 | Ga0070670_100019349 | 3300005331 | Bacteria | 5841 |
| 61 | Ga0070670_100061317 | 3300005331 | Bacteria | 3229 |
| 62 | Ga0070670_100074248 | 3300005331 | Bacteria | 2921 |
| 63 | Ga0070670_100111993 | 3300005331 | Bacteria | 2352 |
| 64 | Ga0070670_100257271 | 3300005331 | Bacteria | 1521 |
| 65 | Ga0070670_100329203 | 3300005331 | Bacteria | 1339 |
| 66 | Ga0070670_100366388 | 3300005331 | Bacteria | 1268 |
| 67 | Ga0070670_100399615 | 3300005331 | Unclassified | 1213 |
| 68 | Ga0070670_100452747 | 3300005331 | Bacteria | 1138 |
| 69 | Ga0070670_100570549 | 3300005331 | Bacteria | 1011 |
| 70 | Ga0070677_10041766 | 3300005333 | Bacteria | 1812 |
| 71 | Ga0070677_10179731 | 3300005333 | Bacteria | 1006 |
| 72 | Ga0070677_10242204 | 3300005333 | Bacteria | 891 |
| 73 | Ga0068869_100210600 | 3300005334 | Bacteria | 1536 |
| 74 | Ga0070666_10000342 | 3300005335 | Bacteria | 29324 |
| 75 | Ga0070666_10001012 | 3300005335 | Bacteria | 17220 |
| 76 | Ga0070666_10005148 | 3300005335 | Bacteria | 8003 |
| 77 | Ga0070666_10060732 | 3300005335 | Bacteria | 2558 |
| 78 | Ga0070666_10488844 | 3300005335 | Bacteria | 892 |
| 79 | Ga0070680_100002233 | 3300005336 | Bacteria | 14285 |
| 80 | Ga0070680_100008106 | 3300005336 | Bacteria | 8021 |
| 81 | Ga0070680_100008234 | 3300005336 | Bacteria | 7973 |
| 82 | Ga0070680_100019477 | 3300005336 | Bacteria | 5376 |
| 83 | Ga0070680_100028316 | 3300005336 | Bacteria | 4492 |
| 84 | Ga0070680_100036698 | 3300005336 | Bacteria | 3960 |
| 85 | Ga0070680_100079360 | 3300005336 | Bacteria | 2705 |
| 86 | Ga0070680_100098549 | 3300005336 | Bacteria | 2424 |
| 87 | Ga0070680_100444946 | 3300005336 | Bacteria | 1106 |
| 88 | Ga0070682_100004951 | 3300005337 | Bacteria | 7401 |
| 89 | Ga0070682_100037140 | 3300005337 | Bacteria | 2980 |
| 90 | Ga0070682_100054227 | 3300005337 | Bacteria | 2515 |
| 91 | Ga0070682_100318298 | 3300005337 | Bacteria | 1148 |
| 92 | Ga0070682_100585949 | 3300005337 | Bacteria | 878 |
| 93 | Ga0068868_100003381 | 3300005338 | Bacteria | 11101 |
| 94 | Ga0068868_100017410 | 3300005338 | Bacteria | 5354 |
| 95 | Ga0068868_100018436 | 3300005338 | Bacteria | 5219 |
| 96 | Ga0068868_100172811 | 3300005338 | Bacteria | 1789 |
| 97 | Ga0068868_100595462 | 3300005338 | Bacteria | 979 |
| 98 | Ga0070660_100000009 | 3300005339 | Bacteria | 145691 |
| 99 | Ga0070660_100005796 | 3300005339 | Bacteria | 8558 |
| 100 | Ga0070660_100009066 | 3300005339 | Bacteria | 6983 |
| 101 | Ga0070660_100009998 | 3300005339 | Bacteria | 6688 |
| 102 | Ga0070660_100021025 | 3300005339 | Bacteria | 4805 |
| 103 | Ga0070660_100063792 | 3300005339 | Bacteria | 2864 |
| 104 | Ga0070660_100088763 | 3300005339 | Bacteria | 2435 |
| 105 | Ga0070660_100097044 | 3300005339 | Bacteria | 2331 |
| 106 | Ga0070660_100117312 | 3300005339 | Bacteria | 2123 |
| 107 | Ga0070660_100170571 | 3300005339 | Bacteria | 1757 |
| 108 | Ga0070660_100184428 | 3300005339 | Bacteria | 1689 |
| 109 | Ga0070660_100199517 | 3300005339 | Bacteria | 1623 |
| 110 | Ga0070660_100219107 | 3300005339 | Bacteria | 1546 |
| 111 | Ga0070660_100223779 | 3300005339 | Bacteria | 1530 |
| 112 | Ga0070660_100287642 | 3300005339 | Bacteria | 1346 |
| 113 | Ga0070660_101110137 | 3300005339 | Bacteria | 669 |
| 114 | Ga0070689_100156590 | 3300005340 | Bacteria | 1839 |
| 115 | Ga0070691_10000548 | 3300005341 | Bacteria | 14241 |
| 116 | Ga0070691_10030245 | 3300005341 | Bacteria | 2536 |
| 117 | Ga0070691_10172889 | 3300005341 | Bacteria | 1120 |
| 118 | Ga0070661_100000100 | 3300005344 | Bacteria | 70585 |
| 119 | Ga0070661_100001881 | 3300005344 | Bacteria | 14533 |
| 120 | Ga0070661_100005867 | 3300005344 | Bacteria | 8446 |
| 121 | Ga0070661_100009541 | 3300005344 | Bacteria | 6723 |
| 122 | Ga0070661_100031901 | 3300005344 | Bacteria | 3811 |
| 123 | Ga0070661_100032441 | 3300005344 | Bacteria | 3781 |
| 124 | Ga0070661_100056333 | 3300005344 | Bacteria | 2880 |
| 125 | Ga0070661_100066991 | 3300005344 | Bacteria | 2639 |
| 126 | Ga0070661_100123767 | 3300005344 | Bacteria | 1939 |
| 127 | Ga0070661_100138673 | 3300005344 | Bacteria | 1831 |
| 128 | Ga0070661_100154581 | 3300005344 | Bacteria | 1735 |
| 129 | Ga0070661_100285634 | 3300005344 | Bacteria | 1281 |
| 130 | Ga0070661_100466368 | 3300005344 | Bacteria | 1006 |
| 131 | Ga0070661_100667931 | 3300005344 | Bacteria | 845 |
| 132 | Ga0070661_101103506 | 3300005344 | Unclassified | 661 |
| 133 | Ga0070692_10015852 | 3300005345 | Bacteria | 3573 |
| 134 | Ga0070692_10024920 | 3300005345 | Bacteria | 2945 |
| 135 | Ga0070692_10029809 | 3300005345 | Bacteria | 2723 |
| 136 | Ga0070692_10115665 | 3300005345 | Bacteria | 1489 |
| 137 | Ga0070692_10304259 | 3300005345 | Bacteria | 974 |
| 138 | Ga0070669_100037839 | 3300005353 | Bacteria | 3501 |
| 139 | Ga0070669_100205472 | 3300005353 | Bacteria | 1552 |
| 140 | Ga0070669_100612934 | 3300005353 | Bacteria | 913 |
| 141 | Ga0070675_100001992 | 3300005354 | Bacteria | 15152 |
| 142 | Ga0070675_100013065 | 3300005354 | Bacteria | 6523 |
| 143 | Ga0070675_100020759 | 3300005354 | Bacteria | 5243 |
| 144 | Ga0070675_100251282 | 3300005354 | Bacteria | 1547 |
| 145 | Ga0070675_100349401 | 3300005354 | Bacteria | 1311 |
| 146 | Ga0070675_100756407 | 3300005354 | Bacteria | 887 |
| 147 | Ga0070671_100004669 | 3300005355 | Bacteria | 10867 |
| 148 | Ga0070671_100013375 | 3300005355 | Bacteria | 6615 |
| 149 | Ga0070671_100016850 | 3300005355 | Bacteria | 5910 |
| 150 | Ga0070671_100032850 | 3300005355 | Bacteria | 4289 |
| 151 | Ga0070671_100036024 | 3300005355 | Bacteria | 4102 |
| 152 | Ga0070671_100193141 | 3300005355 | Bacteria | 1725 |
| 153 | Ga0070671_100352316 | 3300005355 | Bacteria | 1256 |
| 154 | Ga0070674_100001205 | 3300005356 | Bacteria | 13565 |
| 155 | Ga0070674_100015755 | 3300005356 | Bacteria | 4727 |
| 156 | Ga0070674_100078860 | 3300005356 | Bacteria | 2348 |
| 157 | Ga0070673_100014006 | 3300005364 | Bacteria | 5570 |
| 158 | Ga0070673_100023989 | 3300005364 | Bacteria | 4465 |
| 159 | Ga0070673_100045047 | 3300005364 | Bacteria | 3419 |
| 160 | Ga0070673_100106474 | 3300005364 | Bacteria | 2318 |
| 161 | Ga0070673_100136459 | 3300005364 | Bacteria | 2065 |
| 162 | Ga0070673_100146493 | 3300005364 | Bacteria | 1996 |
| 163 | Ga0070673_100186167 | 3300005364 | Bacteria | 1780 |
| 164 | Ga0070673_100237597 | 3300005364 | Bacteria | 1583 |
| 165 | Ga0070673_100280269 | 3300005364 | Unclassified | 1462 |
| 166 | Ga0070673_100394088 | 3300005364 | Bacteria | 1237 |
| 167 | Ga0070659_100000048 | 3300005366 | Bacteria | 98245 |
| 168 | Ga0070659_100008016 | 3300005366 | Bacteria | 7700 |
| 169 | Ga0070659_100022793 | 3300005366 | Bacteria | 4783 |
| 170 | Ga0070659_100026854 | 3300005366 | Bacteria | 4431 |
| 171 | Ga0070659_100035658 | 3300005366 | Bacteria | 3874 |
| 172 | Ga0070659_100058573 | 3300005366 | Bacteria | 3040 |
| 173 | Ga0070659_100092406 | 3300005366 | Bacteria | 2426 |
| 174 | Ga0070659_100109689 | 3300005366 | Bacteria | 2227 |
| 175 | Ga0070659_100267473 | 3300005366 | Bacteria | 1419 |
| 176 | Ga0070659_100576826 | 3300005366 | Unclassified | 965 |
| 177 | Ga0070659_100589505 | 3300005366 | Bacteria | 954 |
| 178 | Ga0070659_100714006 | 3300005366 | Unclassified | 867 |
| 179 | Ga0070659_100730725 | 3300005366 | Bacteria | 858 |
| 180 | Ga0070667_100000656 | 3300005367 | Bacteria | 33607 |
| 181 | Ga0070667_100003299 | 3300005367 | Bacteria | 13798 |
| 182 | Ga0070667_100003435 | 3300005367 | Bacteria | 13491 |
| 183 | Ga0070667_100014805 | 3300005367 | Bacteria | 6443 |
| 184 | Ga0070667_100022404 | 3300005367 | Bacteria | 5239 |
| 185 | Ga0070667_100285304 | 3300005367 | Bacteria | 1483 |
| 186 | Ga0070667_100368945 | 3300005367 | Unclassified | 1302 |
| 187 | Ga0070667_100512136 | 3300005367 | Bacteria | 1101 |
| 188 | Ga0070709_10183865 | 3300005434 | Bacteria | 1470 |
| 189 | Ga0070714_100026766 | 3300005435 | Bacteria | 4768 |
| 190 | Ga0070714_100141951 | 3300005435 | Bacteria | 2157 |
| 191 | Ga0070714_100180725 | 3300005435 | Bacteria | 1919 |
| 192 | Ga0070714_100192783 | 3300005435 | Bacteria | 1860 |
| 193 | Ga0070714_100227573 | 3300005435 | Bacteria | 1717 |
| 194 | Ga0070713_100003629 | 3300005436 | Bacteria | 10211 |
| 195 | Ga0070713_100148259 | 3300005436 | Bacteria | 2084 |
| 196 | Ga0070713_100351371 | 3300005436 | Bacteria | 1368 |
| 197 | Ga0070694_100666072 | 3300005444 | Bacteria | 844 |
| 198 | Ga0070663_100000620 | 3300005455 | Bacteria | 19036 |
| 199 | Ga0070663_100037252 | 3300005455 | Bacteria | 3385 |
| 200 | Ga0070663_100072632 | 3300005455 | Bacteria | 2507 |
| 201 | Ga0070663_100128718 | 3300005455 | Bacteria | 1920 |
| 202 | Ga0070663_100134189 | 3300005455 | Bacteria | 1883 |
| 203 | Ga0070663_100312155 | 3300005455 | Bacteria | 1262 |
| 204 | Ga0070663_100415388 | 3300005455 | Bacteria | 1102 |
| 205 | Ga0070663_100429558 | 3300005455 | Bacteria | 1085 |
| 206 | Ga0070663_100602974 | 3300005455 | Bacteria | 924 |
| 207 | Ga0070663_100658316 | 3300005455 | Bacteria | 886 |
| 208 | Ga0070663_100810303 | 3300005455 | Bacteria | 803 |
| 209 | Ga0070678_100002008 | 3300005456 | Bacteria | 10994 |
| 210 | Ga0070678_100136696 | 3300005456 | Bacteria | 1955 |
| 211 | Ga0070678_100259695 | 3300005456 | Bacteria | 1460 |
| 212 | Ga0070678_100308388 | 3300005456 | Bacteria | 1347 |
| 213 | Ga0070678_100340916 | 3300005456 | Bacteria | 1286 |
| 214 | Ga0070678_100638221 | 3300005456 | Bacteria | 954 |
| 215 | Ga0070678_100681649 | 3300005456 | Bacteria | 924 |
| 216 | Ga0070678_100917281 | 3300005456 | Bacteria | 801 |
| 217 | Ga0070662_100000035 | 3300005457 | Bacteria | 77342 |
| 218 | Ga0070662_100001933 | 3300005457 | Bacteria | 12732 |
| 219 | Ga0070662_100005986 | 3300005457 | Bacteria | 7802 |
| 220 | Ga0070662_100012983 | 3300005457 | Bacteria | 5534 |
| 221 | Ga0070662_100027623 | 3300005457 | Bacteria | 3941 |
| 222 | Ga0070662_100054092 | 3300005457 | Bacteria | 2908 |
| 223 | Ga0070662_100084841 | 3300005457 | Bacteria | 2366 |
| 224 | Ga0070662_100086025 | 3300005457 | Bacteria | 2351 |
| 225 | Ga0070662_100108111 | 3300005457 | Bacteria | 2115 |
| 226 | Ga0070662_100191259 | 3300005457 | Bacteria | 1619 |
| 227 | Ga0070662_100253310 | 3300005457 | Bacteria | 1416 |
| 228 | Ga0070662_100291044 | 3300005457 | Bacteria | 1324 |
| 229 | Ga0070662_100412910 | 3300005457 | Bacteria | 1115 |
| 230 | Ga0070662_100502377 | 3300005457 | Bacteria | 1011 |
| 231 | Ga0070681_10007382 | 3300005458 | Bacteria | 10745 |
| 232 | Ga0070681_10027469 | 3300005458 | Bacteria | 5721 |
| 233 | Ga0070681_10090937 | 3300005458 | Bacteria | 3002 |
| 234 | Ga0070681_10138517 | 3300005458 | Bacteria | 2363 |
| 235 | Ga0070681_10139710 | 3300005458 | Bacteria | 2352 |
| 236 | Ga0070681_10631823 | 3300005458 | Bacteria | 985 |
| 237 | Ga0068867_100002157 | 3300005459 | Bacteria | 13798 |
| 238 | Ga0068867_100013521 | 3300005459 | Bacteria | 5781 |
| 239 | Ga0068867_100058680 | 3300005459 | Bacteria | 2852 |
| 240 | Ga0070685_10129926 | 3300005466 | Bacteria | 1574 |
| 241 | Ga0070685_10158132 | 3300005466 | Bacteria | 1442 |
| 242 | Ga0070685_10392529 | 3300005466 | Bacteria | 959 |
| 243 | Ga0070679_100052424 | 3300005530 | Bacteria | 4063 |
| 244 | Ga0070679_100100779 | 3300005530 | Bacteria | 2874 |
| 245 | Ga0070679_100105747 | 3300005530 | Bacteria | 2800 |
| 246 | Ga0070679_100194513 | 3300005530 | Bacteria | 1996 |
| 247 | Ga0070679_100198235 | 3300005530 | Bacteria | 1974 |
| 248 | Ga0070679_100279162 | 3300005530 | Bacteria | 1623 |
| 249 | Ga0070679_100378175 | 3300005530 | Bacteria | 1363 |
| 250 | Ga0070679_100644163 | 3300005530 | Bacteria | 1002 |
| 251 | Ga0070684_100005169 | 3300005535 | Bacteria | 9978 |
| 252 | Ga0070684_100012155 | 3300005535 | Bacteria | 6885 |
| 253 | Ga0070684_100047690 | 3300005535 | Bacteria | 3713 |
| 254 | Ga0070684_100477544 | 3300005535 | Bacteria | 1154 |
| 255 | Ga0070684_101011425 | 3300005535 | Bacteria | 780 |
| 256 | Ga0070684_101076786 | 3300005535 | Unclassified | 755 |
| 257 | Ga0068853_100005995 | 3300005539 | Bacteria | 9611 |
| 258 | Ga0068853_100016655 | 3300005539 | Bacteria | 6053 |
| 259 | Ga0068853_100036459 | 3300005539 | Bacteria | 4182 |
| 260 | Ga0068853_100050529 | 3300005539 | Bacteria | 3577 |
| 261 | Ga0068853_100214727 | 3300005539 | Unclassified | 1754 |
| 262 | Ga0068853_100295176 | 3300005539 | Bacteria | 1497 |
| 263 | Ga0068853_100584768 | 3300005539 | Unclassified | 1059 |
| 264 | Ga0070672_100001947 | 3300005543 | Bacteria | 12943 |
| 265 | Ga0070672_100005121 | 3300005543 | Bacteria | 8648 |
| 266 | Ga0070672_100014019 | 3300005543 | Bacteria | 5670 |
| 267 | Ga0070672_100027707 | 3300005543 | Bacteria | 4228 |
| 268 | Ga0070672_100263327 | 3300005543 | Bacteria | 1454 |
| 269 | Ga0070672_100415479 | 3300005543 | Bacteria | 1155 |
| 270 | Ga0070686_100008428 | 3300005544 | Bacteria | 5772 |
| 271 | Ga0070686_100011256 | 3300005544 | Bacteria | 5070 |
| 272 | Ga0070696_100345409 | 3300005546 | Bacteria | 1151 |
| 273 | Ga0070693_100000966 | 3300005547 | Bacteria | 12770 |
| 274 | Ga0070693_100020626 | 3300005547 | Bacteria | 3479 |
| 275 | Ga0070693_100034854 | 3300005547 | Bacteria | 2787 |
| 276 | Ga0070693_100402246 | 3300005547 | Bacteria | 950 |
| 277 | Ga0070665_100012074 | 3300005548 | Bacteria | 8714 |
| 278 | Ga0070665_100021376 | 3300005548 | Bacteria | 6508 |
| 279 | Ga0070665_100021432 | 3300005548 | Bacteria | 6500 |
| 280 | Ga0070665_100037912 | 3300005548 | Bacteria | 4845 |
| 281 | Ga0070665_100258632 | 3300005548 | Bacteria | 1742 |
| 282 | Ga0070665_101458061 | 3300005548 | Bacteria | 693 |
| 283 | Ga0068855_100011859 | 3300005563 | Bacteria | 10538 |
| 284 | Ga0068855_100034378 | 3300005563 | Bacteria | 6046 |
| 285 | Ga0068855_100052334 | 3300005563 | Bacteria | 4808 |
| 286 | Ga0068855_100060596 | 3300005563 | Bacteria | 4425 |
| 287 | Ga0068855_100124576 | 3300005563 | Bacteria | 2948 |
| 288 | Ga0068855_100172558 | 3300005563 | Bacteria | 2448 |
| 289 | Ga0068855_100212966 | 3300005563 | Bacteria | 2170 |
| 290 | Ga0068855_100322750 | 3300005563 | Bacteria | 1706 |
| 291 | Ga0068855_100366550 | 3300005563 | Bacteria | 1584 |
| 292 | Ga0068855_100725529 | 3300005563 | Bacteria | 1062 |
| 293 | Ga0068855_101052137 | 3300005563 | Bacteria | 853 |
| 294 | Ga0070664_100000025 | 3300005564 | Bacteria | 93173 |
| 295 | Ga0070664_100002840 | 3300005564 | Bacteria | 14009 |
| 296 | Ga0070664_100004324 | 3300005564 | Bacteria | 11418 |
| 297 | Ga0070664_100010146 | 3300005564 | Bacteria | 7637 |
| 298 | Ga0070664_100017113 | 3300005564 | Bacteria | 5951 |
| 299 | Ga0070664_100036475 | 3300005564 | Bacteria | 4131 |
| 300 | Ga0070664_100061556 | 3300005564 | Bacteria | 3199 |
| 301 | Ga0070664_100071444 | 3300005564 | Bacteria | 2974 |
| 302 | Ga0070664_100094308 | 3300005564 | Bacteria | 2595 |
