F492565

General Info

Members Datasets Scaffolds Average Seq Length
1284 371 1284 273

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100009724|Ga0207675_1000097242
Length 303
Sequence MVSPTGAKRRAKSGGEHRSKLELLRPESAEAAAAALGNGSVALAGGTELVPLLRDGIVRADKLVELRDVVPCGVDGTGIGAGTTLAELEANPEIPQALREACSLAASPQLRSMSTLGGNLLQATRCWYWRLKFPCYLHGGDICHAKAGQHREHAIFGNDRCASAHPSDPAAALLALGARLRTTTRELPLADLYRLPTGDDRNVTALEPGELILELEVPRPEASVYLKAMERRKWSFAIVGVAAARFAEGIRLALAGVAPIPWALSSADALEQATPLPGTAYKVQIARALIRRAVEAVSAPAKA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
156 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
159 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
160 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
161 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
184 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
217 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
218 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
219 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
220 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
221 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
222 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
228 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
229 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
232 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
267 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
335 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
336 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
337 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
364 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
365 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
368 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
370 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
371 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 1.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.08
Nodule 0
Rhizoplane 10.51
Rhizosphere 89.1
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10004004 3300003373 Bacteria 3570
2 Ga0070658_10003965 3300005327 Bacteria 12129
3 Ga0070658_10027533 3300005327 Bacteria 4560
4 Ga0070658_10037793 3300005327 Bacteria 3892
5 Ga0070658_10070807 3300005327 Bacteria 2856
6 Ga0070683_100010433 3300005329 Bacteria 7990
7 Ga0070683_100062154 3300005329 Bacteria 3472
8 Ga0070683_100103809 3300005329 Bacteria 2679
9 Ga0070683_100128371 3300005329 Bacteria 2398
10 Ga0070683_100157563 3300005329 Unclassified 2154
11 Ga0070680_100000833 3300005336 Bacteria 21795
12 Ga0070680_100040065 3300005336 Bacteria 3791
13 Ga0070680_100057288 3300005336 Bacteria 3186
14 Ga0070680_100110899 3300005336 Bacteria 2284
15 Ga0070680_100118748 3300005336 Bacteria 2206
16 Ga0070680_100235743 3300005336 Bacteria 1546
17 Ga0070680_100464070 3300005336 Bacteria 1082
18 Ga0070682_100011854 3300005337 Bacteria 4987
19 Ga0068868_100035378 3300005338 Bacteria 3860
20 Ga0068868_100277079 3300005338 Bacteria 1418
21 Ga0068868_100391114 3300005338 Bacteria 1198
22 Ga0068868_100429318 3300005338 Unclassified 1145
23 Ga0070660_100013910 3300005339 Bacteria 5788
24 Ga0070660_100015853 3300005339 Bacteria 5455
25 Ga0070660_100025497 3300005339 Bacteria 4394
26 Ga0070660_100047136 3300005339 Bacteria 3306
27 Ga0070660_100069382 3300005339 Bacteria 2749
28 Ga0070660_100230852 3300005339 Bacteria 1506
29 Ga0070660_100382727 3300005339 Bacteria 1162
30 Ga0070691_10031025 3300005341 Bacteria 2506
31 Ga0070691_10084204 3300005341 Bacteria 1561
32 Ga0070661_100026212 3300005344 Bacteria 4190
33 Ga0070661_100195055 3300005344 Bacteria 1545
34 Ga0070661_100513034 3300005344 Bacteria 961
35 Ga0070692_10006261 3300005345 Bacteria 5156
36 Ga0070668_100021194 3300005347 Bacteria 4912
37 Ga0070668_100069949 3300005347 Bacteria 2732
38 Ga0070675_100086296 3300005354 Bacteria 2623
39 Ga0070671_100023681 3300005355 Bacteria 5027
40 Ga0070674_100024296 3300005356 Bacteria 3932
41 Ga0070674_100029808 3300005356 Bacteria 3600
42 Ga0070674_100202225 3300005356 Bacteria 1535
43 Ga0070688_100185489 3300005365 Bacteria 1446
44 Ga0070659_100016721 3300005366 Bacteria 5511
45 Ga0070659_100112373 3300005366 Bacteria 2200
46 Ga0070659_100421511 3300005366 Unclassified 1129
47 Ga0070703_10001464 3300005406 Bacteria 7107
48 Ga0070709_10187016 3300005434 Bacteria 1458
49 Ga0070709_10373177 3300005434 Bacteria 1059
50 Ga0070709_10410330 3300005434 Bacteria 1013
51 Ga0070714_100021527 3300005435 Bacteria 5276
52 Ga0070714_100035861 3300005435 Bacteria 4157
53 Ga0070714_100036286 3300005435 Bacteria 4133
54 Ga0070714_100038130 3300005435 Bacteria 4041
55 Ga0070714_100094192 3300005435 Bacteria 2629
56 Ga0070714_100097985 3300005435 Bacteria 2578
57 Ga0070714_100317699 3300005435 Unclassified 1456
58 Ga0070714_100354911 3300005435 Bacteria 1377
59 Ga0070714_100420512 3300005435 Bacteria 1266
60 Ga0070713_100013333 3300005436 Bacteria 6066
61 Ga0070713_100053225 3300005436 Bacteria 3354
62 Ga0070713_100102009 3300005436 Bacteria 2487
63 Ga0070713_100162995 3300005436 Bacteria 1992
64 Ga0070713_100248786 3300005436 Bacteria 1621
65 Ga0070713_100329341 3300005436 Bacteria 1412
66 Ga0070713_100414914 3300005436 Unclassified 1259
67 Ga0070710_10003032 3300005437 Bacteria 7987
68 Ga0070710_10219761 3300005437 Bacteria 1208
69 Ga0070711_100010560 3300005439 Bacteria 5718
70 Ga0070711_100027343 3300005439 Bacteria 3744
71 Ga0070711_100031738 3300005439 Bacteria 3509
72 Ga0070711_100284069 3300005439 Unclassified 1310
73 Ga0070705_100028011 3300005440 Bacteria 3082
74 Ga0070705_100110435 3300005440 Bacteria 1756
75 Ga0070705_100126465 3300005440 Bacteria 1660
76 Ga0070700_100145379 3300005441 Bacteria 1616
77 Ga0070694_100029866 3300005444 Bacteria 3561
78 Ga0070694_100141414 3300005444 Bacteria 1748
79 Ga0070694_100230906 3300005444 Bacteria 1392
80 Ga0070708_100012205 3300005445 Bacteria 7007
81 Ga0070708_100110617 3300005445 Unclassified 2524
82 Ga0070708_100310431 3300005445 Bacteria 1486
83 Ga0070708_100419327 3300005445 Bacteria 1262
84 Ga0070663_100079539 3300005455 Bacteria 2406
85 Ga0070678_100144639 3300005456 Bacteria 1907
86 Ga0070662_100065973 3300005457 Bacteria 2655
87 Ga0070662_100070291 3300005457 Bacteria 2579
88 Ga0070681_10004219 3300005458 Bacteria 13620
89 Ga0070681_10026250 3300005458 Bacteria 5855
90 Ga0070681_10073230 3300005458 Bacteria 3387
91 Ga0070681_10113015 3300005458 Bacteria 2655
92 Ga0070681_10209001 3300005458 Bacteria 1868
93 Ga0070681_10269668 3300005458 Bacteria 1613
94 Ga0068867_100054578 3300005459 Bacteria 2952
95 Ga0070706_100211186 3300005467 Unclassified 1812
96 Ga0070706_100415060 3300005467 Bacteria 1253
97 Ga0070707_100004270 3300005468 Bacteria 13381
98 Ga0070707_100035106 3300005468 Bacteria 4782
99 Ga0070707_100102940 3300005468 Bacteria 2767
100 Ga0070707_100175169 3300005468 Bacteria 2091
101 Ga0070707_100369281 3300005468 Unclassified 1394
102 Ga0070707_100654034 3300005468 Bacteria 1014
103 Ga0070698_100006283 3300005471 Bacteria 12909
104 Ga0070698_100015109 3300005471 Bacteria 8163
105 Ga0070698_100029260 3300005471 Bacteria 5717
106 Ga0070698_100055630 3300005471 Bacteria 4010
107 Ga0070698_100062011 3300005471 Bacteria 3773
108 Ga0070698_100064439 3300005471 Bacteria 3692
109 Ga0070698_100172987 3300005471 Bacteria 2100
110 Ga0070699_100025094 3300005518 Bacteria 5139
111 Ga0070699_100188713 3300005518 Bacteria 1830
112 Ga0070679_100016881 3300005530 Bacteria 7057
113 Ga0070679_100023975 3300005530 Bacteria 5978
114 Ga0070679_100039019 3300005530 Bacteria 4721
115 Ga0070679_100040336 3300005530 Bacteria 4645
116 Ga0070679_100066123 3300005530 Bacteria 3603
117 Ga0070679_100116057 3300005530 Bacteria 2662
118 Ga0070679_100121629 3300005530 Bacteria 2595
119 Ga0070679_100214915 3300005530 Unclassified 1885
120 Ga0070679_100393176 3300005530 Bacteria 1333
121 Ga0070684_100001780 3300005535 Bacteria 15732
122 Ga0070684_100021823 3300005535 Bacteria 5333
123 Ga0070684_100118935 3300005535 Bacteria 2376
124 Ga0070684_100133163 3300005535 Bacteria 2243
125 Ga0070684_100177540 3300005535 Bacteria 1936
126 Ga0070684_100361504 3300005535 Unclassified 1336
127 Ga0070697_100224109 3300005536 Bacteria 1603
128 Ga0070697_100421406 3300005536 Bacteria 1160
129 Ga0068853_100037931 3300005539 Bacteria 4103
130 Ga0068853_100055571 3300005539 Bacteria 3412
131 Ga0068853_100645701 3300005539 Unclassified 1007
132 Ga0070672_100498876 3300005543 Bacteria 1053
133 Ga0070686_100005989 3300005544 Bacteria 6746
134 Ga0070686_100013470 3300005544 Bacteria 4684
135 Ga0070695_100000028 3300005545 Bacteria 53880
136 Ga0070695_100024775 3300005545 Bacteria 3700
137 Ga0070696_100204457 3300005546 Unclassified 1476
138 Ga0070696_100208602 3300005546 Unclassified 1462
139 Ga0070693_100010891 3300005547 Bacteria 4568
140 Ga0070693_100200753 3300005547 Unclassified 1295
141 Ga0070665_100020268 3300005548 Bacteria 6676
142 Ga0070704_100015090 3300005549 Bacteria 4843
143 Ga0070704_100019791 3300005549 Bacteria 4330
144 Ga0070704_100040643 3300005549 Bacteria 3203
145 Ga0070704_100089418 3300005549 Bacteria 2291
146 Ga0068855_100010933 3300005563 Bacteria 10954
147 Ga0068855_100014539 3300005563 Bacteria 9479
148 Ga0068855_100028306 3300005563 Bacteria 6703
149 Ga0068855_100072506 3300005563 Bacteria 4002
150 Ga0068855_100089423 3300005563 Bacteria 3555
151 Ga0068855_100160002 3300005563 Bacteria 2556
152 Ga0068855_100168455 3300005563 Bacteria 2481
153 Ga0068855_100203558 3300005563 Bacteria 2227
154 Ga0068855_100251896 3300005563 Bacteria 1969
155 Ga0068855_100430283 3300005563 Bacteria 1443
156 Ga0068855_100574302 3300005563 Bacteria 1218
157 Ga0070664_100147043 3300005564 Bacteria 2079
158 Ga0070664_100344116 3300005564 Bacteria 1355
159 Ga0068857_100005679 3300005577 Bacteria 10665
160 Ga0068854_100078490 3300005578 Bacteria 2432
161 Ga0068854_100084041 3300005578 Bacteria 2355
162 Ga0068854_100208827 3300005578 Bacteria 1539
163 Ga0068856_100010475 3300005614 Bacteria 9001
164 Ga0068856_100015619 3300005614 Bacteria 7341
165 Ga0068856_100041281 3300005614 Bacteria 4533
166 Ga0068856_100045467 3300005614 Bacteria 4323
167 Ga0068856_100070677 3300005614 Bacteria 3454
168 Ga0068856_100099403 3300005614 Bacteria 2900
169 Ga0070702_100005135 3300005615 Bacteria 6060
170 Ga0070702_100072015 3300005615 Bacteria 2044
171 Ga0068852_100074978 3300005616 Bacteria 2982
172 Ga0068866_10149512 3300005718 Bacteria 1351
173 Ga0068861_100037148 3300005719 Bacteria 3620
174 Ga0068861_100396511 3300005719 Bacteria 1223
175 Ga0068862_100095167 3300005844 Bacteria 2598
176 Ga0081538_10000144 3300005981 Bacteria 73787
177 Ga0081538_10028440 3300005981 Bacteria 3844
178 Ga0081538_10054384 3300005981 Unclassified 2368
179 Ga0081540_1001335 3300005983 Bacteria 21496
180 Ga0081540_1005963 3300005983 Bacteria 8978
181 Ga0081539_10000913 3300005985 Bacteria 55913
182 Ga0081539_10003671 3300005985 Bacteria 18426
183 Ga0081539_10022106 3300005985 Bacteria 4220
184 Ga0070717_10008104 3300006028 Bacteria 7837
185 Ga0070717_10043531 3300006028 Bacteria 3665
186 Ga0070717_10051688 3300006028 Bacteria 3383
187 Ga0070717_10057173 3300006028 Bacteria 3224
188 Ga0070717_10079778 3300006028 Bacteria 2745
189 Ga0070717_10216956 3300006028 Bacteria 1680
190 Ga0075432_10045641 3300006058 Bacteria 1537
191 Ga0075432_10093147 3300006058 Bacteria 1105
192 Ga0070715_10004504 3300006163 Bacteria 4579
193 Ga0070715_10007610 3300006163 Bacteria 3736
194 Ga0070715_10108555 3300006163 Bacteria 1306
195 Ga0070716_100027171 3300006173 Bacteria 3071
196 Ga0070716_100037919 3300006173 Bacteria 2665
197 Ga0070716_100086721 3300006173 Bacteria 1884
198 Ga0070712_100003082 3300006175 Bacteria 10296
199 Ga0070712_100004222 3300006175 Bacteria 8840
200 Ga0070712_100036396 3300006175 Bacteria 3349
201 Ga0070712_100083186 3300006175 Bacteria 2323
202 Ga0070712_100219849 3300006175 Unclassified 1503
203 Ga0070712_100400573 3300006175 Bacteria 1133
204 Ga0070712_100425847 3300006175 Bacteria 1101
205 Ga0097621_100010449 3300006237 Bacteria 6798
206 Ga0097621_100133126 3300006237 Bacteria 2118
207 Ga0097621_100140402 3300006237 Bacteria 2064
208 Ga0075428_100024221 3300006844 Bacteria 6715
209 Ga0075428_100049756 3300006844 Bacteria 4599
210 Ga0075428_100076694 3300006844 Bacteria 3649
211 Ga0075428_100617830 3300006844 Bacteria 1157
212 Ga0075430_100027584 3300006846 Bacteria 4824
213 Ga0075430_100047921 3300006846 Bacteria 3608
214 Ga0075431_100079236 3300006847 Bacteria 3391
215 Ga0075431_100317046 3300006847 Bacteria 1573
216 Ga0075433_10004067 3300006852 Bacteria 11331
217 Ga0075433_10007343 3300006852 Bacteria 8745
218 Ga0075433_10194525 3300006852 Bacteria 1804
219 Ga0075434_100003308 3300006871 Bacteria 14404
220 Ga0075434_100003953 3300006871 Bacteria 13273
221 Ga0075434_100020088 3300006871 Bacteria 6472
222 Ga0075434_100324360 3300006871 Bacteria 1560
223 Ga0075429_100025072 3300006880 Bacteria 5177
224 Ga0068865_100011967 3300006881 Bacteria 5449
225 Ga0068865_100138231 3300006881 Bacteria 1834
226 Ga0075436_100031493 3300006914 Bacteria 3653
227 Ga0075436_100112873 3300006914 Bacteria 1897
228 Ga0075436_100218212 3300006914 Bacteria 1353
229 Ga0075436_100387019 3300006914 Bacteria 1012
230 Ga0075435_100000846 3300007076 Bacteria 19132
231 Ga0075435_100015837 3300007076 Bacteria 5675
232 Ga0075435_100073353 3300007076 Bacteria 2798
233 Ga0105240_10082546 3300009093 Bacteria 3947
234 Ga0105240_10189279 3300009093 Bacteria 2421
235 Ga0105240_10273325 3300009093 Bacteria 1944
236 Ga0105240_10502599 3300009093 Bacteria 1348
237 Ga0111539_10059669 3300009094 Bacteria 4523
238 Ga0111539_10061035 3300009094 Bacteria 4467
239 Ga0111539_10235744 3300009094 Bacteria 2130
240 Ga0111539_10259743 3300009094 Bacteria 2022
241 Ga0105245_10006942 3300009098 Bacteria 9925
242 Ga0105245_10089802 3300009098 Bacteria 2825
243 Ga0105245_10104935 3300009098 Bacteria 2621
244 Ga0105245_10116464 3300009098 Bacteria 2492
245 Ga0105245_10352558 3300009098 Unclassified 1459
246 Ga0114129_10010119 3300009147 Bacteria 13445
247 Ga0114129_10013068 3300009147 Bacteria 11828
248 Ga0114129_10032758 3300009147 Bacteria 7344
249 Ga0114129_10121702 3300009147 Bacteria 3591
250 Ga0114129_10230307 3300009147 Bacteria 2496
251 Ga0114129_10269953 3300009147 Bacteria 2276
252 Ga0105243_10033962 3300009148 Bacteria 3946
253 Ga0105243_10184983 3300009148 Bacteria 1815
254 Ga0105243_10492931 3300009148 Bacteria 1159
255 Ga0105241_10018444 3300009174 Bacteria 5134
256 Ga0105241_10172576 3300009174 Bacteria 1787
257 Ga0105242_10011407 3300009176 Bacteria 6830
258 Ga0105242_10031463 3300009176 Bacteria 4238
259 Ga0105242_10170449 3300009176 Bacteria 1913
260 Ga0105242_10487351 3300009176 Bacteria 1170
261 Ga0105248_10415942 3300009177 Bacteria 1514
262 Ga0105237_10200689 3300009545 Bacteria 1994
263 Ga0105237_10403765 3300009545 Bacteria 1371
264 Ga0105237_10638780 3300009545 Unclassified 1071
265 Ga0105238_10025309 3300009551 Bacteria 6049
266 Ga0105238_10153675 3300009551 Bacteria 2276
267 Ga0105238_10229056 3300009551 Bacteria 1835
268 Ga0105249_10114856 3300009553 Bacteria 2550
269 Ga0105239_10075392 3300010375 Bacteria 3709
270 Ga0105239_10097591 3300010375 Bacteria 3247
271 Ga0105239_10126649 3300010375 Bacteria 2839
272 Ga0157373_10059940 3300013100 Unclassified 2696
273 Ga0157373_10268539 3300013100 Bacteria 1207
274 Ga0157373_10299861 3300013100 Bacteria 1140
275 Ga0157371_10034338 3300013102 Bacteria 3638
276 Ga0157370_10043386 3300013104 Bacteria 4329
277 Ga0157370_10050281 3300013104 Bacteria 3984
278 Ga0157370_10058957 3300013104 Bacteria 3649
279 Ga0157370_10063208 3300013104 Bacteria 3508
280 Ga0157370_10067657 3300013104 Bacteria 3376
281 Ga0157370_10162421 3300013104 Bacteria 2078
282 Ga0157370_10441461 3300013104 Bacteria 1197
283 Ga0157370_10442665 3300013104 Bacteria 1195
284 Ga0157369_10003497 3300013105 Bacteria 18655
285 Ga0157369_10039280 3300013105 Bacteria 5172
286 Ga0157369_10094980 3300013105 Bacteria 3182
287 Ga0157369_10125959 3300013105 Bacteria 2716
288 Ga0157369_10371992 3300013105 Bacteria 1483
289 Ga0157369_10373641 3300013105 Unclassified 1480
290 Ga0157369_10402419 3300013105 Bacteria 1420
291 Ga0157369_10427010 3300013105 Bacteria 1374
292 Ga0157374_10183769 3300013296 Bacteria 2043
293 Ga0157374_10665471 3300013296 Bacteria 1053
294 Ga0163162_10081296 3300013306 Bacteria 3311
295 Ga0163162_10106270 3300013306 Bacteria 2902
296 Ga0157372_10056077 3300013307 Bacteria 4402
297 Ga0157372_10057077 3300013307 Bacteria 4363
298 Ga0157372_10077087 3300013307 Bacteria 3764
299 Ga0157372_10080718 3300013307 Bacteria 3681
300 Ga0157372_10090358 3300013307 Bacteria 3481
301 Ga0157372_10101072 3300013307 Bacteria 3291
302 Ga0157372_10231608 3300013307 Bacteria 2142
303 Ga0157372_10291480 3300013307 Bacteria 1898
304 Ga0157372_10385710 3300013307 Bacteria 1632
305 Ga0157372_10674226 3300013307 Unclassified 1204
306 Ga0157375_10076735 3300013308 Bacteria 3370
307 Ga0157375_10137020 3300013308 Bacteria 2573
308 Ga0157380_10019505 3300014326 Bacteria 5053
309 Ga0157380_10613347 3300014326 Bacteria 1079
310 Ga0157379_10074183 3300014968 Bacteria 3046
311 Ga0157376_10054339 3300014969 Bacteria 3338
312 Ga0157376_10271529 3300014969 Bacteria 1593
313 Ga0157376_10577050 3300014969 Bacteria 1116
314 Ga0163161_10265040 3300017792 Bacteria 1343
315 Ga0197907_10089213 3300020069 Bacteria 1759
316 Ga0197907_10139001 3300020069 Bacteria 2010
317 Ga0197907_10494060 3300020069 Bacteria 1389
318 Ga0206356_10267656 3300020070 Bacteria 4257
319 Ga0206356_10644836 3300020070 Unclassified 1628
320 Ga0206356_10767042 3300020070 Bacteria 3531
321 Ga0206356_11012494 3300020070 Bacteria 1384
322 Ga0206356_11376571 3300020070 Bacteria 2027
323 Ga0206354_10279382 3300020081 Bacteria 3961
324 Ga0206354_10685782 3300020081 Bacteria 3185
325 Ga0206354_10841280 3300020081 Bacteria 1260
326 Ga0206354_11282843 3300020081 Bacteria 4747
327 Ga0206353_10088991 3300020082 Unclassified 1379
328 Ga0206353_10374765 3300020082 Bacteria 2045
329 Ga0206353_10561342 3300020082 Unclassified 1668
330 Ga0206353_10734363 3300020082 Bacteria 2498
331 Ga0224712_10004092 3300022467 Bacteria 3893
332 Ga0224712_10043053 3300022467 Bacteria 1714
333 Ga0224712_10066745 3300022467 Bacteria 1449
