F492697
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1296 | 453 | 1296 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0054487|Ga0501070_0054487_775_1554 |
| Length | 259 |
| Sequence | MSKAKPMNSATPVVLIVDDEVQIRRFLRTGFELNGFSVLEVGTGGEAIRSASLQAIDLVIVDLALPDIDGASVIERIRAWSTVPIIVLSVRSNESEKVRLLELGADDYVVKPFGMAELLARVRAALRRQMRAASGEPQVKIGPLTIDLAARAALLNGARLSLTPKEYRLLQVLAQHAGNVVTHQHLLKEVWGSVHVHDTHYLRIFVRKLRQKIEPDPNAPRILVTELGVGYRLAQNGEIDSPAWPHGGATAAAAGSKAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 109 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 123 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 124 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 127 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 128 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 144 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 145 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 159 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 160 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 243 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 244 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 247 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 249 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 252 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 256 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 257 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 258 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 270 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 275 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 277 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 282 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 283 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 286 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 288 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 290 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 292 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 293 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 294 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 295 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 296 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 297 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 298 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 299 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 301 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 302 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 303 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 304 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 305 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 306 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 307 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 308 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 309 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 310 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 311 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 381 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 382 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 383 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 384 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 385 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 386 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 389 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 390 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 391 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 392 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 393 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 394 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 424 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 425 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 426 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 427 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 428 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 429 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 444 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 445 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 446 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 447 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 449 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 451 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 452 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.24 |
| Nodule | 0 |
| Rhizoplane | 7.64 |
| Rhizosphere | 89.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214683824 | 2209111006 | Bacteria | 4569 |
| 2 | ARcpr5oldR_c000960 | 3300000041 | Bacteria | 3121 |
| 3 | ARSoilYngRDRAFT_c00484 | 3300000042 | Bacteria | 4727 |
| 4 | ARcpr5yngRDRAFT_c000683 | 3300000043 | Bacteria | 4222 |
| 5 | ARSoilOldRDRAFT_c000056 | 3300000044 | Bacteria | 23604 |
| 6 | ARCol0oldRDRAFT_c00385 | 3300000045 | Bacteria | 4255 |
| 7 | ARCol0yngRDRAFT_1000069 | 3300000652 | Bacteria | 18965 |
| 8 | JGI24032J14994_101055 | 3300001430 | Bacteria | 1273 |
| 9 | JGI24752J21851_1013427 | 3300001976 | Bacteria | 1069 |
| 10 | JGI24746J21847_1001650 | 3300001977 | Bacteria | 3577 |
| 11 | JGI24747J21853_1001844 | 3300001978 | Bacteria | 1650 |
| 12 | JGI24739J22299_10014137 | 3300001989 | Bacteria | 2905 |
| 13 | JGI24737J22298_10012901 | 3300001990 | Bacteria | 2723 |
| 14 | JGI24737J22298_10020399 | 3300001990 | Bacteria | 2116 |
| 15 | JGI24737J22298_10064859 | 3300001990 | Bacteria | 1095 |
| 16 | JGI24743J22301_10004048 | 3300001991 | Bacteria | 2360 |
| 17 | JGI24743J22301_10008333 | 3300001991 | Bacteria | 1817 |
| 18 | JGI24750J21931_1000188 | 3300002070 | Bacteria | 10321 |
| 19 | JGI24750J21931_1001196 | 3300002070 | Bacteria | 3311 |
| 20 | JGI24745J21846_1008993 | 3300002073 | Bacteria | 1128 |
| 21 | JGI24738J21930_10000068 | 3300002075 | Bacteria | 21789 |
| 22 | JGI24749J21850_1011821 | 3300002076 | Bacteria | 1226 |
| 23 | JGI24744J21845_10019934 | 3300002077 | Bacteria | 1324 |
| 24 | JGI24035J26624_1000816 | 3300002126 | Bacteria | 2932 |
| 25 | JGI24034J26672_10004654 | 3300002239 | Bacteria | 1950 |
| 26 | JGI24742J22300_10003075 | 3300002244 | Bacteria | 2700 |
| 27 | JGI24742J22300_10019847 | 3300002244 | Bacteria | 1143 |
| 28 | JGI24751J29686_10002565 | 3300002459 | Bacteria | 3649 |
| 29 | rootH1_10199197 | 3300003323 | Bacteria | 1507 |
| 30 | JGI25407J50210_10025802 | 3300003373 | Bacteria | 1523 |
| 31 | Ga0065716_1001578 | 3300005277 | Bacteria | 5949 |
| 32 | Ga0065704_10020946 | 3300005289 | Bacteria | 1982 |
| 33 | Ga0065712_10006735 | 3300005290 | Bacteria | 4677 |
| 34 | Ga0065715_10002029 | 3300005293 | Bacteria | 5263 |
| 35 | Ga0065715_10089172 | 3300005293 | Bacteria | 13154 |
| 36 | Ga0065707_10122926 | 3300005295 | Bacteria | 2077 |
| 37 | Ga0070658_10270701 | 3300005327 | Bacteria | 1445 |
| 38 | Ga0070676_10030891 | 3300005328 | Bacteria | 3058 |
| 39 | Ga0070683_100004718 | 3300005329 | Bacteria | 11267 |
| 40 | Ga0070683_100106661 | 3300005329 | Bacteria | 2641 |
| 41 | Ga0070683_100151902 | 3300005329 | Bacteria | 2195 |
| 42 | Ga0070683_100177709 | 3300005329 | Bacteria | 2021 |