| 303 | Ga0070664_100139683 | 3300005564 | Bacteria | 2132 |
| 304 | Ga0070664_100162899 | 3300005564 | Bacteria | 1974 |
| 305 | Ga0070664_100237698 | 3300005564 | Bacteria | 1634 |
| 306 | Ga0070664_100263228 | 3300005564 | Bacteria | 1552 |
| 307 | Ga0070664_100412215 | 3300005564 | Bacteria | 1236 |
| 308 | Ga0070664_100744878 | 3300005564 | Bacteria | 914 |
| 309 | Ga0068857_100003470 | 3300005577 | Bacteria | 13164 |
| 310 | Ga0068857_100073685 | 3300005577 | Bacteria | 3043 |
| 311 | Ga0068857_100180099 | 3300005577 | Bacteria | 1923 |
| 312 | Ga0068857_100255122 | 3300005577 | Bacteria | 1608 |
| 313 | Ga0068857_100327198 | 3300005577 | Bacteria | 1416 |
| 314 | Ga0068857_100490969 | 3300005577 | Bacteria | 1151 |
| 315 | Ga0068854_100002456 | 3300005578 | Bacteria | 11472 |
| 316 | Ga0068854_100063923 | 3300005578 | Bacteria | 2672 |
| 317 | Ga0068854_100077715 | 3300005578 | Bacteria | 2443 |
| 318 | Ga0068854_100080297 | 3300005578 | Bacteria | 2407 |
| 319 | Ga0068854_100080755 | 3300005578 | Bacteria | 2400 |
| 320 | Ga0068854_100159294 | 3300005578 | Bacteria | 1746 |
| 321 | Ga0068854_100433227 | 3300005578 | Unclassified | 1094 |
| 322 | Ga0068854_100813070 | 3300005578 | Unclassified | 815 |
| 323 | Ga0068856_100000124 | 3300005614 | Bacteria | 77469 |
| 324 | Ga0068856_100057183 | 3300005614 | Bacteria | 3850 |
| 325 | Ga0068856_100059079 | 3300005614 | Bacteria | 3787 |
| 326 | Ga0068856_100130912 | 3300005614 | Bacteria | 2513 |
| 327 | Ga0068856_100150403 | 3300005614 | Bacteria | 2337 |
| 328 | Ga0068856_100336167 | 3300005614 | Bacteria | 1528 |
| 329 | Ga0068856_100381181 | 3300005614 | Bacteria | 1429 |
| 330 | Ga0068856_100413707 | 3300005614 | Bacteria | 1368 |
| 331 | Ga0068856_100455173 | 3300005614 | Bacteria | 1301 |
| 332 | Ga0068856_100530385 | 3300005614 | Unclassified | 1198 |
| 333 | Ga0068856_100578077 | 3300005614 | Bacteria | 1145 |
| 334 | Ga0068856_100578289 | 3300005614 | Bacteria | 1144 |
| 335 | Ga0068856_100687256 | 3300005614 | Bacteria | 1044 |
| 336 | Ga0068856_100816438 | 3300005614 | Bacteria | 952 |
| 337 | Ga0068856_100825440 | 3300005614 | Bacteria | 946 |
| 338 | Ga0068856_100896322 | 3300005614 | Bacteria | 906 |
| 339 | Ga0070702_100667533 | 3300005615 | Unclassified | 788 |
| 340 | Ga0068852_100000258 | 3300005616 | Bacteria | 35932 |
| 341 | Ga0068852_100001780 | 3300005616 | Bacteria | 14646 |
| 342 | Ga0068852_100002322 | 3300005616 | Bacteria | 13070 |
| 343 | Ga0068852_100006143 | 3300005616 | Bacteria | 8664 |
| 344 | Ga0068852_100006923 | 3300005616 | Bacteria | 8245 |
| 345 | Ga0068852_100009796 | 3300005616 | Bacteria | 7123 |
| 346 | Ga0068852_100022922 | 3300005616 | Bacteria | 5017 |
| 347 | Ga0068852_100070145 | 3300005616 | Unclassified | 3074 |
| 348 | Ga0068852_100253030 | 3300005616 | Bacteria | 1688 |
| 349 | Ga0068852_100272698 | 3300005616 | Bacteria | 1629 |
| 350 | Ga0068852_100308173 | 3300005616 | Unclassified | 1534 |
| 351 | Ga0068852_100353971 | 3300005616 | Bacteria | 1434 |
| 352 | Ga0068852_100482548 | 3300005616 | Bacteria | 1232 |
| 353 | Ga0068852_100627740 | 3300005616 | Bacteria | 1080 |
| 354 | Ga0068852_100651310 | 3300005616 | Unclassified | 1061 |
| 355 | Ga0068852_100766566 | 3300005616 | Bacteria | 977 |
| 356 | Ga0068859_100012168 | 3300005617 | Bacteria | 8647 |
| 357 | Ga0068859_100614168 | 3300005617 | Bacteria | 1180 |
| 358 | Ga0068864_100012218 | 3300005618 | Bacteria | 7096 |
| 359 | Ga0068864_100014822 | 3300005618 | Bacteria | 6476 |
| 360 | Ga0068864_100036486 | 3300005618 | Bacteria | 4190 |
| 361 | Ga0068864_100044039 | 3300005618 | Bacteria | 3823 |
| 362 | Ga0068864_100082819 | 3300005618 | Bacteria | 2816 |
| 363 | Ga0068864_100120565 | 3300005618 | Bacteria | 2345 |
| 364 | Ga0068866_10069321 | 3300005718 | Bacteria | 1857 |
| 365 | Ga0068866_10090181 | 3300005718 | Bacteria | 1668 |
| 366 | Ga0068861_100469808 | 3300005719 | Unclassified | 1131 |
| 367 | Ga0068861_100718904 | 3300005719 | Bacteria | 930 |
| 368 | Ga0068851_10005612 | 3300005834 | Bacteria | 5696 |
| 369 | Ga0068851_10028607 | 3300005834 | Bacteria | 2754 |
| 370 | Ga0068851_10047679 | 3300005834 | Bacteria | 2170 |
| 371 | Ga0068851_10050555 | 3300005834 | Bacteria | 2111 |
| 372 | Ga0068851_10221190 | 3300005834 | Bacteria | 1064 |
| 373 | Ga0068851_10222663 | 3300005834 | Bacteria | 1061 |
| 374 | Ga0068870_10117296 | 3300005840 | Bacteria | 1528 |
| 375 | Ga0068863_100006971 | 3300005841 | Bacteria | 11080 |
| 376 | Ga0068863_100029914 | 3300005841 | Bacteria | 5202 |
| 377 | Ga0068863_100066416 | 3300005841 | Bacteria | 3411 |
| 378 | Ga0068863_100149179 | 3300005841 | Bacteria | 2237 |
| 379 | Ga0068863_100924637 | 3300005841 | Bacteria | 873 |
| 380 | Ga0068858_100007473 | 3300005842 | Bacteria | 10564 |
| 381 | Ga0068858_100028311 | 3300005842 | Bacteria | 5205 |
| 382 | Ga0068858_100031238 | 3300005842 | Bacteria | 4945 |
| 383 | Ga0068858_100039224 | 3300005842 | Bacteria | 4393 |
| 384 | Ga0068858_100067395 | 3300005842 | Bacteria | 3315 |
| 385 | Ga0068858_100134742 | 3300005842 | Bacteria | 2317 |
| 386 | Ga0068860_100027079 | 3300005843 | Bacteria | 5523 |
| 387 | Ga0068860_100194061 | 3300005843 | Bacteria | 1966 |
| 388 | Ga0068860_100461109 | 3300005843 | Bacteria | 1264 |
| 389 | Ga0068862_100084138 | 3300005844 | Bacteria | 2764 |
| 390 | Ga0068862_100979743 | 3300005844 | Bacteria | 835 |
| 391 | Ga0081539_10036448 | 3300005985 | Bacteria | 2944 |
| 392 | Ga0081539_10046505 | 3300005985 | Bacteria | 2486 |
| 393 | Ga0070717_10008964 | 3300006028 | Bacteria | 7500 |
| 394 | Ga0070717_10416762 | 3300006028 | Bacteria | 1208 |
| 395 | Ga0070716_100659014 | 3300006173 | Bacteria | 795 |
| 396 | Ga0070712_100172191 | 3300006175 | Bacteria | 1681 |
| 397 | Ga0097621_100056193 | 3300006237 | Bacteria | 3215 |
| 398 | Ga0097621_100060774 | 3300006237 | Bacteria | 3098 |
| 399 | Ga0097621_100370942 | 3300006237 | Bacteria | 1277 |
| 400 | Ga0068871_100005821 | 3300006358 | Bacteria | 8663 |
| 401 | Ga0068871_100113444 | 3300006358 | Bacteria | 2282 |
| 402 | Ga0068871_100328852 | 3300006358 | Bacteria | 1348 |
| 403 | Ga0068865_100003403 | 3300006881 | Bacteria | 9519 |
| 404 | Ga0097620_100012168 | 3300006931 | Bacteria | 8647 |
| 405 | Ga0097620_100614068 | 3300006931 | Bacteria | 1180 |
| 406 | Ga0105240_10031029 | 3300009093 | Bacteria | 6936 |
| 407 | Ga0105240_10044639 | 3300009093 | Bacteria | 5629 |
| 408 | Ga0105240_10053097 | 3300009093 | Bacteria | 5090 |
| 409 | Ga0105240_10148616 | 3300009093 | Bacteria | 2792 |
| 410 | Ga0105245_10004618 | 3300009098 | Bacteria | 12158 |
| 411 | Ga0105245_10263822 | 3300009098 | Bacteria | 1677 |
| 412 | Ga0105247_10419023 | 3300009101 | Bacteria | 958 |
| 413 | Ga0105243_10097294 | 3300009148 | Bacteria | 2436 |
| 414 | Ga0105243_10099429 | 3300009148 | Bacteria | 2411 |
| 415 | Ga0105243_10618992 | 3300009148 | Bacteria | 1045 |
| 416 | Ga0105243_11318304 | 3300009148 | Bacteria | 740 |
| 417 | Ga0105241_10102757 | 3300009174 | Bacteria | 2275 |
| 418 | Ga0105241_10737941 | 3300009174 | Bacteria | 902 |
| 419 | Ga0105242_10005896 | 3300009176 | Bacteria | 9447 |
| 420 | Ga0105242_10119162 | 3300009176 | Bacteria | 2262 |
| 421 | Ga0105248_10000163 | 3300009177 | Bacteria | 77658 |
| 422 | Ga0105248_10001027 | 3300009177 | Bacteria | 30888 |
| 423 | Ga0105248_10012351 | 3300009177 | Bacteria | 9425 |
| 424 | Ga0105248_10030293 | 3300009177 | Bacteria | 6042 |
| 425 | Ga0105248_10067608 | 3300009177 | Bacteria | 4012 |
| 426 | Ga0105248_10260005 | 3300009177 | Bacteria | 1954 |
| 427 | Ga0105248_10273363 | 3300009177 | Bacteria | 1902 |
| 428 | Ga0105248_10334876 | 3300009177 | Bacteria | 1704 |
| 429 | Ga0105248_10348909 | 3300009177 | Bacteria | 1666 |
| 430 | Ga0105248_10551744 | 3300009177 | Bacteria | 1300 |
| 431 | Ga0105237_10043108 | 3300009545 | Bacteria | 4547 |
| 432 | Ga0105238_10007517 | 3300009551 | Bacteria | 10916 |
| 433 | Ga0105238_10011563 | 3300009551 | Bacteria | 8894 |
| 434 | Ga0105238_10041382 | 3300009551 | Bacteria | 4666 |
| 435 | Ga0105238_10075424 | 3300009551 | Bacteria | 3364 |
| 436 | Ga0105238_10150554 | 3300009551 | Bacteria | 2302 |
| 437 | Ga0105238_10753635 | 3300009551 | Bacteria | 988 |
| 438 | Ga0105238_10945471 | 3300009551 | Bacteria | 881 |
| 439 | Ga0105238_11139979 | 3300009551 | Bacteria | 803 |
| 440 | Ga0105239_10038047 | 3300010375 | Bacteria | 5272 |
| 441 | Ga0105239_10084583 | 3300010375 | Bacteria | 3494 |
| 442 | Ga0105246_10161761 | 3300011119 | Bacteria | 1706 |
| 443 | Ga0157315_1019661 | 3300012508 | Bacteria | 702 |
| 444 | Ga0157373_10001899 | 3300013100 | Bacteria | 15862 |
| 445 | Ga0157373_10009283 | 3300013100 | Bacteria | 7272 |
| 446 | Ga0157373_10037379 | 3300013100 | Bacteria | 3480 |
| 447 | Ga0157373_10055698 | 3300013100 | Bacteria | 2809 |
| 448 | Ga0157373_10074694 | 3300013100 | Bacteria | 2391 |
| 449 | Ga0157373_10087659 | 3300013100 | Bacteria | 2193 |
| 450 | Ga0157373_10111140 | 3300013100 | Bacteria | 1927 |
| 451 | Ga0157373_10309083 | 3300013100 | Bacteria | 1123 |
| 452 | Ga0157373_10367654 | 3300013100 | Bacteria | 1027 |
| 453 | Ga0157373_10383629 | 3300013100 | Bacteria | 1005 |
| 454 | Ga0157373_10415158 | 3300013100 | Bacteria | 966 |
| 455 | Ga0157373_10468256 | 3300013100 | Bacteria | 908 |
| 456 | Ga0157373_10495606 | 3300013100 | Bacteria | 882 |
| 457 | Ga0157373_10881036 | 3300013100 | Bacteria | 663 |
| 458 | Ga0157373_10901235 | 3300013100 | Bacteria | 656 |
| 459 | Ga0157371_10000722 | 3300013102 | Bacteria | 38724 |
| 460 | Ga0157371_10018575 | 3300013102 | Bacteria | 5137 |
| 461 | Ga0157371_10045813 | 3300013102 | Bacteria | 3112 |
| 462 | Ga0157371_10045962 | 3300013102 | Bacteria | 3106 |
| 463 | Ga0157371_10050463 | 3300013102 | Bacteria | 2957 |
| 464 | Ga0157371_10083923 | 3300013102 | Bacteria | 2256 |
| 465 | Ga0157371_10085547 | 3300013102 | Bacteria | 2234 |
| 466 | Ga0157371_10175831 | 3300013102 | Bacteria | 1530 |
| 467 | Ga0157371_10206211 | 3300013102 | Bacteria | 1410 |
| 468 | Ga0157371_10379030 | 3300013102 | Bacteria | 1032 |
| 469 | Ga0157371_10489200 | 3300013102 | Bacteria | 908 |
| 470 | Ga0157371_10732572 | 3300013102 | Bacteria | 742 |
| 471 | Ga0157370_10002132 | 3300013104 | Bacteria | 24152 |
| 472 | Ga0157370_10011123 | 3300013104 | Bacteria | 9433 |
| 473 | Ga0157370_10044051 | 3300013104 | Bacteria | 4292 |
| 474 | Ga0157370_10044564 | 3300013104 | Bacteria | 4262 |
| 475 | Ga0157370_10065474 | 3300013104 | Bacteria | 3438 |
| 476 | Ga0157370_10121323 | 3300013104 | Bacteria | 2440 |
| 477 | Ga0157370_10251893 | 3300013104 | Bacteria | 1633 |
| 478 | Ga0157370_10288662 | 3300013104 | Bacteria | 1515 |
| 479 | Ga0157370_10557877 | 3300013104 | Bacteria | 1050 |
| 480 | Ga0157370_10766430 | 3300013104 | Unclassified | 879 |
| 481 | Ga0157369_10002370 | 3300013105 | Bacteria | 22641 |
| 482 | Ga0157369_10003475 | 3300013105 | Bacteria | 18690 |
| 483 | Ga0157369_10016327 | 3300013105 | Bacteria | 8356 |
| 484 | Ga0157369_10029281 | 3300013105 | Bacteria | 6086 |
| 485 | Ga0157369_10063321 | 3300013105 | Bacteria | 3985 |
| 486 | Ga0157369_10104170 | 3300013105 | Bacteria | 3022 |
| 487 | Ga0157369_10125589 | 3300013105 | Bacteria | 2720 |
| 488 | Ga0157369_10131001 | 3300013105 | Bacteria | 2658 |
| 489 | Ga0157369_10266589 | 3300013105 | Bacteria | 1786 |
| 490 | Ga0157369_10390730 | 3300013105 | Bacteria | 1443 |
| 491 | Ga0157369_10546596 | 3300013105 | Bacteria | 1197 |
| 492 | Ga0157369_11408535 | 3300013105 | Bacteria | 710 |
| 493 | Ga0157369_11413402 | 3300013105 | Bacteria | 708 |
| 494 | Ga0157369_11547678 | 3300013105 | Bacteria | 674 |
| 495 | Ga0157374_10033021 | 3300013296 | Bacteria | 4719 |
| 496 | Ga0157374_10089463 | 3300013296 | Bacteria | 2933 |
| 497 | Ga0157374_10169847 | 3300013296 | Bacteria | 2127 |
| 498 | Ga0157374_10387138 | 3300013296 | Bacteria | 1393 |
| 499 | Ga0157378_10669215 | 3300013297 | Bacteria | 1055 |
| 500 | Ga0163162_10014842 | 3300013306 | Bacteria | 7607 |
| 501 | Ga0163162_10021028 | 3300013306 | Bacteria | 6418 |
| 502 | Ga0163162_10026415 | 3300013306 | Bacteria | 5737 |
| 503 | Ga0163162_11192906 | 3300013306 | Bacteria | 864 |
| 504 | Ga0157372_10019012 | 3300013307 | Bacteria | 7395 |
| 505 | Ga0157372_10052353 | 3300013307 | Bacteria | 4545 |
| 506 | Ga0157372_10156877 | 3300013307 | Bacteria | 2629 |
| 507 | Ga0157372_10170221 | 3300013307 | Bacteria | 2520 |
| 508 | Ga0157372_10186546 | 3300013307 | Bacteria | 2402 |
| 509 | Ga0157372_10198890 | 3300013307 | Bacteria | 2321 |
| 510 | Ga0157372_10239273 | 3300013307 | Bacteria | 2106 |
| 511 | Ga0157372_10516489 | 3300013307 | Bacteria | 1392 |
| 512 | Ga0157372_10816097 | 3300013307 | Unclassified | 1083 |
| 513 | Ga0157372_10965634 | 3300013307 | Bacteria | 988 |
| 514 | Ga0157372_11273593 | 3300013307 | Bacteria | 849 |
| 515 | Ga0157375_10002761 | 3300013308 | Bacteria | 15188 |
| 516 | Ga0157375_10034318 | 3300013308 | Bacteria | 4833 |
| 517 | Ga0157375_10200863 | 3300013308 | Bacteria | 2150 |
| 518 | Ga0157375_11475269 | 3300013308 | Bacteria | 802 |
| 519 | Ga0163163_10000173 | 3300014325 | Bacteria | 67717 |
| 520 | Ga0163163_10051669 | 3300014325 | Bacteria | 4052 |
| 521 | Ga0163163_10186225 | 3300014325 | Bacteria | 2124 |
| 522 | Ga0163163_10191172 | 3300014325 | Bacteria | 2095 |
| 523 | Ga0163163_10415726 | 3300014325 | Bacteria | 1403 |
| 524 | Ga0157380_10379370 | 3300014326 | Bacteria | 1334 |
| 525 | Ga0157380_10454426 | 3300014326 | Bacteria | 1231 |
| 526 | Ga0157379_10065182 | 3300014968 | Bacteria | 3256 |
| 527 | Ga0157379_10134024 | 3300014968 | Bacteria | 2231 |
| 528 | Ga0157376_10053140 | 3300014969 | Bacteria | 3372 |
| 529 | Ga0163161_10025329 | 3300017792 | Bacteria | 4198 |
| 530 | Ga0206356_11441584 | 3300020070 | Bacteria | 2171 |
| 531 | Ga0206353_11057767 | 3300020082 | Bacteria | 1965 |
| 532 | Ga0206353_11361306 | 3300020082 | Bacteria | 1541 |
| 533 | Ga0207697_10209462 | 3300025315 | Bacteria | 859 |
| 534 | Ga0207656_10002362 | 3300025321 | Bacteria | 6334 |
| 535 | Ga0207656_10145842 | 3300025321 | Bacteria | 1118 |
| 536 | Ga0207656_10215377 | 3300025321 | Bacteria | 932 |
| 537 | Ga0207682_10028201 | 3300025893 | Bacteria | 2240 |
| 538 | Ga0207682_10043094 | 3300025893 | Bacteria | 1846 |
| 539 | Ga0207682_10086460 | 3300025893 | Bacteria | 1352 |
| 540 | Ga0207642_10042182 | 3300025899 | Bacteria | 2003 |
| 541 | Ga0207642_10046436 | 3300025899 | Bacteria | 1935 |
| 542 | Ga0207642_10396772 | 3300025899 | Bacteria | 825 |
| 543 | Ga0207688_10032435 | 3300025901 | Bacteria | 2887 |
| 544 | Ga0207688_10090427 | 3300025901 | Bacteria | 1757 |
| 545 | Ga0207688_10569129 | 3300025901 | Unclassified | 713 |
| 546 | Ga0207688_10598624 | 3300025901 | Bacteria | 695 |