334 Ga0207653_10008551 3300025885 Bacteria 3188
335 Ga0207692_10003988 3300025898 Bacteria 5801
336 Ga0207692_10184436 3300025898 Bacteria 1217
337 Ga0207692_10296642 3300025898 Bacteria 982
338 Ga0207642_10032504 3300025899 Bacteria 2198
339 Ga0207688_10029415 3300025901 Bacteria 3025
340 Ga0207685_10094493 3300025905 Bacteria 1266
341 Ga0207699_10007837 3300025906 Bacteria 5235
342 Ga0207699_10064773 3300025906 Bacteria 2213
343 Ga0207699_10166181 3300025906 Bacteria 1473
344 Ga0207699_10213472 3300025906 Unclassified 1314
345 Ga0207699_10304760 3300025906 Bacteria 1113
346 Ga0207643_10074879 3300025908 Bacteria 1953
347 Ga0207705_10009942 3300025909 Bacteria 6926
348 Ga0207705_10074738 3300025909 Bacteria 2460
349 Ga0207705_10126059 3300025909 Bacteria 1903
350 Ga0207705_10218356 3300025909 Bacteria 1447
351 Ga0207705_10221504 3300025909 Bacteria 1437
352 Ga0207705_10242455 3300025909 Bacteria 1373
353 Ga0207705_10286870 3300025909 Bacteria 1261
354 Ga0207684_10035784 3300025910 Bacteria 4216
355 Ga0207684_10058034 3300025910 Bacteria 3284
356 Ga0207684_10406599 3300025910 Bacteria 1170
357 Ga0207707_10001354 3300025912 Bacteria 22790
358 Ga0207707_10003861 3300025912 Bacteria 13289
359 Ga0207707_10040778 3300025912 Bacteria 4054
360 Ga0207707_10045685 3300025912 Bacteria 3816
361 Ga0207707_10053316 3300025912 Bacteria 3520
362 Ga0207707_10089996 3300025912 Bacteria 2682
363 Ga0207707_10091058 3300025912 Bacteria 2665
364 Ga0207707_10116100 3300025912 Bacteria 2339
365 Ga0207707_10117118 3300025912 Bacteria 2329
366 Ga0207707_10440029 3300025912 Bacteria 1116
367 Ga0207695_10207577 3300025913 Bacteria 1871
368 Ga0207695_10332712 3300025913 Bacteria 1407
369 Ga0207671_10064359 3300025914 Bacteria 2726
370 Ga0207671_10289506 3300025914 Bacteria 1293
371 Ga0207693_10000904 3300025915 Bacteria 26637
372 Ga0207693_10006140 3300025915 Bacteria 9960
373 Ga0207693_10012860 3300025915 Bacteria 6754
374 Ga0207693_10014992 3300025915 Bacteria 6222
375 Ga0207693_10019508 3300025915 Bacteria 5392
376 Ga0207693_10034467 3300025915 Bacteria 3992
377 Ga0207693_10084696 3300025915 Bacteria 2484
378 Ga0207693_10088304 3300025915 Bacteria 2430
379 Ga0207663_10002700 3300025916 Bacteria 8557
380 Ga0207663_10039347 3300025916 Bacteria 2864
381 Ga0207663_10073154 3300025916 Unclassified 2217
382 Ga0207663_10239468 3300025916 Bacteria 1330
383 Ga0207660_10069364 3300025917 Bacteria 2560
384 Ga0207660_10087052 3300025917 Bacteria 2308
385 Ga0207660_10112587 3300025917 Bacteria 2050
386 Ga0207660_10114243 3300025917 Bacteria 2036
387 Ga0207660_10163938 3300025917 Bacteria 1717
388 Ga0207660_10251388 3300025917 Unclassified 1395
389 Ga0207662_10106396 3300025918 Bacteria 1745
390 Ga0207657_10000150 3300025919 Bacteria 70716
391 Ga0207657_10000184 3300025919 Bacteria 64813
392 Ga0207657_10002804 3300025919 Bacteria 18753
393 Ga0207657_10002847 3300025919 Bacteria 18595
394 Ga0207657_10006585 3300025919 Bacteria 12032
395 Ga0207657_10006650 3300025919 Bacteria 11964
396 Ga0207657_10018582 3300025919 Bacteria 6626
397 Ga0207657_10067084 3300025919 Bacteria 3052
398 Ga0207657_10084751 3300025919 Bacteria 2655
399 Ga0207657_10313208 3300025919 Bacteria 1242
400 Ga0207649_10008750 3300025920 Bacteria 5526
401 Ga0207652_10011232 3300025921 Bacteria 7214
402 Ga0207652_10019032 3300025921 Bacteria 5638
403 Ga0207652_10048429 3300025921 Bacteria 3633
404 Ga0207652_10100031 3300025921 Bacteria 2559
405 Ga0207652_10160484 3300025921 Bacteria 2015
406 Ga0207652_10172174 3300025921 Bacteria 1943
407 Ga0207652_10173909 3300025921 Unclassified 1933
408 Ga0207652_10259937 3300025921 Unclassified 1566
409 Ga0207652_10293507 3300025921 Bacteria 1467
410 Ga0207652_10419058 3300025921 Bacteria 1208
411 Ga0207652_10442799 3300025921 Bacteria 1171
412 Ga0207652_10519621 3300025921 Bacteria 1071
413 Ga0207646_10002759 3300025922 Bacteria 20509
414 Ga0207646_10295581 3300025922 Bacteria 1463
415 Ga0207646_10537521 3300025922 Bacteria 1051
416 Ga0207694_10053334 3300025924 Bacteria 3135
417 Ga0207687_10031647 3300025927 Bacteria 3577
418 Ga0207687_10078348 3300025927 Bacteria 2379
419 Ga0207687_10084579 3300025927 Bacteria 2300
420 Ga0207687_10308984 3300025927 Bacteria 1276
421 Ga0207700_10000021 3300025928 Bacteria 168335
422 Ga0207700_10035208 3300025928 Bacteria 3604
423 Ga0207700_10063112 3300025928 Bacteria 2816
424 Ga0207700_10131072 3300025928 Bacteria 2047
425 Ga0207700_10202266 3300025928 Bacteria 1674
426 Ga0207700_10357119 3300025928 Unclassified 1273
427 Ga0207700_10602768 3300025928 Bacteria 977
428 Ga0207664_10022929 3300025929 Bacteria 4670
429 Ga0207664_10033418 3300025929 Bacteria 3951
430 Ga0207664_10049033 3300025929 Unclassified 3323
431 Ga0207664_10064763 3300025929 Bacteria 2925
432 Ga0207664_10075522 3300025929 Bacteria 2725
433 Ga0207664_10141818 3300025929 Bacteria 2033
434 Ga0207664_10182692 3300025929 Bacteria 1801
435 Ga0207664_10206426 3300025929 Bacteria 1698
436 Ga0207664_10217382 3300025929 Bacteria 1656
437 Ga0207664_10426364 3300025929 Bacteria 1182
438 Ga0207664_10432483 3300025929 Bacteria 1173
439 Ga0207644_10030639 3300025931 Bacteria 3743
440 Ga0207644_10330097 3300025931 Bacteria 1235
441 Ga0207690_10183988 3300025932 Bacteria 1575
442 Ga0207690_10351362 3300025932 Unclassified 1166
443 Ga0207706_10006148 3300025933 Bacteria 11150
444 Ga0207706_10010931 3300025933 Bacteria 8278
445 Ga0207706_10034995 3300025933 Bacteria 4468
446 Ga0207686_10041872 3300025934 Unclassified 2796
447 Ga0207709_10029437 3300025935 Bacteria 3185
448 Ga0207709_10088901 3300025935 Unclassified 2013
449 Ga0207709_10170720 3300025935 Bacteria 1526
450 Ga0207709_10249098 3300025935 Bacteria 1296
451 Ga0207704_10125391 3300025938 Bacteria 1767
452 Ga0207665_10002447 3300025939 Bacteria 12534
453 Ga0207665_10002480 3300025939 Bacteria 12442
454 Ga0207665_10026935 3300025939 Bacteria 3797
455 Ga0207665_10057727 3300025939 Bacteria 2622
456 Ga0207665_10066517 3300025939 Bacteria 2453
457 Ga0207691_10239921 3300025940 Bacteria 1567
458 Ga0207661_10035899 3300025944 Bacteria 3866
459 Ga0207661_10054475 3300025944 Unclassified 3205
460 Ga0207661_10071454 3300025944 Bacteria 2836
461 Ga0207661_10105793 3300025944 Bacteria 2371
462 Ga0207661_10119774 3300025944 Bacteria 2239
463 Ga0207661_10205283 3300025944 Bacteria 1734
464 Ga0207661_10327319 3300025944 Unclassified 1378
465 Ga0207679_10281969 3300025945 Bacteria 1425
466 Ga0207667_10065935 3300025949 Bacteria 3775
467 Ga0207667_10072793 3300025949 Bacteria 3571
468 Ga0207667_10074302 3300025949 Bacteria 3531
469 Ga0207667_10127503 3300025949 Bacteria 2621
470 Ga0207667_10145522 3300025949 Bacteria 2439
471 Ga0207667_10356236 3300025949 Bacteria 1492
472 Ga0207712_10096753 3300025961 Unclassified 2186
473 Ga0207668_10011321 3300025972 Bacteria 5415
474 Ga0207668_10081336 3300025972 Bacteria 2350
475 Ga0207640_10031137 3300025981 Bacteria 3293
476 Ga0207640_10237991 3300025981 Bacteria 1405
477 Ga0207640_10281288 3300025981 Bacteria 1307
478 Ga0207677_10163223 3300026023 Unclassified 1733
479 Ga0207677_10176894 3300026023 Bacteria 1675
480 Ga0207677_10288501 3300026023 Bacteria 1350
481 Ga0207639_10170780 3300026041 Bacteria 1841
482 Ga0207678_10155539 3300026067 Bacteria 1952
483 Ga0207708_10013341 3300026075 Bacteria 6138
484 Ga0207702_10010463 3300026078 Bacteria 7761
485 Ga0207702_10028695 3300026078 Bacteria 4627
486 Ga0207702_10033479 3300026078 Bacteria 4293
487 Ga0207702_10087009 3300026078 Bacteria 2726
488 Ga0207702_10303044 3300026078 Bacteria 1517
489 Ga0207648_10007972 3300026089 Bacteria 10331
490 Ga0207648_10092258 3300026089 Bacteria 2648
491 Ga0207648_10144127 3300026089 Bacteria 2101
492 Ga0207676_10077506 3300026095 Bacteria 2689
493 Ga0207674_10002109 3300026116 Bacteria 25169
494 Ga0207674_10039590 3300026116 Bacteria 4885
495 Ga0207674_10142691 3300026116 Bacteria 2354
496 Ga0207675_100002893 3300026118 Bacteria 16878
497 Ga0207675_100009724 3300026118 Bacteria 9001
498 Ga0207675_100042986 3300026118 Bacteria 4220
499 Ga0207675_100137132 3300026118 Unclassified 2322
500 Ga0207683_10004201 3300026121 Bacteria 12445
501 Ga0207683_10010677 3300026121 Bacteria 7828
502 Ga0207683_10241056 3300026121 Bacteria 1649
503 Ga0207698_10564711 3300026142 Bacteria 1117
504 Ga0207428_10012688 3300027907 Bacteria 7389
505 Ga0207428_10424479 3300027907 Bacteria 971
506 Ga0268266_10280683 3300028379 Bacteria 1549
507 Ga0265326_10019157 3300028558 Bacteria 1968
508 Ga0265319_1014823 3300028563 Bacteria 3043
509 Ga0265334_10053707 3300028573 Bacteria 1538
510 Ga0265334_10115386 3300028573 Bacteria 962
511 Ga0265318_10008316 3300028577 Bacteria 4626
512 Ga0265323_10016483 3300028653 Bacteria 2884
513 Ga0265322_10002700 3300028654 Bacteria 5442
514 Ga0265336_10002697 3300028666 Bacteria 7188
515 Ga0265338_10000938 3300028800 Bacteria 49159
516 Ga0265338_10002652 3300028800 Bacteria 26323
517 Ga0265338_10004226 3300028800 Bacteria 19550
518 Ga0265338_10009728 3300028800 Bacteria 11404
519 Ga0265338_10037632 3300028800 Bacteria 4600
520 Ga0265338_10077496 3300028800 Bacteria 2809
521 Ga0265338_10103168 3300028800 Bacteria 2317
522 Ga0265324_10013637 3300029957 Bacteria 3025
523 Ga0265324_10042543 3300029957 Bacteria 1570
524 Ga0265332_10007652 3300031238 Bacteria 4882
525 Ga0265328_10006148 3300031239 Bacteria 5105
526 Ga0265325_10001447 3300031241 Bacteria 16683
527 Ga0265325_10016612 3300031241 Bacteria 4111
528 Ga0265325_10045291 3300031241 Bacteria 2286
529 Ga0265340_10015777 3300031247 Bacteria 3919
530 Ga0265340_10054352 3300031247 Bacteria 1931
531 Ga0265339_10053703 3300031249 Bacteria 2190
532 Ga0265331_10016679 3300031250 Bacteria 3849
533 Ga0265331_10039610 3300031250 Bacteria 2297
534 Ga0265327_10011377 3300031251 Bacteria 6133
535 Ga0265327_10018398 3300031251 Bacteria 4333
536 Ga0265327_10043752 3300031251 Bacteria 2393
537 Ga0265316_10015601 3300031344 Bacteria 6633
538 Ga0265316_10027256 3300031344 Bacteria 4734
539 Ga0265316_10045508 3300031344 Bacteria 3482
540 Ga0307408_100390414 3300031548 Bacteria 1192
541 Ga0307408_100454148 3300031548 Unclassified 1112
542 Ga0265313_10011330 3300031595 Bacteria 5551
543 Ga0265313_10026983 3300031595 Bacteria 3013
544 Ga0265314_10029525 3300031711 Bacteria 4073
545 Ga0265314_10034822 3300031711 Bacteria 3674
546 Ga0265342_10017813 3300031712 Bacteria 4612
547 Ga0307405_10152897 3300031731 Bacteria 1625
548 Ga0307413_10331956 3300031824 Unclassified 1166
549 Ga0307407_10104733 3300031903 Bacteria 1764
550 Ga0307409_100135091 3300031995 Bacteria 2115
551 Ga0307416_100037411 3300032002 Bacteria 3734
552 Ga0307416_100105236 3300032002 Unclassified 2469
553 Ga0307416_100119096 3300032002 Bacteria 2348
554 Ga0307416_100165790 3300032002 Bacteria 2049
555 Ga0307416_100208763 3300032002 Bacteria 1861
556 Ga0307416_100346976 3300032002 Unclassified 1500
557 Ga0307415_100015496 3300032126 Bacteria 4516
558 Ga0307415_100039541 3300032126 Bacteria 3118
559 Ga0307415_100113977 3300032126 Bacteria 2012
560 Ga0307415_100153191 3300032126 Bacteria 1777
561 Ga0373948_0006120 3300034817 Bacteria 1978
562 Ga0373948_0029234 3300034817 Bacteria 1102
563 Ga0373950_0006092 3300034818 Bacteria 1826
564 Ga0373959_0004595 3300034820 Bacteria 2230
565 Ga0373940_0014349 3300035088 Bacteria 1931
566 Ga0373949_0000662 3300035090 Bacteria 11210
567 Ga0373951_0031438 3300035091 Unclassified 1252
568 Ga0373952_0041028 3300035092 Unclassified 1069
569 Ga0373923_0224291 3300035111 Bacteria 874
570 Ga0373932_0001020 3300035112 Bacteria 8099
571 Ga0373932_0015296 3300035112 Bacteria 1944
572 Ga0373932_0049740 3300035112 Bacteria 1240
573 Ga0373939_0006734 3300035114 Bacteria 2774
574 Ga0373941_0006525 3300035115 Unclassified 2816
575 Ga0373956_0006321 3300035119 Bacteria 4742
576 Ga0373957_0076405 3300035120 Bacteria 1317
577 Ga0373960_0044358 3300035121 Unclassified 1298
578 Ga0373960_0104992 3300035121 Bacteria 920
579 Ga0373943_0002483 3300035170 Bacteria 8378
580 Ga0373943_0003285 3300035170 Bacteria 7353
581 Ga0373943_0003783 3300035170 Bacteria 6874
582 Ga0373946_0007996 3300035171 Bacteria 3885
583 Ga0373955_0081391 3300035172 Bacteria 1831
584 Ga0373942_0003369 3300035207 Bacteria 3758
585 Ga0373961_0000784 3300035241 Bacteria 10914
586 Ga0373962_0002362 3300035242 Bacteria 4509
587 Ga0373924_0036185 3300035410 Bacteria 2005
588 Ga0373931_0042229 3300035691 Bacteria 2397
589 Ga0373935_0005754 3300035692 Bacteria 7328
590 Ga0373935_0158994 3300035692 Bacteria 1539
591 Ga0373927_0050966 3300035695 Bacteria 2677
592 Ga0373927_0116010 3300035695 Bacteria 1746
593 Ga0373927_0156794 3300035695 Bacteria 1491
594 Ga0373933_0219807 3300035724 Bacteria 1218
595 Ga0373933_0300190 3300035724 Bacteria 1040
596 Ga0373947_0002612 3300035725 Bacteria 10814
597 Ga0373947_0009004 3300035725 Bacteria 5739
598 Ga0373947_0116119 3300035725 Bacteria 1697
599 Ga0373947_0131943 3300035725 Bacteria 1595
600 Ga0373947_0274774 3300035725 Bacteria 1119
601 Ga0373937_0001058 3300036401 Bacteria 23217
602 Ga0373937_0052542 3300036401 Bacteria 3736
603 Ga0373937_0144659 3300036401 Bacteria 2225
604 Ga0373937_0221016 3300036401 Bacteria 1783
605 Ga0373925_0001472 3300037068 Bacteria 20286
606 Ga0373925_0010538 3300037068 Bacteria 6705
607 Ga0373925_0145751 3300037068 Bacteria 1856
608 Ga0395899_0001813 3300037312 Bacteria 17679
609 Ga0395899_0010130 3300037312 Bacteria 7228
610 Ga0395899_0016974 3300037312 Bacteria 5548
611 Ga0395899_0041718 3300037312 Bacteria 3428
612 Ga0395899_0068280 3300037312 Archaea 2607
613 Ga0395899_0069482 3300037312 Bacteria 2579
614 Ga0395899_0075634 3300037312 Bacteria 2458
615 Ga0395899_0078497 3300037312 Unclassified 2406
616 Ga0395899_0095894 3300037312 Bacteria 2145
617 Ga0395899_0162621 3300037312 Bacteria 1576
618 Ga0395899_0211811 3300037312 Bacteria 1346
619 Ga0395899_0241419 3300037312 Bacteria 1243
620 Ga0395899_0286360 3300037312 Bacteria 1119
621 Ga0395900_0005363 3300037418 Bacteria 13437
622 Ga0395900_0005432 3300037418 Bacteria 13351
623 Ga0395900_0007148 3300037418 Bacteria 11569
624 Ga0395900_0008154 3300037418 Bacteria 10780
625 Ga0395900_0010193 3300037418 Bacteria 9612
626 Ga0395900_0014100 3300037418 Bacteria 8160
627 Ga0395900_0069058 3300037418 Bacteria 3631
628 Ga0395900_0071992 3300037418 Bacteria 3554
629 Ga0395900_0100880 3300037418 Bacteria 2965
630 Ga0395900_0101632 3300037418 Bacteria 2953
631 Ga0395900_0105537 3300037418 Bacteria 2894
632 Ga0395900_0118131 3300037418 Bacteria 2721
633 Ga0395900_0139795 3300037418 Unclassified 2480
634 Ga0395900_0148564 3300037418 Bacteria 2395
635 Ga0395900_0183561 3300037418 Unclassified 2124
636 Ga0395900_0284523 3300037418 Unclassified 1644
637 Ga0395900_0386485 3300037418 Bacteria 1366
638 Ga0395900_0469864 3300037418 Bacteria 1211
639 Ga0395900_0619413 3300037418 Bacteria 1021
640 Ga0395900_0688073 3300037418 Bacteria 957
641 Ga0395900_0688225 3300037418 Bacteria 957
642 Ga0395898_0002274 3300037466 Bacteria 23201
643 Ga0395898_0006991 3300037466 Bacteria 11996
644 Ga0395898_0008254 3300037466 Bacteria 11013
645 Ga0395898_0027064 3300037466 Bacteria 5761
646 Ga0395898_0027356 3300037466 Bacteria 5727
647 Ga0395898_0027619 3300037466 Bacteria 5693
648 Ga0395898_0031934 3300037466 Bacteria 5258
649 Ga0395898_0039713 3300037466 Bacteria 4656
650 Ga0395898_0058847 3300037466 Bacteria 3740
651 Ga0395898_0062001 3300037466 Bacteria 3632
652 Ga0395898_0064862 3300037466 Bacteria 3541
653 Ga0395898_0070325 3300037466 Unclassified 3384
654 Ga0395898_0071698 3300037466 Bacteria 3347
655 Ga0395898_0081691 3300037466 Bacteria 3116
656 Ga0395898_0101930 3300037466 Bacteria 2756
657 Ga0395898_0127960 3300037466 Bacteria 2433
658 Ga0395898_0128624 3300037466 Bacteria 2426
659 Ga0395898_0132424 3300037466 Bacteria 2387
660 Ga0395898_0183427 3300037466 Bacteria 2000
661 Ga0395898_0216147 3300037466 Bacteria 1828
662 Ga0395898_0217878 3300037466 Bacteria 1821
663 Ga0395898_0241899 3300037466 Unclassified 1721
664 Ga0395898_0313321 3300037466 Bacteria 1497
665 Ga0395898_0338660 3300037466 Bacteria 1434
666 Ga0395905_0002088 3300037471 Bacteria 22707
667 Ga0395905_0002224 3300037471 Bacteria 21889
668 Ga0395905_0003522 3300037471 Bacteria 16691
669 Ga0395905_0005372 3300037471 Bacteria 13093
670 Ga0395905_0006331 3300037471 Bacteria 11928
671 Ga0395905_0012897 3300037471 Bacteria 8034
672 Ga0395905_0020464 3300037471 Bacteria 6268
673 Ga0395905_0021582 3300037471 Bacteria 6088
674 Ga0395905_0026503 3300037471 Bacteria 5464
675 Ga0395905_0042427 3300037471 Bacteria 4269
676 Ga0395905_0043771 3300037471 Bacteria 4200
677 Ga0395905_0061017 3300037471 Bacteria 3526
678 Ga0395905_0062102 3300037471 Bacteria 3495
679 Ga0395905_0086866 3300037471 Bacteria 2932
680 Ga0395905_0152706 3300037471 Bacteria 2172
681 Ga0395905_0163130 3300037471 Bacteria 2094
682 Ga0395905_0178299 3300037471 Bacteria 1995
683 Ga0395905_0233387 3300037471 Bacteria 1720
684 Ga0395905_0241702 3300037471 Unclassified 1687
685 Ga0395905_0248078 3300037471 Bacteria 1663
686 Ga0395905_0282306 3300037471 Bacteria 1547
687 Ga0395905_0329236 3300037471 Bacteria 1418
688 Ga0395905_0356532 3300037471 Bacteria 1355
689 Ga0395905_0367167 3300037471 Unclassified 1332
690 Ga0395901_0001441 3300038443 Bacteria 24821
691 Ga0395901_0003533 3300038443 Bacteria 15752
692 Ga0395901_0003539 3300038443 Bacteria 15741
693 Ga0395901_0008564 3300038443 Bacteria 10336
694 Ga0395901_0013286 3300038443 Bacteria 8363
695 Ga0395901_0014173 3300038443 Bacteria 8117
696 Ga0395901_0016741 3300038443 Bacteria 7470
697 Ga0395901_0021597 3300038443 Bacteria 6595
698 Ga0395901_0021670 3300038443 Bacteria 6583
699 Ga0395901_0028496 3300038443 Bacteria 5742
700 Ga0395901_0030431 3300038443 Bacteria 5561
701 Ga0395901_0032367 3300038443 Bacteria 5396
702 Ga0395901_0035161 3300038443 Bacteria 5177
703 Ga0395901_0035819 3300038443 Bacteria 5128
704 Ga0395901_0052123 3300038443 Bacteria 4253
705 Ga0395901_0059631 3300038443 Bacteria 3970
706 Ga0395901_0064386 3300038443 Bacteria 3816
707 Ga0395901_0072631 3300038443 Bacteria 3587
708 Ga0395901_0081822 3300038443 Bacteria 3373
709 Ga0395901_0084355 3300038443 Bacteria 3320
710 Ga0395901_0088887 3300038443 Bacteria 3232
711 Ga0395901_0090202 3300038443 Bacteria 3208
712 Ga0395901_0110740 3300038443 Bacteria 2883