| 43 | Ga0070683_100186261 | 3300005329 | Bacteria | 1970 |
| 44 | Ga0070690_100001828 | 3300005330 | Bacteria | 11279 |
| 45 | Ga0070690_100012134 | 3300005330 | Bacteria | 5064 |
| 46 | Ga0070690_100085564 | 3300005330 | Bacteria | 2068 |
| 47 | Ga0070690_100252195 | 3300005330 | Bacteria | 1248 |
| 48 | Ga0070670_100001134 | 3300005331 | Bacteria | 21148 |
| 49 | Ga0070670_100019346 | 3300005331 | Bacteria | 5841 |
| 50 | Ga0070670_100022469 | 3300005331 | Bacteria | 5429 |
| 51 | Ga0070670_100113430 | 3300005331 | Bacteria | 2336 |
| 52 | Ga0070677_10004240 | 3300005333 | Bacteria | 4669 |
| 53 | Ga0070677_10080424 | 3300005333 | Bacteria | 1393 |
| 54 | Ga0068869_100002241 | 3300005334 | Bacteria | 11635 |
| 55 | Ga0068869_100072509 | 3300005334 | Bacteria | 2551 |
| 56 | Ga0070666_10241461 | 3300005335 | Bacteria | 1277 |
| 57 | Ga0070666_10295572 | 3300005335 | Bacteria | 1153 |
| 58 | Ga0070680_100024207 | 3300005336 | Bacteria | 4846 |
| 59 | Ga0070680_100037746 | 3300005336 | Bacteria | 3904 |
| 60 | Ga0070680_100134470 | 3300005336 | Bacteria | 2070 |
| 61 | Ga0070680_100195912 | 3300005336 | Bacteria | 1703 |
| 62 | Ga0070682_100048795 | 3300005337 | Bacteria | 2637 |
| 63 | Ga0070682_100060135 | 3300005337 | Bacteria | 2402 |
| 64 | Ga0068868_100045050 | 3300005338 | Bacteria | 3450 |
| 65 | Ga0068868_100060072 | 3300005338 | Bacteria | 3008 |
| 66 | Ga0070660_100000730 | 3300005339 | Bacteria | 21778 |
| 67 | Ga0070660_100221561 | 3300005339 | Bacteria | 1538 |
| 68 | Ga0070660_100236961 | 3300005339 | Bacteria | 1485 |
| 69 | Ga0070689_100000601 | 3300005340 | Bacteria | 21783 |
| 70 | Ga0070689_100011223 | 3300005340 | Bacteria | 6412 |
| 71 | Ga0070689_100069420 | 3300005340 | Bacteria | 2749 |
| 72 | Ga0070689_100131877 | 3300005340 | Bacteria | 2004 |
| 73 | Ga0070691_10016213 | 3300005341 | Bacteria | 3423 |
| 74 | Ga0070691_10025483 | 3300005341 | Bacteria | 2753 |
| 75 | Ga0070691_10051909 | 3300005341 | Bacteria | 1960 |
| 76 | Ga0070687_100000253 | 3300005343 | Bacteria | 18199 |
| 77 | Ga0070661_100003564 | 3300005344 | Bacteria | 10720 |
| 78 | Ga0070661_100005403 | 3300005344 | Bacteria | 8809 |
| 79 | Ga0070692_10000060 | 3300005345 | Bacteria | 21392 |
| 80 | Ga0070692_10018948 | 3300005345 | Bacteria | 3316 |
| 81 | Ga0070668_100096911 | 3300005347 | Bacteria | 2332 |
| 82 | Ga0070668_100187304 | 3300005347 | Bacteria | 1693 |
| 83 | Ga0070668_100315543 | 3300005347 | Bacteria | 1314 |
| 84 | Ga0070669_100000888 | 3300005353 | Bacteria | 21753 |
| 85 | Ga0070669_100062339 | 3300005353 | Bacteria | 2741 |
| 86 | Ga0070669_100207881 | 3300005353 | Bacteria | 1543 |
| 87 | Ga0070669_100397683 | 3300005353 | Bacteria | 1127 |
| 88 | Ga0070675_100000441 | 3300005354 | Bacteria | 28206 |
| 89 | Ga0070675_100087502 | 3300005354 | Bacteria | 2605 |
| 90 | Ga0070675_100220573 | 3300005354 | Bacteria | 1651 |
| 91 | Ga0070675_100273203 | 3300005354 | Bacteria | 1484 |
| 92 | Ga0070675_100307546 | 3300005354 | Bacteria | 1398 |
| 93 | Ga0070675_100361184 | 3300005354 | Bacteria | 1289 |
| 94 | Ga0070671_100012431 | 3300005355 | Bacteria | 6855 |
| 95 | Ga0070671_100038653 | 3300005355 | Bacteria | 3961 |
| 96 | Ga0070671_100086982 | 3300005355 | Bacteria | 2616 |
| 97 | Ga0070674_100000723 | 3300005356 | Bacteria | 16855 |
| 98 | Ga0070674_100035549 | 3300005356 | Bacteria | 3337 |
| 99 | Ga0070674_100045634 | 3300005356 | Bacteria | 2994 |
| 100 | Ga0070674_100071279 | 3300005356 | Bacteria | 2457 |
| 101 | Ga0070674_100305399 | 3300005356 | Bacteria | 1270 |