| 547 | Ga0207680_10000588 | 3300025903 | Bacteria | 17169 |
| 548 | Ga0207680_10002808 | 3300025903 | Bacteria | 8149 |
| 549 | Ga0207680_10005390 | 3300025903 | Bacteria | 6110 |
| 550 | Ga0207680_10024995 | 3300025903 | Bacteria | 3289 |
| 551 | Ga0207680_10057354 | 3300025903 | Bacteria | 2356 |
| 552 | Ga0207647_10000578 | 3300025904 | Bacteria | 28535 |
| 553 | Ga0207647_10000847 | 3300025904 | Bacteria | 23725 |
| 554 | Ga0207647_10008433 | 3300025904 | Bacteria | 7393 |
| 555 | Ga0207647_10014698 | 3300025904 | Bacteria | 5391 |
| 556 | Ga0207647_10025891 | 3300025904 | Bacteria | 3845 |
| 557 | Ga0207647_10077026 | 3300025904 | Bacteria | 2005 |
| 558 | Ga0207647_10210630 | 3300025904 | Bacteria | 1122 |
| 559 | Ga0207647_10234107 | 3300025904 | Unclassified | 1056 |
| 560 | Ga0207647_10257442 | 3300025904 | Bacteria | 1000 |
| 561 | Ga0207699_10233637 | 3300025906 | Bacteria | 1260 |
| 562 | Ga0207699_10391302 | 3300025906 | Bacteria | 988 |
| 563 | Ga0207645_10274253 | 3300025907 | Bacteria | 1119 |
| 564 | Ga0207705_10000114 | 3300025909 | Bacteria | 90132 |
| 565 | Ga0207705_10003467 | 3300025909 | Bacteria | 11996 |
| 566 | Ga0207705_10005572 | 3300025909 | Bacteria | 9409 |
| 567 | Ga0207705_10013148 | 3300025909 | Bacteria | 5975 |
| 568 | Ga0207705_10016862 | 3300025909 | Bacteria | 5232 |
| 569 | Ga0207705_10025558 | 3300025909 | Bacteria | 4213 |
| 570 | Ga0207705_10027307 | 3300025909 | Bacteria | 4071 |
| 571 | Ga0207705_10044210 | 3300025909 | Bacteria | 3201 |
| 572 | Ga0207705_10050687 | 3300025909 | Bacteria | 2988 |
| 573 | Ga0207705_10064937 | 3300025909 | Bacteria | 2638 |
| 574 | Ga0207705_10072788 | 3300025909 | Bacteria | 2493 |
| 575 | Ga0207705_10099178 | 3300025909 | Bacteria | 2141 |
| 576 | Ga0207705_10144254 | 3300025909 | Bacteria | 1780 |
| 577 | Ga0207705_10294887 | 3300025909 | Bacteria | 1243 |
| 578 | Ga0207705_10346894 | 3300025909 | Bacteria | 1143 |
| 579 | Ga0207705_10437624 | 3300025909 | Bacteria | 1013 |
| 580 | Ga0207705_10603019 | 3300025909 | Bacteria | 854 |
| 581 | Ga0207654_10044299 | 3300025911 | Bacteria | 2526 |
| 582 | Ga0207707_10012721 | 3300025912 | Bacteria | 7315 |
| 583 | Ga0207707_10029074 | 3300025912 | Bacteria | 4830 |
| 584 | Ga0207707_10069874 | 3300025912 | Bacteria | 3060 |
| 585 | Ga0207707_10173136 | 3300025912 | Bacteria | 1886 |
| 586 | Ga0207695_10005878 | 3300025913 | Bacteria | 16097 |
| 587 | Ga0207695_10034616 | 3300025913 | Bacteria | 5490 |
| 588 | Ga0207695_10093678 | 3300025913 | Bacteria | 3013 |
| 589 | Ga0207695_10246193 | 3300025913 | Bacteria | 1688 |
| 590 | Ga0207671_10018993 | 3300025914 | Bacteria | 5266 |
| 591 | Ga0207671_10308690 | 3300025914 | Bacteria | 1250 |
| 592 | Ga0207693_10132028 | 3300025915 | Bacteria | 1963 |
| 593 | Ga0207660_10003154 | 3300025917 | Bacteria | 10795 |
| 594 | Ga0207660_10004089 | 3300025917 | Bacteria | 9501 |
| 595 | Ga0207660_10015179 | 3300025917 | Bacteria | 5081 |
| 596 | Ga0207660_10034564 | 3300025917 | Bacteria | 3505 |
| 597 | Ga0207660_10117354 | 3300025917 | Bacteria | 2011 |
| 598 | Ga0207660_10617651 | 3300025917 | Bacteria | 883 |
| 599 | Ga0207662_10117121 | 3300025918 | Bacteria | 1667 |
| 600 | Ga0207657_10000071 | 3300025919 | Bacteria | 93725 |
| 601 | Ga0207657_10001850 | 3300025919 | Bacteria | 22857 |
| 602 | Ga0207657_10003997 | 3300025919 | Bacteria | 15678 |
| 603 | Ga0207657_10004553 | 3300025919 | Bacteria | 14654 |
| 604 | Ga0207657_10005304 | 3300025919 | Bacteria | 13508 |
| 605 | Ga0207657_10005926 | 3300025919 | Bacteria | 12724 |
| 606 | Ga0207657_10008351 | 3300025919 | Bacteria | 10517 |
| 607 | Ga0207657_10012074 | 3300025919 | Bacteria | 8542 |
| 608 | Ga0207657_10012753 | 3300025919 | Bacteria | 8277 |
| 609 | Ga0207657_10012849 | 3300025919 | Bacteria | 8238 |
| 610 | Ga0207657_10015172 | 3300025919 | Bacteria | 7479 |
| 611 | Ga0207657_10038415 | 3300025919 | Bacteria | 4261 |
| 612 | Ga0207657_10048536 | 3300025919 | Bacteria | 3706 |
| 613 | Ga0207657_10080570 | 3300025919 | Bacteria | 2736 |
| 614 | Ga0207657_10113551 | 3300025919 | Bacteria | 2235 |
| 615 | Ga0207657_10147868 | 3300025919 | Bacteria | 1915 |
| 616 | Ga0207657_10164372 | 3300025919 | Bacteria | 1801 |
| 617 | Ga0207657_10365276 | 3300025919 | Bacteria | 1137 |
| 618 | Ga0207649_10000301 | 3300025920 | Bacteria | 37967 |
| 619 | Ga0207649_10006013 | 3300025920 | Bacteria | 6585 |
| 620 | Ga0207649_10007161 | 3300025920 | Bacteria | 6062 |
| 621 | Ga0207649_10025118 | 3300025920 | Bacteria | 3470 |
| 622 | Ga0207649_10025467 | 3300025920 | Bacteria | 3449 |
| 623 | Ga0207649_10088400 | 3300025920 | Bacteria | 2023 |
| 624 | Ga0207649_10110005 | 3300025920 | Bacteria | 1839 |
| 625 | Ga0207649_10146042 | 3300025920 | Bacteria | 1624 |
| 626 | Ga0207649_10261287 | 3300025920 | Bacteria | 1251 |
| 627 | Ga0207649_10305354 | 3300025920 | Bacteria | 1165 |
| 628 | Ga0207649_10534170 | 3300025920 | Bacteria | 895 |
| 629 | Ga0207652_10038052 | 3300025921 | Bacteria | 4075 |
| 630 | Ga0207652_10055667 | 3300025921 | Bacteria | 3403 |
| 631 | Ga0207652_10068217 | 3300025921 | Bacteria | 3085 |
| 632 | Ga0207652_10099772 | 3300025921 | Bacteria | 2563 |
| 633 | Ga0207652_10177448 | 3300025921 | Bacteria | 1913 |
| 634 | Ga0207652_10294419 | 3300025921 | Bacteria | 1465 |
| 635 | Ga0207652_10391083 | 3300025921 | Bacteria | 1255 |
| 636 | Ga0207681_10068598 | 3300025923 | Bacteria | 2464 |
| 637 | Ga0207681_10924529 | 3300025923 | Bacteria | 731 |
| 638 | Ga0207694_10030955 | 3300025924 | Bacteria | 4086 |
| 639 | Ga0207694_10169287 | 3300025924 | Bacteria | 1768 |
| 640 | Ga0207694_10414689 | 3300025924 | Unclassified | 1121 |
| 641 | Ga0207694_10914879 | 3300025924 | Bacteria | 742 |
| 642 | Ga0207650_10003748 | 3300025925 | Bacteria | 10396 |
| 643 | Ga0207650_10029991 | 3300025925 | Bacteria | 3914 |
| 644 | Ga0207650_10101879 | 3300025925 | Bacteria | 2211 |
| 645 | Ga0207650_10138604 | 3300025925 | Bacteria | 1910 |
| 646 | Ga0207650_10148312 | 3300025925 | Bacteria | 1849 |
| 647 | Ga0207650_10170908 | 3300025925 | Bacteria | 1727 |
| 648 | Ga0207650_10264356 | 3300025925 | Bacteria | 1396 |
| 649 | Ga0207650_10335020 | 3300025925 | Bacteria | 1242 |
| 650 | Ga0207650_10409271 | 3300025925 | Bacteria | 1124 |
| 651 | Ga0207659_10026064 | 3300025926 | Bacteria | 3940 |
| 652 | Ga0207659_10040228 | 3300025926 | Bacteria | 3267 |
| 653 | Ga0207687_10025968 | 3300025927 | Bacteria | 3921 |
| 654 | Ga0207687_10038311 | 3300025927 | Bacteria | 3276 |
| 655 | Ga0207687_10151581 | 3300025927 | Bacteria | 1769 |
| 656 | Ga0207687_10273564 | 3300025927 | Bacteria | 1351 |
| 657 | Ga0207700_10043741 | 3300025928 | Bacteria | 3292 |
| 658 | Ga0207700_10066670 | 3300025928 | Bacteria | 2752 |
| 659 | Ga0207700_10823397 | 3300025928 | Bacteria | 830 |
| 660 | Ga0207664_10048381 | 3300025929 | Bacteria | 3343 |
| 661 | Ga0207664_10125113 | 3300025929 | Bacteria | 2157 |
| 662 | Ga0207664_10138033 | 3300025929 | Bacteria | 2059 |
| 663 | Ga0207664_10140772 | 3300025929 | Bacteria | 2040 |
| 664 | Ga0207664_10159852 | 3300025929 | Bacteria | 1921 |
| 665 | Ga0207644_10000938 | 3300025931 | Bacteria | 18557 |
| 666 | Ga0207644_10001286 | 3300025931 | Bacteria | 16154 |
| 667 | Ga0207644_10025546 | 3300025931 | Bacteria | 4061 |
| 668 | Ga0207644_10030490 | 3300025931 | Bacteria | 3751 |
| 669 | Ga0207644_10041678 | 3300025931 | Bacteria | 3249 |
| 670 | Ga0207644_10065238 | 3300025931 | Bacteria | 2647 |
| 671 | Ga0207644_10251506 | 3300025931 | Bacteria | 1410 |
| 672 | Ga0207644_10527233 | 3300025931 | Bacteria | 976 |
| 673 | Ga0207690_10000036 | 3300025932 | Bacteria | 143853 |
| 674 | Ga0207690_10001260 | 3300025932 | Bacteria | 16012 |
| 675 | Ga0207690_10001587 | 3300025932 | Bacteria | 14199 |
| 676 | Ga0207690_10007965 | 3300025932 | Bacteria | 6290 |
| 677 | Ga0207690_10008227 | 3300025932 | Bacteria | 6187 |
| 678 | Ga0207690_10012259 | 3300025932 | Bacteria | 5129 |
| 679 | Ga0207690_10025527 | 3300025932 | Bacteria | 3712 |
| 680 | Ga0207690_10035858 | 3300025932 | Unclassified | 3208 |
| 681 | Ga0207690_10056492 | 3300025932 | Bacteria | 2648 |
| 682 | Ga0207690_10060651 | 3300025932 | Bacteria | 2568 |
| 683 | Ga0207690_10067734 | 3300025932 | Bacteria | 2450 |
| 684 | Ga0207690_10096499 | 3300025932 | Bacteria | 2102 |
| 685 | Ga0207690_10189332 | 3300025932 | Bacteria | 1555 |
| 686 | Ga0207706_10000086 | 3300025933 | Bacteria | 95284 |
| 687 | Ga0207706_10000655 | 3300025933 | Bacteria | 36583 |
| 688 | Ga0207706_10001832 | 3300025933 | Bacteria | 20857 |
| 689 | Ga0207706_10005579 | 3300025933 | Bacteria | 11723 |
| 690 | Ga0207706_10012577 | 3300025933 | Bacteria | 7705 |
| 691 | Ga0207706_10074739 | 3300025933 | Bacteria | 2979 |
| 692 | Ga0207706_10096045 | 3300025933 | Bacteria | 2606 |
| 693 | Ga0207706_10110508 | 3300025933 | Bacteria | 2418 |
| 694 | Ga0207706_10140896 | 3300025933 | Bacteria | 2121 |
| 695 | Ga0207706_10229056 | 3300025933 | Bacteria | 1626 |
| 696 | Ga0207706_10258780 | 3300025933 | Bacteria | 1519 |
| 697 | Ga0207706_10400563 | 3300025933 | Bacteria | 1190 |
| 698 | Ga0207706_10443685 | 3300025933 | Bacteria | 1123 |
| 699 | Ga0207706_10455759 | 3300025933 | Bacteria | 1106 |
| 700 | Ga0207706_10543975 | 3300025933 | Bacteria | 1000 |
| 701 | Ga0207706_10591090 | 3300025933 | Bacteria | 954 |
| 702 | Ga0207706_10727873 | 3300025933 | Bacteria | 846 |
| 703 | Ga0207706_10894271 | 3300025933 | Bacteria | 750 |
| 704 | Ga0207706_10898298 | 3300025933 | Bacteria | 748 |
| 705 | Ga0207686_10026775 | 3300025934 | Bacteria | 3368 |
| 706 | Ga0207670_10183621 | 3300025936 | Bacteria | 1577 |
| 707 | Ga0207669_10005727 | 3300025937 | Bacteria | 5604 |
| 708 | Ga0207669_10048608 | 3300025937 | Bacteria | 2521 |
| 709 | Ga0207669_10245713 | 3300025937 | Bacteria | 1329 |
| 710 | Ga0207704_10012057 | 3300025938 | Bacteria | 4279 |
| 711 | Ga0207665_10434000 | 3300025939 | Bacteria | 1005 |
| 712 | Ga0207691_10005925 | 3300025940 | Bacteria | 11800 |
| 713 | Ga0207691_10008686 | 3300025940 | Bacteria | 9745 |
| 714 | Ga0207691_10016083 | 3300025940 | Bacteria | 7108 |
| 715 | Ga0207691_10018849 | 3300025940 | Bacteria | 6536 |
| 716 | Ga0207691_10069147 | 3300025940 | Bacteria | 3190 |
| 717 | Ga0207691_10077435 | 3300025940 | Bacteria | 2996 |
| 718 | Ga0207691_10141556 | 3300025940 | Bacteria | 2119 |
| 719 | Ga0207691_10260460 | 3300025940 | Bacteria | 1495 |
| 720 | Ga0207691_10283555 | 3300025940 | Unclassified | 1425 |
| 721 | Ga0207691_10315532 | 3300025940 | Bacteria | 1341 |
| 722 | Ga0207711_10001440 | 3300025941 | Bacteria | 22257 |
| 723 | Ga0207711_10004448 | 3300025941 | Bacteria | 11946 |
| 724 | Ga0207711_10014281 | 3300025941 | Bacteria | 6598 |
| 725 | Ga0207711_10023657 | 3300025941 | Bacteria | 5144 |
| 726 | Ga0207711_10033338 | 3300025941 | Bacteria | 4357 |
| 727 | Ga0207711_10073648 | 3300025941 | Bacteria | 2969 |
| 728 | Ga0207711_10183475 | 3300025941 | Bacteria | 1904 |
| 729 | Ga0207711_10297295 | 3300025941 | Bacteria | 1489 |
| 730 | Ga0207711_10473772 | 3300025941 | Bacteria | 1166 |
| 731 | Ga0207661_10001017 | 3300025944 | Bacteria | 18588 |
| 732 | Ga0207661_10041499 | 3300025944 | Bacteria | 3622 |
| 733 | Ga0207661_10079255 | 3300025944 | Bacteria | 2707 |
| 734 | Ga0207661_10145748 | 3300025944 | Bacteria | 2042 |
| 735 | Ga0207661_10152490 | 3300025944 | Bacteria | 1998 |
| 736 | Ga0207661_10157332 | 3300025944 | Bacteria | 1969 |
| 737 | Ga0207661_10170151 | 3300025944 | Bacteria | 1896 |
| 738 | Ga0207661_10289625 | 3300025944 | Bacteria | 1465 |
| 739 | Ga0207661_10565455 | 3300025944 | Bacteria | 1042 |
| 740 | Ga0207661_10835364 | 3300025944 | Bacteria | 848 |
| 741 | Ga0207679_10001003 | 3300025945 | Bacteria | 18128 |
| 742 | Ga0207679_10007564 | 3300025945 | Bacteria | 6895 |
| 743 | Ga0207679_10012180 | 3300025945 | Bacteria | 5600 |
| 744 | Ga0207679_10022450 | 3300025945 | Bacteria | 4298 |
| 745 | Ga0207679_10031643 | 3300025945 | Bacteria | 3705 |
| 746 | Ga0207679_10035299 | 3300025945 | Bacteria | 3536 |
| 747 | Ga0207679_10074095 | 3300025945 | Bacteria | 2578 |
| 748 | Ga0207679_10096517 | 3300025945 | Bacteria | 2300 |
| 749 | Ga0207679_10115276 | 3300025945 | Bacteria | 2128 |
| 750 | Ga0207679_10219517 | 3300025945 | Bacteria | 1599 |
| 751 | Ga0207679_10407233 | 3300025945 | Bacteria | 1197 |
| 752 | Ga0207679_10649255 | 3300025945 | Bacteria | 954 |
| 753 | Ga0207679_10812337 | 3300025945 | Bacteria | 853 |
| 754 | Ga0207667_10020463 | 3300025949 | Bacteria | 7358 |
| 755 | Ga0207667_10020839 | 3300025949 | Bacteria | 7279 |
| 756 | Ga0207667_10047180 | 3300025949 | Bacteria | 4560 |
| 757 | Ga0207667_10047561 | 3300025949 | Bacteria | 4540 |
| 758 | Ga0207667_10076725 | 3300025949 | Bacteria | 3467 |
| 759 | Ga0207667_10142347 | 3300025949 | Bacteria | 2469 |
| 760 | Ga0207667_10237097 | 3300025949 | Unclassified | 1867 |
| 761 | Ga0207667_10314940 | 3300025949 | Bacteria | 1598 |
| 762 | Ga0207667_10535997 | 3300025949 | Bacteria | 1185 |
| 763 | Ga0207667_10704323 | 3300025949 | Bacteria | 1012 |
| 764 | Ga0207667_11185691 | 3300025949 | Bacteria | 744 |
| 765 | Ga0207651_10000835 | 3300025960 | Bacteria | 13378 |
| 766 | Ga0207651_10008691 | 3300025960 | Bacteria | 5504 |
| 767 | Ga0207651_10033050 | 3300025960 | Bacteria | 3331 |
| 768 | Ga0207651_10039416 | 3300025960 | Bacteria | 3115 |
| 769 | Ga0207651_10113312 | 3300025960 | Bacteria | 2040 |
| 770 | Ga0207651_10243792 | 3300025960 | Bacteria | 1466 |
| 771 | Ga0207651_10715936 | 3300025960 | Bacteria | 883 |
| 772 | Ga0207651_10722058 | 3300025960 | Unclassified | 879 |
| 773 | Ga0207651_10954083 | 3300025960 | Bacteria | 765 |
| 774 | Ga0207668_10225992 | 3300025972 | Bacteria | 1506 |
| 775 | Ga0207668_10793464 | 3300025972 | Bacteria | 838 |
| 776 | Ga0207640_10001884 | 3300025981 | Bacteria | 11249 |
| 777 | Ga0207640_10011360 | 3300025981 | Bacteria | 5041 |
| 778 | Ga0207640_10031247 | 3300025981 | Bacteria | 3288 |
| 779 | Ga0207640_10046080 | 3300025981 | Bacteria | 2803 |
| 780 | Ga0207640_10067381 | 3300025981 | Bacteria | 2395 |
| 781 | Ga0207640_10286422 | 3300025981 | Bacteria | 1297 |
| 782 | Ga0207640_10382081 | 3300025981 | Bacteria | 1141 |
| 783 | Ga0207640_10399946 | 3300025981 | Bacteria | 1118 |
| 784 | Ga0207640_10780272 | 3300025981 | Unclassified | 826 |
| 785 | Ga0207658_10005223 | 3300025986 | Bacteria | 8931 |
| 786 | Ga0207658_10028732 | 3300025986 | Bacteria | 3920 |
| 787 | Ga0207658_10031024 | 3300025986 | Bacteria | 3791 |
| 788 | Ga0207658_10094571 | 3300025986 | Bacteria | 2326 |
| 789 | Ga0207658_10130315 | 3300025986 | Bacteria | 2019 |
| 790 | Ga0207658_10168970 | 3300025986 | Bacteria | 1800 |
| 791 | Ga0207658_10281026 | 3300025986 | Unclassified | 1427 |
| 792 | Ga0207658_10451618 | 3300025986 | Unclassified | 1138 |