713 Ga0395901_0134367 3300038443 Bacteria 2600
714 Ga0395901_0230739 3300038443 Bacteria 1932
715 Ga0395901_0260762 3300038443 Bacteria 1804
716 Ga0395901_0292233 3300038443 Unclassified 1691
717 Ga0395901_0316948 3300038443 Bacteria 1614
718 Ga0395901_0404581 3300038443 Bacteria 1402
719 Ga0395901_0463713 3300038443 Bacteria 1294
720 Ga0395901_0539753 3300038443 Bacteria 1183
721 Ga0395901_0730668 3300038443 Bacteria 985
722 Ga0395901_0810810 3300038443 Unclassified 924
723 Ga0436362_0226949 3300039453 Bacteria 1223
724 Ga0439439_0003791 3300041406 Bacteria 3357
725 Ga0439453_0007831 3300041408 Bacteria 1705
726 Ga0451793_1168656 3300041452 Unclassified 1233
727 Ga0451800_0941897 3300041459 Unclassified 982
728 Ga0451802_1228609 3300041460 Bacteria 1003
729 Ga0451835_0140787 3300041492 Bacteria 3096
730 Ga0451849_0044832 3300041505 Bacteria 1221
731 Ga0451853_0028795 3300041512 Bacteria 2577
732 Ga0451853_0448887 3300041512 Bacteria 1337
733 Ga0439431_0005605 3300041997 Bacteria 2769
734 Ga0439431_0084904 3300041997 Bacteria 857
735 Ga0439433_0001351 3300041999 Bacteria 5049
736 Ga0439448_0036170 3300042005 Bacteria 1583
737 Ga0439449_0042502 3300042007 Bacteria 1688
738 Ga0439451_000608 3300042009 Bacteria 6790
739 Ga0439446_0006147 3300042156 Bacteria 3119
740 Ga0439460_0069007 3300042461 Bacteria 1092
741 Ga0439440_0053850 3300042993 Bacteria 1012
742 Ga0466969_0106952 3300044656 Bacteria 1312
743 Ga0466965_0008827 3300044683 Bacteria 4675
744 Ga0466965_0037687 3300044683 Unclassified 2374
745 Ga0466966_0001800 3300044684 Bacteria 13885
746 Ga0466966_0021354 3300044684 Bacteria 4251
747 Ga0466966_0199662 3300044684 Bacteria 1210
748 Ga0466966_0240201 3300044684 Bacteria 1092
749 Ga0466961_0005996 3300044693 Bacteria 7704
750 Ga0466961_0039712 3300044693 Bacteria 3016
751 Ga0466961_0058312 3300044693 Bacteria 2457
752 Ga0466961_0094056 3300044693 Bacteria 1891
753 Ga0466961_0115688 3300044693 Bacteria 1685
754 Ga0466961_0117730 3300044693 Bacteria 1669
755 Ga0466963_0000694 3300044694 Bacteria 16387
756 Ga0466963_0001922 3300044694 Bacteria 11375
757 Ga0466963_0002423 3300044694 Bacteria 10428
758 Ga0466963_0003006 3300044694 Bacteria 9542
759 Ga0466963_0003165 3300044694 Bacteria 9347
760 Ga0466963_0004777 3300044694 Bacteria 7902
761 Ga0466963_0007131 3300044694 Bacteria 6660
762 Ga0466963_0007554 3300044694 Bacteria 6488
763 Ga0466963_0021168 3300044694 Bacteria 4098
764 Ga0466963_0079151 3300044694 Bacteria 2224
765 Ga0466963_0142220 3300044694 Bacteria 1662
766 Ga0466963_0177186 3300044694 Bacteria 1488
767 Ga0466963_0267507 3300044694 Bacteria 1201
768 Ga0466963_0302703 3300044694 Bacteria 1124
769 Ga0466964_0009593 3300044706 Bacteria 3647
770 Ga0466964_0012902 3300044706 Bacteria 3165
771 Ga0466964_0079495 3300044706 Bacteria 1404
772 Ga0466964_0269574 3300044706 Bacteria 847
773 Ga0466971_0002209 3300044719 Bacteria 8226
774 Ga0466971_0003143 3300044719 Bacteria 7036
775 Ga0466971_0004353 3300044719 Bacteria 6107
776 Ga0466971_0004404 3300044719 Bacteria 6077
777 Ga0466971_0009192 3300044719 Bacteria 4320
778 Ga0466971_0071656 3300044719 Bacteria 1574
779 Ga0466971_0096301 3300044719 Bacteria 1357
780 Ga0466968_0000933 3300044735 Bacteria 10298
781 Ga0466968_0024136 3300044735 Bacteria 2483
782 Ga0466968_0033976 3300044735 Bacteria 2126
783 Ga0466968_0099363 3300044735 Bacteria 1297
784 Ga0466968_0103864 3300044735 Bacteria 1271
785 Ga0466970_0048251 3300044765 Bacteria 2270
786 Ga0466970_0048699 3300044765 Bacteria 2260
787 Ga0466970_0271451 3300044765 Bacteria 953
788 Ga0466957_0001545 3300044842 Bacteria 12106
789 Ga0466957_0007794 3300044842 Bacteria 6064
790 Ga0466957_0014670 3300044842 Bacteria 4565
791 Ga0466957_0015797 3300044842 Bacteria 4410
792 Ga0466957_0017566 3300044842 Bacteria 4192
793 Ga0466957_0021942 3300044842 Bacteria 3765
794 Ga0466957_0032348 3300044842 Bacteria 3131
795 Ga0466957_0033677 3300044842 Bacteria 3074
796 Ga0466957_0162133 3300044842 Bacteria 1453
797 Ga0466957_0229370 3300044842 Bacteria 1229
798 Ga0466960_0012688 3300044901 Bacteria 3562
799 Ga0466960_0044515 3300044901 Bacteria 2116
800 Ga0466960_0201246 3300044901 Bacteria 1088
801 Ga0466959_0003272 3300045049 Bacteria 10554
802 Ga0466959_0012819 3300045049 Bacteria 6065
803 Ga0466959_0027998 3300045049 Bacteria 4178
804 Ga0466959_0048153 3300045049 Bacteria 3133
805 Ga0466959_0061306 3300045049 Bacteria 2735
806 Ga0466959_0076309 3300045049 Bacteria 2420
807 Ga0451576_0538922 3300045051 Bacteria 1226
808 Ga0466958_0001480 3300045836 Bacteria 11201
809 Ga0466958_0003857 3300045836 Bacteria 7840
810 Ga0466958_0006546 3300045836 Bacteria 6347
811 Ga0466958_0026124 3300045836 Bacteria 3449
812 Ga0466958_0028547 3300045836 Bacteria 3309
813 Ga0466958_0043705 3300045836 Bacteria 2699
814 Ga0466958_0057280 3300045836 Bacteria 2368
815 Ga0466958_0085323 3300045836 Bacteria 1948
816 Ga0466958_0220497 3300045836 Unclassified 1210
817 Ga0466967_0002222 3300045976 Bacteria 11944
818 Ga0466967_0002953 3300045976 Bacteria 10866
819 Ga0466967_0004404 3300045976 Bacteria 9489
820 Ga0466967_0005380 3300045976 Bacteria 8862
821 Ga0466967_0006225 3300045976 Bacteria 8414
822 Ga0466967_0008898 3300045976 Bacteria 7406
823 Ga0466967_0009935 3300045976 Bacteria 7103
824 Ga0466967_0012774 3300045976 Bacteria 6450
825 Ga0466967_0023267 3300045976 Bacteria 5073
826 Ga0466967_0023579 3300045976 Bacteria 5046
827 Ga0466967_0034228 3300045976 Bacteria 4310
828 Ga0466967_0035858 3300045976 Bacteria 4227
829 Ga0466967_0037723 3300045976 Bacteria 4138
830 Ga0466967_0038238 3300045976 Bacteria 4113
831 Ga0466967_0041841 3300045976 Bacteria 3954
832 Ga0466967_0054621 3300045976 Bacteria 3516
833 Ga0466967_0056140 3300045976 Bacteria 3471
834 Ga0466967_0077759 3300045976 Bacteria 2987
835 Ga0466967_0078816 3300045976 Bacteria 2968
836 Ga0466967_0084154 3300045976 Bacteria 2878
837 Ga0466967_0137588 3300045976 Bacteria 2272
838 Ga0466967_0152844 3300045976 Bacteria 2159
839 Ga0466967_0170988 3300045976 Bacteria 2044
840 Ga0466967_0196326 3300045976 Bacteria 1909
841 Ga0466967_0201238 3300045976 Bacteria 1886
842 Ga0466967_0276253 3300045976 Bacteria 1611
843 Ga0466967_0318014 3300045976 Bacteria 1500
844 Ga0466967_0533760 3300045976 Bacteria 1154
845 Ga0466967_0554286 3300045976 Bacteria 1131
846 Ga0466967_0574986 3300045976 Viruses 1110
847 Ga0466967_0592512 3300045976 Unclassified 1094
848 Ga0495592_0000037 3300046454 Bacteria 125143
849 Ga0495592_0162931 3300046454 Bacteria 1533
850 Ga0495592_0202158 3300046454 Bacteria 1340
851 Ga0495603_0001374 3300046455 Bacteria 14134
852 Ga0495603_0008076 3300046455 Bacteria 6359
853 Ga0495603_0128854 3300046455 Bacteria 1474
854 Ga0495629_0001380 3300046459 Bacteria 19145
855 Ga0495629_0007625 3300046459 Bacteria 7967
856 Ga0495629_0104272 3300046459 Bacteria 1978
857 Ga0495629_0152464 3300046459 Bacteria 1606
858 Ga0495629_0180569 3300046459 Bacteria 1463
859 Ga0495629_0368940 3300046459 Bacteria 978
860 Ga0495641_0000416 3300046461 Bacteria 35566
861 Ga0495641_0001029 3300046461 Bacteria 23958
862 Ga0495641_0010174 3300046461 Bacteria 5490
863 Ga0495641_0039515 3300046461 Bacteria 2200
864 Ga0495651_0000038 3300046462 Bacteria 97248
865 Ga0495651_0010678 3300046462 Bacteria 7064
866 Ga0495651_0180915 3300046462 Bacteria 1492
867 Ga0495653_0004001 3300046463 Bacteria 11902
868 Ga0495653_0047002 3300046463 Bacteria 3340
869 Ga0495653_0200563 3300046463 Bacteria 1354
870 Ga0495580_0040690 3300046472 Bacteria 3319
871 Ga0495580_0388776 3300046472 Unclassified 942
872 Ga0495582_0000108 3300046473 Bacteria 43115
873 Ga0495582_0004292 3300046473 Bacteria 8019
874 Ga0495582_0040361 3300046473 Bacteria 2571
875 Ga0495582_0211861 3300046473 Bacteria 1107
876 Ga0495605_0027017 3300046474 Bacteria 2978
877 Ga0495605_0060688 3300046474 Bacteria 1812
878 Ga0495639_0000578 3300046475 Bacteria 17076
879 Ga0495662_0005764 3300046476 Bacteria 6197
880 Ga0495664_0085758 3300046477 Bacteria 1891
881 Ga0495664_0112023 3300046477 Bacteria 1647
882 Ga0495584_0085757 3300046491 Unclassified 1587
883 Ga0495584_0113088 3300046491 Bacteria 1374
884 Ga0495584_0197432 3300046491 Bacteria 1023
885 Ga0495594_0001293 3300046499 Bacteria 13054
886 Ga0495607_0044274 3300046501 Bacteria 2625
887 Ga0495608_0001032 3300046511 Bacteria 19553
888 Ga0495608_0004248 3300046511 Bacteria 10265
889 Ga0495608_0009021 3300046511 Bacteria 6975
890 Ga0495608_0040891 3300046511 Bacteria 3105
891 Ga0495618_0001122 3300046514 Bacteria 18089
892 Ga0495618_0044961 3300046514 Bacteria 2785
893 Ga0495618_0058319 3300046514 Bacteria 2445
894 Ga0495618_0065679 3300046514 Unclassified 2306
895 Ga0495628_0000025 3300046516 Bacteria 127935
896 Ga0495628_0003449 3300046516 Bacteria 14162
897 Ga0495628_0209317 3300046516 Bacteria 1467
898 Ga0495628_0317919 3300046516 Bacteria 1149
899 Ga0495630_0002325 3300046517 Bacteria 13223
900 Ga0495630_0034774 3300046517 Bacteria 3764
901 Ga0495630_0054724 3300046517 Bacteria 2989
902 Ga0495630_0107209 3300046517 Bacteria 2116
903 Ga0495630_0128412 3300046517 Unclassified 1924
904 Ga0495644_0107404 3300046523 Unclassified 1058
905 Ga0495663_0021550 3300046525 Bacteria 1856
906 Ga0495666_0023487 3300046526 Bacteria 3049
907 Ga0495666_0067563 3300046526 Bacteria 1703
908 Ga0495642_0046135 3300046528 Bacteria 1782
909 Ga0495652_0000088 3300046529 Bacteria 98865
910 Ga0495652_0032184 3300046529 Unclassified 4588
911 Ga0495652_0087245 3300046529 Bacteria 2559
912 Ga0495652_0161283 3300046529 Bacteria 1741
913 Ga0495665_0010108 3300046531 Bacteria 5113
914 Ga0495640_0006444 3300046533 Bacteria 9280
915 Ga0495640_0028068 3300046533 Bacteria 4054
916 Ga0495640_0206960 3300046533 Unclassified 1242
917 Ga0495640_0271000 3300046533 Bacteria 1059
918 Ga0495587_0000502 3300046536 Bacteria 27283
919 Ga0495587_0080643 3300046536 Bacteria 1886
920 Ga0495597_0118880 3300046542 Bacteria 1103
921 Ga0495645_0000024 3300046543 Bacteria 125065
922 Ga0495645_0111557 3300046543 Unclassified 1934
923 Ga0495667_0007352 3300046559 Bacteria 7468
924 Ga0495667_0015780 3300046559 Bacteria 5107
925 Ga0495667_0028876 3300046559 Bacteria 3734
926 Ga0495667_0030658 3300046559 Bacteria 3613
927 Ga0495656_0019905 3300046615 Bacteria 2596
928 Ga0495656_0049863 3300046615 Bacteria 1785
929 Ga0495656_0050655 3300046615 Bacteria 1774
930 Ga0495634_0039729 3300046642 Bacteria 3203
931 Ga0495634_0070345 3300046642 Bacteria 2307
932 Ga0495634_0085374 3300046642 Bacteria 2057
933 Ga0495635_0136845 3300046663 Bacteria 1669
934 Ga0495635_0152181 3300046663 Bacteria 1575
935 Ga0495588_0000417 3300046674 Bacteria 23054
936 Ga0495588_0050756 3300046674 Bacteria 2135
937 Ga0495657_0033173 3300046675 Bacteria 3597
938 Ga0495657_0054867 3300046675 Bacteria 2660
939 Ga0495599_0000019 3300046678 Bacteria 141108
940 Ga0495599_0043511 3300046678 Bacteria 2818
941 Ga0495623_0000032 3300046679 Bacteria 84435
942 Ga0495623_0299113 3300046679 Bacteria 890
943 Ga0495646_0001414 3300046680 Bacteria 14283
944 Ga0495646_0038081 3300046680 Bacteria 2971
945 Ga0495646_0056334 3300046680 Bacteria 2357
946 Ga0495647_0006761 3300046681 Bacteria 3818
947 Ga0495647_0029767 3300046681 Bacteria 2021
948 Ga0495647_0154272 3300046681 Unclassified 986
949 Ga0495658_0000132 3300046683 Bacteria 41217
950 Ga0495658_0088067 3300046683 Bacteria 1834
951 Ga0495613_0004012 3300046689 Bacteria 11017
952 Ga0495613_0012664 3300046689 Bacteria 6270
953 Ga0495613_0056129 3300046689 Bacteria 2892
954 Ga0495624_0010665 3300046690 Bacteria 6329
955 Ga0495624_0032034 3300046690 Bacteria 3411
956 Ga0495624_0036974 3300046690 Bacteria 3143
957 Ga0495670_0143907 3300046691 Bacteria 1248
958 Ga0495670_0182662 3300046691 Unclassified 1108
959 Ga0495589_0126159 3300046794 Bacteria 1231
960 Ga0495600_0026892 3300046809 Bacteria 3716
961 Ga0495600_0293806 3300046809 Unclassified 1026
962 Ga0495600_0296855 3300046809 Unclassified 1020
963 Ga0495581_0073780 3300047315 Bacteria 1975
964 Ga0495581_0089882 3300047315 Unclassified 1781
965 Ga0495581_0107012 3300047315 Bacteria 1625
966 Ga0495581_0145151 3300047315 Bacteria 1385
967 Ga0495604_0000476 3300047317 Bacteria 35284
968 Ga0495604_0047344 3300047317 Bacteria 3349
969 Ga0495604_0176530 3300047317 Bacteria 1497
970 Ga0495604_0218164 3300047317 Unclassified 1314
971 Ga0495636_0074829 3300047318 Bacteria 1451
972 Ga0495674_0001965 3300047319 Bacteria 20247
973 Ga0495674_0044638 3300047319 Bacteria 3939
974 Ga0495674_0134404 3300047319 Bacteria 2082
975 Ga0495674_0296552 3300047319 Bacteria 1321
976 Ga0495674_0370221 3300047319 Bacteria 1160
977 Ga0495674_0535767 3300047319 Bacteria 933
978 Ga0495676_0002345 3300047321 Bacteria 16782
979 Ga0495676_0005803 3300047321 Bacteria 11323
980 Ga0495676_0094046 3300047321 Unclassified 2234
981 Ga0495676_0161867 3300047321 Bacteria 1583
982 Ga0495676_0216680 3300047321 Bacteria 1321
983 Ga0495680_0001771 3300047322 Bacteria 22882
984 Ga0495680_0012102 3300047322 Bacteria 7613
985 Ga0495680_0023823 3300047322 Bacteria 5086
986 Ga0495680_0026108 3300047322 Bacteria 4821
987 Ga0495680_0028649 3300047322 Bacteria 4565
988 Ga0495680_0077967 3300047322 Bacteria 2508
989 Ga0495675_0000007 3300047444 Bacteria 162640
990 Ga0495684_0005676 3300047471 Bacteria 9717
991 Ga0495684_0030753 3300047471 Bacteria 4122
992 Ga0495684_0048709 3300047471 Bacteria 3239
993 Ga0495593_0009475 3300047673 Bacteria 5648
994 Ga0495602_0000246 3300048088 Bacteria 50728
995 Ga0495602_0146820 3300048088 Bacteria 1859
996 Ga0495602_0324363 3300048088 Bacteria 1119
997 Ga0495614_0002864 3300048089 Bacteria 7673
998 Ga0495614_0087227 3300048089 Bacteria 1355
999 Ga0496100_0000648 3300048903 Bacteria 16518
1000 Ga0496100_0036846 3300048903 Bacteria 3088
1001 Ga0496100_0068816 3300048903 Bacteria 2355
1002 Ga0496100_0125738 3300048903 Bacteria 1799
1003 Ga0496100_0293843 3300048903 Unclassified 1214
1004 Ga0496100_0504549 3300048903 Bacteria 932
1005 Ga0496101_0011052 3300048904 Bacteria 5980
1006 Ga0496101_0034215 3300048904 Bacteria 3588
1007 Ga0496101_0040024 3300048904 Bacteria 3337
1008 Ga0496101_0071232 3300048904 Bacteria 2548
1009 Ga0496101_0120919 3300048904 Bacteria 1980
1010 Ga0496101_0155773 3300048904 Bacteria 1750
1011 Ga0496101_0161455 3300048904 Unclassified 1718
1012 Ga0496101_0205871 3300048904 Bacteria 1522
1013 Ga0496101_0253630 3300048904 Unclassified 1371
1014 Ga0496101_0265475 3300048904 Bacteria 1339
1015 Ga0496101_0277744 3300048904 Unclassified 1309
1016 Ga0496102_0002063 3300048905 Bacteria 17305
1017 Ga0496102_0019615 3300048905 Bacteria 5957
1018 Ga0496102_0035747 3300048905 Bacteria 4473
1019 Ga0496102_0057794 3300048905 Bacteria 3543
1020 Ga0496102_0065582 3300048905 Bacteria 3328
1021 Ga0496102_0085973 3300048905 Bacteria 2904
1022 Ga0496102_0141332 3300048905 Bacteria 2257
1023 Ga0496102_0186634 3300048905 Bacteria 1954
1024 Ga0496102_0203375 3300048905 Unclassified 1867
1025 Ga0496102_0258974 3300048905 Bacteria 1640
1026 Ga0496102_0302926 3300048905 Bacteria 1506
1027 Ga0496102_0566550 3300048905 Unclassified 1058
1028 Ga0496103_0022071 3300048906 Bacteria 3831
1029 Ga0496103_0052753 3300048906 Bacteria 2519
1030 Ga0496103_0059054 3300048906 Bacteria 2383
1031 Ga0496103_0241236 3300048906 Unclassified 1163
1032 Ga0496104_0000904 3300048907 Bacteria 25446
1033 Ga0496104_0003386 3300048907 Bacteria 13770
1034 Ga0496104_0068829 3300048907 Bacteria 3363
1035 Ga0496104_0488388 3300048907 Bacteria 1143
1036 Ga0496104_0556288 3300048907 Bacteria 1058
1037 Ga0496105_0000042 3300048908 Bacteria 114886
1038 Ga0496105_0000406 3300048908 Bacteria 28366
1039 Ga0496105_0006393 3300048908 Bacteria 9057
1040 Ga0496105_0019052 3300048908 Bacteria 5530
1041 Ga0496105_0023510 3300048908 Bacteria 4999
1042 Ga0496105_0159570 3300048908 Bacteria 1851
1043 Ga0496106_0000263 3300048909 Bacteria 36905
1044 Ga0496106_0001780 3300048909 Bacteria 16082
1045 Ga0496106_0071321 3300048909 Bacteria 2655
1046 Ga0496106_0103137 3300048909 Bacteria 2213
1047 Ga0496106_0131314 3300048909 Bacteria 1964
1048 Ga0496106_0141791 3300048909 Unclassified 1891
1049 Ga0496106_0238734 3300048909 Bacteria 1452
1050 Ga0496106_0329100 3300048909 Unclassified 1226
1051 Ga0496106_0484821 3300048909 Bacteria 993
1052 Ga0496107_0000712 3300048910 Bacteria 18973
1053 Ga0496107_0003430 3300048910 Bacteria 10597
1054 Ga0496107_0008672 3300048910 Bacteria 7042
1055 Ga0496107_0018842 3300048910 Bacteria 4865
1056 Ga0496107_0055943 3300048910 Bacteria 2849
1057 Ga0496107_0064283 3300048910 Bacteria 2660
1058 Ga0496107_0403361 3300048910 Bacteria 1017
1059 Ga0496108_0001638 3300048911 Bacteria 17745
1060 Ga0496108_0002246 3300048911 Bacteria 15461
1061 Ga0496108_0048720 3300048911 Bacteria 3543
1062 Ga0496108_0075303 3300048911 Bacteria 2851
1063 Ga0496108_0107506 3300048911 Bacteria 2382
1064 Ga0496108_0225160 3300048911 Bacteria 1630
1065 Ga0496109_0002657 3300048912 Bacteria 14996
1066 Ga0496109_0002961 3300048912 Bacteria 14210
1067 Ga0496109_0006975 3300048912 Bacteria 9535
1068 Ga0496109_0010365 3300048912 Bacteria 7960
1069 Ga0496109_0047156 3300048912 Bacteria 3916
1070 Ga0496109_0059462 3300048912 Bacteria 3491
1071 Ga0496109_0136189 3300048912 Bacteria 2295
1072 Ga0496109_0195275 3300048912 Bacteria 1902
1073 Ga0496109_0435368 3300048912 Bacteria 1239
1074 Ga0496110_0001458 3300048913 Bacteria 17154
1075 Ga0496110_0003901 3300048913 Bacteria 11470
1076 Ga0496110_0007895 3300048913 Bacteria 8522
1077 Ga0496110_0026390 3300048913 Bacteria 4971
1078 Ga0496110_0145308 3300048913 Bacteria 2145
1079 Ga0496110_0174400 3300048913 Bacteria 1951
1080 Ga0496110_0199370 3300048913 Bacteria 1818
1081 Ga0496111_0002886 3300048914 Bacteria 10499
1082 Ga0496111_0015249 3300048914 Bacteria 5270
1083 Ga0496111_0037207 3300048914 Unclassified 3483
1084 Ga0496111_0054026 3300048914 Bacteria 2903
1085 Ga0496111_0060053 3300048914 Bacteria 2755
1086 Ga0496111_0317948 3300048914 Bacteria 1153
1087 Ga0496112_0000894 3300048915 Bacteria 21457
1088 Ga0496112_0001403 3300048915 Bacteria 18402
1089 Ga0496112_0002855 3300048915 Bacteria 14040
1090 Ga0496112_0003739 3300048915 Bacteria 12711
1091 Ga0496112_0032584 3300048915 Bacteria 5061
1092 Ga0496112_0071698 3300048915 Bacteria 3424
1093 Ga0496112_0085883 3300048915 Bacteria 3113
1094 Ga0496112_0089792 3300048915 Bacteria 3041