| 102 | Ga0070673_100000456 | 3300005364 | Bacteria | 21637 |
| 103 | Ga0070673_100006931 | 3300005364 | Bacteria | 7413 |
| 104 | Ga0070673_100023232 | 3300005364 | Bacteria | 4529 |
| 105 | Ga0070673_100036643 | 3300005364 | Bacteria | 3730 |
| 106 | Ga0070673_100278696 | 3300005364 | Bacteria | 1466 |
| 107 | Ga0070673_100593512 | 3300005364 | Bacteria | 1010 |
| 108 | Ga0070673_100981390 | 3300005364 | Bacteria | 786 |
| 109 | Ga0070688_100016044 | 3300005365 | Bacteria | 4274 |
| 110 | Ga0070688_100068213 | 3300005365 | Bacteria | 2267 |
| 111 | Ga0070659_100071077 | 3300005366 | Bacteria | 2766 |
| 112 | Ga0070659_100149522 | 3300005366 | Bacteria | 1904 |
| 113 | Ga0070659_100294699 | 3300005366 | Bacteria | 1351 |
| 114 | Ga0070667_100004366 | 3300005367 | Bacteria | 11932 |
| 115 | Ga0070667_100028530 | 3300005367 | Bacteria | 4647 |
| 116 | Ga0070667_100042342 | 3300005367 | Bacteria | 3821 |
| 117 | Ga0070667_100054032 | 3300005367 | Bacteria | 3391 |
| 118 | Ga0070667_100110696 | 3300005367 | Bacteria | 2381 |
| 119 | Ga0070667_100218666 | 3300005367 | Bacteria | 1695 |
| 120 | Ga0070667_100297760 | 3300005367 | Bacteria | 1452 |
| 121 | Ga0070703_10142656 | 3300005406 | Bacteria | 892 |
| 122 | Ga0070709_10012396 | 3300005434 | Bacteria | 4771 |
| 123 | Ga0070709_10064725 | 3300005434 | Bacteria | 2338 |
| 124 | Ga0070709_10267256 | 3300005434 | Bacteria | 1238 |
| 125 | Ga0070714_100001717 | 3300005435 | Bacteria | 15944 |
| 126 | Ga0070714_100072401 | 3300005435 | Bacteria | 2983 |
| 127 | Ga0070714_100092964 | 3300005435 | Bacteria | 2644 |
| 128 | Ga0070713_100008626 | 3300005436 | Bacteria | 7242 |
| 129 | Ga0070713_100025030 | 3300005436 | Bacteria | 4660 |
| 130 | Ga0070713_100051947 | 3300005436 | Bacteria | 3392 |
| 131 | Ga0070713_100073307 | 3300005436 | Bacteria | 2898 |
| 132 | Ga0070713_100099211 | 3300005436 | Bacteria | 2519 |
| 133 | Ga0070713_100337916 | 3300005436 | Bacteria | 1395 |
| 134 | Ga0070710_10014117 | 3300005437 | Bacteria | 4013 |
| 135 | Ga0070710_10014261 | 3300005437 | Bacteria | 3997 |
| 136 | Ga0070710_10021851 | 3300005437 | Bacteria | 3339 |
| 137 | Ga0070710_10030745 | 3300005437 | Bacteria | 2891 |
| 138 | Ga0070701_10000150 | 3300005438 | Bacteria | 21357 |
| 139 | Ga0070701_10028731 | 3300005438 | Bacteria | 2735 |
| 140 | Ga0070701_10040980 | 3300005438 | Bacteria | 2357 |
| 141 | Ga0070711_100115737 | 3300005439 | Bacteria | 1975 |
| 142 | Ga0070711_100136053 | 3300005439 | Bacteria | 1836 |
| 143 | Ga0070705_100115517 | 3300005440 | Bacteria | 1723 |
| 144 | Ga0070705_100404685 | 3300005440 | Bacteria | 1011 |
| 145 | Ga0070705_100611149 | 3300005440 | Bacteria | 845 |
| 146 | Ga0070700_100001083 | 3300005441 | Bacteria | 13532 |
| 147 | Ga0070700_100014797 | 3300005441 | Bacteria | 4409 |
| 148 | Ga0070700_100073585 | 3300005441 | Bacteria | 2187 |
| 149 | Ga0070700_100096905 | 3300005441 | Bacteria | 1936 |
| 150 | Ga0070700_100172225 | 3300005441 | Bacteria | 1500 |
| 151 | Ga0070700_100299024 | 3300005441 | Bacteria | 1174 |
| 152 | Ga0070694_100005807 | 3300005444 | Bacteria | 7485 |
| 153 | Ga0070694_100019456 | 3300005444 | Bacteria | 4318 |
| 154 | Ga0070694_100202123 | 3300005444 | Bacteria | 1482 |
| 155 | Ga0070694_100766443 | 3300005444 | Bacteria | 789 |
| 156 | Ga0070708_100482556 | 3300005445 | Bacteria | 1169 |
| 157 | Ga0070663_100012921 | 3300005455 | Bacteria | 5301 |
| 158 | Ga0070663_100055519 | 3300005455 | Bacteria | 2835 |
| 159 | Ga0070663_100061112 | 3300005455 | Bacteria | 2712 |
| 160 | Ga0070663_100235138 | 3300005455 | Bacteria | 1444 |