| 793 | Ga0207677_10000756 | 3300026023 | Bacteria | 18615 |
| 794 | Ga0207677_10003910 | 3300026023 | Bacteria | 7935 |
| 795 | Ga0207677_10045549 | 3300026023 | Bacteria | 2930 |
| 796 | Ga0207677_10218062 | 3300026023 | Bacteria | 1528 |
| 797 | Ga0207677_10278500 | 3300026023 | Bacteria | 1372 |
| 798 | Ga0207703_10002376 | 3300026035 | Bacteria | 16368 |
| 799 | Ga0207703_10004143 | 3300026035 | Bacteria | 11960 |
| 800 | Ga0207703_10022384 | 3300026035 | Bacteria | 4957 |
| 801 | Ga0207703_10030255 | 3300026035 | Bacteria | 4278 |
| 802 | Ga0207703_10958366 | 3300026035 | Bacteria | 820 |
| 803 | Ga0207639_10001003 | 3300026041 | Bacteria | 19193 |
| 804 | Ga0207639_10085686 | 3300026041 | Bacteria | 2506 |
| 805 | Ga0207639_10096809 | 3300026041 | Bacteria | 2375 |
| 806 | Ga0207639_10100044 | 3300026041 | Bacteria | 2341 |
| 807 | Ga0207639_10130406 | 3300026041 | Bacteria | 2080 |
| 808 | Ga0207639_10211114 | 3300026041 | Bacteria | 1671 |
| 809 | Ga0207639_10400529 | 3300026041 | Bacteria | 1236 |
| 810 | Ga0207639_10542121 | 3300026041 | Unclassified | 1067 |
| 811 | Ga0207678_10000311 | 3300026067 | Bacteria | 43860 |
| 812 | Ga0207678_10000860 | 3300026067 | Bacteria | 27872 |
| 813 | Ga0207678_10010899 | 3300026067 | Bacteria | 7987 |
| 814 | Ga0207678_10015794 | 3300026067 | Bacteria | 6637 |
| 815 | Ga0207678_10018362 | 3300026067 | Bacteria | 6142 |
| 816 | Ga0207678_10031397 | 3300026067 | Bacteria | 4633 |
| 817 | Ga0207678_10045759 | 3300026067 | Bacteria | 3784 |
| 818 | Ga0207678_10155907 | 3300026067 | Bacteria | 1950 |
| 819 | Ga0207678_10180040 | 3300026067 | Bacteria | 1805 |
| 820 | Ga0207678_10363316 | 3300026067 | Bacteria | 1249 |
| 821 | Ga0207702_10000254 | 3300026078 | Bacteria | 61680 |
| 822 | Ga0207702_10026383 | 3300026078 | Bacteria | 4823 |
| 823 | Ga0207702_10058590 | 3300026078 | Bacteria | 3278 |
| 824 | Ga0207702_10082571 | 3300026078 | Bacteria | 2794 |
| 825 | Ga0207702_10124805 | 3300026078 | Bacteria | 2309 |
| 826 | Ga0207702_10212041 | 3300026078 | Bacteria | 1801 |
| 827 | Ga0207702_10216363 | 3300026078 | Bacteria | 1783 |
| 828 | Ga0207702_10337051 | 3300026078 | Bacteria | 1440 |
| 829 | Ga0207702_10421497 | 3300026078 | Unclassified | 1291 |
| 830 | Ga0207641_10050807 | 3300026088 | Bacteria | 3509 |
| 831 | Ga0207641_10170090 | 3300026088 | Bacteria | 1988 |
| 832 | Ga0207641_10277997 | 3300026088 | Bacteria | 1573 |
| 833 | Ga0207641_11358746 | 3300026088 | Bacteria | 711 |
| 834 | Ga0207648_10002294 | 3300026089 | Bacteria | 20667 |
| 835 | Ga0207648_10082565 | 3300026089 | Bacteria | 2802 |
| 836 | Ga0207648_10279144 | 3300026089 | Bacteria | 1494 |
| 837 | Ga0207648_11160018 | 3300026089 | Bacteria | 725 |
| 838 | Ga0207676_10003616 | 3300026095 | Bacteria | 10929 |
| 839 | Ga0207676_10010907 | 3300026095 | Bacteria | 6482 |
| 840 | Ga0207676_10014877 | 3300026095 | Bacteria | 5605 |
| 841 | Ga0207676_10056032 | 3300026095 | Bacteria | 3097 |
| 842 | Ga0207676_10058487 | 3300026095 | Unclassified | 3041 |
| 843 | Ga0207676_10131413 | 3300026095 | Bacteria | 2129 |
| 844 | Ga0207676_10502540 | 3300026095 | Bacteria | 1151 |
| 845 | Ga0207674_10005176 | 3300026116 | Bacteria | 15535 |
| 846 | Ga0207674_10005543 | 3300026116 | Bacteria | 14983 |
| 847 | Ga0207674_10007065 | 3300026116 | Bacteria | 13122 |
| 848 | Ga0207674_10007931 | 3300026116 | Bacteria | 12328 |
| 849 | Ga0207674_10024605 | 3300026116 | Bacteria | 6431 |
| 850 | Ga0207674_10219475 | 3300026116 | Bacteria | 1849 |
| 851 | Ga0207674_10237068 | 3300026116 | Bacteria | 1772 |
| 852 | Ga0207675_100213003 | 3300026118 | Bacteria | 1859 |
| 853 | Ga0207683_10001310 | 3300026121 | Bacteria | 22492 |
| 854 | Ga0207683_10003597 | 3300026121 | Bacteria | 13507 |
| 855 | Ga0207683_10011050 | 3300026121 | Bacteria | 7694 |
| 856 | Ga0207683_10031941 | 3300026121 | Bacteria | 4572 |
| 857 | Ga0207683_10089353 | 3300026121 | Bacteria | 2742 |
| 858 | Ga0207683_10250062 | 3300026121 | Bacteria | 1618 |
| 859 | Ga0207683_10405302 | 3300026121 | Bacteria | 1255 |
| 860 | Ga0207683_10837032 | 3300026121 | Bacteria | 854 |
| 861 | Ga0207698_10003268 | 3300026142 | Bacteria | 9741 |
| 862 | Ga0207698_10008079 | 3300026142 | Bacteria | 6637 |
| 863 | Ga0207698_10012833 | 3300026142 | Bacteria | 5503 |
| 864 | Ga0207698_10029712 | 3300026142 | Bacteria | 3918 |
| 865 | Ga0207698_10049084 | 3300026142 | Bacteria | 3209 |
| 866 | Ga0207698_10084138 | 3300026142 | Bacteria | 2578 |
| 867 | Ga0207698_10175868 | 3300026142 | Unclassified | 1890 |
| 868 | Ga0207698_10268608 | 3300026142 | Bacteria | 1571 |
| 869 | Ga0207698_10347339 | 3300026142 | Bacteria | 1400 |
| 870 | Ga0207698_10376473 | 3300026142 | Bacteria | 1349 |
| 871 | Ga0207698_10579905 | 3300026142 | Bacteria | 1103 |
| 872 | Ga0207698_10845936 | 3300026142 | Bacteria | 920 |
| 873 | Ga0207698_11071303 | 3300026142 | Bacteria | 818 |
| 874 | Ga0207698_11386753 | 3300026142 | Unclassified | 718 |
| 875 | Ga0207698_11617726 | 3300026142 | Unclassified | 663 |
| 876 | Ga0210000_1057162 | 3300027462 | Bacteria | 630 |
| 877 | Ga0268266_10010254 | 3300028379 | Bacteria | 8206 |
| 878 | Ga0268266_10028160 | 3300028379 | Bacteria | 4777 |
| 879 | Ga0268266_10038358 | 3300028379 | Bacteria | 4079 |
| 880 | Ga0268266_10063146 | 3300028379 | Bacteria | 3197 |
| 881 | Ga0268266_10169778 | 3300028379 | Bacteria | 1979 |
| 882 | Ga0268265_10186975 | 3300028380 | Archaea | 1785 |
| 883 | Ga0268264_10205041 | 3300028381 | Bacteria | 1806 |
| 884 | Ga0268264_10861873 | 3300028381 | Bacteria | 907 |
| 885 | Ga0268264_11468442 | 3300028381 | Unclassified | 692 |
| 886 | Ga0316182_1354237 | 3300030745 | Bacteria | 738 |
| 887 | Ga0307408_100112234 | 3300031548 | Bacteria | 2096 |
| 888 | Ga0307408_100155144 | 3300031548 | Bacteria | 1812 |
| 889 | Ga0307408_100304655 | 3300031548 | Bacteria | 1336 |
| 890 | Ga0307408_100990397 | 3300031548 | Bacteria | 774 |
| 891 | Ga0307405_10006019 | 3300031731 | Bacteria | 5926 |
| 892 | Ga0307405_10045634 | 3300031731 | Bacteria | 2687 |
| 893 | Ga0307405_10258548 | 3300031731 | Bacteria | 1299 |
| 894 | Ga0307413_10026836 | 3300031824 | Bacteria | 3181 |
| 895 | Ga0307413_10095446 | 3300031824 | Bacteria | 1950 |
| 896 | Ga0307413_10108838 | 3300031824 | Bacteria | 1850 |
| 897 | Ga0307413_10142749 | 3300031824 | Bacteria | 1657 |
| 898 | Ga0307413_10967853 | 3300031824 | Bacteria | 727 |
| 899 | Ga0307410_10002555 | 3300031852 | Bacteria | 8817 |
| 900 | Ga0307410_10012463 | 3300031852 | Bacteria | 4919 |
| 901 | Ga0307410_10024901 | 3300031852 | Bacteria | 3746 |
| 902 | Ga0307410_10062353 | 3300031852 | Bacteria | 2554 |
| 903 | Ga0307410_10144196 | 3300031852 | Bacteria | 1765 |
| 904 | Ga0307410_10247309 | 3300031852 | Bacteria | 1385 |
| 905 | Ga0307410_10442130 | 3300031852 | Bacteria | 1059 |
| 906 | Ga0307410_10809072 | 3300031852 | Bacteria | 798 |
| 907 | Ga0307410_11098032 | 3300031852 | Bacteria | 689 |
| 908 | Ga0307406_10116588 | 3300031901 | Bacteria | 1848 |
| 909 | Ga0307406_10164426 | 3300031901 | Unclassified | 1599 |
| 910 | Ga0307406_10435356 | 3300031901 | Bacteria | 1048 |
| 911 | Ga0307406_11075777 | 3300031901 | Bacteria | 693 |
| 912 | Ga0307406_11283352 | 3300031901 | Bacteria | 638 |
| 913 | Ga0307407_10011608 | 3300031903 | Bacteria | 4202 |
| 914 | Ga0307407_10017576 | 3300031903 | Bacteria | 3594 |
| 915 | Ga0307407_10050738 | 3300031903 | Bacteria | 2375 |
| 916 | Ga0307407_10055577 | 3300031903 | Bacteria | 2288 |
| 917 | Ga0307407_10061633 | 3300031903 | Bacteria | 2193 |
| 918 | Ga0307407_10076096 | 3300031903 | Bacteria | 2014 |
| 919 | Ga0307407_10406032 | 3300031903 | Bacteria | 978 |
| 920 | Ga0307407_10575354 | 3300031903 | Bacteria | 836 |
| 921 | Ga0307412_10006903 | 3300031911 | Bacteria | 6441 |
| 922 | Ga0307412_10182619 | 3300031911 | Bacteria | 1579 |
| 923 | Ga0307409_100016844 | 3300031995 | Bacteria | 4851 |
| 924 | Ga0307409_100016939 | 3300031995 | Bacteria | 4841 |
| 925 | Ga0307409_100029228 | 3300031995 | Bacteria | 3941 |
| 926 | Ga0307409_100045170 | 3300031995 | Bacteria | 3323 |
| 927 | Ga0307409_100237602 | 3300031995 | Bacteria | 1656 |
| 928 | Ga0307409_100399328 | 3300031995 | Bacteria | 1312 |
| 929 | Ga0307409_100929163 | 3300031995 | Bacteria | 885 |
| 930 | Ga0307416_100005020 | 3300032002 | Bacteria | 8070 |
| 931 | Ga0307416_100007589 | 3300032002 | Bacteria | 6917 |
| 932 | Ga0307416_100067414 | 3300032002 | Bacteria | 2952 |
| 933 | Ga0307416_100145821 | 3300032002 | Bacteria | 2161 |
| 934 | Ga0307416_100940252 | 3300032002 | Bacteria | 966 |
| 935 | Ga0307414_10001190 | 3300032004 | Bacteria | 13371 |
| 936 | Ga0307414_10023300 | 3300032004 | Bacteria | 3924 |
| 937 | Ga0307414_10041903 | 3300032004 | Bacteria | 3106 |
| 938 | Ga0307414_10050480 | 3300032004 | Bacteria | 2882 |
| 939 | Ga0307414_10080737 | 3300032004 | Bacteria | 2379 |
| 940 | Ga0307414_10196107 | 3300032004 | Bacteria | 1638 |
| 941 | Ga0307414_10322016 | 3300032004 | Bacteria | 1316 |
| 942 | Ga0307414_10457531 | 3300032004 | Bacteria | 1121 |
| 943 | Ga0307411_10000684 | 3300032005 | Bacteria | 12469 |
| 944 | Ga0307411_10001568 | 3300032005 | Bacteria | 9474 |
| 945 | Ga0307411_10007374 | 3300032005 | Bacteria | 5596 |
| 946 | Ga0307411_10007424 | 3300032005 | Bacteria | 5586 |
| 947 | Ga0307411_10030604 | 3300032005 | Bacteria | 3301 |
| 948 | Ga0307411_10051940 | 3300032005 | Bacteria | 2677 |
| 949 | Ga0307411_10056837 | 3300032005 | Bacteria | 2581 |
| 950 | Ga0307411_10114170 | 3300032005 | Bacteria | 1940 |
| 951 | Ga0307411_10164614 | 3300032005 | Bacteria | 1665 |
| 952 | Ga0307411_10334243 | 3300032005 | Bacteria | 1229 |
| 953 | Ga0307411_10372014 | 3300032005 | Bacteria | 1172 |
| 954 | Ga0307411_10386423 | 3300032005 | Bacteria | 1153 |
| 955 | Ga0307411_10601446 | 3300032005 | Bacteria | 945 |
| 956 | Ga0307411_10709013 | 3300032005 | Unclassified | 877 |
| 957 | Ga0307411_11280332 | 3300032005 | Bacteria | 667 |
| 958 | Ga0307415_100012232 | 3300032126 | Bacteria | 4955 |
| 959 | Ga0307415_100076270 | 3300032126 | Bacteria | 2376 |
| 960 | Ga0307415_100114016 | 3300032126 | Bacteria | 2011 |
| 961 | Ga0307415_100194831 | 3300032126 | Bacteria | 1602 |
| 962 | Ga0307415_100259793 | 3300032126 | Bacteria | 1416 |
| 963 | Ga0307415_100468983 | 3300032126 | Bacteria | 1093 |
| 964 | Ga0373929_0005662 | 3300035085 | Bacteria | 2254 |
| 965 | Ga0373923_0006193 | 3300035111 | Bacteria | 4117 |
| 966 | Ga0373939_0046488 | 3300035114 | Bacteria | 1329 |
| 967 | Ga0373943_0018615 | 3300035170 | Bacteria | 3192 |
| 968 | Ga0373942_0186080 | 3300035207 | Unclassified | 682 |
| 969 | Ga0373962_0086971 | 3300035242 | Bacteria | 957 |
| 970 | Ga0373931_0039580 | 3300035691 | Bacteria | 2470 |
| 971 | Ga0373935_0564331 | 3300035692 | Bacteria | 830 |
| 972 | Ga0373927_0094295 | 3300035695 | Bacteria | 1945 |
| 973 | Ga0373925_0073763 | 3300037068 | Bacteria | 2583 |
| 974 | Ga0395899_0000334 | 3300037312 | Bacteria | 59344 |
| 975 | Ga0395899_0012346 | 3300037312 | Bacteria | 6542 |
| 976 | Ga0395899_0018132 | 3300037312 | Bacteria | 5356 |
| 977 | Ga0395899_0037601 | 3300037312 | Bacteria | 3629 |
| 978 | Ga0395899_0064900 | 3300037312 | Bacteria | 2683 |
| 979 | Ga0395899_0075586 | 3300037312 | Bacteria | 2460 |
| 980 | Ga0395899_0076686 | 3300037312 | Bacteria | 2439 |
| 981 | Ga0395899_0080924 | 3300037312 | Bacteria | 2364 |
| 982 | Ga0395899_0081003 | 3300037312 | Bacteria | 2363 |
| 983 | Ga0395899_0123180 | 3300037312 | Bacteria | 1855 |
| 984 | Ga0395899_0135791 | 3300037312 | Bacteria | 1753 |
| 985 | Ga0395899_0208523 | 3300037312 | Bacteria | 1359 |
| 986 | Ga0395899_0256934 | 3300037312 | Bacteria | 1196 |
| 987 | Ga0395899_0274782 | 3300037312 | Bacteria | 1148 |
| 988 | Ga0395899_0317915 | 3300037312 | Bacteria | 1049 |
| 989 | Ga0395899_0496141 | 3300037312 | Bacteria | 792 |
| 990 | Ga0395900_0000432 | 3300037418 | Bacteria | 60134 |
| 991 | Ga0395900_0001160 | 3300037418 | Bacteria | 32963 |
| 992 | Ga0395900_0003986 | 3300037418 | Bacteria | 15767 |
| 993 | Ga0395900_0008812 | 3300037418 | Bacteria | 10363 |
| 994 | Ga0395900_0017346 | 3300037418 | Bacteria | 7350 |
| 995 | Ga0395900_0018056 | 3300037418 | Bacteria | 7201 |
| 996 | Ga0395900_0021947 | 3300037418 | Bacteria | 6527 |
| 997 | Ga0395900_0037484 | 3300037418 | Bacteria | 4998 |
| 998 | Ga0395900_0038042 | 3300037418 | Bacteria | 4960 |
| 999 | Ga0395900_0051619 | 3300037418 | Bacteria | 4236 |
| 1000 | Ga0395900_0051734 | 3300037418 | Bacteria | 4230 |
| 1001 | Ga0395900_0052710 | 3300037418 | Bacteria | 4187 |
| 1002 | Ga0395900_0067978 | 3300037418 | Bacteria | 3661 |
| 1003 | Ga0395900_0067997 | 3300037418 | Bacteria | 3660 |
| 1004 | Ga0395900_0102092 | 3300037418 | Bacteria | 2946 |
| 1005 | Ga0395900_0121494 | 3300037418 | Bacteria | 2679 |
| 1006 | Ga0395900_0131246 | 3300037418 | Bacteria | 2567 |
| 1007 | Ga0395900_0160205 | 3300037418 | Bacteria | 2295 |
| 1008 | Ga0395900_0208653 | 3300037418 | Bacteria | 1973 |
| 1009 | Ga0395900_0209570 | 3300037418 | Bacteria | 1968 |
| 1010 | Ga0395900_0211567 | 3300037418 | Bacteria | 1958 |
| 1011 | Ga0395900_0219753 | 3300037418 | Bacteria | 1916 |
| 1012 | Ga0395900_0242554 | 3300037418 | Bacteria | 1807 |
| 1013 | Ga0395900_0261051 | 3300037418 | Bacteria | 1730 |
| 1014 | Ga0395900_0622482 | 3300037418 | Bacteria | 1018 |
| 1015 | Ga0395900_0688208 | 3300037418 | Bacteria | 957 |
| 1016 | Ga0395900_0829420 | 3300037418 | Bacteria | 851 |
| 1017 | Ga0395900_1079408 | 3300037418 | Bacteria | 720 |
| 1018 | Ga0395900_1199202 | 3300037418 | Bacteria | 674 |
| 1019 | Ga0395900_1305623 | 3300037418 | Bacteria | 639 |
| 1020 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 1021 | Ga0395898_0036496 | 3300037466 | Bacteria | 4880 |
| 1022 | Ga0395898_0051020 | 3300037466 | Bacteria | 4046 |
| 1023 | Ga0395898_0066634 | 3300037466 | Bacteria | 3487 |
| 1024 | Ga0395898_0074263 | 3300037466 | Bacteria | 3284 |
| 1025 | Ga0395898_0090560 | 3300037466 | Bacteria | 2943 |
| 1026 | Ga0395898_0142924 | 3300037466 | Bacteria | 2291 |
| 1027 | Ga0395898_0148186 | 3300037466 | Bacteria | 2246 |
| 1028 | Ga0395898_0222148 | 3300037466 | Bacteria | 1802 |
| 1029 | Ga0395898_0232179 | 3300037466 | Bacteria | 1759 |
| 1030 | Ga0395898_0277597 | 3300037466 | Bacteria | 1598 |
| 1031 | Ga0395898_0313564 | 3300037466 | Bacteria | 1496 |
| 1032 | Ga0395898_0314529 | 3300037466 | Bacteria | 1494 |
| 1033 | Ga0395898_0517428 | 3300037466 | Bacteria | 1134 |
| 1034 | Ga0395898_0579390 | 3300037466 | Bacteria | 1064 |
| 1035 | Ga0395898_0666424 | 3300037466 | Bacteria | 982 |
| 1036 | Ga0395905_0000413 | 3300037471 | Bacteria | 60132 |
| 1037 | Ga0395905_0000688 | 3300037471 | Bacteria | 44764 |
| 1038 | Ga0395905_0004997 | 3300037471 | Bacteria | 13667 |