1095 Ga0496112_0092743 3300048915 Bacteria 2989
1096 Ga0496112_0098547 3300048915 Bacteria 2892
1097 Ga0496112_0150063 3300048915 Bacteria 2298
1098 Ga0496112_0275917 3300048915 Bacteria 1629
1099 Ga0496112_0326473 3300048915 Bacteria 1478
1100 Ga0496112_0409959 3300048915 Bacteria 1294
1101 Ga0496113_0000110 3300048916 Bacteria 35203
1102 Ga0496113_0003480 3300048916 Bacteria 9435
1103 Ga0496113_0016018 3300048916 Bacteria 5171
1104 Ga0496113_0020320 3300048916 Bacteria 4667
1105 Ga0496113_0035153 3300048916 Bacteria 3663
1106 Ga0496113_0051103 3300048916 Bacteria 3084
1107 Ga0496113_0158438 3300048916 Bacteria 1789
1108 Ga0496113_0221693 3300048916 Bacteria 1507
1109 Ga0496113_0265113 3300048916 Bacteria 1372
1110 Ga0496114_0000444 3300048917 Bacteria 30383
1111 Ga0496114_0003753 3300048917 Bacteria 11706
1112 Ga0496114_0024082 3300048917 Bacteria 4968
1113 Ga0496114_0025295 3300048917 Bacteria 4852
1114 Ga0496114_0069187 3300048917 Bacteria 2964
1115 Ga0496114_0111998 3300048917 Bacteria 2339
1116 Ga0496114_0193886 3300048917 Bacteria 1778
1117 Ga0496114_0242469 3300048917 Unclassified 1585
1118 Ga0496114_0340249 3300048917 Unclassified 1326
1119 Ga0496114_0397510 3300048917 Unclassified 1220
1120 Ga0496114_0537373 3300048917 Bacteria 1033
1121 Ga0496114_0816820 3300048917 Bacteria 811
1122 Ga0496115_0000415 3300048918 Bacteria 34771
1123 Ga0496115_0016264 3300048918 Bacteria 5661
1124 Ga0496115_0048637 3300048918 Bacteria 3392
1125 Ga0496115_0050995 3300048918 Bacteria 3317
1126 Ga0496115_0058999 3300048918 Bacteria 3089
1127 Ga0496115_0117282 3300048918 Bacteria 2190
1128 Ga0496115_0121726 3300048918 Bacteria 2147
1129 Ga0496115_0147718 3300048918 Bacteria 1940
1130 Ga0496115_0458268 3300048918 Bacteria 1029
1131 Ga0501031_0010535 3300049568 Bacteria 6019
1132 Ga0501032_0023411 3300049569 Bacteria 4267
1133 Ga0501033_0062129 3300049570 Bacteria 2751
1134 Ga0501034_0145102 3300049571 Bacteria 2351
1135 Ga0501034_0444464 3300049571 Bacteria 1215
1136 Ga0501036_0010058 3300049572 Bacteria 7792
1137 Ga0501036_0021440 3300049572 Bacteria 5432
1138 Ga0501037_0003648 3300049573 Bacteria 11167
1139 Ga0501037_0072221 3300049573 Bacteria 2510
1140 Ga0501037_0078900 3300049573 Bacteria 2389
1141 Ga0501038_0045292 3300049574 Bacteria 3819
1142 Ga0501038_0077328 3300049574 Bacteria 2809
1143 Ga0501039_0002203 3300049575 Bacteria 14420
1144 Ga0501039_0005896 3300049575 Bacteria 9282
1145 Ga0501040_0005743 3300049576 Bacteria 8026
1146 Ga0501040_0011123 3300049576 Bacteria 5882
1147 Ga0501040_0015780 3300049576 Bacteria 4993
1148 Ga0501040_0136658 3300049576 Unclassified 1726
1149 Ga0501041_0002538 3300049577 Bacteria 10402
1150 Ga0501041_0004358 3300049577 Bacteria 8190
1151 Ga0501041_0011812 3300049577 Bacteria 5169
1152 Ga0501042_0000873 3300049578 Bacteria 16854
1153 Ga0501043_0007710 3300049579 Bacteria 8523
1154 Ga0501046_0140282 3300049580 Bacteria 1829
1155 Ga0501047_0112308 3300049581 Bacteria 2607
1156 Ga0501048_0002986 3300049582 Bacteria 12912
1157 Ga0501048_0015279 3300049582 Bacteria 5669
1158 Ga0501048_0046641 3300049582 Bacteria 3092
1159 Ga0501067_0014954 3300049583 Bacteria 4294
1160 Ga0501067_0102326 3300049583 Bacteria 1591
1161 Ga0501067_0275392 3300049583 Bacteria 937
1162 Ga0501068_0245565 3300049584 Bacteria 1140
1163 Ga0501069_0000573 3300049585 Bacteria 17009
1164 Ga0501069_0016886 3300049585 Bacteria 3922
1165 Ga0501069_0022902 3300049585 Bacteria 3402
1166 Ga0501069_0039951 3300049585 Bacteria 2592
1167 Ga0501069_0044839 3300049585 Bacteria 2448
1168 Ga0501069_0074975 3300049585 Bacteria 1899
1169 Ga0501070_0000104 3300049586 Bacteria 74572
1170 Ga0501070_0008199 3300049586 Bacteria 8836
1171 Ga0501070_0126192 3300049586 Bacteria 2115
1172 Ga0501070_0137614 3300049586 Bacteria 2016
1173 Ga0501070_0165505 3300049586 Bacteria 1822
1174 Ga0501070_0223470 3300049586 Bacteria 1544
1175 Ga0501070_0365812 3300049586 Bacteria 1169
1176 Ga0501071_0017473 3300049587 Bacteria 4947
1177 Ga0501071_0027040 3300049587 Bacteria 4033
1178 Ga0501071_0037793 3300049587 Bacteria 3448
1179 Ga0501072_0001074 3300049588 Bacteria 20312
1180 Ga0501072_0010020 3300049588 Bacteria 7208
1181 Ga0501073_0139250 3300049589 Bacteria 1681
1182 Ga0501073_0155406 3300049589 Bacteria 1585
1183 Ga0501074_0002541 3300049590 Bacteria 12723
1184 Ga0501074_0004394 3300049590 Bacteria 10076
1185 Ga0501074_0006260 3300049590 Bacteria 8592
1186 Ga0501074_0076732 3300049590 Bacteria 2398
1187 Ga0501074_0082879 3300049590 Bacteria 2299
1188 Ga0501074_0191560 3300049590 Bacteria 1458
1189 Ga0501075_0029807 3300049591 Bacteria 4036
1190 Ga0501075_0041146 3300049591 Bacteria 3462
1191 Ga0501075_0093399 3300049591 Bacteria 2284
1192 Ga0501076_0003423 3300049592 Bacteria 11130
1193 Ga0501076_0003747 3300049592 Bacteria 10687
1194 Ga0501076_0192117 3300049592 Unclassified 1666
1195 Ga0501077_0006981 3300049593 Bacteria 6957
1196 Ga0501077_0008641 3300049593 Bacteria 6312
1197 Ga0501079_0001804 3300049741 Bacteria 15292
1198 Ga0501079_0346232 3300049741 Bacteria 1164
1199 Ga0501080_0010664 3300049742 Bacteria 8410
1200 Ga0501080_0017932 3300049742 Bacteria 6551
1201 Ga0501080_0028690 3300049742 Bacteria 5180
1202 Ga0501080_0076993 3300049742 Bacteria 3102
1203 Ga0501080_0099025 3300049742 Bacteria 2705
1204 Ga0501080_0230161 3300049742 Bacteria 1694
1205 Ga0501080_0270135 3300049742 Bacteria 1548
1206 Ga0501081_0002825 3300049743 Bacteria 11013
1207 Ga0501081_0005074 3300049743 Bacteria 8473
1208 Ga0501081_0011695 3300049743 Bacteria 5745
1209 Ga0501083_0036819 3300049744 Bacteria 3335
1210 Ga0501083_0178417 3300049744 Bacteria 1387
1211 Ga0501035_0069331 3300049822 Bacteria 3126
1212 Ga0501035_0170962 3300049822 Bacteria 1877
1213 Ga0501044_0166172 3300049823 Bacteria 2181
1214 Ga0501044_0383071 3300049823 Bacteria 1321
1215 Ga0501045_0000404 3300049824 Bacteria 26259
1216 Ga0501045_0001212 3300049824 Bacteria 17175
1217 Ga0501045_0008660 3300049824 Bacteria 7094
1218 nmdc:mga0yw44_27853_c1 3300050492 Bacteria 3242
1219 nmdc:mga05p37_234905_c1 3300050507 Bacteria 2207
1220 nmdc:mga05p37_439083_c1 3300050507 Bacteria 1514
1221 nmdc:mga05p37_520_c1 3300050507 Bacteria 42619
1222 nmdc:mga05p37_579134_c1 3300050507 Bacteria 1271
1223 nmdc:mga09592_3679_c1 3300050508 Bacteria 12363
1224 nmdc:mga0qj67_11941_c1 3300050509 Bacteria 6526
1225 nmdc:mga0qj67_189845_c1 3300050509 Unclassified 1670
1226 nmdc:mga0qj67_58699_c1 3300050509 Bacteria 3051
1227 nmdc:mga06r32_120955_c1 3300050510 Bacteria 2583
1228 nmdc:mga06r32_16761_c1 3300050510 Bacteria 6680
1229 nmdc:mga08y16_100027_c1 3300050511 Bacteria 3019
1230 nmdc:mga08y16_186340_c1 3300050511 Bacteria 2153
1231 nmdc:mga08y16_37351_c1 3300050511 Bacteria 5102
1232 nmdc:mga08y16_616884_c1 3300050511 Bacteria 1092
1233 nmdc:mga0n895_11132_c1 3300050512 Bacteria 8005
1234 nmdc:mga0n895_144981_c1 3300050512 Bacteria 2404
1235 nmdc:mga0n895_235706_c1 3300050512 Unclassified 1857
1236 nmdc:mga0n895_26848_c1 3300050512 Bacteria 5462
1237 nmdc:mga0n895_36178_c1 3300050512 Bacteria 4767
1238 nmdc:mga0n895_8675_c1 3300050512 Bacteria 8826
1239 nmdc:mga0rr50_209551_c1 3300050513 Bacteria 1605
1240 nmdc:mga0rr50_5288_c1 3300050513 Bacteria 7679
1241 nmdc:mga08x19_20563_c1 3300050514 Bacteria 4064
1242 nmdc:mga08x19_29465_c1 3300050514 Bacteria 3442
1243 nmdc:mga08x19_301314_c1 3300050514 Bacteria 1113
1244 nmdc:mga0a205_23649_c1 3300050515 Bacteria 5828
1245 nmdc:mga0a205_267423_c1 3300050515 Bacteria 1587
1246 nmdc:mga0a205_269989_c1 3300050515 Bacteria 1578
1247 nmdc:mga0a205_5604_c1 3300050515 Bacteria 11312
1248 nmdc:mga0a205_60731_c1 3300050515 Bacteria 3651
1249 nmdc:mga0a205_66668_c1 3300050515 Bacteria 3478
1250 Ga0495601_0000325 3300053077 Bacteria 25289
1251 Ga0495601_0034317 3300053077 Bacteria 3164
1252 Ga0495601_0110580 3300053077 Bacteria 1779
1253 Ga0495612_0021067 3300053078 Bacteria 2615
1254 Ga0495595_0008898 3300053084 Bacteria 4137
1255 Ga0495595_0010915 3300053084 Bacteria 3790
1256 Ga0495595_0020888 3300053084 Bacteria 2854
1257 Ga0495595_0251968 3300053084 Bacteria 884
1258 Ga0495619_0001347 3300053085 Bacteria 16107
1259 Ga0495619_0002519 3300053085 Bacteria 11984
1260 Ga0495619_0003695 3300053085 Bacteria 9864
1261 Ga0495619_0059354 3300053085 Bacteria 2541
1262 Ga0501084_0004496 3300054114 Bacteria 11395
1263 Ga0501084_0009493 3300054114 Bacteria 8051
1264 Ga0501084_0026397 3300054114 Bacteria 4847
1265 Ga0501084_0146468 3300054114 Bacteria 1989
1266 Ga0590075_035830 3300059424 Bacteria 1264
1267 Ga0590077_003120 3300059426 Bacteria 3468
1268 Ga0501082_0005605 3300060353 Bacteria 10896
1269 Ga0501082_0054627 3300060353 Bacteria 3443
1270 Ga0501082_0291177 3300060353 Bacteria 1422
1271 Ga0466962_0001120 3300061719 Bacteria 12353
1272 Ga0466962_0005689 3300061719 Bacteria 5989
1273 Ga0466962_0006268 3300061719 Bacteria 5714
1274 Ga0466962_0008095 3300061719 Bacteria 5040
1275 Ga0466962_0008380 3300061719 Bacteria 4955
1276 Ga0466962_0009007 3300061719 Bacteria 4780
1277 Ga0466962_0070670 3300061719 Bacteria 1668
1278 Ga0466962_0077254 3300061719 Bacteria 1591
1279 Ga0530510_0008221 3300061734 Bacteria 7277
1280 Ga0530510_0035068 3300061734 Bacteria 3615
1281 Ga0530510_0049636 3300061734 Bacteria 3031
1282 Ga0530510_0061209 3300061734 Bacteria 2725
1283 Ga0530510_0144974 3300061734 Bacteria 1751
1284 Ga0530510_0177306 3300061734 Bacteria 1580

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044706 Ga0466964_0269574 Ga0466964_0269574_128_832 234
2 3300037471 Ga0395905_0086866 Ga0395905_0086866_857_1708 237
3 3300035111 Ga0373923_0224291 Ga0373923_0224291_104_826 239
4 3300035170 Ga0373943_0002483 Ga0373943_0002483_6887_7609 239
5 3300035692 Ga0373935_0005754 Ga0373935_0005754_5151_5873 239
6 3300035695 Ga0373927_0050966 Ga0373927_0050966_289_1011 239
7 3300046459 Ga0495629_0001380 Ga0495629_0001380_5610_6332 239
8 3300046463 Ga0495653_0200563 Ga0495653_0200563_332_1054 239
9 3300046473 Ga0495582_0000108 Ga0495582_0000108_42278_43000 239
10 3300046475 Ga0495639_0000578 Ga0495639_0000578_2982_3704 239
11 3300046511 Ga0495608_0040891 Ga0495608_0040891_2096_2818 239
12 3300046517 Ga0495630_0002325 Ga0495630_0002325_6478_7200 239
13 3300046663 Ga0495635_0136845 Ga0495635_0136845_880_1602 239
14 3300046681 Ga0495647_0006761 Ga0495647_0006761_518_1240 239
15 3300046689 Ga0495613_0004012 Ga0495613_0004012_2392_3114 239
16 3300047315 Ga0495581_0073780 Ga0495581_0073780_476_1198 239
17 3300047319 Ga0495674_0044638 Ga0495674_0044638_1788_2510 239
18 3300047321 Ga0495676_0002345 Ga0495676_0002345_6606_7328 239
19 3300047471 Ga0495684_0048709 Ga0495684_0048709_2018_2740 239
20 3300048089 Ga0495614_0002864 Ga0495614_0002864_6433_7155 239
21 3300048088 Ga0495602_0324363 Ga0495602_0324363_370_1098 241
22 3300061719 Ga0466962_0070670 Ga0466962_0070670_901_1638 244
23 3300046514 Ga0495618_0058319 Ga0495618_0058319_609_1349 245
24 3300046536 Ga0495587_0080643 Ga0495587_0080643_507_1247 245
25 3300046615 Ga0495656_0049863 Ga0495656_0049863_35_823 245
26 3300046679 Ga0495623_0299113 Ga0495623_0299113_69_809 245
27 3300048916 Ga0496113_0158438 Ga0496113_0158438_140_892 245
28 3300048918 Ga0496115_0048637 Ga0496115_0048637_2424_3164 245
29 3300049571 Ga0501034_0444464 Ga0501034_0444464_228_965 245
30 3300049823 Ga0501044_0383071 Ga0501044_0383071_534_1271 245
31 3300037312 Ga0395899_0211811 Ga0395899_0211811_355_1095 246
32 3300049742 Ga0501080_0230161 Ga0501080_0230161_851_1594 246
33 3300005985 Ga0081539_10000913 Ga0081539_1000091353 247
34 3300013296 Ga0157374_10665471 Ga0157374_106654712 247
35 3300037466 Ga0395898_0031934 Ga0395898_0031934_456_1241 247
36 3300037466 Ga0395898_0127960 Ga0395898_0127960_1453_2196 247
37 3300037471 Ga0395905_0248078 Ga0395905_0248078_314_1099 247
38 3300038443 Ga0395901_0230739 Ga0395901_0230739_648_1433 247
39 3300044693 Ga0466961_0058312 Ga0466961_0058312_503_1246 247
40 3300048915 Ga0496112_0275917 Ga0496112_0275917_310_1053 247
41 3300025921 Ga0207652_10259937 Ga0207652_102599372 248
42 3300045976 Ga0466967_0023579 Ga0466967_0023579_2089_2850 248
43 3300005614 Ga0068856_100015619 Ga0068856_1000156192 249
44 3300009098 Ga0105245_10089802 Ga0105245_100898022 249
45 3300009174 Ga0105241_10018444 Ga0105241_100184442 249
46 3300037418 Ga0395900_0619413 Ga0395900_0619413_61_810 249
47 3300037471 Ga0395905_0043771 Ga0395905_0043771_2546_3295 249
48 3300038443 Ga0395901_0316948 Ga0395901_0316948_151_900 249
49 3300044683 Ga0466965_0008827 Ga0466965_0008827_292_1041 249
50 3300044683 Ga0466965_0037687 Ga0466965_0037687_1367_2119 249
51 3300044719 Ga0466971_0004353 Ga0466971_0004353_4902_5651 249
52 3300044765 Ga0466970_0048699 Ga0466970_0048699_1455_2204 249
53 3300044765 Ga0466970_0271451 Ga0466970_0271451_13_762 249
54 3300045976 Ga0466967_0008898 Ga0466967_0008898_330_1079 249
55 3300045976 Ga0466967_0554286 Ga0466967_0554286_119_868 249
56 3300046459 Ga0495629_0104272 Ga0495629_0104272_1056_1808 249
57 3300046615 Ga0495656_0050655 Ga0495656_0050655_383_1132 249
58 3300046681 Ga0495647_0154272 Ga0495647_0154272_163_915 249
59 3300046691 Ga0495670_0182662 Ga0495670_0182662_22_771 249
60 3300006844 Ga0075428_100076694 Ga0075428_1000766943 250
61 3300006846 Ga0075430_100047921 Ga0075430_1000479212 250
62 3300037418 Ga0395900_0007148 Ga0395900_0007148_2137_2889 250
63 3300038443 Ga0395901_0021670 Ga0395901_0021670_303_1055 250
64 3300042993 Ga0439440_0053850 Ga0439440_0053850_234_986 250
65 3300048917 Ga0496114_0816820 Ga0496114_0816820_14_769 250
66 3300034817 Ga0373948_0029234 Ga0373948_0029234_223_1059 253
67 3300037312 Ga0395899_0241419 Ga0395899_0241419_99_938 253
68 3300037418 Ga0395900_0069058 Ga0395900_0069058_856_1695 253
69 3300037466 Ga0395898_0027356 Ga0395898_0027356_4056_4895 253
70 3300037471 Ga0395905_0026503 Ga0395905_0026503_4568_5407 253
71 3300038443 Ga0395901_0016741 Ga0395901_0016741_5098_5937 253
72 3300061734 Ga0530510_0008221 Ga0530510_0008221_965_1804 253
73 3300005336 Ga0070680_100000833 Ga0070680_1000008332 255
74 3300005458 Ga0070681_10004219 Ga0070681_1000421910 255
75 3300005530 Ga0070679_100039019 Ga0070679_1000390195 255
76 3300025917 Ga0207660_10114243 Ga0207660_101142432 255
77 3300025920 Ga0207649_10008750 Ga0207649_100087502 255
78 3300026078 Ga0207702_10028695 Ga0207702_100286952 255
79 3300026116 Ga0207674_10142691 Ga0207674_101426912 255
80 3300046526 Ga0495666_0067563 Ga0495666_0067563_737_1507 255
81 3300048915 Ga0496112_0003739 Ga0496112_0003739_323_1093 255
82 3300005614 Ga0068856_100099403 Ga0068856_1000994032 256
83 3300009094 Ga0111539_10235744 Ga0111539_102357442 256
84 3300037471 Ga0395905_0012897 Ga0395905_0012897_7035_7805 256
85 3300048903 Ga0496100_0504549 Ga0496100_0504549_25_798 256
86 3300037418 Ga0395900_0101632 Ga0395900_0101632_737_1510 257
87 3300037466 Ga0395898_0081691 Ga0395898_0081691_1055_1828 257
88 3300037471 Ga0395905_0367167 Ga0395905_0367167_73_846 257
89 3300038443 Ga0395901_0052123 Ga0395901_0052123_3008_3781 257
90 3300038443 Ga0395901_0081822 Ga0395901_0081822_1845_2618 257
91 3300044684 Ga0466966_0240201 Ga0466966_0240201_250_1077 257
92 3300044706 Ga0466964_0012902 Ga0466964_0012902_1970_2743 257
93 3300044901 Ga0466960_0201246 Ga0466960_0201246_275_1048 257
94 3300045976 Ga0466967_0006225 Ga0466967_0006225_4209_4982 257
95 3300045976 Ga0466967_0078816 Ga0466967_0078816_364_1137 257
96 3300048904 Ga0496101_0071232 Ga0496101_0071232_1723_2496 257
97 3300048917 Ga0496114_0537373 Ga0496114_0537373_209_982 257
98 3300049568 Ga0501031_0010535 Ga0501031_0010535_2673_3512 257
99 3300049570 Ga0501033_0062129 Ga0501033_0062129_1392_2231 257
100 3300049572 Ga0501036_0021440 Ga0501036_0021440_2922_3761 257
101 3300049573 Ga0501037_0078900 Ga0501037_0078900_1150_1989 257
102 3300049574 Ga0501038_0045292 Ga0501038_0045292_2298_3137 257
103 3300049575 Ga0501039_0005896 Ga0501039_0005896_646_1485 257
104 3300049576 Ga0501040_0011123 Ga0501040_0011123_4771_5610 257
105 3300049577 Ga0501041_0004358 Ga0501041_0004358_3504_4343 257
106 3300049578 Ga0501042_0000873 Ga0501042_0000873_15512_16351 257
107 3300049582 Ga0501048_0015279 Ga0501048_0015279_4185_5024 257
108 3300049585 Ga0501069_0022902 Ga0501069_0022902_2042_2881 257
109 3300049587 Ga0501071_0027040 Ga0501071_0027040_298_1137 257
110 3300049588 Ga0501072_0001074 Ga0501072_0001074_17443_18282 257
111 3300049590 Ga0501074_0002541 Ga0501074_0002541_11536_12375 257
112 3300049591 Ga0501075_0041146 Ga0501075_0041146_1393_2232 257
113 3300049592 Ga0501076_0003747 Ga0501076_0003747_307_1146 257
114 3300049593 Ga0501077_0006981 Ga0501077_0006981_2385_3224 257
115 3300049742 Ga0501080_0076993 Ga0501080_0076993_1562_2401 257
116 3300049743 Ga0501081_0002825 Ga0501081_0002825_5625_6464 257
117 3300049744 Ga0501083_0178417 Ga0501083_0178417_186_1025 257
118 3300049824 Ga0501045_0000404 Ga0501045_0000404_2568_3407 257
119 3300054114 Ga0501084_0004496 Ga0501084_0004496_2605_3444 257
120 3300037418 Ga0395900_0469864 Ga0395900_0469864_209_985 258
121 3300037471 Ga0395905_0178299 Ga0395905_0178299_128_904 258
122 3300037471 Ga0395905_0329236 Ga0395905_0329236_593_1369 258
123 3300038443 Ga0395901_0035819 Ga0395901_0035819_1219_1995 258
124 3300038443 Ga0395901_0810810 Ga0395901_0810810_95_877 258
125 3300044706 Ga0466964_0079495 Ga0466964_0079495_409_1185 258
126 3300046674 Ga0495588_0050756 Ga0495588_0050756_220_996 258
127 3300048907 Ga0496104_0556288 Ga0496104_0556288_14_790 258
128 3300048912 Ga0496109_0136189 Ga0496109_0136189_509_1285 258
129 3300048912 Ga0496109_0195275 Ga0496109_0195275_879_1655 258
130 3300005354 Ga0070675_100086296 Ga0070675_1000862962 259
131 3300028379 Ga0268266_10280683 Ga0268266_102806832 259
132 3300045976 Ga0466967_0533760 Ga0466967_0533760_17_799 259
133 3300046528 Ga0495642_0046135 Ga0495642_0046135_751_1542 259
134 3300047318 Ga0495636_0074829 Ga0495636_0074829_227_1018 259
135 3300048913 Ga0496110_0174400 Ga0496110_0174400_1146_1937 259
136 3300005468 Ga0070707_100369281 Ga0070707_1003692811 261
137 3300025922 Ga0207646_10295581 Ga0207646_102955811 261
138 3300037418 Ga0395900_0139795 Ga0395900_0139795_774_1559 261
139 3300037466 Ga0395898_0027619 Ga0395898_0027619_2053_2838 261
140 3300037418 Ga0395900_0005363 Ga0395900_0005363_3430_4221 262
141 3300037466 Ga0395898_0071698 Ga0395898_0071698_209_1000 262