| 161 | Ga0070678_100000199 | 3300005456 | Bacteria | 26434 |
| 162 | Ga0070678_100019407 | 3300005456 | Bacteria | 4431 |
| 163 | Ga0070678_100032267 | 3300005456 | Bacteria | 3623 |
| 164 | Ga0070678_100141386 | 3300005456 | Bacteria | 1926 |
| 165 | Ga0070678_100344074 | 3300005456 | Unclassified | 1280 |
| 166 | Ga0070662_100067575 | 3300005457 | Bacteria | 2625 |
| 167 | Ga0070662_100203962 | 3300005457 | Bacteria | 1570 |
| 168 | Ga0070681_10001398 | 3300005458 | Bacteria | 21148 |
| 169 | Ga0070681_10051334 | 3300005458 | Bacteria | 4113 |
| 170 | Ga0070681_10281525 | 3300005458 | Bacteria | 1573 |
| 171 | Ga0070681_10471298 | 3300005458 | Bacteria | 1168 |
| 172 | Ga0070681_10611962 | 3300005458 | Bacteria | 1004 |
| 173 | Ga0068867_100070864 | 3300005459 | Bacteria | 2606 |
| 174 | Ga0068867_100135265 | 3300005459 | Bacteria | 1920 |
| 175 | Ga0070685_10012971 | 3300005466 | Bacteria | 4388 |
| 176 | Ga0070685_10012988 | 3300005466 | Bacteria | 4386 |
| 177 | Ga0070685_10070280 | 3300005466 | Bacteria | 2072 |
| 178 | Ga0070685_10156737 | 3300005466 | Bacteria | 1448 |
| 179 | Ga0070685_10232234 | 3300005466 | Bacteria | 1214 |
| 180 | Ga0070699_100010246 | 3300005518 | Bacteria | 8108 |
| 181 | Ga0070679_100003933 | 3300005530 | Bacteria | 13668 |
| 182 | Ga0070679_100109379 | 3300005530 | Bacteria | 2750 |
| 183 | Ga0070679_100163896 | 3300005530 | Bacteria | 2197 |
| 184 | Ga0070679_100200367 | 3300005530 | Bacteria | 1963 |
| 185 | Ga0070684_100008219 | 3300005535 | Bacteria | 8153 |
| 186 | Ga0070684_100033102 | 3300005535 | Bacteria | 4410 |
| 187 | Ga0070684_100100028 | 3300005535 | Bacteria | 2589 |
| 188 | Ga0070684_100811840 | 3300005535 | Bacteria | 875 |
| 189 | Ga0070697_100528546 | 3300005536 | Bacteria | 1033 |
| 190 | Ga0070672_100035421 | 3300005543 | Bacteria | 3795 |
| 191 | Ga0070672_100084911 | 3300005543 | Bacteria | 2543 |
| 192 | Ga0070672_100281702 | 3300005543 | Bacteria | 1406 |
| 193 | Ga0070672_100282939 | 3300005543 | Bacteria | 1402 |
| 194 | Ga0070686_100000746 | 3300005544 | Bacteria | 18847 |
| 195 | Ga0070686_100003612 | 3300005544 | Bacteria | 8488 |
| 196 | Ga0070686_100010778 | 3300005544 | Bacteria | 5168 |
| 197 | Ga0070686_100013596 | 3300005544 | Bacteria | 4667 |
| 198 | Ga0070686_100376233 | 3300005544 | Bacteria | 1074 |
| 199 | Ga0070695_100180484 | 3300005545 | Bacteria | 1495 |
| 200 | Ga0070696_100140069 | 3300005546 | Bacteria | 1767 |
| 201 | Ga0070693_100000613 | 3300005547 | Bacteria | 15823 |
| 202 | Ga0070693_100025946 | 3300005547 | Bacteria | 3157 |
| 203 | Ga0070665_100023806 | 3300005548 | Bacteria | 6169 |
| 204 | Ga0070665_100056129 | 3300005548 | Bacteria | 3949 |
| 205 | Ga0070704_100111030 | 3300005549 | Bacteria | 2086 |
| 206 | Ga0070704_100161117 | 3300005549 | Bacteria | 1774 |
| 207 | Ga0070704_100195506 | 3300005549 | Bacteria | 1629 |
| 208 | Ga0068855_100004415 | 3300005563 | Bacteria | 17183 |
| 209 | Ga0068855_100208336 | 3300005563 | Bacteria | 2198 |
| 210 | Ga0070664_100023220 | 3300005564 | Bacteria | 5122 |
| 211 | Ga0070664_100306345 | 3300005564 | Bacteria | 1436 |
| 212 | Ga0070664_100405256 | 3300005564 | Bacteria | 1247 |
| 213 | Ga0068857_100010463 | 3300005577 | Bacteria | 8063 |
| 214 | Ga0068857_100048107 | 3300005577 | Bacteria | 3787 |
| 215 | Ga0068857_100385003 | 3300005577 | Bacteria | 1303 |
| 216 | Ga0068854_100022931 | 3300005578 | Bacteria | 4259 |
| 217 | Ga0068854_100038064 | 3300005578 | Bacteria | 3380 |
| 218 | Ga0068854_100151074 | 3300005578 | Bacteria | 1791 |
| 219 | Ga0068856_100001340 | 3300005614 | Bacteria | 25903 |