| 1039 | Ga0395905_0008813 | 3300037471 | Bacteria | 9912 |
| 1040 | Ga0395905_0010096 | 3300037471 | Bacteria | 9204 |
| 1041 | Ga0395905_0013497 | 3300037471 | Bacteria | 7827 |
| 1042 | Ga0395905_0014327 | 3300037471 | Bacteria | 7578 |
| 1043 | Ga0395905_0015950 | 3300037471 | Bacteria | 7139 |
| 1044 | Ga0395905_0017635 | 3300037471 | Bacteria | 6776 |
| 1045 | Ga0395905_0035094 | 3300037471 | Bacteria | 4708 |
| 1046 | Ga0395905_0039027 | 3300037471 | Bacteria | 4455 |
| 1047 | Ga0395905_0041715 | 3300037471 | Bacteria | 4307 |
| 1048 | Ga0395905_0042916 | 3300037471 | Bacteria | 4243 |
| 1049 | Ga0395905_0047098 | 3300037471 | Bacteria | 4042 |
| 1050 | Ga0395905_0050964 | 3300037471 | Bacteria | 3877 |
| 1051 | Ga0395905_0066963 | 3300037471 | Bacteria | 3363 |
| 1052 | Ga0395905_0096439 | 3300037471 | Bacteria | 2776 |
| 1053 | Ga0395905_0097685 | 3300037471 | Bacteria | 2758 |
| 1054 | Ga0395905_0115243 | 3300037471 | Bacteria | 2525 |
| 1055 | Ga0395905_0121465 | 3300037471 | Bacteria | 2455 |
| 1056 | Ga0395905_0151069 | 3300037471 | Bacteria | 2185 |
| 1057 | Ga0395905_0157204 | 3300037471 | Bacteria | 2138 |
| 1058 | Ga0395905_0181456 | 3300037471 | Bacteria | 1976 |
| 1059 | Ga0395905_0181831 | 3300037471 | Bacteria | 1974 |
| 1060 | Ga0395905_0197563 | 3300037471 | Bacteria | 1886 |
| 1061 | Ga0395905_0200971 | 3300037471 | Unclassified | 1868 |
| 1062 | Ga0395905_0208188 | 3300037471 | Bacteria | 1833 |
| 1063 | Ga0395905_0209456 | 3300037471 | Bacteria | 1826 |
| 1064 | Ga0395905_0212661 | 3300037471 | Bacteria | 1811 |
| 1065 | Ga0395905_0249410 | 3300037471 | Bacteria | 1658 |
| 1066 | Ga0395905_0261740 | 3300037471 | Bacteria | 1615 |
| 1067 | Ga0395905_0306588 | 3300037471 | Bacteria | 1476 |
| 1068 | Ga0395905_0343988 | 3300037471 | Bacteria | 1383 |
| 1069 | Ga0395905_0403595 | 3300037471 | Bacteria | 1262 |
| 1070 | Ga0395905_0549334 | 3300037471 | Bacteria | 1056 |
| 1071 | Ga0395905_0552383 | 3300037471 | Bacteria | 1053 |
| 1072 | Ga0395905_0640461 | 3300037471 | Unclassified | 965 |
| 1073 | Ga0395905_0657074 | 3300037471 | Bacteria | 950 |
| 1074 | Ga0395905_0784216 | 3300037471 | Bacteria | 856 |
| 1075 | Ga0395905_1239808 | 3300037471 | Bacteria | 649 |
| 1076 | Ga0395901_0000241 | 3300038443 | Bacteria | 68503 |
| 1077 | Ga0395901_0000476 | 3300038443 | Bacteria | 46589 |
| 1078 | Ga0395901_0011523 | 3300038443 | Bacteria | 8960 |
| 1079 | Ga0395901_0020834 | 3300038443 | Bacteria | 6712 |
| 1080 | Ga0395901_0034542 | 3300038443 | Bacteria | 5222 |
| 1081 | Ga0395901_0057733 | 3300038443 | Bacteria | 4036 |
| 1082 | Ga0395901_0057777 | 3300038443 | Bacteria | 4035 |
| 1083 | Ga0395901_0057844 | 3300038443 | Bacteria | 4032 |
| 1084 | Ga0395901_0062289 | 3300038443 | Bacteria | 3882 |
| 1085 | Ga0395901_0112319 | 3300038443 | Bacteria | 2861 |
| 1086 | Ga0395901_0121288 | 3300038443 | Bacteria | 2747 |
| 1087 | Ga0395901_0139648 | 3300038443 | Bacteria | 2546 |
| 1088 | Ga0395901_0179519 | 3300038443 | Bacteria | 2220 |
| 1089 | Ga0395901_0185793 | 3300038443 | Bacteria | 2180 |
| 1090 | Ga0395901_0187334 | 3300038443 | Bacteria | 2170 |
| 1091 | Ga0395901_0196737 | 3300038443 | Bacteria | 2114 |
| 1092 | Ga0395901_0249503 | 3300038443 | Unclassified | 1849 |
| 1093 | Ga0395901_0423153 | 3300038443 | Bacteria | 1365 |
| 1094 | Ga0395901_0455725 | 3300038443 | Bacteria | 1307 |
| 1095 | Ga0395901_0459253 | 3300038443 | Bacteria | 1301 |
| 1096 | Ga0395901_0529303 | 3300038443 | Bacteria | 1196 |
| 1097 | Ga0395901_0609134 | 3300038443 | Bacteria | 1100 |
| 1098 | Ga0395901_0704653 | 3300038443 | Bacteria | 1007 |
| 1099 | Ga0395901_0826911 | 3300038443 | Bacteria | 913 |
| 1100 | Ga0436365_0605932 | 3300039437 | Bacteria | 7270 |
| 1101 | Ga0436363_0724783 | 3300039450 | Bacteria | 1487 |
| 1102 | Ga0439448_0223837 | 3300042005 | Unclassified | 662 |
| 1103 | Ga0439432_042370 | 3300042006 | Unclassified | 1439 |
| 1104 | Ga0439432_125985 | 3300042006 | Unclassified | 757 |
| 1105 | Ga0439449_0191792 | 3300042007 | Unclassified | 765 |
| 1106 | Ga0450912_004686 | 3300042116 | Unclassified | 1023 |
| 1107 | Ga0450914_002047 | 3300042118 | Bacteria | 1383 |
| 1108 | Ga0450905_040945 | 3300042142 | Bacteria | 737 |
| 1109 | Ga0439458_0003466 | 3300042157 | Bacteria | 3683 |
| 1110 | Ga0439458_0017103 | 3300042157 | Bacteria | 1653 |
| 1111 | Ga0466969_0013647 | 3300044656 | Bacteria | 4276 |
| 1112 | Ga0466972_0140871 | 3300044658 | Bacteria | 1135 |
| 1113 | Ga0466965_0223930 | 3300044683 | Bacteria | 1003 |
| 1114 | Ga0466965_0233061 | 3300044683 | Bacteria | 984 |
| 1115 | Ga0466966_0007012 | 3300044684 | Bacteria | 7462 |
| 1116 | Ga0466966_0058045 | 3300044684 | Bacteria | 2446 |
| 1117 | Ga0466966_0167138 | 3300044684 | Bacteria | 1338 |
| 1118 | Ga0466966_0358093 | 3300044684 | Bacteria | 877 |
| 1119 | Ga0466966_0475615 | 3300044684 | Bacteria | 751 |
| 1120 | Ga0466966_0509271 | 3300044684 | Bacteria | 724 |
| 1121 | Ga0466961_0049984 | 3300044693 | Bacteria | 2671 |
| 1122 | Ga0466961_0142760 | 3300044693 | Bacteria | 1498 |
| 1123 | Ga0466961_0356501 | 3300044693 | Bacteria | 890 |
| 1124 | Ga0466961_0533382 | 3300044693 | Unclassified | 707 |
| 1125 | Ga0466963_0022198 | 3300044694 | Bacteria | 4017 |
| 1126 | Ga0466963_0052919 | 3300044694 | Bacteria | 2695 |
| 1127 | Ga0466963_0055860 | 3300044694 | Bacteria | 2626 |
| 1128 | Ga0466963_0060600 | 3300044694 | Bacteria | 2528 |
| 1129 | Ga0466963_0085745 | 3300044694 | Bacteria | 2138 |
| 1130 | Ga0466963_0098515 | 3300044694 | Bacteria | 1998 |
| 1131 | Ga0466963_0445623 | 3300044694 | Unclassified | 913 |
| 1132 | Ga0466963_0452917 | 3300044694 | Bacteria | 905 |
| 1133 | Ga0466964_0029895 | 3300044706 | Bacteria | 2154 |
| 1134 | Ga0466964_0036561 | 3300044706 | Bacteria | 1969 |
| 1135 | Ga0466964_0048380 | 3300044706 | Bacteria | 1738 |
| 1136 | Ga0466964_0178496 | 3300044706 | Bacteria | 1005 |
| 1137 | Ga0466971_0004306 | 3300044719 | Bacteria | 6135 |
| 1138 | Ga0466971_0032665 | 3300044719 | Bacteria | 2332 |
| 1139 | Ga0466971_0035761 | 3300044719 | Bacteria | 2228 |
| 1140 | Ga0466971_0250591 | 3300044719 | Bacteria | 844 |
| 1141 | Ga0466968_0016705 | 3300044735 | Bacteria | 2924 |
| 1142 | Ga0466970_0005939 | 3300044765 | Bacteria | 6087 |
| 1143 | Ga0466970_0133369 | 3300044765 | Bacteria | 1365 |
| 1144 | Ga0466970_0145654 | 3300044765 | Bacteria | 1306 |
| 1145 | Ga0466970_0150356 | 3300044765 | Bacteria | 1285 |
| 1146 | Ga0466957_0031148 | 3300044842 | Bacteria | 3186 |
| 1147 | Ga0466957_0032607 | 3300044842 | Bacteria | 3120 |
| 1148 | Ga0466957_0125438 | 3300044842 | Bacteria | 1640 |
| 1149 | Ga0466957_0181718 | 3300044842 | Bacteria | 1374 |
| 1150 | Ga0466960_0222034 | 3300044901 | Unclassified | 1040 |
| 1151 | Ga0466960_0314195 | 3300044901 | Bacteria | 886 |
| 1152 | Ga0466959_0035229 | 3300045049 | Bacteria | 3703 |
| 1153 | Ga0466959_0114258 | 3300045049 | Bacteria | 1924 |
| 1154 | Ga0466959_0126928 | 3300045049 | Bacteria | 1810 |
| 1155 | Ga0466959_0176635 | 3300045049 | Bacteria | 1495 |
| 1156 | Ga0466959_0264107 | 3300045049 | Unclassified | 1184 |
| 1157 | Ga0466959_0789771 | 3300045049 | Bacteria | 635 |
| 1158 | Ga0466958_0016764 | 3300045836 | Bacteria | 4224 |
| 1159 | Ga0466958_0063647 | 3300045836 | Bacteria | 2249 |
| 1160 | Ga0466958_0080227 | 3300045836 | Bacteria | 2007 |
| 1161 | Ga0466958_0103265 | 3300045836 | Bacteria | 1775 |
| 1162 | Ga0466958_0152635 | 3300045836 | Bacteria | 1457 |
| 1163 | Ga0466958_0392924 | 3300045836 | Bacteria | 895 |
| 1164 | Ga0466967_0001666 | 3300045976 | Bacteria | 13169 |
| 1165 | Ga0466967_0008439 | 3300045976 | Bacteria | 7549 |
| 1166 | Ga0466967_0029980 | 3300045976 | Bacteria | 4560 |
| 1167 | Ga0466967_0100510 | 3300045976 | Bacteria | 2642 |
| 1168 | Ga0466967_0125519 | 3300045976 | Bacteria | 2377 |
| 1169 | Ga0466967_0144748 | 3300045976 | Bacteria | 2216 |
| 1170 | Ga0466967_0204018 | 3300045976 | Bacteria | 1873 |
| 1171 | Ga0466967_0341080 | 3300045976 | Bacteria | 1449 |
| 1172 | Ga0466967_0350234 | 3300045976 | Unclassified | 1429 |
| 1173 | Ga0466967_0367188 | 3300045976 | Bacteria | 1395 |
| 1174 | Ga0466967_0404817 | 3300045976 | Bacteria | 1328 |
| 1175 | Ga0466967_0420534 | 3300045976 | Bacteria | 1302 |
| 1176 | Ga0466967_0440393 | 3300045976 | Bacteria | 1272 |
| 1177 | Ga0466967_0646536 | 3300045976 | Bacteria | 1045 |
| 1178 | Ga0466967_0739348 | 3300045976 | Bacteria | 975 |
| 1179 | Ga0466967_1049127 | 3300045976 | Bacteria | 812 |
| 1180 | Ga0466967_1349035 | 3300045976 | Bacteria | 710 |
| 1181 | Ga0495583_0149235 | 3300046506 | Bacteria | 970 |
| 1182 | Ga0495606_0226669 | 3300046507 | Bacteria | 1050 |
| 1183 | Ga0495663_0005015 | 3300046525 | Bacteria | 3698 |
| 1184 | Ga0495663_0049171 | 3300046525 | Bacteria | 1302 |
| 1185 | Ga0495663_0216592 | 3300046525 | Bacteria | 672 |
| 1186 | Ga0495642_0220513 | 3300046528 | Unclassified | 828 |
| 1187 | Ga0495598_0000719 | 3300046537 | Bacteria | 6304 |
| 1188 | Ga0495598_0001949 | 3300046537 | Bacteria | 4184 |
| 1189 | Ga0495621_0002706 | 3300046539 | Bacteria | 4804 |
| 1190 | Ga0495621_0005051 | 3300046539 | Bacteria | 3762 |
| 1191 | Ga0495633_0018383 | 3300046558 | Bacteria | 3550 |
| 1192 | Ga0495656_0221923 | 3300046615 | Unclassified | 945 |
| 1193 | Ga0495668_0023756 | 3300046616 | Bacteria | 3492 |
| 1194 | Ga0495668_0052993 | 3300046616 | Bacteria | 2244 |
| 1195 | Ga0495661_0051350 | 3300046665 | Bacteria | 2490 |
| 1196 | Ga0495647_0124696 | 3300046681 | Bacteria | 1086 |
| 1197 | Ga0495669_0001193 | 3300046684 | Bacteria | 10803 |
| 1198 | Ga0495669_0001894 | 3300046684 | Bacteria | 8579 |
| 1199 | Ga0495669_0005742 | 3300046684 | Bacteria | 5174 |
| 1200 | Ga0495669_0076366 | 3300046684 | Bacteria | 1533 |
| 1201 | Ga0495669_0120437 | 3300046684 | Unclassified | 1229 |
| 1202 | Ga0495669_0300696 | 3300046684 | Bacteria | 773 |
| 1203 | Ga0495670_0006231 | 3300046691 | Bacteria | 5856 |
| 1204 | Ga0495670_0041650 | 3300046691 | Bacteria | 2291 |
| 1205 | Ga0495677_0006042 | 3300047445 | Bacteria | 4579 |
| 1206 | Ga0495677_0135949 | 3300047445 | Bacteria | 942 |
| 1207 | Ga0495681_0074694 | 3300047470 | Bacteria | 1528 |
| 1208 | Ga0496100_0020173 | 3300048903 | Bacteria | 3992 |
| 1209 | Ga0496100_0072159 | 3300048903 | Bacteria | 2307 |
| 1210 | Ga0496100_0204202 | 3300048903 | Bacteria | 1442 |
| 1211 | Ga0496101_0057168 | 3300048904 | Bacteria | 2821 |
| 1212 | Ga0496101_0447599 | 3300048904 | Bacteria | 1019 |
| 1213 | Ga0496102_0064876 | 3300048905 | Bacteria | 3346 |
| 1214 | Ga0496102_0218414 | 3300048905 | Bacteria | 1797 |
| 1215 | Ga0496103_0133936 | 3300048906 | Bacteria | 1583 |
| 1216 | Ga0496103_0189385 | 3300048906 | Bacteria | 1323 |
| 1217 | Ga0496104_0104201 | 3300048907 | Bacteria | 2718 |
| 1218 | Ga0496104_0930731 | 3300048907 | Unclassified | 774 |
| 1219 | Ga0496105_0009837 | 3300048908 | Bacteria | 7495 |
| 1220 | Ga0496106_0012723 | 3300048909 | Bacteria | 6215 |
| 1221 | Ga0496106_0574333 | 3300048909 | Bacteria | 904 |
| 1222 | Ga0496107_0179676 | 3300048910 | Bacteria | 1571 |
| 1223 | Ga0496107_0238100 | 3300048910 | Bacteria | 1354 |
| 1224 | Ga0496108_0000302 | 3300048911 | Bacteria | 42284 |
| 1225 | Ga0496108_0035971 | 3300048911 | Bacteria | 4118 |
| 1226 | Ga0496108_0066165 | 3300048911 | Bacteria | 3047 |
| 1227 | Ga0496108_0126360 | 3300048911 | Bacteria | 2195 |
| 1228 | Ga0496108_0183791 | 3300048911 | Bacteria | 1811 |
| 1229 | Ga0496109_0001875 | 3300048912 | Bacteria | 17420 |
| 1230 | Ga0496109_0019350 | 3300048912 | Bacteria | 6002 |
| 1231 | Ga0496109_0037291 | 3300048912 | Bacteria | 4392 |
| 1232 | Ga0496109_0039550 | 3300048912 | Bacteria | 4269 |
| 1233 | Ga0496109_0057790 | 3300048912 | Bacteria | 3542 |
| 1234 | Ga0496109_0216082 | 3300048912 | Bacteria | 1803 |
| 1235 | Ga0496109_0290247 | 3300048912 | Bacteria | 1542 |
| 1236 | Ga0496109_0707582 | 3300048912 | Bacteria | 945 |
| 1237 | Ga0496110_0002728 | 3300048913 | Bacteria | 13339 |
| 1238 | Ga0496110_0013369 | 3300048913 | Bacteria | 6783 |
| 1239 | Ga0496110_0063493 | 3300048913 | Bacteria | 3263 |
| 1240 | Ga0496110_0188559 | 3300048913 | Bacteria | 1873 |
| 1241 | Ga0496110_0435699 | 3300048913 | Bacteria | 1194 |
| 1242 | Ga0496110_0948902 | 3300048913 | Bacteria | 767 |
| 1243 | Ga0496111_0045675 | 3300048914 | Bacteria | 3152 |
| 1244 | Ga0496111_0049963 | 3300048914 | Bacteria | 3015 |
| 1245 | Ga0496111_0115176 | 3300048914 | Bacteria | 1982 |
| 1246 | Ga0496111_0158333 | 3300048914 | Bacteria | 1681 |
| 1247 | Ga0496111_0427487 | 3300048914 | Bacteria | 978 |
| 1248 | Ga0496111_0473984 | 3300048914 | Bacteria | 923 |
| 1249 | Ga0496112_0006104 | 3300048915 | Bacteria | 10531 |
| 1250 | Ga0496112_0013095 | 3300048915 | Bacteria | 7652 |
| 1251 | Ga0496112_0033243 | 3300048915 | Bacteria | 5012 |
| 1252 | Ga0496112_0073113 | 3300048915 | Bacteria | 3389 |
| 1253 | Ga0496112_0081381 | 3300048915 | Bacteria | 3202 |
| 1254 | Ga0496112_0201714 | 3300048915 | Bacteria | 1948 |
| 1255 | Ga0496112_0255955 | 3300048915 | Bacteria | 1701 |
| 1256 | Ga0496112_0492948 | 3300048915 | Bacteria | 1161 |
| 1257 | Ga0496112_0573703 | 3300048915 | Bacteria | 1061 |
| 1258 | Ga0496112_0866657 | 3300048915 | Bacteria | 826 |
| 1259 | Ga0496113_0002096 | 3300048916 | Bacteria | 11488 |
| 1260 | Ga0496113_0002373 | 3300048916 | Bacteria | 10915 |
| 1261 | Ga0496113_0009973 | 3300048916 | Bacteria | 6260 |
| 1262 | Ga0496113_0146037 | 3300048916 | Bacteria | 1863 |
| 1263 | Ga0496113_0332410 | 3300048916 | Unclassified | 1218 |
| 1264 | Ga0496114_0000023 | 3300048917 | Bacteria | 219092 |
| 1265 | Ga0501047_0400144 | 3300049581 | Unclassified | 1206 |
| 1266 | Ga0501067_0236194 | 3300049583 | Bacteria | 1017 |
| 1267 | Ga0501070_0822283 | 3300049586 | Bacteria | 728 |
| 1268 | Ga0501074_0386161 | 3300049590 | Bacteria | 993 |
| 1269 | Ga0501080_0178502 | 3300049742 | Bacteria | 1955 |
| 1270 | Ga0495612_0228104 | 3300053078 | Bacteria | 826 |
| 1271 | Ga0495655_0004465 | 3300053083 | Bacteria | 2392 |
| 1272 | Ga0466962_0087102 | 3300061719 | Bacteria | 1495 |
| 1273 | Ga0466971_0130762 | |||
| 1274 | JGI24741J21665_1000751 | |||
| 1275 | JGI24741J21665_1002561 | |||
| 1276 | JGI24741J21665_1013932 | |||
| 1277 | JGI24741J21665_1016512 | |||
| 1278 | JGI24752J21851_1004462 | |||
| 1279 | JGI24740J21852_10000589 | |||
| 1280 | JGI24740J21852_10023570 | |||
| 1281 | JGI24740J21852_10070242 | |||
| 1282 | JGI24739J22299_10015404 | |||
| 1283 | JGI24739J22299_10025322 | |||
| 1284 | JGI24739J22299_10026653 | |||
| 1285 | JGI24739J22299_10037051 | |||
| 1286 | JGI24739J22299_10052660 | |||
| 1287 | JGI24737J22298_10001716 | |||
| 1288 | JGI24737J22298_10002005 | |||
| 1289 | JGI24737J22298_10002883 | |||
| 1290 | JGI24737J22298_10058965 | |||