142 3300037471 Ga0395905_0006331 Ga0395905_0006331_5532_6323 262
143 3300038443 Ga0395901_0013286 Ga0395901_0013286_4700_5491 262
144 3300006844 Ga0075428_100617830 Ga0075428_1006178302 263
145 3300009176 Ga0105242_10011407 Ga0105242_100114074 264
146 3300046472 Ga0495580_0388776 Ga0495580_0388776_55_903 264
147 3300048903 Ga0496100_0068816 Ga0496100_0068816_135_986 264
148 3300048905 Ga0496102_0141332 Ga0496102_0141332_111_962 264
149 3300048909 Ga0496106_0103137 Ga0496106_0103137_1072_1923 264
150 3300048917 Ga0496114_0397510 Ga0496114_0397510_255_1106 264
151 3300049571 Ga0501034_0145102 Ga0501034_0145102_1246_2043 264
152 3300049583 Ga0501067_0275392 Ga0501067_0275392_128_925 264
153 3300049586 Ga0501070_0008199 Ga0501070_0008199_8002_8799 264
154 3300049586 Ga0501070_0137614 Ga0501070_0137614_179_976 264
155 3300049590 Ga0501074_0004394 Ga0501074_0004394_4609_5406 264
156 3300049742 Ga0501080_0010664 Ga0501080_0010664_3299_4096 264
157 3300005985 Ga0081539_10003671 Ga0081539_100036712 265
158 3300042009 Ga0439451_000608 Ga0439451_000608_3978_4778 265
159 3300044694 Ga0466963_0003165 Ga0466963_0003165_5764_6561 265
160 3300049572 Ga0501036_0010058 Ga0501036_0010058_162_962 265
161 3300049573 Ga0501037_0072221 Ga0501037_0072221_246_1046 265
162 3300049575 Ga0501039_0002203 Ga0501039_0002203_12801_13601 265
163 3300049576 Ga0501040_0015780 Ga0501040_0015780_1041_1841 265
164 3300049577 Ga0501041_0002538 Ga0501041_0002538_2655_3455 265
165 3300049580 Ga0501046_0140282 Ga0501046_0140282_59_859 265
166 3300049582 Ga0501048_0002986 Ga0501048_0002986_5586_6386 265
167 3300049584 Ga0501068_0245565 Ga0501068_0245565_95_895 265
168 3300049587 Ga0501071_0017473 Ga0501071_0017473_279_1079 265
169 3300049588 Ga0501072_0010020 Ga0501072_0010020_2999_3799 265
170 3300049589 Ga0501073_0155406 Ga0501073_0155406_476_1276 265
171 3300049590 Ga0501074_0076732 Ga0501074_0076732_549_1349 265
172 3300049592 Ga0501076_0003423 Ga0501076_0003423_5303_6103 265
173 3300049741 Ga0501079_0001804 Ga0501079_0001804_14097_14897 265
174 3300049741 Ga0501079_0346232 Ga0501079_0346232_194_994 265
175 3300049742 Ga0501080_0099025 Ga0501080_0099025_905_1705 265
176 3300049743 Ga0501081_0005074 Ga0501081_0005074_5689_6489 265
177 3300049744 Ga0501083_0036819 Ga0501083_0036819_554_1354 265
178 3300049822 Ga0501035_0069331 Ga0501035_0069331_1983_2783 265
179 3300049824 Ga0501045_0001212 Ga0501045_0001212_6892_7692 265
180 3300054114 Ga0501084_0009493 Ga0501084_0009493_4779_5579 265
181 3300060353 Ga0501082_0005605 Ga0501082_0005605_9342_10142 265
182 3300061734 Ga0530510_0144974 Ga0530510_0144974_886_1686 265
183 3300035112 Ga0373932_0015296 Ga0373932_0015296_415_1215 266
184 3300048917 Ga0496114_0340249 Ga0496114_0340249_360_1196 266
185 3300005535 Ga0070684_100177540 Ga0070684_1001775402 267
186 3300038443 Ga0395901_0539753 Ga0395901_0539753_111_959 267
187 3300045051 Ga0451576_0538922 Ga0451576_0538922_187_993 268
188 3300005355 Ga0070671_100023681 Ga0070671_1000236812 269
189 3300005436 Ga0070713_100248786 Ga0070713_1002487862 269
190 3300005614 Ga0068856_100010475 Ga0068856_10001047514 269
191 3300006175 Ga0070712_100003082 Ga0070712_1000030828 269
192 3300006237 Ga0097621_100140402 Ga0097621_1001404022 269
193 3300013105 Ga0157369_10003497 Ga0157369_1000349721 269
194 3300014969 Ga0157376_10271529 Ga0157376_102715292 269
195 3300025906 Ga0207699_10166181 Ga0207699_101661812 269
196 3300025928 Ga0207700_10131072 Ga0207700_101310723 269
197 3300026078 Ga0207702_10033479 Ga0207702_100334792 269
198 3300037312 Ga0395899_0069482 Ga0395899_0069482_1655_2473 269
199 3300037418 Ga0395900_0005432 Ga0395900_0005432_6907_7734 269
200 3300037466 Ga0395898_0217878 Ga0395898_0217878_113_940 269
201 3300037471 Ga0395905_0042427 Ga0395905_0042427_902_1720 269
202 3300038443 Ga0395901_0014173 Ga0395901_0014173_4242_5069 269
203 3300041406 Ga0439439_0003791 Ga0439439_0003791_358_1170 269
204 3300041997 Ga0439431_0005605 Ga0439431_0005605_1773_2585 269
205 3300041999 Ga0439433_0001351 Ga0439433_0001351_2690_3502 269
206 3300042007 Ga0439449_0042502 Ga0439449_0042502_704_1516 269
207 3300044684 Ga0466966_0021354 Ga0466966_0021354_542_1351 269
208 3300044693 Ga0466961_0115688 Ga0466961_0115688_833_1642 269
209 3300044842 Ga0466957_0229370 Ga0466957_0229370_49_861 269
210 3300045836 Ga0466958_0028547 Ga0466958_0028547_2234_3043 269
211 3300045976 Ga0466967_0574986 Ga0466967_0574986_63_872 269
212 3300048903 Ga0496100_0000648 Ga0496100_0000648_8137_8952 269
213 3300048904 Ga0496101_0011052 Ga0496101_0011052_2235_3050 269
214 3300048905 Ga0496102_0002063 Ga0496102_0002063_4215_5030 269
215 3300048907 Ga0496104_0003386 Ga0496104_0003386_11592_12407 269
216 3300048908 Ga0496105_0000406 Ga0496105_0000406_25407_26222 269
217 3300048909 Ga0496106_0000263 Ga0496106_0000263_28824_29639 269
218 3300048910 Ga0496107_0000712 Ga0496107_0000712_3183_3998 269
219 3300048911 Ga0496108_0001638 Ga0496108_0001638_4282_5097 269
220 3300048912 Ga0496109_0006975 Ga0496109_0006975_3775_4590 269
221 3300048913 Ga0496110_0003901 Ga0496110_0003901_347_1162 269
222 3300048915 Ga0496112_0089792 Ga0496112_0089792_806_1621 269
223 3300048916 Ga0496113_0051103 Ga0496113_0051103_279_1094 269
224 3300048917 Ga0496114_0000444 Ga0496114_0000444_11603_12418 269
225 3300048918 Ga0496115_0000415 Ga0496115_0000415_27458_28273 269
226 3300050507 nmdc:mga05p37_579134_c1 nmdc:mga05p37_579134_c1_217_1035 269
227 3300050512 nmdc:mga0n895_235706_c1 nmdc:mga0n895_235706_c1_961_1779 269
228 3300061719 Ga0466962_0077254 Ga0466962_0077254_720_1529 269
229 3300005336 Ga0070680_100057288 Ga0070680_1000572885 270
230 3300005435 Ga0070714_100094192 Ga0070714_1000941924 270
231 3300005435 Ga0070714_100354911 Ga0070714_1003549112 270
232 3300005435 Ga0070714_100420512 Ga0070714_1004205122 270
233 3300005530 Ga0070679_100393176 Ga0070679_1003931762 270
234 3300005563 Ga0068855_100014539 Ga0068855_1000145395 270
235 3300005563 Ga0068855_100251896 Ga0068855_1002518962 270
236 3300006852 Ga0075433_10194525 Ga0075433_101945252 270
237 3300009551 Ga0105238_10153675 Ga0105238_101536753 270
238 3300009551 Ga0105238_10229056 Ga0105238_102290562 270
239 3300013100 Ga0157373_10268539 Ga0157373_102685392 270
240 3300013104 Ga0157370_10067657 Ga0157370_100676575 270
241 3300013307 Ga0157372_10077087 Ga0157372_100770873 270
242 3300013307 Ga0157372_10674226 Ga0157372_106742262 270
243 3300014969 Ga0157376_10577050 Ga0157376_105770501 270
244 3300020069 Ga0197907_10139001 Ga0197907_101390012 270
245 3300022467 Ga0224712_10043053 Ga0224712_100430532 270
246 3300025905 Ga0207685_10094493 Ga0207685_100944932 270
247 3300025912 Ga0207707_10001354 Ga0207707_1000135415 270
248 3300025912 Ga0207707_10091058 Ga0207707_100910585 270
249 3300025913 Ga0207695_10332712 Ga0207695_103327122 270
250 3300025914 Ga0207671_10289506 Ga0207671_102895062 270
251 3300025921 Ga0207652_10011232 Ga0207652_100112325 270
252 3300025929 Ga0207664_10182692 Ga0207664_101826921 270
253 3300025929 Ga0207664_10426364 Ga0207664_104263642 270
254 3300025949 Ga0207667_10127503 Ga0207667_101275033 270
255 3300026142 Ga0207698_10564711 Ga0207698_105647112 270
256 3300035170 Ga0373943_0003285 Ga0373943_0003285_5509_6333 270
257 3300035695 Ga0373927_0116010 Ga0373927_0116010_540_1364 270
258 3300035725 Ga0373947_0009004 Ga0373947_0009004_649_1473 270
259 3300037068 Ga0373925_0145751 Ga0373925_0145751_738_1562 270
260 3300037418 Ga0395900_0688225 Ga0395900_0688225_53_865 270
261 3300037466 Ga0395898_0313321 Ga0395898_0313321_83_895 270
262 3300037471 Ga0395905_0282306 Ga0395905_0282306_43_861 270
263 3300038443 Ga0395901_0730668 Ga0395901_0730668_47_862 270
264 3300044694 Ga0466963_0000694 Ga0466963_0000694_121_936 270
265 3300044694 Ga0466963_0079151 Ga0466963_0079151_536_1348 270
266 3300044735 Ga0466968_0033976 Ga0466968_0033976_1222_2037 270
267 3300044842 Ga0466957_0033677 Ga0466957_0033677_699_1514 270
268 3300045049 Ga0466959_0012819 Ga0466959_0012819_3667_4482 270
269 3300045836 Ga0466958_0085323 Ga0466958_0085323_951_1766 270
270 3300045976 Ga0466967_0054621 Ga0466967_0054621_727_1542 270
271 3300045976 Ga0466967_0170988 Ga0466967_0170988_843_1658 270
272 3300045976 Ga0466967_0276253 Ga0466967_0276253_107_922 270
273 3300046473 Ga0495582_0211861 Ga0495582_0211861_110_934 270
274 3300047321 Ga0495676_0161867 Ga0495676_0161867_438_1262 270
275 3300048903 Ga0496100_0125738 Ga0496100_0125738_717_1538 270
276 3300048904 Ga0496101_0265475 Ga0496101_0265475_161_982 270
277 3300048909 Ga0496106_0071321 Ga0496106_0071321_1101_1922 270
278 3300048910 Ga0496107_0008672 Ga0496107_0008672_5774_6595 270
279 3300049742 Ga0501080_0028690 Ga0501080_0028690_2042_2857 270
280 3300050515 nmdc:mga0a205_267423_c1 nmdc:mga0a205_267423_c1_150_965 270
281 3300005329 Ga0070683_100103809 Ga0070683_1001038092 271
282 3300005336 Ga0070680_100118748 Ga0070680_1001187482 271
283 3300005436 Ga0070713_100162995 Ga0070713_1001629952 271
284 3300005468 Ga0070707_100175169 Ga0070707_1001751692 271
285 3300005530 Ga0070679_100016881 Ga0070679_10001688110 271
286 3300005530 Ga0070679_100040336 Ga0070679_1000403366 271
287 3300005535 Ga0070684_100361504 Ga0070684_1003615042 271
288 3300005563 Ga0068855_100160002 Ga0068855_1001600024 271
289 3300005563 Ga0068855_100430283 Ga0068855_1004302832 271
290 3300006028 Ga0070717_10216956 Ga0070717_102169562 271
291 3300006175 Ga0070712_100425847 Ga0070712_1004258472 271
292 3300006871 Ga0075434_100003308 Ga0075434_10000330813 271
293 3300007076 Ga0075435_100015837 Ga0075435_1000158372 271
294 3300020070 Ga0206356_10644836 Ga0206356_106448362 271
295 3300020070 Ga0206356_10767042 Ga0206356_107670424 271
296 3300020082 Ga0206353_10734363 Ga0206353_107343633 271
297 3300025909 Ga0207705_10286870 Ga0207705_102868702 271
298 3300025912 Ga0207707_10040778 Ga0207707_100407787 271
299 3300025917 Ga0207660_10087052 Ga0207660_100870524 271
300 3300025917 Ga0207660_10251388 Ga0207660_102513882 271
301 3300025919 Ga0207657_10006585 Ga0207657_100065858 271
302 3300025921 Ga0207652_10048429 Ga0207652_100484292 271
303 3300025921 Ga0207652_10100031 Ga0207652_101000314 271
304 3300025949 Ga0207667_10356236 Ga0207667_103562362 271
305 3300028558 Ga0265326_10019157 Ga0265326_100191571 271
306 3300028573 Ga0265334_10053707 Ga0265334_100537072 271
307 3300028654 Ga0265322_10002700 Ga0265322_100027005 271
308 3300028800 Ga0265338_10004226 Ga0265338_1000422620 271
309 3300028800 Ga0265338_10103168 Ga0265338_101031682 271
310 3300029957 Ga0265324_10042543 Ga0265324_100425432 271
311 3300031241 Ga0265325_10016612 Ga0265325_100166122 271
312 3300031247 Ga0265340_10054352 Ga0265340_100543522 271
313 3300031250 Ga0265331_10039610 Ga0265331_100396102 271
314 3300031251 Ga0265327_10043752 Ga0265327_100437523 271
315 3300031344 Ga0265316_10015601 Ga0265316_100156014 271
316 3300031548 Ga0307408_100390414 Ga0307408_1003904142 271
317 3300031595 Ga0265313_10011330 Ga0265313_100113302 271
318 3300031711 Ga0265314_10029525 Ga0265314_100295253 271
319 3300031731 Ga0307405_10152897 Ga0307405_101528972 271
320 3300031995 Ga0307409_100135091 Ga0307409_1001350912 271
321 3300032002 Ga0307416_100037411 Ga0307416_1000374112 271
322 3300032126 Ga0307415_100039541 Ga0307415_1000395413 271
323 3300037466 Ga0395898_0128624 Ga0395898_0128624_1185_2009 271
324 3300037466 Ga0395898_0183427 Ga0395898_0183427_43_861 271
325 3300037471 Ga0395905_0356532 Ga0395905_0356532_224_1042 271
326 3300038443 Ga0395901_0072631 Ga0395901_0072631_975_1790 271
327 3300038443 Ga0395901_0134367 Ga0395901_0134367_253_1077 271
328 3300044693 Ga0466961_0005996 Ga0466961_0005996_2154_2972 271
329 3300044765 Ga0466970_0048251 Ga0466970_0048251_520_1338 271
330 3300044842 Ga0466957_0032348 Ga0466957_0032348_615_1433 271
331 3300045049 Ga0466959_0048153 Ga0466959_0048153_1109_1927 271
332 3300045976 Ga0466967_0137588 Ga0466967_0137588_375_1190 271
333 3300046517 Ga0495630_0107209 Ga0495630_0107209_346_1191 271
334 3300049576 Ga0501040_0136658 Ga0501040_0136658_513_1331 271
335 3300049581 Ga0501047_0112308 Ga0501047_0112308_942_1757 271
336 3300049585 Ga0501069_0044839 Ga0501069_0044839_1244_2059 271
337 3300049585 Ga0501069_0074975 Ga0501069_0074975_724_1539 271
338 3300049586 Ga0501070_0165505 Ga0501070_0165505_845_1660 271
339 3300049590 Ga0501074_0082879 Ga0501074_0082879_824_1639 271
340 3300049592 Ga0501076_0192117 Ga0501076_0192117_197_1015 271
341 3300049593 Ga0501077_0008641 Ga0501077_0008641_4272_5090 271
342 3300050512 nmdc:mga0n895_8675_c1 nmdc:mga0n895_8675_c1_7217_8041 271
343 3300050513 nmdc:mga0rr50_5288_c1 nmdc:mga0rr50_5288_c1_204_1028 271
344 3300054114 Ga0501084_0146468 Ga0501084_0146468_1065_1883 271
345 3300060353 Ga0501082_0291177 Ga0501082_0291177_535_1350 271
346 3300061719 Ga0466962_0008380 Ga0466962_0008380_2704_3522 271
347 3300061734 Ga0530510_0061209 Ga0530510_0061209_1186_2001 271
348 3300005327 Ga0070658_10027533 Ga0070658_100275332 272
349 3300005329 Ga0070683_100010433 Ga0070683_1000104335 272
350 3300005336 Ga0070680_100040065 Ga0070680_1000400656 272
351 3300005339 Ga0070660_100013910 Ga0070660_1000139109 272
352 3300005339 Ga0070660_100015853 Ga0070660_1000158532 272
353 3300005366 Ga0070659_100112373 Ga0070659_1001123732 272
354 3300005435 Ga0070714_100021527 Ga0070714_1000215277 272
355 3300005458 Ga0070681_10026250 Ga0070681_100262502 272
356 3300005471 Ga0070698_100064439 Ga0070698_1000644395 272
357 3300005530 Ga0070679_100214915 Ga0070679_1002149152 272
358 3300005535 Ga0070684_100001780 Ga0070684_10000178015 272
359 3300005539 Ga0068853_100645701 Ga0068853_1006457012 272
360 3300005563 Ga0068855_100010933 Ga0068855_1000109334 272
361 3300005564 Ga0070664_100344116 Ga0070664_1003441162 272
362 3300006844 Ga0075428_100024221 Ga0075428_1000242216 272
363 3300006846 Ga0075430_100027584 Ga0075430_1000275848 272
364 3300006880 Ga0075429_100025072 Ga0075429_1000250724 272
365 3300009093 Ga0105240_10082546 Ga0105240_100825462 272
366 3300009093 Ga0105240_10189279 Ga0105240_101892792 272
367 3300009147 Ga0114129_10010119 Ga0114129_100101198 272
368 3300013104 Ga0157370_10058957 Ga0157370_100589575 272
369 3300013105 Ga0157369_10125959 Ga0157369_101259595 272
370 3300013105 Ga0157369_10402419 Ga0157369_104024192 272
371 3300013307 Ga0157372_10080718 Ga0157372_100807182 272
372 3300020069 Ga0197907_10089213 Ga0197907_100892132 272
373 3300020081 Ga0206354_10685782 Ga0206354_106857824 272
374 3300020081 Ga0206354_11282843 Ga0206354_112828432 272
375 3300020082 Ga0206353_10088991 Ga0206353_100889912 272
376 3300020082 Ga0206353_10374765 Ga0206353_103747652 272
377 3300025909 Ga0207705_10126059 Ga0207705_101260592 272
378 3300025909 Ga0207705_10218356 Ga0207705_102183562 272
379 3300025912 Ga0207707_10003861 Ga0207707_100038619 272
380 3300025913 Ga0207695_10207577 Ga0207695_102075772 272
381 3300025919 Ga0207657_10000150 Ga0207657_100001503 272
382 3300025919 Ga0207657_10002804 Ga0207657_1000280412 272
383 3300025921 Ga0207652_10019032 Ga0207652_100190322 272
384 3300025921 Ga0207652_10172174 Ga0207652_101721742 272
385 3300025929 Ga0207664_10217382 Ga0207664_102173822 272
386 3300025934 Ga0207686_10041872 Ga0207686_100418723 272
387 3300025944 Ga0207661_10205283 Ga0207661_102052832 272
388 3300025949 Ga0207667_10145522 Ga0207667_101455224 272
389 3300026078 Ga0207702_10303044 Ga0207702_103030441 272
390 3300026121 Ga0207683_10241056 Ga0207683_102410562 272
391 3300028563 Ga0265319_1014823 Ga0265319_10148232 272
392 3300028800 Ga0265338_10077496 Ga0265338_100774963 272
393 3300031241 Ga0265325_10045291 Ga0265325_100452912 272
394 3300031249 Ga0265339_10053703 Ga0265339_100537033 272
395 3300031344 Ga0265316_10045508 Ga0265316_100455082 272
396 3300037312 Ga0395899_0075634 Ga0395899_0075634_1301_2125 272
397 3300037466 Ga0395898_0002274 Ga0395898_0002274_11127_11951 272
398 3300038443 Ga0395901_0001441 Ga0395901_0001441_11515_12339 272
399 3300039453 Ga0436362_0226949 Ga0436362_0226949_395_1213 272
400 3300044694 Ga0466963_0267507 Ga0466963_0267507_246_1079 272
401 3300044735 Ga0466968_0024136 Ga0466968_0024136_1164_1997 272
402 3300045049 Ga0466959_0076309 Ga0466959_0076309_802_1635 272
403 3300045836 Ga0466958_0043705 Ga0466958_0043705_158_976 272
404 3300045976 Ga0466967_0002953 Ga0466967_0002953_2606_3424 272
405 3300045976 Ga0466967_0037723 Ga0466967_0037723_2692_3510 272
406 3300045976 Ga0466967_0196326 Ga0466967_0196326_690_1511 272
407 3300046474 Ga0495605_0060688 Ga0495605_0060688_870_1688 272
408 3300046514 Ga0495618_0065679 Ga0495618_0065679_822_1643 272
409 3300046516 Ga0495628_0003449 Ga0495628_0003449_2410_3231 272
410 3300046517 Ga0495630_0054724 Ga0495630_0054724_1117_1938 272
411 3300046529 Ga0495652_0032184 Ga0495652_0032184_1686_2507 272
412 3300046533 Ga0495640_0271000 Ga0495640_0271000_141_968 272
413 3300046559 Ga0495667_0030658 Ga0495667_0030658_1452_2273 272
414 3300046809 Ga0495600_0293806 Ga0495600_0293806_157_978 272
415 3300047319 Ga0495674_0001965 Ga0495674_0001965_4844_5665 272
416 3300047322 Ga0495680_0001771 Ga0495680_0001771_2309_3130 272
417 3300048905 Ga0496102_0019615 Ga0496102_0019615_4796_5620 272
418 3300048915 Ga0496112_0071698 Ga0496112_0071698_898_1719 272
419 3300048915 Ga0496112_0098547 Ga0496112_0098547_806_1630 272
420 3300049585 Ga0501069_0016886 Ga0501069_0016886_561_1388 272
421 3300049586 Ga0501070_0000104 Ga0501070_0000104_42906_43733 272
422 3300049586 Ga0501070_0223470 Ga0501070_0223470_121_942 272
423 3300049590 Ga0501074_0191560 Ga0501074_0191560_527_1348 272
424 3300049742 Ga0501080_0270135 Ga0501080_0270135_416_1237 272
425 3300049823 Ga0501044_0166172 Ga0501044_0166172_574_1395 272
426 3300050507 nmdc:mga05p37_520_c1 nmdc:mga05p37_520_c1_7145_7972 272
427 3300050508 nmdc:mga09592_3679_c1 nmdc:mga09592_3679_c1_5778_6605 272
428 3300050509 nmdc:mga0qj67_11941_c1 nmdc:mga0qj67_11941_c1_5387_6214 272
429 3300053084 Ga0495595_0251968 Ga0495595_0251968_43_870 272
430 3300005327 Ga0070658_10003965 Ga0070658_100039652 273
431 3300005327 Ga0070658_10037793 Ga0070658_100377932 273
432 3300005327 Ga0070658_10070807 Ga0070658_100708074 273
433 3300005329 Ga0070683_100062154 Ga0070683_1000621544 273
434 3300005329 Ga0070683_100128371 Ga0070683_1001283712 273
435 3300005336 Ga0070680_100110899 Ga0070680_1001108992 273