| 220 | Ga0068856_100045746 | 3300005614 | Bacteria | 4310 |
| 221 | Ga0068856_100120449 | 3300005614 | Bacteria | 2625 |
| 222 | Ga0068856_100330525 | 3300005614 | Bacteria | 1542 |
| 223 | Ga0068856_100638112 | 3300005614 | Bacteria | 1086 |
| 224 | Ga0070702_100000293 | 3300005615 | Bacteria | 17107 |
| 225 | Ga0070702_100005192 | 3300005615 | Bacteria | 6032 |
| 226 | Ga0070702_100113030 | 3300005615 | Bacteria | 1687 |
| 227 | Ga0068852_100028469 | 3300005616 | Bacteria | 4574 |
| 228 | Ga0068852_100087901 | 3300005616 | Bacteria | 2774 |
| 229 | Ga0068859_100001767 | 3300005617 | Bacteria | 21986 |
| 230 | Ga0068859_100020118 | 3300005617 | Bacteria | 6701 |
| 231 | Ga0068859_100060567 | 3300005617 | Bacteria | 3814 |
| 232 | Ga0068859_100108650 | 3300005617 | Bacteria | 2835 |
| 233 | Ga0068859_100358863 | 3300005617 | Bacteria | 1552 |
| 234 | Ga0068864_100003544 | 3300005618 | Bacteria | 12907 |
| 235 | Ga0068864_100022792 | 3300005618 | Bacteria | 5252 |
| 236 | Ga0068864_100182279 | 3300005618 | Bacteria | 1920 |
| 237 | Ga0068864_100996407 | 3300005618 | Bacteria | 831 |
| 238 | Ga0068866_10000372 | 3300005718 | Bacteria | 21128 |
| 239 | Ga0068866_10065626 | 3300005718 | Bacteria | 1899 |
| 240 | Ga0068866_10075107 | 3300005718 | Bacteria | 1799 |
| 241 | Ga0068861_100067567 | 3300005719 | Bacteria | 2759 |
| 242 | Ga0068861_100090261 | 3300005719 | Bacteria | 2417 |
| 243 | Ga0068861_100238331 | 3300005719 | Bacteria | 1546 |
| 244 | Ga0068851_10011533 | 3300005834 | Bacteria | 4147 |
| 245 | Ga0068851_10067204 | 3300005834 | Bacteria | 1849 |
| 246 | Ga0068870_10000207 | 3300005840 | Bacteria | 21125 |
| 247 | Ga0068870_10007460 | 3300005840 | Bacteria | 4876 |
| 248 | Ga0068863_100028324 | 3300005841 | Bacteria | 5348 |
| 249 | Ga0068863_100034537 | 3300005841 | Bacteria | 4817 |
| 250 | Ga0068863_100047285 | 3300005841 | Bacteria | 4082 |
| 251 | Ga0068863_100300993 | 3300005841 | Bacteria | 1556 |
| 252 | Ga0068858_100004999 | 3300005842 | Bacteria | 12990 |
| 253 | Ga0068858_100238575 | 3300005842 | Bacteria | 1724 |
| 254 | Ga0068858_100601218 | 3300005842 | Bacteria | 1067 |
| 255 | Ga0068860_100019087 | 3300005843 | Bacteria | 6656 |
| 256 | Ga0068860_100110596 | 3300005843 | Bacteria | 2626 |
| 257 | Ga0068860_100510993 | 3300005843 | Bacteria | 1200 |
| 258 | Ga0068860_100563699 | 3300005843 | Bacteria | 1142 |
| 259 | Ga0068862_100030660 | 3300005844 | Bacteria | 4533 |
| 260 | Ga0068862_100051221 | 3300005844 | Bacteria | 3530 |
| 261 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 262 | Ga0081455_10017616 | 3300005937 | Bacteria | 6838 |
| 263 | Ga0081455_10018858 | 3300005937 | Bacteria | 6546 |
| 264 | Ga0081455_10082492 | 3300005937 | Bacteria | 2630 |
| 265 | Ga0081455_10407144 | 3300005937 | Bacteria | 942 |
| 266 | Ga0081538_10009357 | 3300005981 | Bacteria | 8187 |
| 267 | Ga0081538_10017589 | 3300005981 | Bacteria | 5417 |
| 268 | Ga0081540_1004734 | 3300005983 | Bacteria | 10288 |
| 269 | Ga0081540_1010142 | 3300005983 | Bacteria | 6411 |
| 270 | Ga0081540_1023475 | 3300005983 | Bacteria | 3605 |
| 271 | Ga0081540_1127389 | 3300005983 | Bacteria | 1045 |
| 272 | Ga0070717_10005256 | 3300006028 | Bacteria | 9433 |
| 273 | Ga0070717_10159756 | 3300006028 | Bacteria | 1955 |
| 274 | Ga0070717_10229996 | 3300006028 | Bacteria | 1632 |
| 275 | Ga0070717_10259779 | 3300006028 | Bacteria | 1536 |
| 276 | Ga0070717_10269131 | 3300006028 | Bacteria | 1509 |
| 277 | Ga0070717_10284299 | 3300006028 | Bacteria | 1468 |
| 278 | Ga0070717_10391947 | 3300006028 | Bacteria | 1247 |