| 1291 | JGI24737J22298_10080683 | |||
| 1292 | JGI24735J21928_10002872 | |||
| 1293 | JGI24735J21928_10005019 | |||
| 1294 | JGI24735J21928_10007110 | |||
| 1295 | JGI24735J21928_10012028 | |||
| 1296 | JGI24738J21930_10001169 | |||
| 1297 | JGI24738J21930_10030199 | |||
| 1298 | JGI24034J26672_10014367 | |||
| 1299 | Ga0065712_10001212 | |||
| 1300 | Ga0065712_10151657 | |||
| 1301 | Ga0065715_10535567 | |||
| 1302 | Ga0070658_10000205 | |||
| 1303 | Ga0070658_10003017 | |||
| 1304 | Ga0070658_10007898 | |||
| 1305 | Ga0070658_10009387 | |||
| 1306 | Ga0070658_10010244 | |||
| 1307 | Ga0070658_10021879 | |||
| 1308 | Ga0070658_10028103 | |||
| 1309 | Ga0070658_10044420 | |||
| 1310 | Ga0070658_10094746 | |||
| 1311 | Ga0070658_10238921 | |||
| 1312 | Ga0070658_10297736 | |||
| 1313 | Ga0070658_10584484 | |||
| 1314 | Ga0070658_10761109 | |||
| 1315 | Ga0070676_10157268 | |||
| 1316 | Ga0070676_10332507 | |||
| 1317 | Ga0070683_100000969 | |||
| 1318 | Ga0070683_100010316 | |||
| 1319 | Ga0070683_100071546 | |||
| 1320 | Ga0070683_100086204 | |||
| 1321 | Ga0070683_100140169 | |||
| 1322 | Ga0070683_100158009 | |||
| 1323 | Ga0070683_100184166 | |||
| 1324 | Ga0070683_100320538 | |||
| 1325 | Ga0070683_100421336 | |||
| 1326 | Ga0070683_100642504 | |||
| 1327 | Ga0070683_100881740 | |||
| 1328 | Ga0070690_100001273 | |||
| 1329 | Ga0070690_100131443 | |||
| 1330 | Ga0070670_100003010 | |||
| 1331 | Ga0070670_100003116 | |||
| 1332 | Ga0070670_100019349 | |||
| 1333 | Ga0070670_100061317 | |||
| 1334 | Ga0070670_100074248 | |||
| 1335 | Ga0070670_100111993 | |||
| 1336 | Ga0070670_100257271 | |||
| 1337 | Ga0070670_100329203 | |||
| 1338 | Ga0070670_100366388 | |||
| 1339 | Ga0070670_100399615 | |||
| 1340 | Ga0070670_100452747 | |||
| 1341 | Ga0070670_100570549 | |||
| 1342 | Ga0070677_10041766 | |||
| 1343 | Ga0070677_10179731 | |||
| 1344 | Ga0070677_10242204 | |||
| 1345 | Ga0068869_100210600 | |||
| 1346 | Ga0070666_10000342 | |||
| 1347 | Ga0070666_10001012 | |||
| 1348 | Ga0070666_10005148 | |||
| 1349 | Ga0070666_10060732 | |||
| 1350 | Ga0070666_10488844 | |||
| 1351 | Ga0070680_100002233 | |||
| 1352 | Ga0070680_100008106 | |||
| 1353 | Ga0070680_100008234 | |||
| 1354 | Ga0070680_100019477 | |||
| 1355 | Ga0070680_100028316 | |||
| 1356 | Ga0070680_100036698 | |||
| 1357 | Ga0070680_100079360 | |||
| 1358 | Ga0070680_100098549 | |||
| 1359 | Ga0070680_100444946 | |||
| 1360 | Ga0070682_100004951 | |||
| 1361 | Ga0070682_100037140 | |||
| 1362 | Ga0070682_100054227 | |||
| 1363 | Ga0070682_100318298 | |||
| 1364 | Ga0070682_100585949 | |||
| 1365 | Ga0068868_100003381 | |||
| 1366 | Ga0068868_100017410 | |||
| 1367 | Ga0068868_100018436 | |||
| 1368 | Ga0068868_100172811 | |||
| 1369 | Ga0068868_100595462 | |||
| 1370 | Ga0070660_100000009 | |||
| 1371 | Ga0070660_100005796 | |||
| 1372 | Ga0070660_100009066 | |||
| 1373 | Ga0070660_100009998 | |||
| 1374 | Ga0070660_100021025 | |||
| 1375 | Ga0070660_100063792 | |||
| 1376 | Ga0070660_100088763 | |||
| 1377 | Ga0070660_100097044 | |||
| 1378 | Ga0070660_100117312 | |||
| 1379 | Ga0070660_100170571 | |||
| 1380 | Ga0070660_100184428 | |||
| 1381 | Ga0070660_100199517 | |||
| 1382 | Ga0070660_100219107 | |||
| 1383 | Ga0070660_100223779 | |||
| 1384 | Ga0070660_100287642 | |||
| 1385 | Ga0070660_101110137 | |||
| 1386 | Ga0070689_100156590 | |||
| 1387 | Ga0070691_10000548 | |||
| 1388 | Ga0070691_10030245 | |||
| 1389 | Ga0070691_10172889 | |||
| 1390 | Ga0070661_100000100 | |||
| 1391 | Ga0070661_100001881 | |||
| 1392 | Ga0070661_100005867 | |||
| 1393 | Ga0070661_100009541 | |||
| 1394 | Ga0070661_100031901 | |||
| 1395 | Ga0070661_100032441 | |||
| 1396 | Ga0070661_100056333 | |||
| 1397 | Ga0070661_100066991 | |||
| 1398 | Ga0070661_100123767 | |||
| 1399 | Ga0070661_100138673 | |||
| 1400 | Ga0070661_100154581 | |||
| 1401 | Ga0070661_100285634 | |||
| 1402 | Ga0070661_100466368 | |||
| 1403 | Ga0070661_100667931 | |||
| 1404 | Ga0070661_101103506 | |||
| 1405 | Ga0070692_10015852 | |||
| 1406 | Ga0070692_10024920 | |||
| 1407 | Ga0070692_10029809 | |||
| 1408 | Ga0070692_10115665 | |||
| 1409 | Ga0070692_10304259 | |||
| 1410 | Ga0070669_100037839 | |||
| 1411 | Ga0070669_100205472 | |||
| 1412 | Ga0070669_100612934 | |||
| 1413 | Ga0070675_100001992 | |||
| 1414 | Ga0070675_100013065 | |||
| 1415 | Ga0070675_100020759 | |||
| 1416 | Ga0070675_100251282 | |||
| 1417 | Ga0070675_100349401 | |||
| 1418 | Ga0070675_100756407 | |||
| 1419 | Ga0070671_100004669 | |||
| 1420 | Ga0070671_100013375 | |||
| 1421 | Ga0070671_100016850 | |||
| 1422 | Ga0070671_100032850 | |||
| 1423 | Ga0070671_100036024 | |||
| 1424 | Ga0070671_100193141 | |||
| 1425 | Ga0070671_100352316 | |||
| 1426 | Ga0070674_100001205 | |||
| 1427 | Ga0070674_100015755 | |||
| 1428 | Ga0070674_100078860 | |||
| 1429 | Ga0070673_100014006 | |||
| 1430 | Ga0070673_100023989 | |||
| 1431 | Ga0070673_100045047 | |||
| 1432 | Ga0070673_100106474 | |||
| 1433 | Ga0070673_100136459 | |||
| 1434 | Ga0070673_100146493 | |||
| 1435 | Ga0070673_100186167 | |||
| 1436 | Ga0070673_100237597 | |||
| 1437 | Ga0070673_100280269 | |||
| 1438 | Ga0070673_100394088 | |||
| 1439 | Ga0070659_100000048 | |||
| 1440 | Ga0070659_100008016 | |||
| 1441 | Ga0070659_100022793 | |||
| 1442 | Ga0070659_100026854 | |||
| 1443 | Ga0070659_100035658 | |||
| 1444 | Ga0070659_100058573 | |||
| 1445 | Ga0070659_100092406 | |||
| 1446 | Ga0070659_100109689 | |||
| 1447 | Ga0070659_100267473 | |||
| 1448 | Ga0070659_100576826 | |||
| 1449 | Ga0070659_100589505 | |||
| 1450 | Ga0070659_100714006 | |||
| 1451 | Ga0070659_100730725 | |||
| 1452 | Ga0070667_100000656 | |||
| 1453 | Ga0070667_100003299 | |||
| 1454 | Ga0070667_100003435 | |||
| 1455 | Ga0070667_100014805 | |||
| 1456 | Ga0070667_100022404 | |||
| 1457 | Ga0070667_100285304 | |||
| 1458 | Ga0070667_100368945 | |||
| 1459 | Ga0070667_100512136 | |||
| 1460 | Ga0070709_10183865 | |||
| 1461 | Ga0070714_100026766 | |||
| 1462 | Ga0070714_100141951 | |||
| 1463 | Ga0070714_100180725 | |||
| 1464 | Ga0070714_100192783 | |||
| 1465 | Ga0070714_100227573 | |||
| 1466 | Ga0070713_100003629 | |||
| 1467 | Ga0070713_100148259 | |||
| 1468 | Ga0070713_100351371 | |||
| 1469 | Ga0070694_100666072 | |||
| 1470 | Ga0070663_100000620 | |||
| 1471 | Ga0070663_100037252 | |||
| 1472 | Ga0070663_100072632 | |||
| 1473 | Ga0070663_100128718 | |||
| 1474 | Ga0070663_100134189 | |||
| 1475 | Ga0070663_100312155 | |||
| 1476 | Ga0070663_100415388 | |||
| 1477 | Ga0070663_100429558 | |||
| 1478 | Ga0070663_100602974 | |||
| 1479 | Ga0070663_100658316 | |||
| 1480 | Ga0070663_100810303 | |||
| 1481 | Ga0070678_100002008 | |||
| 1482 | Ga0070678_100136696 | |||
| 1483 | Ga0070678_100259695 | |||
| 1484 | Ga0070678_100308388 | |||
| 1485 | Ga0070678_100340916 | |||
| 1486 | Ga0070678_100638221 | |||
| 1487 | Ga0070678_100681649 | |||
| 1488 | Ga0070678_100917281 | |||
| 1489 | Ga0070662_100000035 | |||
| 1490 | Ga0070662_100001933 | |||
| 1491 | Ga0070662_100005986 | |||
| 1492 | Ga0070662_100012983 | |||
| 1493 | Ga0070662_100027623 | |||
| 1494 | Ga0070662_100054092 | |||
| 1495 | Ga0070662_100084841 | |||
| 1496 | Ga0070662_100086025 | |||
| 1497 | Ga0070662_100108111 | |||
| 1498 | Ga0070662_100191259 | |||
| 1499 | Ga0070662_100253310 | |||
| 1500 | Ga0070662_100291044 | |||
| 1501 | Ga0070662_100412910 | |||
| 1502 | Ga0070662_100502377 | |||
| 1503 | Ga0070681_10007382 | |||
| 1504 | Ga0070681_10027469 | |||
| 1505 | Ga0070681_10090937 | |||
| 1506 | Ga0070681_10138517 | |||
| 1507 | Ga0070681_10139710 | |||
| 1508 | Ga0070681_10631823 | |||
| 1509 | Ga0068867_100002157 | |||
| 1510 | Ga0068867_100013521 | |||
| 1511 | Ga0068867_100058680 | |||
| 1512 | Ga0070685_10129926 | |||
| 1513 | Ga0070685_10158132 | |||
| 1514 | Ga0070685_10392529 | |||
| 1515 | Ga0070679_100052424 | |||
| 1516 | Ga0070679_100100779 | |||
| 1517 | Ga0070679_100105747 | |||
| 1518 | Ga0070679_100194513 | |||
| 1519 | Ga0070679_100198235 | |||
| 1520 | Ga0070679_100279162 | |||
| 1521 | Ga0070679_100378175 | |||
| 1522 | Ga0070679_100644163 | |||
| 1523 | Ga0070684_100005169 | |||
| 1524 | Ga0070684_100012155 | |||
| 1525 | Ga0070684_100047690 | |||
| 1526 | Ga0070684_100477544 | |||
| 1527 | Ga0070684_101011425 | |||
| 1528 | Ga0070684_101076786 | |||
| 1529 | Ga0068853_100005995 | |||
| 1530 | Ga0068853_100016655 | |||
| 1531 | Ga0068853_100036459 | |||
| 1532 | Ga0068853_100050529 | |||
| 1533 | Ga0068853_100214727 | |||
| 1534 | Ga0068853_100295176 | |||
| 1535 | Ga0068853_100584768 | |||
| 1536 | Ga0070672_100001947 | |||
| 1537 | Ga0070672_100005121 | |||
| 1538 | Ga0070672_100014019 | |||
| 1539 | Ga0070672_100027707 | |||
| 1540 | Ga0070672_100263327 | |||
| 1541 | Ga0070672_100415479 | |||
| 1542 | Ga0070686_100008428 | |||
| 1543 | Ga0070686_100011256 | |||
| 1544 | Ga0070696_100345409 | |||
| 1545 | Ga0070693_100000966 | |||
| 1546 | Ga0070693_100020626 | |||
| 1547 | Ga0070693_100034854 | |||
| 1548 | Ga0070693_100402246 | |||
| 1549 | Ga0070665_100012074 | |||
| 1550 | Ga0070665_100021376 | |||
| 1551 | Ga0070665_100021432 | |||
| 1552 | Ga0070665_100037912 | |||
| 1553 | Ga0070665_100258632 | |||
| 1554 | Ga0070665_101458061 | |||
| 1555 | Ga0068855_100011859 | |||
| 1556 | Ga0068855_100034378 | |||
| 1557 | Ga0068855_100052334 | |||
| 1558 | Ga0068855_100060596 | |||
| 1559 | Ga0068855_100124576 | |||
| 1560 | Ga0068855_100172558 | |||
| 1561 | Ga0068855_100212966 | |||
| 1562 | Ga0068855_100322750 | |||
| 1563 | Ga0068855_100366550 | |||
| 1564 | Ga0068855_100725529 | |||
| 1565 | Ga0068855_101052137 | |||
| 1566 | Ga0070664_100000025 | |||
| 1567 | Ga0070664_100002840 | |||
| 1568 | Ga0070664_100004324 | |||
| 1569 | Ga0070664_100010146 | |||
| 1570 | Ga0070664_100017113 | |||
| 1571 | Ga0070664_100036475 | |||
| 1572 | Ga0070664_100061556 | |||
| 1573 | Ga0070664_100071444 | |||
| 1574 | Ga0070664_100094308 | |||
| 1575 | Ga0070664_100139683 | |||
| 1576 | Ga0070664_100162899 | |||
| 1577 | Ga0070664_100237698 | |||
| 1578 | Ga0070664_100263228 | |||
| 1579 | Ga0070664_100412215 | |||
| 1580 | Ga0070664_100744878 | |||
| 1581 | Ga0068857_100003470 | |||
| 1582 | Ga0068857_100073685 | |||
| 1583 | Ga0068857_100180099 | |||
| 1584 | Ga0068857_100255122 | |||
| 1585 | Ga0068857_100327198 | |||
| 1586 | Ga0068857_100490969 | |||
| 1587 | Ga0068854_100002456 | |||
| 1588 | Ga0068854_100063923 | |||
| 1589 | Ga0068854_100077715 | |||
| 1590 | Ga0068854_100080297 | |||
| 1591 | Ga0068854_100080755 | |||
| 1592 | Ga0068854_100159294 | |||
| 1593 | Ga0068854_100433227 | |||
| 1594 | Ga0068854_100813070 | |||
| 1595 | Ga0068856_100000124 | |||
| 1596 | Ga0068856_100057183 | |||
| 1597 | Ga0068856_100059079 | |||
| 1598 | Ga0068856_100130912 | |||
| 1599 | Ga0068856_100150403 | |||
| 1600 | Ga0068856_100336167 | |||
| 1601 | Ga0068856_100381181 | |||
| 1602 | Ga0068856_100413707 | |||
| 1603 | Ga0068856_100455173 | |||
| 1604 | Ga0068856_100530385 | |||
| 1605 | Ga0068856_100578077 | |||
| 1606 | Ga0068856_100578289 | |||
| 1607 | Ga0068856_100687256 | |||
| 1608 | Ga0068856_100816438 | |||
| 1609 | Ga0068856_100825440 | |||
| 1610 | Ga0068856_100896322 | |||
| 1611 | Ga0070702_100667533 | |||
| 1612 | Ga0068852_100000258 | |||
| 1613 | Ga0068852_100001780 | |||
| 1614 | Ga0068852_100002322 | |||
| 1615 | Ga0068852_100006143 | |||
| 1616 | Ga0068852_100006923 | |||
| 1617 | Ga0068852_100009796 | |||
| 1618 | Ga0068852_100022922 | |||
| 1619 | Ga0068852_100070145 | |||
| 1620 | Ga0068852_100253030 | |||
| 1621 | Ga0068852_100272698 | |||
| 1622 | Ga0068852_100308173 | |||
| 1623 | Ga0068852_100353971 | |||
| 1624 | Ga0068852_100482548 | |||
| 1625 | Ga0068852_100627740 | |||
| 1626 | Ga0068852_100651310 | |||
| 1627 | Ga0068852_100766566 | |||
| 1628 | Ga0068859_100012168 | |||
| 1629 | Ga0068859_100614168 | |||
| 1630 | Ga0068864_100012218 | |||
| 1631 | Ga0068864_100014822 | |||
| 1632 | Ga0068864_100036486 | |||
| 1633 | Ga0068864_100044039 | |||
| 1634 | Ga0068864_100082819 | |||
| 1635 | Ga0068864_100120565 | |||
| 1636 | Ga0068866_10069321 | |||
| 1637 | Ga0068866_10090181 | |||
| 1638 | Ga0068861_100469808 | |||
| 1639 | Ga0068861_100718904 | |||
| 1640 | Ga0068851_10005612 | |||
| 1641 | Ga0068851_10028607 | |||
| 1642 | Ga0068851_10047679 | |||
| 1643 | Ga0068851_10050555 | |||
| 1644 | Ga0068851_10221190 | |||
| 1645 | Ga0068851_10222663 | |||
| 1646 | Ga0068870_10117296 | |||
| 1647 | Ga0068863_100006971 | |||
| 1648 | Ga0068863_100029914 | |||
| 1649 | Ga0068863_100066416 | |||
| 1650 | Ga0068863_100149179 | |||
| 1651 | Ga0068863_100924637 | |||
| 1652 | Ga0068858_100007473 | |||
| 1653 | Ga0068858_100028311 | |||
| 1654 | Ga0068858_100031238 | |||
| 1655 | Ga0068858_100039224 | |||
| 1656 | Ga0068858_100067395 | |||
| 1657 | Ga0068858_100134742 | |||
| 1658 | Ga0068860_100027079 | |||
| 1659 | Ga0068860_100194061 | |||
| 1660 | Ga0068860_100461109 | |||
| 1661 | Ga0068862_100084138 | |||
| 1662 | Ga0068862_100979743 | |||
| 1663 | Ga0081539_10036448 | |||
| 1664 | Ga0081539_10046505 | |||
| 1665 | Ga0070717_10008964 | |||
| 1666 | Ga0070717_10416762 | |||
| 1667 | Ga0070716_100659014 | |||
| 1668 | Ga0070712_100172191 | |||
| 1669 | Ga0097621_100056193 | |||
| 1670 | Ga0097621_100060774 | |||
| 1671 | Ga0097621_100370942 | |||
| 1672 | Ga0068871_100005821 | |||
| 1673 | Ga0068871_100113444 | |||
| 1674 | Ga0068871_100328852 | |||
| 1675 | Ga0068865_100003403 | |||
| 1676 | Ga0097620_100012168 | |||
| 1677 | Ga0097620_100614068 | |||
| 1678 | Ga0105240_10031029 | |||
| 1679 | Ga0105240_10044639 | |||
| 1680 | Ga0105240_10053097 | |||
| 1681 | Ga0105240_10148616 | |||
| 1682 | Ga0105245_10004618 | |||
| 1683 | Ga0105245_10263822 | |||
| 1684 | Ga0105247_10419023 | |||
| 1685 | Ga0105243_10097294 | |||
| 1686 | Ga0105243_10099429 | |||
| 1687 | Ga0105243_10618992 | |||
| 1688 | Ga0105243_11318304 | |||
| 1689 | Ga0105241_10102757 | |||
| 1690 | Ga0105241_10737941 | |||
| 1691 | Ga0105242_10005896 | |||
| 1692 | Ga0105242_10119162 | |||
| 1693 | Ga0105248_10000163 | |||
| 1694 | Ga0105248_10001027 | |||
| 1695 | Ga0105248_10012351 | |||
| 1696 | Ga0105248_10030293 | |||
| 1697 | Ga0105248_10067608 | |||
| 1698 | Ga0105248_10260005 | |||
| 1699 | Ga0105248_10273363 | |||
| 1700 | Ga0105248_10334876 | |||
| 1701 | Ga0105248_10348909 | |||
| 1702 | Ga0105248_10551744 | |||
| 1703 | Ga0105237_10043108 | |||
| 1704 | Ga0105238_10007517 | |||
| 1705 | Ga0105238_10011563 | |||
| 1706 | Ga0105238_10041382 | |||
| 1707 | Ga0105238_10075424 | |||
| 1708 | Ga0105238_10150554 | |||
| 1709 | Ga0105238_10753635 | |||
| 1710 | Ga0105238_10945471 | |||
| 1711 | Ga0105238_11139979 | |||
| 1712 | Ga0105239_10038047 | |||
| 1713 | Ga0105239_10084583 | |||
| 1714 | Ga0105246_10161761 | |||