436 3300005336 Ga0070680_100235743 Ga0070680_1002357432 273
437 3300005338 Ga0068868_100391114 Ga0068868_1003911141 273
438 3300005339 Ga0070660_100025497 Ga0070660_1000254974 273
439 3300005339 Ga0070660_100069382 Ga0070660_1000693822 273
440 3300005339 Ga0070660_100230852 Ga0070660_1002308522 273
441 3300005339 Ga0070660_100382727 Ga0070660_1003827271 273
442 3300005344 Ga0070661_100026212 Ga0070661_1000262122 273
443 3300005344 Ga0070661_100195055 Ga0070661_1001950552 273
444 3300005344 Ga0070661_100513034 Ga0070661_1005130341 273
445 3300005366 Ga0070659_100016721 Ga0070659_1000167213 273
446 3300005434 Ga0070709_10410330 Ga0070709_104103301 273
447 3300005435 Ga0070714_100035861 Ga0070714_1000358612 273
448 3300005435 Ga0070714_100036286 Ga0070714_1000362864 273
449 3300005435 Ga0070714_100038130 Ga0070714_1000381306 273
450 3300005435 Ga0070714_100097985 Ga0070714_1000979853 273
451 3300005435 Ga0070714_100317699 Ga0070714_1003176992 273
452 3300005436 Ga0070713_100013333 Ga0070713_1000133332 273
453 3300005436 Ga0070713_100102009 Ga0070713_1001020095 273
454 3300005436 Ga0070713_100329341 Ga0070713_1003293412 273
455 3300005437 Ga0070710_10219761 Ga0070710_102197612 273
456 3300005439 Ga0070711_100031738 Ga0070711_1000317382 273
457 3300005455 Ga0070663_100079539 Ga0070663_1000795392 273
458 3300005458 Ga0070681_10073230 Ga0070681_100732303 273
459 3300005458 Ga0070681_10113015 Ga0070681_101130151 273
460 3300005458 Ga0070681_10209001 Ga0070681_102090012 273
461 3300005458 Ga0070681_10269668 Ga0070681_102696682 273
462 3300005468 Ga0070707_100004270 Ga0070707_1000042702 273
463 3300005471 Ga0070698_100015109 Ga0070698_1000151091 273
464 3300005471 Ga0070698_100062011 Ga0070698_1000620112 273
465 3300005530 Ga0070679_100066123 Ga0070679_1000661232 273
466 3300005530 Ga0070679_100116057 Ga0070679_1001160572 273
467 3300005530 Ga0070679_100121629 Ga0070679_1001216292 273
468 3300005535 Ga0070684_100021823 Ga0070684_1000218236 273
469 3300005535 Ga0070684_100133163 Ga0070684_1001331633 273
470 3300005536 Ga0070697_100421406 Ga0070697_1004214062 273
471 3300005539 Ga0068853_100055571 Ga0068853_1000555714 273
472 3300005545 Ga0070695_100000028 Ga0070695_10000002818 273
473 3300005546 Ga0070696_100208602 Ga0070696_1002086022 273
474 3300005548 Ga0070665_100020268 Ga0070665_1000202685 273
475 3300005563 Ga0068855_100072506 Ga0068855_1000725062 273
476 3300005563 Ga0068855_100203558 Ga0068855_1002035582 273
477 3300005563 Ga0068855_100574302 Ga0068855_1005743022 273
478 3300005564 Ga0070664_100147043 Ga0070664_1001470432 273
479 3300005578 Ga0068854_100084041 Ga0068854_1000840413 273
480 3300005614 Ga0068856_100041281 Ga0068856_1000412814 273
481 3300005614 Ga0068856_100045467 Ga0068856_1000454672 273
482 3300005616 Ga0068852_100074978 Ga0068852_1000749784 273
483 3300005981 Ga0081538_10028440 Ga0081538_100284406 273
484 3300005983 Ga0081540_1001335 Ga0081540_100133523 273
485 3300006028 Ga0070717_10008104 Ga0070717_1000810411 273
486 3300006028 Ga0070717_10043531 Ga0070717_100435312 273
487 3300006028 Ga0070717_10051688 Ga0070717_100516882 273
488 3300006028 Ga0070717_10057173 Ga0070717_100571731 273
489 3300006163 Ga0070715_10004504 Ga0070715_100045048 273
490 3300006175 Ga0070712_100036396 Ga0070712_1000363962 273
491 3300006175 Ga0070712_100400573 Ga0070712_1004005731 273
492 3300006914 Ga0075436_100218212 Ga0075436_1002182121 273
493 3300006914 Ga0075436_100387019 Ga0075436_1003870192 273
494 3300007076 Ga0075435_100073353 Ga0075435_1000733532 273
495 3300009093 Ga0105240_10273325 Ga0105240_102733252 273
496 3300009093 Ga0105240_10502599 Ga0105240_105025992 273
497 3300009098 Ga0105245_10352558 Ga0105245_103525582 273
498 3300009174 Ga0105241_10172576 Ga0105241_101725763 273
499 3300009176 Ga0105242_10487351 Ga0105242_104873512 273
500 3300009177 Ga0105248_10415942 Ga0105248_104159422 273
501 3300009545 Ga0105237_10200689 Ga0105237_102006892 273
502 3300009545 Ga0105237_10403765 Ga0105237_104037652 273
503 3300009551 Ga0105238_10025309 Ga0105238_1002530911 273
504 3300013100 Ga0157373_10059940 Ga0157373_100599402 273
505 3300013100 Ga0157373_10299861 Ga0157373_102998611 273
506 3300013102 Ga0157371_10034338 Ga0157371_100343382 273
507 3300013104 Ga0157370_10043386 Ga0157370_100433865 273
508 3300013104 Ga0157370_10050281 Ga0157370_100502812 273
509 3300013104 Ga0157370_10063208 Ga0157370_100632082 273
510 3300013104 Ga0157370_10162421 Ga0157370_101624212 273
511 3300013104 Ga0157370_10441461 Ga0157370_104414612 273
512 3300013104 Ga0157370_10442665 Ga0157370_104426651 273
513 3300013105 Ga0157369_10039280 Ga0157369_100392803 273
514 3300013105 Ga0157369_10094980 Ga0157369_100949802 273
515 3300013105 Ga0157369_10371992 Ga0157369_103719922 273
516 3300013105 Ga0157369_10373641 Ga0157369_103736412 273
517 3300013105 Ga0157369_10427010 Ga0157369_104270102 273
518 3300013296 Ga0157374_10183769 Ga0157374_101837693 273
519 3300013307 Ga0157372_10090358 Ga0157372_100903582 273
520 3300013307 Ga0157372_10101072 Ga0157372_101010724 273
521 3300013307 Ga0157372_10231608 Ga0157372_102316084 273
522 3300013307 Ga0157372_10291480 Ga0157372_102914804 273
523 3300013307 Ga0157372_10385710 Ga0157372_103857102 273
524 3300014968 Ga0157379_10074183 Ga0157379_100741836 273
525 3300014969 Ga0157376_10054339 Ga0157376_100543396 273
526 3300020069 Ga0197907_10494060 Ga0197907_104940602 273
527 3300020070 Ga0206356_10267656 Ga0206356_102676568 273
528 3300020070 Ga0206356_11012494 Ga0206356_110124942 273
529 3300020070 Ga0206356_11376571 Ga0206356_113765713 273
530 3300020081 Ga0206354_10279382 Ga0206354_102793824 273
531 3300020081 Ga0206354_10841280 Ga0206354_108412802 273
532 3300020082 Ga0206353_10561342 Ga0206353_105613422 273
533 3300022467 Ga0224712_10004092 Ga0224712_100040922 273
534 3300022467 Ga0224712_10066745 Ga0224712_100667452 273
535 3300025898 Ga0207692_10003988 Ga0207692_100039885 273
536 3300025906 Ga0207699_10007837 Ga0207699_100078372 273
537 3300025909 Ga0207705_10009942 Ga0207705_100099424 273
538 3300025909 Ga0207705_10074738 Ga0207705_100747382 273
539 3300025909 Ga0207705_10221504 Ga0207705_102215042 273
540 3300025909 Ga0207705_10242455 Ga0207705_102424552 273
541 3300025910 Ga0207684_10058034 Ga0207684_100580343 273
542 3300025912 Ga0207707_10045685 Ga0207707_100456854 273
543 3300025912 Ga0207707_10053316 Ga0207707_100533162 273
544 3300025912 Ga0207707_10089996 Ga0207707_100899963 273
545 3300025912 Ga0207707_10117118 Ga0207707_101171182 273
546 3300025912 Ga0207707_10440029 Ga0207707_104400292 273
547 3300025914 Ga0207671_10064359 Ga0207671_100643592 273
548 3300025915 Ga0207693_10006140 Ga0207693_1000614013 273
549 3300025915 Ga0207693_10019508 Ga0207693_100195085 273
550 3300025915 Ga0207693_10084696 Ga0207693_100846962 273
551 3300025916 Ga0207663_10002700 Ga0207663_1000270010 273
552 3300025916 Ga0207663_10239468 Ga0207663_102394682 273
553 3300025917 Ga0207660_10069364 Ga0207660_100693641 273
554 3300025917 Ga0207660_10112587 Ga0207660_101125872 273
555 3300025919 Ga0207657_10000184 Ga0207657_1000018450 273
556 3300025919 Ga0207657_10002847 Ga0207657_1000284711 273
557 3300025919 Ga0207657_10006650 Ga0207657_1000665016 273
558 3300025919 Ga0207657_10067084 Ga0207657_100670841 273
559 3300025919 Ga0207657_10084751 Ga0207657_100847515 273
560 3300025919 Ga0207657_10313208 Ga0207657_103132082 273
561 3300025921 Ga0207652_10173909 Ga0207652_101739092 273
562 3300025921 Ga0207652_10293507 Ga0207652_102935072 273
563 3300025921 Ga0207652_10519621 Ga0207652_105196212 273
564 3300025922 Ga0207646_10002759 Ga0207646_1000275912 273
565 3300025924 Ga0207694_10053334 Ga0207694_100533342 273
566 3300025928 Ga0207700_10063112 Ga0207700_100631122 273
567 3300025928 Ga0207700_10202266 Ga0207700_102022662 273
568 3300025929 Ga0207664_10022929 Ga0207664_100229299 273
569 3300025929 Ga0207664_10033418 Ga0207664_100334182 273
570 3300025929 Ga0207664_10064763 Ga0207664_100647634 273
571 3300025929 Ga0207664_10075522 Ga0207664_100755222 273
572 3300025929 Ga0207664_10206426 Ga0207664_102064262 273
573 3300025929 Ga0207664_10432483 Ga0207664_104324832 273
574 3300025931 Ga0207644_10330097 Ga0207644_103300971 273
575 3300025939 Ga0207665_10002480 Ga0207665_100024809 273
576 3300025944 Ga0207661_10035899 Ga0207661_100358993 273
577 3300025944 Ga0207661_10054475 Ga0207661_100544752 273
578 3300025944 Ga0207661_10119774 Ga0207661_101197742 273
579 3300025944 Ga0207661_10327319 Ga0207661_103273192 273
580 3300025945 Ga0207679_10281969 Ga0207679_102819692 273
581 3300025981 Ga0207640_10237991 Ga0207640_102379912 273
582 3300026067 Ga0207678_10155539 Ga0207678_101555393 273
583 3300026116 Ga0207674_10039590 Ga0207674_100395903 273
584 3300028573 Ga0265334_10115386 Ga0265334_101153861 273
585 3300028666 Ga0265336_10002697 Ga0265336_1000269711 273
586 3300028800 Ga0265338_10002652 Ga0265338_1000265214 273
587 3300028800 Ga0265338_10009728 Ga0265338_1000972810 273
588 3300028800 Ga0265338_10037632 Ga0265338_100376322 273
589 3300029957 Ga0265324_10013637 Ga0265324_100136372 273
590 3300035112 Ga0373932_0049740 Ga0373932_0049740_41_865 273
591 3300035121 Ga0373960_0104992 Ga0373960_0104992_84_908 273
592 3300035724 Ga0373933_0300190 Ga0373933_0300190_127_951 273
593 3300035725 Ga0373947_0002612 Ga0373947_0002612_681_1505 273
594 3300035725 Ga0373947_0274774 Ga0373947_0274774_23_847 273
595 3300036401 Ga0373937_0001058 Ga0373937_0001058_10155_10991 273
596 3300036401 Ga0373937_0144659 Ga0373937_0144659_231_1055 273
597 3300036401 Ga0373937_0221016 Ga0373937_0221016_867_1691 273
598 3300037068 Ga0373925_0001472 Ga0373925_0001472_6758_7582 273
599 3300037312 Ga0395899_0068280 Ga0395899_0068280_1256_2119 273
600 3300037312 Ga0395899_0078497 Ga0395899_0078497_322_1143 273
601 3300037418 Ga0395900_0100880 Ga0395900_0100880_973_1794 273
602 3300037466 Ga0395898_0027064 Ga0395898_0027064_3190_4011 273
603 3300037471 Ga0395905_0233387 Ga0395905_0233387_249_1070 273
604 3300038443 Ga0395901_0463713 Ga0395901_0463713_46_867 273
605 3300041512 Ga0451853_0028795 Ga0451853_0028795_571_1392 273
606 3300041512 Ga0451853_0448887 Ga0451853_0448887_275_1096 273
607 3300044656 Ga0466969_0106952 Ga0466969_0106952_32_865 273
608 3300044684 Ga0466966_0001800 Ga0466966_0001800_117_938 273
609 3300044684 Ga0466966_0199662 Ga0466966_0199662_240_1064 273
610 3300044693 Ga0466961_0039712 Ga0466961_0039712_614_1447 273
611 3300044693 Ga0466961_0094056 Ga0466961_0094056_1012_1836 273
612 3300044693 Ga0466961_0117730 Ga0466961_0117730_674_1495 273
613 3300044694 Ga0466963_0001922 Ga0466963_0001922_2280_3101 273
614 3300044694 Ga0466963_0002423 Ga0466963_0002423_5683_6507 273
615 3300044694 Ga0466963_0003006 Ga0466963_0003006_8513_9337 273
616 3300044694 Ga0466963_0004777 Ga0466963_0004777_2474_3298 273
617 3300044694 Ga0466963_0007131 Ga0466963_0007131_687_1508 273
618 3300044694 Ga0466963_0007554 Ga0466963_0007554_3430_4254 273
619 3300044694 Ga0466963_0021168 Ga0466963_0021168_2710_3534 273
620 3300044694 Ga0466963_0142220 Ga0466963_0142220_581_1405 273
621 3300044694 Ga0466963_0177186 Ga0466963_0177186_299_1120 273
622 3300044694 Ga0466963_0302703 Ga0466963_0302703_195_1016 273
623 3300044706 Ga0466964_0009593 Ga0466964_0009593_808_1629 273
624 3300044719 Ga0466971_0002209 Ga0466971_0002209_6726_7547 273
625 3300044719 Ga0466971_0003143 Ga0466971_0003143_2675_3496 273
626 3300044719 Ga0466971_0004404 Ga0466971_0004404_2789_3613 273
627 3300044719 Ga0466971_0009192 Ga0466971_0009192_1376_2209 273
628 3300044719 Ga0466971_0096301 Ga0466971_0096301_343_1164 273
629 3300044735 Ga0466968_0000933 Ga0466968_0000933_6934_7758 273
630 3300044735 Ga0466968_0099363 Ga0466968_0099363_360_1184 273
631 3300044842 Ga0466957_0001545 Ga0466957_0001545_893_1714 273
632 3300044842 Ga0466957_0007794 Ga0466957_0007794_4779_5603 273
633 3300044842 Ga0466957_0014670 Ga0466957_0014670_2018_2851 273
634 3300044842 Ga0466957_0015797 Ga0466957_0015797_2123_2944 273
635 3300044842 Ga0466957_0017566 Ga0466957_0017566_496_1320 273
636 3300044842 Ga0466957_0021942 Ga0466957_0021942_1680_2504 273
637 3300044901 Ga0466960_0044515 Ga0466960_0044515_1259_2080 273
638 3300045049 Ga0466959_0003272 Ga0466959_0003272_1877_2701 273
639 3300045049 Ga0466959_0027998 Ga0466959_0027998_1748_2581 273
640 3300045049 Ga0466959_0061306 Ga0466959_0061306_180_1001 273
641 3300045836 Ga0466958_0001480 Ga0466958_0001480_3457_4281 273
642 3300045836 Ga0466958_0003857 Ga0466958_0003857_5279_6100 273
643 3300045836 Ga0466958_0006546 Ga0466958_0006546_4553_5377 273
644 3300045836 Ga0466958_0026124 Ga0466958_0026124_676_1497 273
645 3300045836 Ga0466958_0057280 Ga0466958_0057280_493_1317 273
646 3300045836 Ga0466958_0220497 Ga0466958_0220497_106_930 273
647 3300045976 Ga0466967_0002222 Ga0466967_0002222_2774_3595 273
648 3300045976 Ga0466967_0004404 Ga0466967_0004404_292_1113 273
649 3300045976 Ga0466967_0005380 Ga0466967_0005380_5762_6586 273
650 3300045976 Ga0466967_0009935 Ga0466967_0009935_792_1616 273
651 3300045976 Ga0466967_0012774 Ga0466967_0012774_4656_5477 273
652 3300045976 Ga0466967_0023267 Ga0466967_0023267_266_1090 273
653 3300045976 Ga0466967_0034228 Ga0466967_0034228_1767_2591 273
654 3300045976 Ga0466967_0035858 Ga0466967_0035858_2586_3407 273
655 3300045976 Ga0466967_0038238 Ga0466967_0038238_3022_3846 273
656 3300045976 Ga0466967_0041841 Ga0466967_0041841_1603_2424 273
657 3300045976 Ga0466967_0056140 Ga0466967_0056140_170_1003 273
658 3300045976 Ga0466967_0084154 Ga0466967_0084154_235_1056 273
659 3300045976 Ga0466967_0152844 Ga0466967_0152844_23_856 273
660 3300045976 Ga0466967_0201238 Ga0466967_0201238_322_1143 273
661 3300045976 Ga0466967_0318014 Ga0466967_0318014_148_972 273
662 3300045976 Ga0466967_0592512 Ga0466967_0592512_11_832 273
663 3300046454 Ga0495592_0000037 Ga0495592_0000037_10927_11763 273
664 3300046454 Ga0495592_0202158 Ga0495592_0202158_24_848 273
665 3300046455 Ga0495603_0008076 Ga0495603_0008076_3422_4246 273
666 3300046455 Ga0495603_0128854 Ga0495603_0128854_567_1391 273
667 3300046459 Ga0495629_0007625 Ga0495629_0007625_6936_7760 273
668 3300046459 Ga0495629_0152464 Ga0495629_0152464_245_1069 273
669 3300046459 Ga0495629_0180569 Ga0495629_0180569_44_868 273
670 3300046459 Ga0495629_0368940 Ga0495629_0368940_89_910 273
671 3300046461 Ga0495641_0000416 Ga0495641_0000416_30809_31633 273
672 3300046461 Ga0495641_0010174 Ga0495641_0010174_3170_3994 273
673 3300046461 Ga0495641_0039515 Ga0495641_0039515_58_879 273
674 3300046462 Ga0495651_0000038 Ga0495651_0000038_82746_83582 273
675 3300046462 Ga0495651_0010678 Ga0495651_0010678_1809_2633 273
676 3300046463 Ga0495653_0004001 Ga0495653_0004001_2547_3383 273
677 3300046463 Ga0495653_0047002 Ga0495653_0047002_925_1749 273
678 3300046473 Ga0495582_0040361 Ga0495582_0040361_759_1583 273
679 3300046476 Ga0495662_0005764 Ga0495662_0005764_3687_4511 273
680 3300046477 Ga0495664_0085758 Ga0495664_0085758_392_1216 273
681 3300046477 Ga0495664_0112023 Ga0495664_0112023_56_880 273
682 3300046501 Ga0495607_0044274 Ga0495607_0044274_103_927 273
683 3300046511 Ga0495608_0001032 Ga0495608_0001032_5196_6032 273
684 3300046511 Ga0495608_0009021 Ga0495608_0009021_692_1516 273
685 3300046514 Ga0495618_0001122 Ga0495618_0001122_12253_13089 273
686 3300046514 Ga0495618_0044961 Ga0495618_0044961_252_1073 273
687 3300046516 Ga0495628_0000025 Ga0495628_0000025_72014_72850 273
688 3300046516 Ga0495628_0209317 Ga0495628_0209317_259_1083 273
689 3300046517 Ga0495630_0034774 Ga0495630_0034774_1480_2304 273
690 3300046517 Ga0495630_0128412 Ga0495630_0128412_534_1355 273
691 3300046523 Ga0495644_0107404 Ga0495644_0107404_35_859 273
692 3300046529 Ga0495652_0000088 Ga0495652_0000088_82766_83602 273
693 3300046529 Ga0495652_0087245 Ga0495652_0087245_1572_2396 273
694 3300046531 Ga0495665_0010108 Ga0495665_0010108_111_935 273
695 3300046533 Ga0495640_0006444 Ga0495640_0006444_575_1399 273
696 3300046533 Ga0495640_0028068 Ga0495640_0028068_3076_3900 273
697 3300046533 Ga0495640_0206960 Ga0495640_0206960_214_1035 273
698 3300046536 Ga0495587_0000502 Ga0495587_0000502_15523_16359 273
699 3300046543 Ga0495645_0000024 Ga0495645_0000024_82741_83577 273
700 3300046543 Ga0495645_0111557 Ga0495645_0111557_329_1153 273
701 3300046559 Ga0495667_0007352 Ga0495667_0007352_1088_1912 273
702 3300046559 Ga0495667_0015780 Ga0495667_0015780_3858_4682 273
703 3300046615 Ga0495656_0019905 Ga0495656_0019905_165_989 273
704 3300046642 Ga0495634_0039729 Ga0495634_0039729_1875_2696 273
705 3300046642 Ga0495634_0085374 Ga0495634_0085374_837_1661 273
706 3300046675 Ga0495657_0054867 Ga0495657_0054867_660_1484 273
707 3300046678 Ga0495599_0000019 Ga0495599_0000019_68626_69462 273
708 3300046678 Ga0495599_0043511 Ga0495599_0043511_311_1135 273
709 3300046679 Ga0495623_0000032 Ga0495623_0000032_37677_38513 273
710 3300046680 Ga0495646_0001414 Ga0495646_0001414_768_1604 273
711 3300046680 Ga0495646_0038081 Ga0495646_0038081_473_1297 273
712 3300046680 Ga0495646_0056334 Ga0495646_0056334_605_1429 273
713 3300046681 Ga0495647_0029767 Ga0495647_0029767_579_1403 273
714 3300046683 Ga0495658_0000132 Ga0495658_0000132_10032_10856 273
715 3300046683 Ga0495658_0088067 Ga0495658_0088067_119_943 273
716 3300046689 Ga0495613_0012664 Ga0495613_0012664_5034_5858 273
717 3300046689 Ga0495613_0056129 Ga0495613_0056129_1014_1838 273
718 3300046690 Ga0495624_0010665 Ga0495624_0010665_3656_4480 273
719 3300046690 Ga0495624_0032034 Ga0495624_0032034_1145_1969 273
720 3300046690 Ga0495624_0036974 Ga0495624_0036974_1064_1888 273
721 3300046809 Ga0495600_0026892 Ga0495600_0026892_2090_2914 273
722 3300047315 Ga0495581_0107012 Ga0495581_0107012_619_1443 273
723 3300047317 Ga0495604_0000476 Ga0495604_0000476_19184_20020 273
724 3300047317 Ga0495604_0047344 Ga0495604_0047344_310_1134 273
725 3300047317 Ga0495604_0176530 Ga0495604_0176530_581_1405 273
726 3300047317 Ga0495604_0218164 Ga0495604_0218164_78_899 273
727 3300047319 Ga0495674_0134404 Ga0495674_0134404_83_907 273
728 3300047319 Ga0495674_0296552 Ga0495674_0296552_228_1052 273
729 3300047319 Ga0495674_0370221 Ga0495674_0370221_91_915 273
730 3300047319 Ga0495674_0535767 Ga0495674_0535767_29_853 273
731 3300047321 Ga0495676_0216680 Ga0495676_0216680_382_1206 273
732 3300047322 Ga0495680_0023823 Ga0495680_0023823_842_1678 273