| 279 | Ga0070717_10456719 | 3300006028 | Bacteria | 1152 |
| 280 | Ga0070717_10708378 | 3300006028 | Bacteria | 915 |
| 281 | Ga0075363_100026063 | 3300006048 | Bacteria | 2989 |
| 282 | Ga0075364_10108613 | 3300006051 | Bacteria | 1850 |
| 283 | Ga0075364_10189800 | 3300006051 | Bacteria | 1391 |
| 284 | Ga0075432_10010313 | 3300006058 | Bacteria | 3169 |
| 285 | Ga0075432_10060363 | 3300006058 | Bacteria | 1349 |
| 286 | Ga0070715_10039488 | 3300006163 | Bacteria | 1966 |
| 287 | Ga0070716_100002237 | 3300006173 | Bacteria | 8916 |
| 288 | Ga0070716_100171043 | 3300006173 | Bacteria | 1418 |
| 289 | Ga0070716_100312353 | 3300006173 | Bacteria | 1098 |
| 290 | Ga0070712_100184118 | 3300006175 | Bacteria | 1630 |
| 291 | Ga0075362_10019167 | 3300006177 | Bacteria | 2842 |
| 292 | Ga0075362_10072275 | 3300006177 | Bacteria | 1578 |
| 293 | Ga0075366_10137332 | 3300006195 | Bacteria | 1477 |
| 294 | Ga0075366_10238531 | 3300006195 | Bacteria | 1108 |
| 295 | Ga0097621_100026392 | 3300006237 | Bacteria | 4556 |
| 296 | Ga0097621_100045181 | 3300006237 | Bacteria | 3556 |
| 297 | Ga0097621_100172544 | 3300006237 | Bacteria | 1865 |
| 298 | Ga0097621_100397358 | 3300006237 | Bacteria | 1233 |
| 299 | Ga0075370_10013697 | 3300006353 | Bacteria | 4316 |
| 300 | Ga0068871_100007371 | 3300006358 | Bacteria | 7851 |
| 301 | Ga0068871_100078310 | 3300006358 | Bacteria | 2733 |
| 302 | Ga0068871_100078591 | 3300006358 | Bacteria | 2728 |
| 303 | Ga0068871_100697189 | 3300006358 | Bacteria | 930 |
| 304 | Ga0075428_100001802 | 3300006844 | Bacteria | 22929 |
| 305 | Ga0075428_100010200 | 3300006844 | Bacteria | 10427 |
| 306 | Ga0075428_100010216 | 3300006844 | Bacteria | 10422 |
| 307 | Ga0075428_100103269 | 3300006844 | Bacteria | 3109 |
| 308 | Ga0075428_100186326 | 3300006844 | Bacteria | 2245 |
| 309 | Ga0075430_100001483 | 3300006846 | Bacteria | 19129 |
| 310 | Ga0075430_100003861 | 3300006846 | Bacteria | 12622 |
| 311 | Ga0075430_100056700 | 3300006846 | Bacteria | 3295 |
| 312 | Ga0075430_100228568 | 3300006846 | Bacteria | 1543 |
| 313 | Ga0075431_100001018 | 3300006847 | Bacteria | 24961 |
| 314 | Ga0075431_100017410 | 3300006847 | Bacteria | 7302 |
| 315 | Ga0075431_100055912 | 3300006847 | Bacteria | 4071 |
| 316 | Ga0075431_100097874 | 3300006847 | Bacteria | 3029 |
| 317 | Ga0075431_100498757 | 3300006847 | Bacteria | 1209 |
| 318 | Ga0075433_10002052 | 3300006852 | Bacteria | 15222 |
| 319 | Ga0075433_10019693 | 3300006852 | Bacteria | 5628 |
| 320 | Ga0075433_10031620 | 3300006852 | Bacteria | 4525 |
| 321 | Ga0075433_10184035 | 3300006852 | Bacteria | 1859 |
| 322 | Ga0075433_10222295 | 3300006852 | Bacteria | 1677 |
| 323 | Ga0075433_10316169 | 3300006852 | Bacteria | 1382 |
| 324 | Ga0075433_10367375 | 3300006852 | Bacteria | 1271 |
| 325 | Ga0075434_100001473 | 3300006871 | Bacteria | 19815 |
| 326 | Ga0075434_100003814 | 3300006871 | Bacteria | 13476 |
| 327 | Ga0075434_100031871 | 3300006871 | Bacteria | 5198 |
| 328 | Ga0075434_100060134 | 3300006871 | Bacteria | 3778 |
| 329 | Ga0075434_100071882 | 3300006871 | Bacteria | 3451 |
| 330 | Ga0075434_100110966 | 3300006871 | Bacteria | 2753 |
| 331 | Ga0075434_100135632 | 3300006871 | Bacteria | 2480 |
| 332 | Ga0075434_100160232 | 3300006871 | Bacteria | 2270 |
| 333 | Ga0075434_100529770 | 3300006871 | Bacteria | 1198 |
| 334 | Ga0075429_100005294 | 3300006880 | Bacteria | 11102 |
| 335 | Ga0075429_100030953 | 3300006880 | Bacteria | 4651 |
| 336 | Ga0075429_100082444 | 3300006880 | Bacteria | 2803 |
| 337 | Ga0075429_100142052 | 3300006880 | Bacteria | 2102 |
| 338 | Ga0075429_100582962 | 3300006880 | Bacteria | 980 |