| 1715 | Ga0157315_1019661 | |||
| 1716 | Ga0157373_10001899 | |||
| 1717 | Ga0157373_10009283 | |||
| 1718 | Ga0157373_10037379 | |||
| 1719 | Ga0157373_10055698 | |||
| 1720 | Ga0157373_10074694 | |||
| 1721 | Ga0157373_10087659 | |||
| 1722 | Ga0157373_10111140 | |||
| 1723 | Ga0157373_10309083 | |||
| 1724 | Ga0157373_10367654 | |||
| 1725 | Ga0157373_10383629 | |||
| 1726 | Ga0157373_10415158 | |||
| 1727 | Ga0157373_10468256 | |||
| 1728 | Ga0157373_10495606 | |||
| 1729 | Ga0157373_10881036 | |||
| 1730 | Ga0157373_10901235 | |||
| 1731 | Ga0157371_10000722 | |||
| 1732 | Ga0157371_10018575 | |||
| 1733 | Ga0157371_10045813 | |||
| 1734 | Ga0157371_10045962 | |||
| 1735 | Ga0157371_10050463 | |||
| 1736 | Ga0157371_10083923 | |||
| 1737 | Ga0157371_10085547 | |||
| 1738 | Ga0157371_10175831 | |||
| 1739 | Ga0157371_10206211 | |||
| 1740 | Ga0157371_10379030 | |||
| 1741 | Ga0157371_10489200 | |||
| 1742 | Ga0157371_10732572 | |||
| 1743 | Ga0157370_10002132 | |||
| 1744 | Ga0157370_10011123 | |||
| 1745 | Ga0157370_10044051 | |||
| 1746 | Ga0157370_10044564 | |||
| 1747 | Ga0157370_10065474 | |||
| 1748 | Ga0157370_10121323 | |||
| 1749 | Ga0157370_10251893 | |||
| 1750 | Ga0157370_10288662 | |||
| 1751 | Ga0157370_10557877 | |||
| 1752 | Ga0157370_10766430 | |||
| 1753 | Ga0157369_10002370 | |||
| 1754 | Ga0157369_10003475 | |||
| 1755 | Ga0157369_10016327 | |||
| 1756 | Ga0157369_10029281 | |||
| 1757 | Ga0157369_10063321 | |||
| 1758 | Ga0157369_10104170 | |||
| 1759 | Ga0157369_10125589 | |||
| 1760 | Ga0157369_10131001 | |||
| 1761 | Ga0157369_10266589 | |||
| 1762 | Ga0157369_10390730 | |||
| 1763 | Ga0157369_10546596 | |||
| 1764 | Ga0157369_11408535 | |||
| 1765 | Ga0157369_11413402 | |||
| 1766 | Ga0157369_11547678 | |||
| 1767 | Ga0157374_10033021 | |||
| 1768 | Ga0157374_10089463 | |||
| 1769 | Ga0157374_10169847 | |||
| 1770 | Ga0157374_10387138 | |||
| 1771 | Ga0157378_10669215 | |||
| 1772 | Ga0163162_10014842 | |||
| 1773 | Ga0163162_10021028 | |||
| 1774 | Ga0163162_10026415 | |||
| 1775 | Ga0163162_11192906 | |||
| 1776 | Ga0157372_10019012 | |||
| 1777 | Ga0157372_10052353 | |||
| 1778 | Ga0157372_10156877 | |||
| 1779 | Ga0157372_10170221 | |||
| 1780 | Ga0157372_10186546 | |||
| 1781 | Ga0157372_10198890 | |||
| 1782 | Ga0157372_10239273 | |||
| 1783 | Ga0157372_10516489 | |||
| 1784 | Ga0157372_10816097 | |||
| 1785 | Ga0157372_10965634 | |||
| 1786 | Ga0157372_11273593 | |||
| 1787 | Ga0157375_10002761 | |||
| 1788 | Ga0157375_10034318 | |||
| 1789 | Ga0157375_10200863 | |||
| 1790 | Ga0157375_11475269 | |||
| 1791 | Ga0163163_10000173 | |||
| 1792 | Ga0163163_10051669 | |||
| 1793 | Ga0163163_10186225 | |||
| 1794 | Ga0163163_10191172 | |||
| 1795 | Ga0163163_10415726 | |||
| 1796 | Ga0157380_10379370 | |||
| 1797 | Ga0157380_10454426 | |||
| 1798 | Ga0157379_10065182 | |||
| 1799 | Ga0157379_10134024 | |||
| 1800 | Ga0157376_10053140 | |||
| 1801 | Ga0163161_10025329 | |||
| 1802 | Ga0206356_11441584 | |||
| 1803 | Ga0206353_11057767 | |||
| 1804 | Ga0206353_11361306 | |||
| 1805 | Ga0207697_10209462 | |||
| 1806 | Ga0207656_10002362 | |||
| 1807 | Ga0207656_10145842 | |||
| 1808 | Ga0207656_10215377 | |||
| 1809 | Ga0207682_10028201 | |||
| 1810 | Ga0207682_10043094 | |||
| 1811 | Ga0207682_10086460 | |||
| 1812 | Ga0207642_10042182 | |||
| 1813 | Ga0207642_10046436 | |||
| 1814 | Ga0207642_10396772 | |||
| 1815 | Ga0207688_10032435 | |||
| 1816 | Ga0207688_10090427 | |||
| 1817 | Ga0207688_10569129 | |||
| 1818 | Ga0207688_10598624 | |||
| 1819 | Ga0207680_10000588 | |||
| 1820 | Ga0207680_10002808 | |||
| 1821 | Ga0207680_10005390 | |||
| 1822 | Ga0207680_10024995 | |||
| 1823 | Ga0207680_10057354 | |||
| 1824 | Ga0207647_10000578 | |||
| 1825 | Ga0207647_10000847 | |||
| 1826 | Ga0207647_10008433 | |||
| 1827 | Ga0207647_10014698 | |||
| 1828 | Ga0207647_10025891 | |||
| 1829 | Ga0207647_10077026 | |||
| 1830 | Ga0207647_10210630 | |||
| 1831 | Ga0207647_10234107 | |||
| 1832 | Ga0207647_10257442 | |||
| 1833 | Ga0207699_10233637 | |||
| 1834 | Ga0207699_10391302 | |||
| 1835 | Ga0207645_10274253 | |||
| 1836 | Ga0207705_10000114 | |||
| 1837 | Ga0207705_10003467 | |||
| 1838 | Ga0207705_10005572 | |||
| 1839 | Ga0207705_10013148 | |||
| 1840 | Ga0207705_10016862 | |||
| 1841 | Ga0207705_10025558 | |||
| 1842 | Ga0207705_10027307 | |||
| 1843 | Ga0207705_10044210 | |||
| 1844 | Ga0207705_10050687 | |||
| 1845 | Ga0207705_10064937 | |||
| 1846 | Ga0207705_10072788 | |||
| 1847 | Ga0207705_10099178 | |||
| 1848 | Ga0207705_10144254 | |||
| 1849 | Ga0207705_10294887 | |||
| 1850 | Ga0207705_10346894 | |||
| 1851 | Ga0207705_10437624 | |||
| 1852 | Ga0207705_10603019 | |||
| 1853 | Ga0207654_10044299 | |||
| 1854 | Ga0207707_10012721 | |||
| 1855 | Ga0207707_10029074 | |||
| 1856 | Ga0207707_10069874 | |||
| 1857 | Ga0207707_10173136 | |||
| 1858 | Ga0207695_10005878 | |||
| 1859 | Ga0207695_10034616 | |||
| 1860 | Ga0207695_10093678 | |||
| 1861 | Ga0207695_10246193 | |||
| 1862 | Ga0207671_10018993 | |||
| 1863 | Ga0207671_10308690 | |||
| 1864 | Ga0207693_10132028 | |||
| 1865 | Ga0207660_10003154 | |||
| 1866 | Ga0207660_10004089 | |||
| 1867 | Ga0207660_10015179 | |||
| 1868 | Ga0207660_10034564 | |||
| 1869 | Ga0207660_10117354 | |||
| 1870 | Ga0207660_10617651 | |||
| 1871 | Ga0207662_10117121 | |||
| 1872 | Ga0207657_10000071 | |||
| 1873 | Ga0207657_10001850 | |||
| 1874 | Ga0207657_10003997 | |||
| 1875 | Ga0207657_10004553 | |||
| 1876 | Ga0207657_10005304 | |||
| 1877 | Ga0207657_10005926 | |||
| 1878 | Ga0207657_10008351 | |||
| 1879 | Ga0207657_10012074 | |||
| 1880 | Ga0207657_10012753 | |||
| 1881 | Ga0207657_10012849 | |||
| 1882 | Ga0207657_10015172 | |||
| 1883 | Ga0207657_10038415 | |||
| 1884 | Ga0207657_10048536 | |||
| 1885 | Ga0207657_10080570 | |||
| 1886 | Ga0207657_10113551 | |||
| 1887 | Ga0207657_10147868 | |||
| 1888 | Ga0207657_10164372 | |||
| 1889 | Ga0207657_10365276 | |||
| 1890 | Ga0207649_10000301 | |||
| 1891 | Ga0207649_10006013 | |||
| 1892 | Ga0207649_10007161 | |||
| 1893 | Ga0207649_10025118 | |||
| 1894 | Ga0207649_10025467 | |||
| 1895 | Ga0207649_10088400 | |||
| 1896 | Ga0207649_10110005 | |||
| 1897 | Ga0207649_10146042 | |||
| 1898 | Ga0207649_10261287 | |||
| 1899 | Ga0207649_10305354 | |||
| 1900 | Ga0207649_10534170 | |||
| 1901 | Ga0207652_10038052 | |||
| 1902 | Ga0207652_10055667 | |||
| 1903 | Ga0207652_10068217 | |||
| 1904 | Ga0207652_10099772 | |||
| 1905 | Ga0207652_10177448 | |||
| 1906 | Ga0207652_10294419 | |||
| 1907 | Ga0207652_10391083 | |||
| 1908 | Ga0207681_10068598 | |||
| 1909 | Ga0207681_10924529 | |||
| 1910 | Ga0207694_10030955 | |||
| 1911 | Ga0207694_10169287 | |||
| 1912 | Ga0207694_10414689 | |||
| 1913 | Ga0207694_10914879 | |||
| 1914 | Ga0207650_10003748 | |||
| 1915 | Ga0207650_10029991 | |||
| 1916 | Ga0207650_10101879 | |||
| 1917 | Ga0207650_10138604 | |||
| 1918 | Ga0207650_10148312 | |||
| 1919 | Ga0207650_10170908 | |||
| 1920 | Ga0207650_10264356 | |||
| 1921 | Ga0207650_10335020 | |||
| 1922 | Ga0207650_10409271 | |||
| 1923 | Ga0207659_10026064 | |||
| 1924 | Ga0207659_10040228 | |||
| 1925 | Ga0207687_10025968 | |||
| 1926 | Ga0207687_10038311 | |||
| 1927 | Ga0207687_10151581 | |||
| 1928 | Ga0207687_10273564 | |||
| 1929 | Ga0207700_10043741 | |||
| 1930 | Ga0207700_10066670 | |||
| 1931 | Ga0207700_10823397 | |||
| 1932 | Ga0207664_10048381 | |||
| 1933 | Ga0207664_10125113 | |||
| 1934 | Ga0207664_10138033 | |||
| 1935 | Ga0207664_10140772 | |||
| 1936 | Ga0207664_10159852 | |||
| 1937 | Ga0207644_10000938 | |||
| 1938 | Ga0207644_10001286 | |||
| 1939 | Ga0207644_10025546 | |||
| 1940 | Ga0207644_10030490 | |||
| 1941 | Ga0207644_10041678 | |||
| 1942 | Ga0207644_10065238 | |||
| 1943 | Ga0207644_10251506 | |||
| 1944 | Ga0207644_10527233 | |||
| 1945 | Ga0207690_10000036 | |||
| 1946 | Ga0207690_10001260 | |||
| 1947 | Ga0207690_10001587 | |||
| 1948 | Ga0207690_10007965 | |||
| 1949 | Ga0207690_10008227 | |||
| 1950 | Ga0207690_10012259 | |||
| 1951 | Ga0207690_10025527 | |||
| 1952 | Ga0207690_10035858 | |||
| 1953 | Ga0207690_10056492 | |||
| 1954 | Ga0207690_10060651 | |||
| 1955 | Ga0207690_10067734 | |||
| 1956 | Ga0207690_10096499 | |||
| 1957 | Ga0207690_10189332 | |||
| 1958 | Ga0207706_10000086 | |||
| 1959 | Ga0207706_10000655 | |||
| 1960 | Ga0207706_10001832 | |||
| 1961 | Ga0207706_10005579 | |||
| 1962 | Ga0207706_10012577 | |||
| 1963 | Ga0207706_10074739 | |||
| 1964 | Ga0207706_10096045 | |||
| 1965 | Ga0207706_10110508 | |||
| 1966 | Ga0207706_10140896 | |||
| 1967 | Ga0207706_10229056 | |||
| 1968 | Ga0207706_10258780 | |||
| 1969 | Ga0207706_10400563 | |||
| 1970 | Ga0207706_10443685 | |||
| 1971 | Ga0207706_10455759 | |||
| 1972 | Ga0207706_10543975 | |||
| 1973 | Ga0207706_10591090 | |||
| 1974 | Ga0207706_10727873 | |||
| 1975 | Ga0207706_10894271 | |||
| 1976 | Ga0207706_10898298 | |||
| 1977 | Ga0207686_10026775 | |||
| 1978 | Ga0207670_10183621 | |||
| 1979 | Ga0207669_10005727 | |||
| 1980 | Ga0207669_10048608 | |||
| 1981 | Ga0207669_10245713 | |||
| 1982 | Ga0207704_10012057 | |||
| 1983 | Ga0207665_10434000 | |||
| 1984 | Ga0207691_10005925 | |||
| 1985 | Ga0207691_10008686 | |||
| 1986 | Ga0207691_10016083 | |||
| 1987 | Ga0207691_10018849 | |||
| 1988 | Ga0207691_10069147 | |||
| 1989 | Ga0207691_10077435 | |||
| 1990 | Ga0207691_10141556 | |||
| 1991 | Ga0207691_10260460 | |||
| 1992 | Ga0207691_10283555 | |||
| 1993 | Ga0207691_10315532 | |||
| 1994 | Ga0207711_10001440 | |||
| 1995 | Ga0207711_10004448 | |||
| 1996 | Ga0207711_10014281 | |||
| 1997 | Ga0207711_10023657 | |||
| 1998 | Ga0207711_10033338 | |||
| 1999 | Ga0207711_10073648 | |||
| 2000 | Ga0207711_10183475 | |||
| 2001 | Ga0207711_10297295 | |||
| 2002 | Ga0207711_10473772 | |||
| 2003 | Ga0207661_10001017 | |||
| 2004 | Ga0207661_10041499 | |||
| 2005 | Ga0207661_10079255 | |||
| 2006 | Ga0207661_10145748 | |||
| 2007 | Ga0207661_10152490 | |||
| 2008 | Ga0207661_10157332 | |||
| 2009 | Ga0207661_10170151 | |||
| 2010 | Ga0207661_10289625 | |||
| 2011 | Ga0207661_10565455 | |||
| 2012 | Ga0207661_10835364 | |||
| 2013 | Ga0207679_10001003 | |||
| 2014 | Ga0207679_10007564 | |||
| 2015 | Ga0207679_10012180 | |||
| 2016 | Ga0207679_10022450 | |||
| 2017 | Ga0207679_10031643 | |||
| 2018 | Ga0207679_10035299 | |||
| 2019 | Ga0207679_10074095 | |||
| 2020 | Ga0207679_10096517 | |||
| 2021 | Ga0207679_10115276 | |||
| 2022 | Ga0207679_10219517 | |||
| 2023 | Ga0207679_10407233 | |||
| 2024 | Ga0207679_10649255 | |||
| 2025 | Ga0207679_10812337 | |||
| 2026 | Ga0207667_10020463 | |||
| 2027 | Ga0207667_10020839 | |||
| 2028 | Ga0207667_10047180 | |||
| 2029 | Ga0207667_10047561 | |||
| 2030 | Ga0207667_10076725 | |||
| 2031 | Ga0207667_10142347 | |||
| 2032 | Ga0207667_10237097 | |||
| 2033 | Ga0207667_10314940 | |||
| 2034 | Ga0207667_10535997 | |||
| 2035 | Ga0207667_10704323 | |||
| 2036 | Ga0207667_11185691 | |||
| 2037 | Ga0207651_10000835 | |||
| 2038 | Ga0207651_10008691 | |||
| 2039 | Ga0207651_10033050 | |||
| 2040 | Ga0207651_10039416 | |||
| 2041 | Ga0207651_10113312 | |||
| 2042 | Ga0207651_10243792 | |||
| 2043 | Ga0207651_10715936 | |||
| 2044 | Ga0207651_10722058 | |||
| 2045 | Ga0207651_10954083 | |||
| 2046 | Ga0207668_10225992 | |||
| 2047 | Ga0207668_10793464 | |||
| 2048 | Ga0207640_10001884 | |||
| 2049 | Ga0207640_10011360 | |||
| 2050 | Ga0207640_10031247 | |||
| 2051 | Ga0207640_10046080 | |||
| 2052 | Ga0207640_10067381 | |||
| 2053 | Ga0207640_10286422 | |||
| 2054 | Ga0207640_10382081 | |||
| 2055 | Ga0207640_10399946 | |||
| 2056 | Ga0207640_10780272 | |||
| 2057 | Ga0207658_10005223 | |||
| 2058 | Ga0207658_10028732 | |||
| 2059 | Ga0207658_10031024 | |||
| 2060 | Ga0207658_10094571 | |||
| 2061 | Ga0207658_10130315 | |||
| 2062 | Ga0207658_10168970 | |||
| 2063 | Ga0207658_10281026 | |||
| 2064 | Ga0207658_10451618 | |||
| 2065 | Ga0207677_10000756 | |||
| 2066 | Ga0207677_10003910 | |||
| 2067 | Ga0207677_10045549 | |||
| 2068 | Ga0207677_10218062 | |||
| 2069 | Ga0207677_10278500 | |||
| 2070 | Ga0207703_10002376 | |||
| 2071 | Ga0207703_10004143 | |||
| 2072 | Ga0207703_10022384 | |||
| 2073 | Ga0207703_10030255 | |||
| 2074 | Ga0207703_10958366 | |||
| 2075 | Ga0207639_10001003 | |||
| 2076 | Ga0207639_10085686 | |||
| 2077 | Ga0207639_10096809 | |||
| 2078 | Ga0207639_10100044 | |||
| 2079 | Ga0207639_10130406 | |||
| 2080 | Ga0207639_10211114 | |||
| 2081 | Ga0207639_10400529 | |||
| 2082 | Ga0207639_10542121 | |||
| 2083 | Ga0207678_10000311 | |||
| 2084 | Ga0207678_10000860 | |||
| 2085 | Ga0207678_10010899 | |||
| 2086 | Ga0207678_10015794 | |||
| 2087 | Ga0207678_10018362 | |||
| 2088 | Ga0207678_10031397 | |||
| 2089 | Ga0207678_10045759 | |||
| 2090 | Ga0207678_10155907 | |||
| 2091 | Ga0207678_10180040 | |||
| 2092 | Ga0207678_10363316 | |||
| 2093 | Ga0207702_10000254 | |||
| 2094 | Ga0207702_10026383 | |||
| 2095 | Ga0207702_10058590 | |||
| 2096 | Ga0207702_10082571 | |||
| 2097 | Ga0207702_10124805 | |||
| 2098 | Ga0207702_10212041 | |||
| 2099 | Ga0207702_10216363 | |||
| 2100 | Ga0207702_10337051 | |||
| 2101 | Ga0207702_10421497 | |||
| 2102 | Ga0207641_10050807 | |||
| 2103 | Ga0207641_10170090 | |||
| 2104 | Ga0207641_10277997 | |||
| 2105 | Ga0207641_11358746 | |||
| 2106 | Ga0207648_10002294 | |||
| 2107 | Ga0207648_10082565 | |||
| 2108 | Ga0207648_10279144 | |||
| 2109 | Ga0207648_11160018 | |||
| 2110 | Ga0207676_10003616 | |||
| 2111 | Ga0207676_10010907 | |||
| 2112 | Ga0207676_10014877 | |||
| 2113 | Ga0207676_10056032 | |||
| 2114 | Ga0207676_10058487 | |||
| 2115 | Ga0207676_10131413 | |||
| 2116 | Ga0207676_10502540 | |||
| 2117 | Ga0207674_10005176 | |||
| 2118 | Ga0207674_10005543 | |||
| 2119 | Ga0207674_10007065 | |||
| 2120 | Ga0207674_10007931 | |||
| 2121 | Ga0207674_10024605 | |||
| 2122 | Ga0207674_10219475 | |||
| 2123 | Ga0207674_10237068 | |||
| 2124 | Ga0207675_100213003 | |||
| 2125 | Ga0207683_10001310 | |||
| 2126 | Ga0207683_10003597 | |||
| 2127 | Ga0207683_10011050 | |||
| 2128 | Ga0207683_10031941 | |||
| 2129 | Ga0207683_10089353 | |||
| 2130 | Ga0207683_10250062 | |||
| 2131 | Ga0207683_10405302 | |||
| 2132 | Ga0207683_10837032 | |||
| 2133 | Ga0207698_10003268 | |||
| 2134 | Ga0207698_10008079 | |||
| 2135 | Ga0207698_10012833 | |||
| 2136 | Ga0207698_10029712 | |||
| 2137 | Ga0207698_10049084 | |||
| 2138 | Ga0207698_10084138 | |||
| 2139 | Ga0207698_10175868 | |||
| 2140 | Ga0207698_10268608 | |||
| 2141 | Ga0207698_10347339 | |||
| 2142 | Ga0207698_10376473 | |||
| 2143 | Ga0207698_10579905 | |||
| 2144 | Ga0207698_10845936 | |||
| 2145 | Ga0207698_11071303 | |||
| 2146 | Ga0207698_11386753 | |||
| 2147 | Ga0207698_11617726 | |||
| 2148 | Ga0210000_1057162 | |||
| 2149 | Ga0268266_10010254 | |||