733 3300047322 Ga0495680_0026108 Ga0495680_0026108_198_1022 273
734 3300047322 Ga0495680_0028649 Ga0495680_0028649_1436_2260 273
735 3300047322 Ga0495680_0077967 Ga0495680_0077967_989_1813 273
736 3300047444 Ga0495675_0000007 Ga0495675_0000007_79059_79895 273
737 3300047471 Ga0495684_0005676 Ga0495684_0005676_1049_1873 273
738 3300047673 Ga0495593_0009475 Ga0495593_0009475_381_1205 273
739 3300048088 Ga0495602_0000246 Ga0495602_0000246_36358_37194 273
740 3300048088 Ga0495602_0146820 Ga0495602_0146820_694_1518 273
741 3300048089 Ga0495614_0087227 Ga0495614_0087227_306_1130 273
742 3300048903 Ga0496100_0036846 Ga0496100_0036846_2071_2895 273
743 3300048904 Ga0496101_0040024 Ga0496101_0040024_1189_2013 273
744 3300048904 Ga0496101_0120919 Ga0496101_0120919_998_1819 273
745 3300048904 Ga0496101_0155773 Ga0496101_0155773_19_843 273
746 3300048905 Ga0496102_0035747 Ga0496102_0035747_3456_4280 273
747 3300048905 Ga0496102_0085973 Ga0496102_0085973_486_1310 273
748 3300048906 Ga0496103_0022071 Ga0496103_0022071_2277_3101 273
749 3300048906 Ga0496103_0052753 Ga0496103_0052753_1638_2462 273
750 3300048907 Ga0496104_0068829 Ga0496104_0068829_1170_1994 273
751 3300048907 Ga0496104_0488388 Ga0496104_0488388_143_964 273
752 3300048908 Ga0496105_0159570 Ga0496105_0159570_629_1453 273
753 3300048909 Ga0496106_0001780 Ga0496106_0001780_2299_3123 273
754 3300048909 Ga0496106_0484821 Ga0496106_0484821_111_935 273
755 3300048910 Ga0496107_0018842 Ga0496107_0018842_2373_3197 273
756 3300048911 Ga0496108_0075303 Ga0496108_0075303_1704_2528 273
757 3300048911 Ga0496108_0225160 Ga0496108_0225160_620_1441 273
758 3300048912 Ga0496109_0059462 Ga0496109_0059462_119_940 273
759 3300048912 Ga0496109_0435368 Ga0496109_0435368_98_922 273
760 3300048913 Ga0496110_0007895 Ga0496110_0007895_1593_2417 273
761 3300048914 Ga0496111_0060053 Ga0496111_0060053_153_977 273
762 3300048915 Ga0496112_0002855 Ga0496112_0002855_13037_13861 273
763 3300048915 Ga0496112_0085883 Ga0496112_0085883_719_1543 273
764 3300048915 Ga0496112_0092743 Ga0496112_0092743_404_1228 273
765 3300048915 Ga0496112_0150063 Ga0496112_0150063_88_912 273
766 3300048915 Ga0496112_0409959 Ga0496112_0409959_82_903 273
767 3300048916 Ga0496113_0016018 Ga0496113_0016018_2497_3321 273
768 3300048916 Ga0496113_0221693 Ga0496113_0221693_461_1285 273
769 3300048917 Ga0496114_0024082 Ga0496114_0024082_2045_2869 273
770 3300048917 Ga0496114_0025295 Ga0496114_0025295_2940_3764 273
771 3300048917 Ga0496114_0069187 Ga0496114_0069187_2115_2939 273
772 3300048918 Ga0496115_0016264 Ga0496115_0016264_2612_3436 273
773 3300048918 Ga0496115_0050995 Ga0496115_0050995_194_1018 273
774 3300049583 Ga0501067_0014954 Ga0501067_0014954_2414_3235 273
775 3300049583 Ga0501067_0102326 Ga0501067_0102326_459_1280 273
776 3300049585 Ga0501069_0000573 Ga0501069_0000573_772_1593 273
777 3300049585 Ga0501069_0039951 Ga0501069_0039951_1497_2318 273
778 3300049586 Ga0501070_0126192 Ga0501070_0126192_664_1485 273
779 3300049586 Ga0501070_0365812 Ga0501070_0365812_203_1024 273
780 3300050511 nmdc:mga08y16_616884_c1 nmdc:mga08y16_616884_c1_64_888 273
781 3300050512 nmdc:mga0n895_11132_c1 nmdc:mga0n895_11132_c1_960_1784 273
782 3300050513 nmdc:mga0rr50_209551_c1 nmdc:mga0rr50_209551_c1_601_1425 273
783 3300050514 nmdc:mga08x19_301314_c1 nmdc:mga08x19_301314_c1_31_852 273
784 3300053077 Ga0495601_0000325 Ga0495601_0000325_10921_11757 273
785 3300053077 Ga0495601_0034317 Ga0495601_0034317_1689_2510 273
786 3300053077 Ga0495601_0110580 Ga0495601_0110580_301_1125 273
787 3300053078 Ga0495612_0021067 Ga0495612_0021067_1622_2458 273
788 3300053084 Ga0495595_0010915 Ga0495595_0010915_1887_2711 273
789 3300053084 Ga0495595_0020888 Ga0495595_0020888_1866_2690 273
790 3300053085 Ga0495619_0001347 Ga0495619_0001347_13552_14388 273
791 3300053085 Ga0495619_0002519 Ga0495619_0002519_7109_7933 273
792 3300053085 Ga0495619_0003695 Ga0495619_0003695_3478_4302 273
793 3300059424 Ga0590075_035830 Ga0590075_035830_190_1026 273
794 3300061719 Ga0466962_0001120 Ga0466962_0001120_10354_11178 273
795 3300061719 Ga0466962_0005689 Ga0466962_0005689_2153_2986 273
796 3300061719 Ga0466962_0006268 Ga0466962_0006268_3875_4696 273
797 3300061719 Ga0466962_0008095 Ga0466962_0008095_1101_1922 273
798 3300061734 Ga0530510_0049636 Ga0530510_0049636_55_876 273
799 3300005468 Ga0070707_100102940 Ga0070707_1001029403 274
800 3300028577 Ga0265318_10008316 Ga0265318_100083162 274
801 3300028653 Ga0265323_10016483 Ga0265323_100164832 274
802 3300028800 Ga0265338_10000938 Ga0265338_1000093824 274
803 3300031238 Ga0265332_10007652 Ga0265332_100076525 274
804 3300031239 Ga0265328_10006148 Ga0265328_100061486 274
805 3300031241 Ga0265325_10001447 Ga0265325_1000144721 274
806 3300031247 Ga0265340_10015777 Ga0265340_100157772 274
807 3300031250 Ga0265331_10016679 Ga0265331_100166794 274
808 3300031251 Ga0265327_10011377 Ga0265327_100113779 274
809 3300031251 Ga0265327_10018398 Ga0265327_100183982 274
810 3300031344 Ga0265316_10027256 Ga0265316_100272564 274
811 3300031548 Ga0307408_100454148 Ga0307408_1004541482 274
812 3300031595 Ga0265313_10026983 Ga0265313_100269832 274
813 3300031711 Ga0265314_10034822 Ga0265314_100348222 274
814 3300031712 Ga0265342_10017813 Ga0265342_100178134 274
815 3300031824 Ga0307413_10331956 Ga0307413_103319562 274
816 3300032002 Ga0307416_100105236 Ga0307416_1001052362 274
817 3300032002 Ga0307416_100346976 Ga0307416_1003469762 274
818 3300032126 Ga0307415_100015496 Ga0307415_1000154965 274
819 3300032126 Ga0307415_100153191 Ga0307415_1001531912 274
820 3300035119 Ga0373956_0006321 Ga0373956_0006321_3579_4406 274
821 3300035120 Ga0373957_0076405 Ga0373957_0076405_177_1004 274
822 3300035172 Ga0373955_0081391 Ga0373955_0081391_841_1668 274
823 3300035410 Ga0373924_0036185 Ga0373924_0036185_747_1574 274
824 3300035724 Ga0373933_0219807 Ga0373933_0219807_245_1072 274
825 3300036401 Ga0373937_0052542 Ga0373937_0052542_681_1508 274
826 3300037418 Ga0395900_0284523 Ga0395900_0284523_541_1365 274
827 3300037471 Ga0395905_0241702 Ga0395905_0241702_486_1310 274
828 3300038443 Ga0395901_0021597 Ga0395901_0021597_3379_4203 274
829 3300044719 Ga0466971_0071656 Ga0466971_0071656_427_1257 274
830 3300046454 Ga0495592_0162931 Ga0495592_0162931_73_897 274
831 3300046462 Ga0495651_0180915 Ga0495651_0180915_86_913 274
832 3300046491 Ga0495584_0197432 Ga0495584_0197432_121_945 274
833 3300046511 Ga0495608_0004248 Ga0495608_0004248_1251_2078 274
834 3300046516 Ga0495628_0317919 Ga0495628_0317919_173_997 274
835 3300046529 Ga0495652_0161283 Ga0495652_0161283_273_1115 274
836 3300046559 Ga0495667_0028876 Ga0495667_0028876_561_1388 274
837 3300046642 Ga0495634_0070345 Ga0495634_0070345_945_1772 274
838 3300046663 Ga0495635_0152181 Ga0495635_0152181_351_1178 274
839 3300046675 Ga0495657_0033173 Ga0495657_0033173_2405_3232 274
840 3300046691 Ga0495670_0143907 Ga0495670_0143907_278_1102 274
841 3300046809 Ga0495600_0296855 Ga0495600_0296855_98_925 274
842 3300047322 Ga0495680_0012102 Ga0495680_0012102_4655_5482 274
843 3300047471 Ga0495684_0030753 Ga0495684_0030753_1002_1829 274
844 3300048913 Ga0496110_0145308 Ga0496110_0145308_188_1012 274
845 3300048914 Ga0496111_0054026 Ga0496111_0054026_1338_2162 274
846 3300048915 Ga0496112_0032584 Ga0496112_0032584_1058_1882 274
847 3300053084 Ga0495595_0008898 Ga0495595_0008898_2060_2887 274
848 3300053085 Ga0495619_0059354 Ga0495619_0059354_1461_2288 274
849 3300061719 Ga0466962_0009007 Ga0466962_0009007_1918_2748 274
850 3300005329 Ga0070683_100157563 Ga0070683_1001575632 275
851 3300005338 Ga0068868_100277079 Ga0068868_1002770792 275
852 3300005365 Ga0070688_100185489 Ga0070688_1001854892 275
853 3300005543 Ga0070672_100498876 Ga0070672_1004988762 275
854 3300005577 Ga0068857_100005679 Ga0068857_1000056795 275
855 3300006844 Ga0075428_100049756 Ga0075428_1000497566 275
856 3300006847 Ga0075431_100079236 Ga0075431_1000792362 275
857 3300009148 Ga0105243_10492931 Ga0105243_104929312 275
858 3300009176 Ga0105242_10170449 Ga0105242_101704493 275
859 3300010375 Ga0105239_10097591 Ga0105239_100975914 275
860 3300025935 Ga0207709_10249098 Ga0207709_102490982 275
861 3300025944 Ga0207661_10105793 Ga0207661_101057933 275
862 3300026023 Ga0207677_10176894 Ga0207677_101768942 275
863 3300026116 Ga0207674_10002109 Ga0207674_1000210919 275
864 3300037418 Ga0395900_0071992 Ga0395900_0071992_2218_3045 275
865 3300037466 Ga0395898_0101930 Ga0395898_0101930_925_1752 275
866 3300037471 Ga0395905_0163130 Ga0395905_0163130_476_1303 275
867 3300038443 Ga0395901_0090202 Ga0395901_0090202_240_1067 275
868 3300042461 Ga0439460_0069007 Ga0439460_0069007_11_862 275
869 3300046474 Ga0495605_0027017 Ga0495605_0027017_2112_2939 275
870 3300046525 Ga0495663_0021550 Ga0495663_0021550_980_1807 275
871 3300046542 Ga0495597_0118880 Ga0495597_0118880_35_862 275
872 3300050507 nmdc:mga05p37_439083_c1 nmdc:mga05p37_439083_c1_29_856 275
873 3300050509 nmdc:mga0qj67_189845_c1 nmdc:mga0qj67_189845_c1_654_1481 275
874 3300005341 Ga0070691_10084204 Ga0070691_100842042 276
875 3300005356 Ga0070674_100029808 Ga0070674_1000298086 276
876 3300005366 Ga0070659_100421511 Ga0070659_1004215112 276
877 3300005457 Ga0070662_100065973 Ga0070662_1000659732 276
878 3300005563 Ga0068855_100089423 Ga0068855_1000894232 276
879 3300009098 Ga0105245_10006942 Ga0105245_1000694212 276
880 3300010375 Ga0105239_10126649 Ga0105239_101266492 276
881 3300013307 Ga0157372_10056077 Ga0157372_100560776 276
882 3300025908 Ga0207643_10074879 Ga0207643_100748793 276
883 3300025927 Ga0207687_10308984 Ga0207687_103089842 276
884 3300025932 Ga0207690_10351362 Ga0207690_103513622 276
885 3300025933 Ga0207706_10010931 Ga0207706_100109312 276
886 3300025949 Ga0207667_10074302 Ga0207667_100743022 276
887 3300026023 Ga0207677_10163223 Ga0207677_101632232 276
888 3300026089 Ga0207648_10144127 Ga0207648_101441272 276
889 3300032002 Ga0307416_100208763 Ga0307416_1002087632 276
890 3300005436 Ga0070713_100414914 Ga0070713_1004149142 277
891 3300006173 Ga0070716_100027171 Ga0070716_1000271712 277
892 3300025928 Ga0207700_10000021 Ga0207700_10000021138 277
893 3300025939 Ga0207665_10057727 Ga0207665_100577272 277
894 3300037466 Ga0395898_0058847 Ga0395898_0058847_462_1295 277
895 3300037471 Ga0395905_0062102 Ga0395905_0062102_2601_3440 277
896 3300038443 Ga0395901_0110740 Ga0395901_0110740_946_1785 277
897 3300041408 Ga0439453_0007831 Ga0439453_0007831_248_1081 277
898 3300041997 Ga0439431_0084904 Ga0439431_0084904_10_843 277
899 3300042156 Ga0439446_0006147 Ga0439446_0006147_1374_2207 277
900 3300046491 Ga0495584_0113088 Ga0495584_0113088_165_1001 277
901 3300049591 Ga0501075_0093399 Ga0501075_0093399_969_1802 277
902 3300005336 Ga0070680_100464070 Ga0070680_1004640701 278
903 3300005337 Ga0070682_100011854 Ga0070682_1000118542 278
904 3300005338 Ga0068868_100035378 Ga0068868_1000353782 278
905 3300005339 Ga0070660_100047136 Ga0070660_1000471364 278
906 3300005341 Ga0070691_10031025 Ga0070691_100310252 278
907 3300005345 Ga0070692_10006261 Ga0070692_100062614 278
908 3300005356 Ga0070674_100024296 Ga0070674_1000242967 278
909 3300005437 Ga0070710_10003032 Ga0070710_100030329 278
910 3300005439 Ga0070711_100284069 Ga0070711_1002840692 278
911 3300005440 Ga0070705_100110435 Ga0070705_1001104352 278
912 3300005441 Ga0070700_100145379 Ga0070700_1001453792 278
913 3300005444 Ga0070694_100141414 Ga0070694_1001414142 278
914 3300005445 Ga0070708_100419327 Ga0070708_1004193272 278
915 3300005456 Ga0070678_100144639 Ga0070678_1001446392 278
916 3300005457 Ga0070662_100070291 Ga0070662_1000702912 278
917 3300005468 Ga0070707_100654034 Ga0070707_1006540342 278
918 3300005471 Ga0070698_100006283 Ga0070698_1000062835 278
919 3300005518 Ga0070699_100025094 Ga0070699_1000250945 278
920 3300005530 Ga0070679_100023975 Ga0070679_1000239752 278
921 3300005535 Ga0070684_100118935 Ga0070684_1001189353 278
922 3300005539 Ga0068853_100037931 Ga0068853_1000379312 278
923 3300005544 Ga0070686_100005989 Ga0070686_1000059895 278
924 3300005544 Ga0070686_100013470 Ga0070686_1000134707 278
925 3300005545 Ga0070695_100024775 Ga0070695_1000247756 278
926 3300005547 Ga0070693_100010891 Ga0070693_1000108912 278
927 3300005549 Ga0070704_100015090 Ga0070704_1000150907 278
928 3300005563 Ga0068855_100168455 Ga0068855_1001684552 278
929 3300005578 Ga0068854_100078490 Ga0068854_1000784902 278
930 3300005578 Ga0068854_100208827 Ga0068854_1002088272 278
931 3300005614 Ga0068856_100070677 Ga0068856_1000706773 278
932 3300005615 Ga0070702_100005135 Ga0070702_1000051355 278
933 3300005615 Ga0070702_100072015 Ga0070702_1000720151 278
934 3300005844 Ga0068862_100095167 Ga0068862_1000951672 278
935 3300005981 Ga0081538_10054384 Ga0081538_100543843 278
936 3300005983 Ga0081540_1005963 Ga0081540_10059638 278
937 3300006028 Ga0070717_10079778 Ga0070717_100797784 278
938 3300006058 Ga0075432_10045641 Ga0075432_100456412 278
939 3300006163 Ga0070715_10007610 Ga0070715_100076102 278
940 3300006175 Ga0070712_100219849 Ga0070712_1002198492 278
941 3300006237 Ga0097621_100010449 Ga0097621_1000104494 278
942 3300006852 Ga0075433_10004067 Ga0075433_1000406713 278
943 3300006871 Ga0075434_100003953 Ga0075434_1000039538 278
944 3300006881 Ga0068865_100011967 Ga0068865_1000119679 278
945 3300006914 Ga0075436_100112873 Ga0075436_1001128732 278
946 3300007076 Ga0075435_100000846 Ga0075435_10000084622 278
947 3300009098 Ga0105245_10104935 Ga0105245_101049352 278
948 3300009148 Ga0105243_10033962 Ga0105243_100339622 278
949 3300009176 Ga0105242_10031463 Ga0105242_100314632 278
950 3300009545 Ga0105237_10638780 Ga0105237_106387802 278
951 3300009553 Ga0105249_10114856 Ga0105249_101148564 278
952 3300013306 Ga0163162_10081296 Ga0163162_100812965 278
953 3300013307 Ga0157372_10057077 Ga0157372_100570772 278
954 3300013308 Ga0157375_10076735 Ga0157375_100767353 278
955 3300013308 Ga0157375_10137020 Ga0157375_101370202 278
956 3300014326 Ga0157380_10019505 Ga0157380_100195052 278
957 3300025898 Ga0207692_10296642 Ga0207692_102966421 278
958 3300025899 Ga0207642_10032504 Ga0207642_100325042 278
959 3300025912 Ga0207707_10116100 Ga0207707_101161003 278
960 3300025915 Ga0207693_10012860 Ga0207693_100128605 278
961 3300025915 Ga0207693_10014992 Ga0207693_100149924 278
962 3300025916 Ga0207663_10073154 Ga0207663_100731542 278
963 3300025917 Ga0207660_10163938 Ga0207660_101639383 278
964 3300025918 Ga0207662_10106396 Ga0207662_101063962 278
965 3300025919 Ga0207657_10018582 Ga0207657_100185822 278
966 3300025921 Ga0207652_10160484 Ga0207652_101604842 278
967 3300025921 Ga0207652_10419058 Ga0207652_104190582 278
968 3300025921 Ga0207652_10442799 Ga0207652_104427992 278
969 3300025922 Ga0207646_10537521 Ga0207646_105375212 278
970 3300025927 Ga0207687_10078348 Ga0207687_100783482 278
971 3300025927 Ga0207687_10084579 Ga0207687_100845792 278
972 3300025928 Ga0207700_10035208 Ga0207700_100352083 278
973 3300025929 Ga0207664_10049033 Ga0207664_100490332 278
974 3300025931 Ga0207644_10030639 Ga0207644_100306392 278
975 3300025932 Ga0207690_10183988 Ga0207690_101839882 278
976 3300025933 Ga0207706_10006148 Ga0207706_100061486 278
977 3300025935 Ga0207709_10029437 Ga0207709_100294375 278
978 3300025939 Ga0207665_10002447 Ga0207665_100024477 278
979 3300025940 Ga0207691_10239921 Ga0207691_102399212 278
980 3300025944 Ga0207661_10071454 Ga0207661_100714542 278
981 3300025949 Ga0207667_10065935 Ga0207667_100659357 278
982 3300025981 Ga0207640_10031137 Ga0207640_100311374 278
983 3300025981 Ga0207640_10281288 Ga0207640_102812882 278
984 3300026023 Ga0207677_10288501 Ga0207677_102885012 278
985 3300026041 Ga0207639_10170780 Ga0207639_101707802 278
986 3300026075 Ga0207708_10013341 Ga0207708_100133412 278
987 3300026078 Ga0207702_10010463 Ga0207702_100104632 278
988 3300026089 Ga0207648_10007972 Ga0207648_100079724 278
989 3300026095 Ga0207676_10077506 Ga0207676_100775062 278
990 3300026118 Ga0207675_100042986 Ga0207675_1000429866 278
991 3300026118 Ga0207675_100137132 Ga0207675_1001371323 278
992 3300026121 Ga0207683_10004201 Ga0207683_1000420117 278
993 3300027907 Ga0207428_10012688 Ga0207428_100126882 278
994 3300031903 Ga0307407_10104733 Ga0307407_101047332 278
995 3300032002 Ga0307416_100119096 Ga0307416_1001190962 278
996 3300032126 Ga0307415_100113977 Ga0307415_1001139772 278
997 3300034818 Ga0373950_0006092 Ga0373950_0006092_884_1720 278
998 3300035091 Ga0373951_0031438 Ga0373951_0031438_86_922 278
999 3300035092 Ga0373952_0041028 Ga0373952_0041028_172_1008 278
1000 3300035115 Ga0373941_0006525 Ga0373941_0006525_1299_2135 278
1001 3300035121 Ga0373960_0044358 Ga0373960_0044358_136_972 278
1002 3300035170 Ga0373943_0003783 Ga0373943_0003783_1005_1841 278
1003 3300035171 Ga0373946_0007996 Ga0373946_0007996_2614_3450 278
1004 3300035691 Ga0373931_0042229 Ga0373931_0042229_684_1520 278
1005 3300035692 Ga0373935_0158994 Ga0373935_0158994_503_1339 278
1006 3300035695 Ga0373927_0156794 Ga0373927_0156794_318_1154 278
1007 3300035725 Ga0373947_0116119 Ga0373947_0116119_35_877 278
1008 3300035725 Ga0373947_0131943 Ga0373947_0131943_294_1130 278
1009 3300037068 Ga0373925_0010538 Ga0373925_0010538_3462_4298 278
1010 3300037312 Ga0395899_0041718 Ga0395899_0041718_669_1511 278
1011 3300037312 Ga0395899_0286360 Ga0395899_0286360_255_1094 278
1012 3300037466 Ga0395898_0064862 Ga0395898_0064862_833_1669 278
1013 3300037471 Ga0395905_0002224 Ga0395905_0002224_8881_9723 278
1014 3300037471 Ga0395905_0021582 Ga0395905_0021582_4599_5435 278
1015 3300038443 Ga0395901_0008564 Ga0395901_0008564_3023_3865 278
1016 3300038443 Ga0395901_0088887 Ga0395901_0088887_2350_3189 278
1017 3300038443 Ga0395901_0260762 Ga0395901_0260762_322_1161 278
1018 3300038443 Ga0395901_0292233 Ga0395901_0292233_842_1678 278
1019 3300042005 Ga0439448_0036170 Ga0439448_0036170_410_1246 278
1020 3300046455 Ga0495603_0001374 Ga0495603_0001374_2136_2972 278
1021 3300046461 Ga0495641_0001029 Ga0495641_0001029_12415_13251 278
1022 3300046472 Ga0495580_0040690 Ga0495580_0040690_538_1374 278
1023 3300046473 Ga0495582_0004292 Ga0495582_0004292_5107_5943 278
1024 3300046499 Ga0495594_0001293 Ga0495594_0001293_10497_11333 278
1025 3300046526 Ga0495666_0023487 Ga0495666_0023487_1624_2460 278
1026 3300046674 Ga0495588_0000417 Ga0495588_0000417_1722_2558 278
1027 3300046794 Ga0495589_0126159 Ga0495589_0126159_140_985 278
1028 3300047315 Ga0495581_0089882 Ga0495581_0089882_144_986 278
1029 3300047315 Ga0495581_0145151 Ga0495581_0145151_200_1042 278
1030 3300047321 Ga0495676_0005803 Ga0495676_0005803_7418_8254 278
1031 3300047321 Ga0495676_0094046 Ga0495676_0094046_341_1183 278
1032 3300048903 Ga0496100_0293843 Ga0496100_0293843_330_1166 278
1033 3300048904 Ga0496101_0161455 Ga0496101_0161455_32_868 278
1034 3300048905 Ga0496102_0057794 Ga0496102_0057794_2045_2881 278
1035 3300048905 Ga0496102_0186634 Ga0496102_0186634_479_1315 278
1036 3300048905 Ga0496102_0258974 Ga0496102_0258974_768_1604 278
1037 3300048906 Ga0496103_0059054 Ga0496103_0059054_718_1554 278
1038 3300048906 Ga0496103_0241236 Ga0496103_0241236_258_1094 278
1039 3300048907 Ga0496104_0000904 Ga0496104_0000904_6131_6967 278
1040 3300048908 Ga0496105_0000042 Ga0496105_0000042_58524_59360 278
1041 3300048908 Ga0496105_0019052 Ga0496105_0019052_4076_4912 278
1042 3300048908 Ga0496105_0023510 Ga0496105_0023510_980_1816 278
1043 3300048909 Ga0496106_0329100 Ga0496106_0329100_379_1215 278
1044 3300048910 Ga0496107_0003430 Ga0496107_0003430_3162_3998 278
1045 3300048910 Ga0496107_0403361 Ga0496107_0403361_116_952 278
1046 3300048911 Ga0496108_0002246 Ga0496108_0002246_1798_2634 278
1047 3300048912 Ga0496109_0002961 Ga0496109_0002961_10158_10994 278
1048 3300048912 Ga0496109_0010365 Ga0496109_0010365_386_1222 278
1049 3300048913 Ga0496110_0001458 Ga0496110_0001458_4272_5108 278
1050 3300048914 Ga0496111_0002886 Ga0496111_0002886_8473_9309 278
1051 3300048914 Ga0496111_0015249 Ga0496111_0015249_201_1037 278
1052 3300048914 Ga0496111_0037207 Ga0496111_0037207_1472_2308 278
1053 3300048915 Ga0496112_0000894 Ga0496112_0000894_20045_20881 278
1054 3300048915 Ga0496112_0001403 Ga0496112_0001403_7142_7978 278
1055 3300048916 Ga0496113_0000110 Ga0496113_0000110_21835_22671 278
1056 3300048916 Ga0496113_0003480 Ga0496113_0003480_3295_4131 278
1057 3300048916 Ga0496113_0035153 Ga0496113_0035153_93_941 278
1058 3300048917 Ga0496114_0111998 Ga0496114_0111998_1136_1972 278
1059 3300048917 Ga0496114_0242469 Ga0496114_0242469_210_1046 278
1060 3300048918 Ga0496115_0058999 Ga0496115_0058999_1126_1962 278
1061 3300048918 Ga0496115_0147718 Ga0496115_0147718_831_1667 278
1062 3300048918 Ga0496115_0458268 Ga0496115_0458268_93_929 278
1063 3300050510 nmdc:mga06r32_120955_c1 nmdc:mga06r32_120955_c1_1060_1896 278
1064 3300050511 nmdc:mga08y16_37351_c1 nmdc:mga08y16_37351_c1_1594_2430 278
1065 3300050512 nmdc:mga0n895_144981_c1 nmdc:mga0n895_144981_c1_1137_1976 278
1066 3300050512 nmdc:mga0n895_26848_c1 nmdc:mga0n895_26848_c1_3341_4177 278
1067 3300050515 nmdc:mga0a205_23649_c1 nmdc:mga0a205_23649_c1_2393_3232 278
1068 3300050515 nmdc:mga0a205_60731_c1 nmdc:mga0a205_60731_c1_1222_2058 278
1069 3300059426 Ga0590077_003120 Ga0590077_003120_143_979 278
1070 3300061734 Ga0530510_0177306 Ga0530510_0177306_554_1390 278
1071 3300005338 Ga0068868_100429318 Ga0068868_1004293182 279
1072 3300005347 Ga0070668_100021194 Ga0070668_1000211943 279
1073 3300005347 Ga0070668_100069949 Ga0070668_1000699492 279
1074 3300005356 Ga0070674_100202225 Ga0070674_1002022252 279
1075 3300005406 Ga0070703_10001464 Ga0070703_100014649 279
1076 3300005434 Ga0070709_10187016 Ga0070709_101870161 279
1077 3300005434 Ga0070709_10373177 Ga0070709_103731771 279
1078 3300005436 Ga0070713_100053225 Ga0070713_1000532252 279
1079 3300005439 Ga0070711_100010560 Ga0070711_1000105605 279
1080 3300005439 Ga0070711_100027343 Ga0070711_1000273433 279
1081 3300005440 Ga0070705_100028011 Ga0070705_1000280113 279
1082 3300005440 Ga0070705_100126465 Ga0070705_1001264652 279
1083 3300005444 Ga0070694_100029866 Ga0070694_1000298663 279
1084 3300005444 Ga0070694_100230906 Ga0070694_1002309062 279
1085 3300005445 Ga0070708_100012205 Ga0070708_1000122056 279
1086 3300005445 Ga0070708_100110617 Ga0070708_1001106172 279
1087 3300005445 Ga0070708_100310431 Ga0070708_1003104312 279
1088 3300005459 Ga0068867_100054578 Ga0068867_1000545783 279
1089 3300005467 Ga0070706_100211186 Ga0070706_1002111862 279
1090 3300005467 Ga0070706_100415060 Ga0070706_1004150601 279
1091 3300005468 Ga0070707_100035106 Ga0070707_1000351062 279
1092 3300005471 Ga0070698_100029260 Ga0070698_1000292602 279
1093 3300005471 Ga0070698_100055630 Ga0070698_1000556303 279
1094 3300005471 Ga0070698_100172987 Ga0070698_1001729872 279
1095 3300005518 Ga0070699_100188713 Ga0070699_1001887132 279
1096 3300005536 Ga0070697_100224109 Ga0070697_1002241092 279
1097 3300005546 Ga0070696_100204457 Ga0070696_1002044572 279
1098 3300005547 Ga0070693_100200753 Ga0070693_1002007532 279
1099 3300005549 Ga0070704_100019791 Ga0070704_1000197911 279
1100 3300005549 Ga0070704_100040643 Ga0070704_1000406432 279
1101 3300005549 Ga0070704_100089418 Ga0070704_1000894183 279
1102 3300005563 Ga0068855_100028306 Ga0068855_1000283064 279
1103 3300005718 Ga0068866_10149512 Ga0068866_101495122 279
1104 3300005719 Ga0068861_100037148 Ga0068861_1000371483 279
1105 3300005719 Ga0068861_100396511 Ga0068861_1003965111 279
1106 3300005985 Ga0081539_10022106 Ga0081539_100221064 279
1107 3300006058 Ga0075432_10093147 Ga0075432_100931471 279
1108 3300006163 Ga0070715_10108555 Ga0070715_101085552 279
1109 3300006173 Ga0070716_100037919 Ga0070716_1000379192 279
1110 3300006173 Ga0070716_100086721 Ga0070716_1000867212 279
1111 3300006175 Ga0070712_100004222 Ga0070712_1000042224 279
1112 3300006175 Ga0070712_100083186 Ga0070712_1000831863 279
1113 3300006237 Ga0097621_100133126 Ga0097621_1001331262 279
1114 3300006847 Ga0075431_100317046 Ga0075431_1003170462 279
1115 3300006852 Ga0075433_10007343 Ga0075433_100073437 279
1116 3300006871 Ga0075434_100020088 Ga0075434_1000200882 279
1117 3300006871 Ga0075434_100324360 Ga0075434_1003243602 279
1118 3300006881 Ga0068865_100138231 Ga0068865_1001382313 279
1119 3300006914 Ga0075436_100031493 Ga0075436_1000314932 279
1120 3300009094 Ga0111539_10059669 Ga0111539_100596692 279
1121 3300009094 Ga0111539_10061035 Ga0111539_100610355 279
1122 3300009094 Ga0111539_10259743 Ga0111539_102597433 279
1123 3300009098 Ga0105245_10116464 Ga0105245_101164643 279
1124 3300009147 Ga0114129_10013068 Ga0114129_1001306816 279
1125 3300009147 Ga0114129_10032758 Ga0114129_100327586 279
1126 3300009147 Ga0114129_10121702 Ga0114129_101217022 279
1127 3300009147 Ga0114129_10269953 Ga0114129_102699533 279
1128 3300009148 Ga0105243_10184983 Ga0105243_101849831 279
1129 3300010375 Ga0105239_10075392 Ga0105239_100753927 279
1130 3300013306 Ga0163162_10106270 Ga0163162_101062702 279
1131 3300014326 Ga0157380_10613347 Ga0157380_106133472 279
1132 3300017792 Ga0163161_10265040 Ga0163161_102650402 279
1133 3300025885 Ga0207653_10008551 Ga0207653_100085512 279
1134 3300025898 Ga0207692_10184436 Ga0207692_101844362 279
1135 3300025901 Ga0207688_10029415 Ga0207688_100294153 279
1136 3300025906 Ga0207699_10064773 Ga0207699_100647732 279
1137 3300025906 Ga0207699_10213472 Ga0207699_102134722 279
1138 3300025906 Ga0207699_10304760 Ga0207699_103047602 279
1139 3300025910 Ga0207684_10035784 Ga0207684_100357843 279
1140 3300025910 Ga0207684_10406599 Ga0207684_104065991 279
1141 3300025915 Ga0207693_10000904 Ga0207693_100009046 279
1142 3300025915 Ga0207693_10034467 Ga0207693_100344672 279
1143 3300025915 Ga0207693_10088304 Ga0207693_100883042 279
1144 3300025916 Ga0207663_10039347 Ga0207663_100393471 279
1145 3300025927 Ga0207687_10031647 Ga0207687_100316472 279
1146 3300025928 Ga0207700_10357119 Ga0207700_103571192 279
1147 3300025928 Ga0207700_10602768 Ga0207700_106027681 279
1148 3300025929 Ga0207664_10141818 Ga0207664_101418182 279
1149 3300025933 Ga0207706_10034995 Ga0207706_100349952 279
1150 3300025935 Ga0207709_10088901 Ga0207709_100889012 279
1151 3300025935 Ga0207709_10170720 Ga0207709_101707202 279
1152 3300025938 Ga0207704_10125391 Ga0207704_101253913 279
1153 3300025939 Ga0207665_10026935 Ga0207665_100269353 279
1154 3300025939 Ga0207665_10066517 Ga0207665_100665173 279
1155 3300025949 Ga0207667_10072793 Ga0207667_100727934 279
1156 3300025961 Ga0207712_10096753 Ga0207712_100967533 279
1157 3300025972 Ga0207668_10011321 Ga0207668_100113214 279
1158 3300025972 Ga0207668_10081336 Ga0207668_100813363 279
1159 3300026078 Ga0207702_10087009 Ga0207702_100870094 279
1160 3300026089 Ga0207648_10092258 Ga0207648_100922582 279
1161 3300026118 Ga0207675_100002893 Ga0207675_10000289315 279
1162 3300026118 Ga0207675_100009724 Ga0207675_1000097242 279
1163 3300026121 Ga0207683_10010677 Ga0207683_100106776 279
1164 3300027907 Ga0207428_10424479 Ga0207428_104244791 279
1165 3300032002 Ga0307416_100165790 Ga0307416_1001657902 279
1166 3300034817 Ga0373948_0006120 Ga0373948_0006120_273_1121 279
1167 3300034820 Ga0373959_0004595 Ga0373959_0004595_447_1295 279
1168 3300035088 Ga0373940_0014349 Ga0373940_0014349_493_1341 279
1169 3300035090 Ga0373949_0000662 Ga0373949_0000662_1354_2202 279
1170 3300035112 Ga0373932_0001020 Ga0373932_0001020_897_1745 279
1171 3300035114 Ga0373939_0006734 Ga0373939_0006734_1140_1988 279
1172 3300035207 Ga0373942_0003369 Ga0373942_0003369_443_1291 279
1173 3300035241 Ga0373961_0000784 Ga0373961_0000784_9086_9934 279
1174 3300035242 Ga0373962_0002362 Ga0373962_0002362_494_1342 279
1175 3300037312 Ga0395899_0001813 Ga0395899_0001813_3771_4649 279
1176 3300037312 Ga0395899_0010130 Ga0395899_0010130_1566_2423 279
1177 3300037312 Ga0395899_0016974 Ga0395899_0016974_4509_5366 279
1178 3300037312 Ga0395899_0095894 Ga0395899_0095894_644_1501 279
1179 3300037418 Ga0395900_0008154 Ga0395900_0008154_5916_6764 279
1180 3300037418 Ga0395900_0010193 Ga0395900_0010193_6003_6860 279
1181 3300037418 Ga0395900_0014100 Ga0395900_0014100_1551_2408 279
1182 3300037418 Ga0395900_0105537 Ga0395900_0105537_1843_2694 279
1183 3300037418 Ga0395900_0118131 Ga0395900_0118131_146_985 279
1184 3300037418 Ga0395900_0148564 Ga0395900_0148564_191_1039 279
1185 3300037418 Ga0395900_0183561 Ga0395900_0183561_254_1138 279
1186 3300037418 Ga0395900_0386485 Ga0395900_0386485_283_1140 279
1187 3300037418 Ga0395900_0688073 Ga0395900_0688073_55_897 279
1188 3300037466 Ga0395898_0006991 Ga0395898_0006991_2851_3729 279
1189 3300037466 Ga0395898_0008254 Ga0395898_0008254_9707_10555 279
1190 3300037466 Ga0395898_0039713 Ga0395898_0039713_2625_3482 279
1191 3300037466 Ga0395898_0070325 Ga0395898_0070325_1674_2513 279
1192 3300037466 Ga0395898_0132424 Ga0395898_0132424_612_1469 279
1193 3300037466 Ga0395898_0216147 Ga0395898_0216147_875_1726 279
1194 3300037466 Ga0395898_0241899 Ga0395898_0241899_466_1305 279
1195 3300037466 Ga0395898_0338660 Ga0395898_0338660_43_882 279
1196 3300037471 Ga0395905_0002088 Ga0395905_0002088_14104_14943 279
1197 3300037471 Ga0395905_0003522 Ga0395905_0003522_15714_16592 279
1198 3300037471 Ga0395905_0005372 Ga0395905_0005372_2119_2976 279
1199 3300037471 Ga0395905_0020464 Ga0395905_0020464_4424_5281 279
1200 3300037471 Ga0395905_0061017 Ga0395905_0061017_1439_2287 279
1201 3300037471 Ga0395905_0152706 Ga0395905_0152706_505_1353 279
1202 3300038443 Ga0395901_0003533 Ga0395901_0003533_13974_14813 279
1203 3300038443 Ga0395901_0003539 Ga0395901_0003539_2696_3544 279
1204 3300038443 Ga0395901_0028496 Ga0395901_0028496_3031_3909 279
1205 3300038443 Ga0395901_0030431 Ga0395901_0030431_3548_4432 279
1206 3300038443 Ga0395901_0032367 Ga0395901_0032367_1268_2107 279
1207 3300038443 Ga0395901_0035161 Ga0395901_0035161_965_1813 279
1208 3300038443 Ga0395901_0059631 Ga0395901_0059631_192_1049 279
1209 3300038443 Ga0395901_0064386 Ga0395901_0064386_1241_2098 279
1210 3300038443 Ga0395901_0084355 Ga0395901_0084355_227_1084 279
1211 3300038443 Ga0395901_0404581 Ga0395901_0404581_149_991 279
1212 3300041452 Ga0451793_1168656 Ga0451793_1168656_34_873 279
1213 3300041459 Ga0451800_0941897 Ga0451800_0941897_111_950 279
1214 3300041460 Ga0451802_1228609 Ga0451802_1228609_69_908 279
1215 3300041492 Ga0451835_0140787 Ga0451835_0140787_2017_2856 279
1216 3300041505 Ga0451849_0044832 Ga0451849_0044832_80_919 279
1217 3300044735 Ga0466968_0103864 Ga0466968_0103864_250_1095 279
1218 3300044842 Ga0466957_0162133 Ga0466957_0162133_291_1133 279
1219 3300044901 Ga0466960_0012688 Ga0466960_0012688_1846_2685 279
1220 3300045976 Ga0466967_0077759 Ga0466967_0077759_1871_2710 279
1221 3300046491 Ga0495584_0085757 Ga0495584_0085757_14_853 279
1222 3300048904 Ga0496101_0034215 Ga0496101_0034215_961_1800 279
1223 3300048904 Ga0496101_0205871 Ga0496101_0205871_199_1047 279
1224 3300048904 Ga0496101_0253630 Ga0496101_0253630_302_1153 279
1225 3300048904 Ga0496101_0277744 Ga0496101_0277744_23_880 279
1226 3300048905 Ga0496102_0065582 Ga0496102_0065582_1743_2597 279
1227 3300048905 Ga0496102_0203375 Ga0496102_0203375_272_1123 279
1228 3300048905 Ga0496102_0302926 Ga0496102_0302926_294_1133 279
1229 3300048905 Ga0496102_0566550 Ga0496102_0566550_11_859 279
1230 3300048908 Ga0496105_0006393 Ga0496105_0006393_136_975 279
1231 3300048909 Ga0496106_0131314 Ga0496106_0131314_498_1346 279
1232 3300048909 Ga0496106_0141791 Ga0496106_0141791_469_1320 279
1233 3300048909 Ga0496106_0238734 Ga0496106_0238734_236_1075 279
1234 3300048910 Ga0496107_0055943 Ga0496107_0055943_773_1621 279
1235 3300048910 Ga0496107_0064283 Ga0496107_0064283_178_1017 279
1236 3300048911 Ga0496108_0048720 Ga0496108_0048720_208_1059 279
1237 3300048911 Ga0496108_0107506 Ga0496108_0107506_153_992 279
1238 3300048912 Ga0496109_0002657 Ga0496109_0002657_5032_5883 279
1239 3300048912 Ga0496109_0047156 Ga0496109_0047156_200_1048 279
1240 3300048913 Ga0496110_0026390 Ga0496110_0026390_298_1137 279
1241 3300048913 Ga0496110_0199370 Ga0496110_0199370_322_1170 279
1242 3300048914 Ga0496111_0317948 Ga0496111_0317948_215_1066 279
1243 3300048915 Ga0496112_0326473 Ga0496112_0326473_270_1109 279
1244 3300048916 Ga0496113_0020320 Ga0496113_0020320_3809_4648 279
1245 3300048916 Ga0496113_0265113 Ga0496113_0265113_352_1200 279
1246 3300048917 Ga0496114_0003753 Ga0496114_0003753_3161_4000 279
1247 3300048917 Ga0496114_0193886 Ga0496114_0193886_91_939 279
1248 3300048918 Ga0496115_0117282 Ga0496115_0117282_644_1495 279
1249 3300048918 Ga0496115_0121726 Ga0496115_0121726_914_1762 279
1250 3300050507 nmdc:mga05p37_234905_c1 nmdc:mga05p37_234905_c1_87_938 279
1251 3300050511 nmdc:mga08y16_100027_c1 nmdc:mga08y16_100027_c1_1353_2198 279
1252 3300050511 nmdc:mga08y16_186340_c1 nmdc:mga08y16_186340_c1_984_1886 279
1253 3300050512 nmdc:mga0n895_36178_c1 nmdc:mga0n895_36178_c1_829_1677 279
1254 3300050514 nmdc:mga08x19_20563_c1 nmdc:mga08x19_20563_c1_948_1799 279
1255 3300050514 nmdc:mga08x19_29465_c1 nmdc:mga08x19_29465_c1_1006_1860 279
1256 3300050515 nmdc:mga0a205_269989_c1 nmdc:mga0a205_269989_c1_649_1494 279
1257 3300050515 nmdc:mga0a205_5604_c1 nmdc:mga0a205_5604_c1_3478_4326 279
1258 3300050515 nmdc:mga0a205_66668_c1 nmdc:mga0a205_66668_c1_1712_2566 279
1259 3300003373 JGI25407J50210_10004004 JGI25407J50210_100040042 281
1260 3300005981 Ga0081538_10000144 Ga0081538_1000014453 281
1261 3300009147 Ga0114129_10230307 Ga0114129_102303072 281
1262 3300037312 Ga0395899_0162621 Ga0395899_0162621_423_1280 281
1263 3300037466 Ga0395898_0062001 Ga0395898_0062001_431_1288 281
1264 3300049569 Ga0501032_0023411 Ga0501032_0023411_2877_3722 281
1265 3300049573 Ga0501037_0003648 Ga0501037_0003648_9685_10530 281
1266 3300049574 Ga0501038_0077328 Ga0501038_0077328_611_1456 281
1267 3300049576 Ga0501040_0005743 Ga0501040_0005743_611_1456 281
1268 3300049577 Ga0501041_0011812 Ga0501041_0011812_4281_5126 281
1269 3300049579 Ga0501043_0007710 Ga0501043_0007710_644_1489 281
1270 3300049582 Ga0501048_0046641 Ga0501048_0046641_907_1752 281
1271 3300049587 Ga0501071_0037793 Ga0501071_0037793_1354_2199 281
1272 3300049589 Ga0501073_0139250 Ga0501073_0139250_44_889 281
1273 3300049590 Ga0501074_0006260 Ga0501074_0006260_1288_2133 281
1274 3300049591 Ga0501075_0029807 Ga0501075_0029807_1943_2788 281
1275 3300049742 Ga0501080_0017932 Ga0501080_0017932_739_1584 281
1276 3300049743 Ga0501081_0011695 Ga0501081_0011695_783_1628 281
1277 3300049822 Ga0501035_0170962 Ga0501035_0170962_611_1456 281
1278 3300049824 Ga0501045_0008660 Ga0501045_0008660_6206_7051 281
1279 3300050492 nmdc:mga0yw44_27853_c1 nmdc:mga0yw44_27853_c1_1566_2411 281
1280 3300050509 nmdc:mga0qj67_58699_c1 nmdc:mga0qj67_58699_c1_2134_2979 281
1281 3300050510 nmdc:mga06r32_16761_c1 nmdc:mga06r32_16761_c1_5341_6186 281
1282 3300054114 Ga0501084_0026397 Ga0501084_0026397_2727_3572 281
1283 3300060353 Ga0501082_0054627 Ga0501082_0054627_1356_2201 281
1284 3300061734 Ga0530510_0035068 Ga0530510_0035068_44_889 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

19

220

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g5h-assembly1.cif.gz_B escherichia coli periplasmic aldehyde oxidase r440h mutant 0.8945 1 281
5g5h-assembly1.cif.gz_B escherichia coli periplasmic aldehyde oxidase r440h mutant 0.8915 1 281
5y6q-assembly1.cif.gz_B crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.8703 3 280
5y6q-assembly1.cif.gz_B crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.8588 3 280
1sb3-assembly1.cif.gz_E structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.791 3 277
ID Description Score Start End Superfamily
1ffuF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9172 1 47 3.30.43.10
1t3qF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.8934 1 51 3.30.43.10
4zohB01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.8925 1 46 3.30.43.10
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.8861 1 48 3.30.43.10
af_Q46800_3_54_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.8275 2 48 3.30.43.10
ID Description Score Start End GO Terms
AF-A0A7V9CV68-F1-model_v4 FAD binding domain-containing protein 0.9703 1 279 GO:0016491
GO:0071949
AF-A0A538D0F6-F1-model_v4 CO dehydrogenase flavoprotein C-terminal domain-containing protein 0.9605 109 279 GO:0050660
AF-A0A7V9CV68-F1-model_v4 FAD binding domain-containing protein 0.9601 1 279 GO:0016491
GO:0071949
AF-A0A538MVF5-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9558 1 281 GO:0016491
GO:0071949
AF-A0A537Z340-F1-model_v4 Molybdopterin dehydrogenase FAD-binding domain-containing protein 0.9533 1 84 GO:0016491
GO:0050660

Feature Viewer

pLDDT pTM Quality
90.44 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map