| 2150 | Ga0268266_10028160 | |||
| 2151 | Ga0268266_10038358 | |||
| 2152 | Ga0268266_10063146 | |||
| 2153 | Ga0268266_10169778 | |||
| 2154 | Ga0268265_10186975 | |||
| 2155 | Ga0268264_10205041 | |||
| 2156 | Ga0268264_10861873 | |||
| 2157 | Ga0268264_11468442 | |||
| 2158 | Ga0316182_1354237 | |||
| 2159 | Ga0307408_100112234 | |||
| 2160 | Ga0307408_100155144 | |||
| 2161 | Ga0307408_100304655 | |||
| 2162 | Ga0307408_100990397 | |||
| 2163 | Ga0307405_10006019 | |||
| 2164 | Ga0307405_10045634 | |||
| 2165 | Ga0307405_10258548 | |||
| 2166 | Ga0307413_10026836 | |||
| 2167 | Ga0307413_10095446 | |||
| 2168 | Ga0307413_10108838 | |||
| 2169 | Ga0307413_10142749 | |||
| 2170 | Ga0307413_10967853 | |||
| 2171 | Ga0307410_10002555 | |||
| 2172 | Ga0307410_10012463 | |||
| 2173 | Ga0307410_10024901 | |||
| 2174 | Ga0307410_10062353 | |||
| 2175 | Ga0307410_10144196 | |||
| 2176 | Ga0307410_10247309 | |||
| 2177 | Ga0307410_10442130 | |||
| 2178 | Ga0307410_10809072 | |||
| 2179 | Ga0307410_11098032 | |||
| 2180 | Ga0307406_10116588 | |||
| 2181 | Ga0307406_10164426 | |||
| 2182 | Ga0307406_10435356 | |||
| 2183 | Ga0307406_11075777 | |||
| 2184 | Ga0307406_11283352 | |||
| 2185 | Ga0307407_10011608 | |||
| 2186 | Ga0307407_10017576 | |||
| 2187 | Ga0307407_10050738 | |||
| 2188 | Ga0307407_10055577 | |||
| 2189 | Ga0307407_10061633 | |||
| 2190 | Ga0307407_10076096 | |||
| 2191 | Ga0307407_10406032 | |||
| 2192 | Ga0307407_10575354 | |||
| 2193 | Ga0307412_10006903 | |||
| 2194 | Ga0307412_10182619 | |||
| 2195 | Ga0307409_100016844 | |||
| 2196 | Ga0307409_100016939 | |||
| 2197 | Ga0307409_100029228 | |||
| 2198 | Ga0307409_100045170 | |||
| 2199 | Ga0307409_100237602 | |||
| 2200 | Ga0307409_100399328 | |||
| 2201 | Ga0307409_100929163 | |||
| 2202 | Ga0307416_100005020 | |||
| 2203 | Ga0307416_100007589 | |||
| 2204 | Ga0307416_100067414 | |||
| 2205 | Ga0307416_100145821 | |||
| 2206 | Ga0307416_100940252 | |||
| 2207 | Ga0307414_10001190 | |||
| 2208 | Ga0307414_10023300 | |||
| 2209 | Ga0307414_10041903 | |||
| 2210 | Ga0307414_10050480 | |||
| 2211 | Ga0307414_10080737 | |||
| 2212 | Ga0307414_10196107 | |||
| 2213 | Ga0307414_10322016 | |||
| 2214 | Ga0307414_10457531 | |||
| 2215 | Ga0307411_10000684 | |||
| 2216 | Ga0307411_10001568 | |||
| 2217 | Ga0307411_10007374 | |||
| 2218 | Ga0307411_10007424 | |||
| 2219 | Ga0307411_10030604 | |||
| 2220 | Ga0307411_10051940 | |||
| 2221 | Ga0307411_10056837 | |||
| 2222 | Ga0307411_10114170 | |||
| 2223 | Ga0307411_10164614 | |||
| 2224 | Ga0307411_10334243 | |||
| 2225 | Ga0307411_10372014 | |||
| 2226 | Ga0307411_10386423 | |||
| 2227 | Ga0307411_10601446 | |||
| 2228 | Ga0307411_10709013 | |||
| 2229 | Ga0307411_11280332 | |||
| 2230 | Ga0307415_100012232 | |||
| 2231 | Ga0307415_100076270 | |||
| 2232 | Ga0307415_100114016 | |||
| 2233 | Ga0307415_100194831 | |||
| 2234 | Ga0307415_100259793 | |||
| 2235 | Ga0307415_100468983 | |||
| 2236 | Ga0373929_0005662 | |||
| 2237 | Ga0373923_0006193 | |||
| 2238 | Ga0373939_0046488 | |||
| 2239 | Ga0373943_0018615 | |||
| 2240 | Ga0373942_0186080 | |||
| 2241 | Ga0373962_0086971 | |||
| 2242 | Ga0373931_0039580 | |||
| 2243 | Ga0373935_0564331 | |||
| 2244 | Ga0373927_0094295 | |||
| 2245 | Ga0373925_0073763 | |||
| 2246 | Ga0395899_0000334 | |||
| 2247 | Ga0395899_0012346 | |||
| 2248 | Ga0395899_0018132 | |||
| 2249 | Ga0395899_0037601 | |||
| 2250 | Ga0395899_0064900 | |||
| 2251 | Ga0395899_0075586 | |||
| 2252 | Ga0395899_0076686 | |||
| 2253 | Ga0395899_0080924 | |||
| 2254 | Ga0395899_0081003 | |||
| 2255 | Ga0395899_0123180 | |||
| 2256 | Ga0395899_0135791 | |||
| 2257 | Ga0395899_0208523 | |||
| 2258 | Ga0395899_0256934 | |||
| 2259 | Ga0395899_0274782 | |||
| 2260 | Ga0395899_0317915 | |||
| 2261 | Ga0395899_0496141 | |||
| 2262 | Ga0395900_0000432 | |||
| 2263 | Ga0395900_0001160 | |||
| 2264 | Ga0395900_0003986 | |||
| 2265 | Ga0395900_0008812 | |||
| 2266 | Ga0395900_0017346 | |||
| 2267 | Ga0395900_0018056 | |||
| 2268 | Ga0395900_0021947 | |||
| 2269 | Ga0395900_0037484 | |||
| 2270 | Ga0395900_0038042 | |||
| 2271 | Ga0395900_0051619 | |||
| 2272 | Ga0395900_0051734 | |||
| 2273 | Ga0395900_0052710 | |||
| 2274 | Ga0395900_0067978 | |||
| 2275 | Ga0395900_0067997 | |||
| 2276 | Ga0395900_0102092 | |||
| 2277 | Ga0395900_0121494 | |||
| 2278 | Ga0395900_0131246 | |||
| 2279 | Ga0395900_0160205 | |||
| 2280 | Ga0395900_0208653 | |||
| 2281 | Ga0395900_0209570 | |||
| 2282 | Ga0395900_0211567 | |||
| 2283 | Ga0395900_0219753 | |||
| 2284 | Ga0395900_0242554 | |||
| 2285 | Ga0395900_0261051 | |||
| 2286 | Ga0395900_0622482 | |||
| 2287 | Ga0395900_0688208 | |||
| 2288 | Ga0395900_0829420 | |||
| 2289 | Ga0395900_1079408 | |||
| 2290 | Ga0395900_1199202 | |||
| 2291 | Ga0395900_1305623 | |||
| 2292 | Ga0395898_0000021 | |||
| 2293 | Ga0395898_0036496 | |||
| 2294 | Ga0395898_0051020 | |||
| 2295 | Ga0395898_0066634 | |||
| 2296 | Ga0395898_0074263 | |||
| 2297 | Ga0395898_0090560 | |||
| 2298 | Ga0395898_0142924 | |||
| 2299 | Ga0395898_0148186 | |||
| 2300 | Ga0395898_0222148 | |||
| 2301 | Ga0395898_0232179 | |||
| 2302 | Ga0395898_0277597 | |||
| 2303 | Ga0395898_0313564 | |||
| 2304 | Ga0395898_0314529 | |||
| 2305 | Ga0395898_0517428 | |||
| 2306 | Ga0395898_0579390 | |||
| 2307 | Ga0395898_0666424 | |||
| 2308 | Ga0395905_0000413 | |||
| 2309 | Ga0395905_0000688 | |||
| 2310 | Ga0395905_0004997 | |||
| 2311 | Ga0395905_0008813 | |||
| 2312 | Ga0395905_0010096 | |||
| 2313 | Ga0395905_0013497 | |||
| 2314 | Ga0395905_0014327 | |||
| 2315 | Ga0395905_0015950 | |||
| 2316 | Ga0395905_0017635 | |||
| 2317 | Ga0395905_0035094 | |||
| 2318 | Ga0395905_0039027 | |||
| 2319 | Ga0395905_0041715 | |||
| 2320 | Ga0395905_0042916 | |||
| 2321 | Ga0395905_0047098 | |||
| 2322 | Ga0395905_0050964 | |||
| 2323 | Ga0395905_0066963 | |||
| 2324 | Ga0395905_0096439 | |||
| 2325 | Ga0395905_0097685 | |||
| 2326 | Ga0395905_0115243 | |||
| 2327 | Ga0395905_0121465 | |||
| 2328 | Ga0395905_0151069 | |||
| 2329 | Ga0395905_0157204 | |||
| 2330 | Ga0395905_0181456 | |||
| 2331 | Ga0395905_0181831 | |||
| 2332 | Ga0395905_0197563 | |||
| 2333 | Ga0395905_0200971 | |||
| 2334 | Ga0395905_0208188 | |||
| 2335 | Ga0395905_0209456 | |||
| 2336 | Ga0395905_0212661 | |||
| 2337 | Ga0395905_0249410 | |||
| 2338 | Ga0395905_0261740 | |||
| 2339 | Ga0395905_0306588 | |||
| 2340 | Ga0395905_0343988 | |||
| 2341 | Ga0395905_0403595 | |||
| 2342 | Ga0395905_0549334 | |||
| 2343 | Ga0395905_0552383 | |||
| 2344 | Ga0395905_0640461 | |||
| 2345 | Ga0395905_0657074 | |||
| 2346 | Ga0395905_0784216 | |||
| 2347 | Ga0395905_1239808 | |||
| 2348 | Ga0395901_0000241 | |||
| 2349 | Ga0395901_0000476 | |||
| 2350 | Ga0395901_0011523 | |||
| 2351 | Ga0395901_0020834 | |||
| 2352 | Ga0395901_0034542 | |||
| 2353 | Ga0395901_0057733 | |||
| 2354 | Ga0395901_0057777 | |||
| 2355 | Ga0395901_0057844 | |||
| 2356 | Ga0395901_0062289 | |||
| 2357 | Ga0395901_0112319 | |||
| 2358 | Ga0395901_0121288 | |||
| 2359 | Ga0395901_0139648 | |||
| 2360 | Ga0395901_0179519 | |||
| 2361 | Ga0395901_0185793 | |||
| 2362 | Ga0395901_0187334 | |||
| 2363 | Ga0395901_0196737 | |||
| 2364 | Ga0395901_0249503 | |||
| 2365 | Ga0395901_0423153 | |||
| 2366 | Ga0395901_0455725 | |||
| 2367 | Ga0395901_0459253 | |||
| 2368 | Ga0395901_0529303 | |||
| 2369 | Ga0395901_0609134 | |||
| 2370 | Ga0395901_0704653 | |||
| 2371 | Ga0395901_0826911 | |||
| 2372 | Ga0436365_0605932 | |||
| 2373 | Ga0436363_0724783 | |||
| 2374 | Ga0439448_0223837 | |||
| 2375 | Ga0439432_042370 | |||
| 2376 | Ga0439432_125985 | |||
| 2377 | Ga0439449_0191792 | |||
| 2378 | Ga0450912_004686 | |||
| 2379 | Ga0450914_002047 | |||
| 2380 | Ga0450905_040945 | |||
| 2381 | Ga0439458_0003466 | |||
| 2382 | Ga0439458_0017103 | |||
| 2383 | Ga0466969_0013647 | |||
| 2384 | Ga0466972_0140871 | |||
| 2385 | Ga0466965_0223930 | |||
| 2386 | Ga0466965_0233061 | |||
| 2387 | Ga0466966_0007012 | |||
| 2388 | Ga0466966_0058045 | |||
| 2389 | Ga0466966_0167138 | |||
| 2390 | Ga0466966_0358093 | |||
| 2391 | Ga0466966_0475615 | |||
| 2392 | Ga0466966_0509271 | |||
| 2393 | Ga0466961_0049984 | |||
| 2394 | Ga0466961_0142760 | |||
| 2395 | Ga0466961_0356501 | |||
| 2396 | Ga0466961_0533382 | |||
| 2397 | Ga0466963_0022198 | |||
| 2398 | Ga0466963_0052919 | |||
| 2399 | Ga0466963_0055860 | |||
| 2400 | Ga0466963_0060600 | |||
| 2401 | Ga0466963_0085745 | |||
| 2402 | Ga0466963_0098515 | |||
| 2403 | Ga0466963_0445623 | |||
| 2404 | Ga0466963_0452917 | |||
| 2405 | Ga0466964_0029895 | |||
| 2406 | Ga0466964_0036561 | |||
| 2407 | Ga0466964_0048380 | |||
| 2408 | Ga0466964_0178496 | |||
| 2409 | Ga0466971_0004306 | |||
| 2410 | Ga0466971_0032665 | |||
| 2411 | Ga0466971_0035761 | |||
| 2412 | Ga0466971_0250591 | |||
| 2413 | Ga0466968_0016705 | |||
| 2414 | Ga0466970_0005939 | |||
| 2415 | Ga0466970_0133369 | |||
| 2416 | Ga0466970_0145654 | |||
| 2417 | Ga0466970_0150356 | |||
| 2418 | Ga0466957_0031148 | |||
| 2419 | Ga0466957_0032607 | |||
| 2420 | Ga0466957_0125438 | |||
| 2421 | Ga0466957_0181718 | |||
| 2422 | Ga0466960_0222034 | |||
| 2423 | Ga0466960_0314195 | |||
| 2424 | Ga0466959_0035229 | |||
| 2425 | Ga0466959_0114258 | |||
| 2426 | Ga0466959_0126928 | |||
| 2427 | Ga0466959_0176635 | |||
| 2428 | Ga0466959_0264107 | |||
| 2429 | Ga0466959_0789771 | |||
| 2430 | Ga0466958_0016764 | |||
| 2431 | Ga0466958_0063647 | |||
| 2432 | Ga0466958_0080227 | |||
| 2433 | Ga0466958_0103265 | |||
| 2434 | Ga0466958_0152635 | |||
| 2435 | Ga0466958_0392924 | |||
| 2436 | Ga0466967_0001666 | |||
| 2437 | Ga0466967_0008439 | |||
| 2438 | Ga0466967_0029980 | |||
| 2439 | Ga0466967_0100510 | |||
| 2440 | Ga0466967_0125519 | |||
| 2441 | Ga0466967_0144748 | |||
| 2442 | Ga0466967_0204018 | |||
| 2443 | Ga0466967_0341080 | |||
| 2444 | Ga0466967_0350234 | |||
| 2445 | Ga0466967_0367188 | |||
| 2446 | Ga0466967_0404817 | |||
| 2447 | Ga0466967_0420534 | |||
| 2448 | Ga0466967_0440393 | |||
| 2449 | Ga0466967_0646536 | |||
| 2450 | Ga0466967_0739348 | |||
| 2451 | Ga0466967_1049127 | |||
| 2452 | Ga0466967_1349035 | |||
| 2453 | Ga0495583_0149235 | |||
| 2454 | Ga0495606_0226669 | |||
| 2455 | Ga0495663_0005015 | |||
| 2456 | Ga0495663_0049171 | |||
| 2457 | Ga0495663_0216592 | |||
| 2458 | Ga0495642_0220513 | |||
| 2459 | Ga0495598_0000719 | |||
| 2460 | Ga0495598_0001949 | |||
| 2461 | Ga0495621_0002706 | |||
| 2462 | Ga0495621_0005051 | |||
| 2463 | Ga0495633_0018383 | |||
| 2464 | Ga0495656_0221923 | |||
| 2465 | Ga0495668_0023756 | |||
| 2466 | Ga0495668_0052993 | |||
| 2467 | Ga0495661_0051350 | |||
| 2468 | Ga0495647_0124696 | |||
| 2469 | Ga0495669_0001193 | |||
| 2470 | Ga0495669_0001894 | |||
| 2471 | Ga0495669_0005742 | |||
| 2472 | Ga0495669_0076366 | |||
| 2473 | Ga0495669_0120437 | |||
| 2474 | Ga0495669_0300696 | |||
| 2475 | Ga0495670_0006231 | |||
| 2476 | Ga0495670_0041650 | |||
| 2477 | Ga0495677_0006042 | |||
| 2478 | Ga0495677_0135949 | |||
| 2479 | Ga0495681_0074694 | |||
| 2480 | Ga0496100_0020173 | |||
| 2481 | Ga0496100_0072159 | |||
| 2482 | Ga0496100_0204202 | |||
| 2483 | Ga0496101_0057168 | |||
| 2484 | Ga0496101_0447599 | |||
| 2485 | Ga0496102_0064876 | |||
| 2486 | Ga0496102_0218414 | |||
| 2487 | Ga0496103_0133936 | |||
| 2488 | Ga0496103_0189385 | |||
| 2489 | Ga0496104_0104201 | |||
| 2490 | Ga0496104_0930731 | |||
| 2491 | Ga0496105_0009837 | |||
| 2492 | Ga0496106_0012723 | |||
| 2493 | Ga0496106_0574333 | |||
| 2494 | Ga0496107_0179676 | |||
| 2495 | Ga0496107_0238100 | |||
| 2496 | Ga0496108_0000302 | |||
| 2497 | Ga0496108_0035971 | |||
| 2498 | Ga0496108_0066165 | |||
| 2499 | Ga0496108_0126360 | |||
| 2500 | Ga0496108_0183791 | |||
| 2501 | Ga0496109_0001875 | |||
| 2502 | Ga0496109_0019350 | |||
| 2503 | Ga0496109_0037291 | |||
| 2504 | Ga0496109_0039550 | |||
| 2505 | Ga0496109_0057790 | |||
| 2506 | Ga0496109_0216082 | |||
| 2507 | Ga0496109_0290247 | |||
| 2508 | Ga0496109_0707582 | |||
| 2509 | Ga0496110_0002728 | |||
| 2510 | Ga0496110_0013369 | |||
| 2511 | Ga0496110_0063493 | |||
| 2512 | Ga0496110_0188559 | |||
| 2513 | Ga0496110_0435699 | |||
| 2514 | Ga0496110_0948902 | |||
| 2515 | Ga0496111_0045675 | |||
| 2516 | Ga0496111_0049963 | |||
| 2517 | Ga0496111_0115176 | |||
| 2518 | Ga0496111_0158333 | |||
| 2519 | Ga0496111_0427487 | |||
| 2520 | Ga0496111_0473984 | |||
| 2521 | Ga0496112_0006104 | |||
| 2522 | Ga0496112_0013095 | |||
| 2523 | Ga0496112_0033243 | |||
| 2524 | Ga0496112_0073113 | |||
| 2525 | Ga0496112_0081381 | |||
| 2526 | Ga0496112_0201714 | |||
| 2527 | Ga0496112_0255955 | |||
| 2528 | Ga0496112_0492948 | |||
| 2529 | Ga0496112_0573703 | |||
| 2530 | Ga0496112_0866657 | |||
| 2531 | Ga0496113_0002096 | |||
| 2532 | Ga0496113_0002373 | |||
| 2533 | Ga0496113_0009973 | |||
| 2534 | Ga0496113_0146037 | |||
| 2535 | Ga0496113_0332410 | |||
| 2536 | Ga0496114_0000023 | |||
| 2537 | Ga0501047_0400144 | |||
| 2538 | Ga0501067_0236194 | |||
| 2539 | Ga0501070_0822283 | |||
| 2540 | Ga0501074_0386161 | |||
| 2541 | Ga0501080_0178502 | |||
| 2542 | Ga0495612_0228104 | |||
| 2543 | Ga0495655_0004465 | |||
| 2544 | Ga0466962_0087102 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3o5y-assembly2.cif.gz_B | the crystal structure of the gaf domain of a two-component sensor histidine kinase from bacillus halodurans to 2.45a | 0.7206 | 73 | 188 |
| 3e98-assembly1.cif.gz_B | crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution | 0.7172 | 9 | 182 |
| 8bor-assembly1.cif.gz_B | photosensory module from drbphp without phy tongue | 0.6895 | 37 | 181 |
| 3e98-assembly1.cif.gz_B | crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution | 0.6892 | 9 | 182 |
| 2o9c-assembly1.cif.gz_A | crystal structure of bacteriophytochrome chromophore binding domain at 1.45 angstrom resolution | 0.6878 | 42 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37013_4_170_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7525 | 40 | 184 | 3.30.450.40 |
| af_P19323_185_355_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7416 | 41 | 184 | 3.30.450.40 |
| af_P71229_153_329_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7309 | 42 | 183 | 3.30.450.40 |
| af_A4HWN6_215_389_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7168 | 34 | 184 | 3.30.450.40 |
| af_P23305_50_233_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7031 | 4 | 183 | 3.30.450.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A839YYC8-F1-model_v4 | Uncharacterized protein YigA (DUF484 family) | 0.9512 | 13 | 184 |
|
| AF-A0A521SRR0-F1-model_v4 | deleted | 0.9349 | 1 | 177 |
|
| AF-A0A520YFB3-F1-model_v4 | DUF484 family protein | 0.9283 | 1 | 188 |
|
| AF-T1W8G4-F1-model_v4 | deleted | 0.9253 | 7 | 188 |
|
| AF-A0A521SRR0-F1-model_v4 | deleted | 0.9249 | 1 | 177 |
|