| 339 | Ga0068865_100000537 | 3300006881 | Bacteria | 21125 |
| 340 | Ga0068865_100021335 | 3300006881 | Bacteria | 4210 |
| 341 | Ga0068865_100063296 | 3300006881 | Bacteria | 2599 |
| 342 | Ga0068865_100112839 | 3300006881 | Bacteria | 2008 |
| 343 | Ga0068865_100405001 | 3300006881 | Bacteria | 1118 |
| 344 | Ga0075436_100026165 | 3300006914 | Bacteria | 4017 |
| 345 | Ga0075436_100249389 | 3300006914 | Bacteria | 1264 |
| 346 | Ga0075436_100406007 | 3300006914 | Bacteria | 988 |
| 347 | Ga0097620_100001767 | 3300006931 | Bacteria | 21986 |
| 348 | Ga0097620_100020117 | 3300006931 | Bacteria | 6701 |
| 349 | Ga0097620_100060567 | 3300006931 | Bacteria | 3814 |
| 350 | Ga0097620_100108648 | 3300006931 | Bacteria | 2835 |
| 351 | Ga0097620_100358823 | 3300006931 | Bacteria | 1552 |
| 352 | Ga0075435_100024384 | 3300007076 | Bacteria | 4694 |
| 353 | Ga0075435_100247914 | 3300007076 | Bacteria | 1516 |
| 354 | Ga0075435_100452317 | 3300007076 | Bacteria | 1107 |
| 355 | Ga0099794_10021139 | 3300007265 | Bacteria | 2954 |
| 356 | Ga0099795_10013800 | 3300007788 | Bacteria | 2490 |
| 357 | Ga0105240_10175883 | 3300009093 | Bacteria | 2530 |
| 358 | Ga0105240_10192164 | 3300009093 | Bacteria | 2399 |
| 359 | Ga0105240_10486749 | 3300009093 | Bacteria | 1374 |
| 360 | Ga0111539_10000200 | 3300009094 | Bacteria | 70531 |
| 361 | Ga0111539_10008538 | 3300009094 | Bacteria | 13014 |
| 362 | Ga0111539_10012114 | 3300009094 | Bacteria | 10820 |
| 363 | Ga0111539_10094883 | 3300009094 | Bacteria | 3505 |
| 364 | Ga0111539_10250757 | 3300009094 | Bacteria | 2061 |
| 365 | Ga0111539_10273679 | 3300009094 | Bacteria | 1965 |
| 366 | Ga0111539_10318811 | 3300009094 | Bacteria | 1809 |
| 367 | Ga0111539_10465254 | 3300009094 | Bacteria | 1472 |
| 368 | Ga0111539_10484660 | 3300009094 | Bacteria | 1440 |
| 369 | Ga0105245_10000888 | 3300009098 | Bacteria | 27206 |
| 370 | Ga0105245_10052837 | 3300009098 | Bacteria | 3645 |
| 371 | Ga0105245_10130933 | 3300009098 | Bacteria | 2353 |
| 372 | Ga0105247_10047293 | 3300009101 | Bacteria | 2641 |
| 373 | Ga0105247_10083629 | 3300009101 | Bacteria | 2016 |
| 374 | Ga0105247_10135152 | 3300009101 | Bacteria | 1611 |
| 375 | Ga0114129_10000205 | 3300009147 | Bacteria | 65770 |
| 376 | Ga0114129_10011166 | 3300009147 | Bacteria | 12804 |
| 377 | Ga0114129_10022387 | 3300009147 | Bacteria | 8973 |
| 378 | Ga0114129_10046549 | 3300009147 | Bacteria | 6095 |
| 379 | Ga0114129_10061852 | 3300009147 | Bacteria | 5232 |
| 380 | Ga0114129_10135358 | 3300009147 | Bacteria | 3381 |
| 381 | Ga0114129_10375341 | 3300009147 | Bacteria | 1879 |
| 382 | Ga0114129_10416397 | 3300009147 | Bacteria | 1768 |
| 383 | Ga0114129_11377658 | 3300009147 | Bacteria | 871 |
| 384 | Ga0105243_10076858 | 3300009148 | Bacteria | 2714 |
| 385 | Ga0105243_10085706 | 3300009148 | Bacteria | 2582 |
| 386 | Ga0105243_10114907 | 3300009148 | Bacteria | 2259 |
| 387 | Ga0105243_10148864 | 3300009148 | Bacteria | 2006 |
| 388 | Ga0105243_10163891 | 3300009148 | Bacteria | 1919 |
| 389 | Ga0105243_10196764 | 3300009148 | Bacteria | 1765 |
| 390 | Ga0105241_10000662 | 3300009174 | Bacteria | 25854 |
| 391 | Ga0105241_10165889 | 3300009174 | Bacteria | 1820 |
| 392 | Ga0105242_10014624 | 3300009176 | Bacteria | 6076 |
| 393 | Ga0105242_10053790 | 3300009176 | Bacteria | 3289 |
| 394 | Ga0105242_10312002 | 3300009176 | Bacteria | 1439 |
| 395 | Ga0105248_10002336 | 3300009177 | Bacteria | 21042 |
| 396 | Ga0105248_10031394 | 3300009177 | Bacteria | 5938 |
| 397 | Ga0105248_10460221 | 3300009177 | Bacteria | 1434 |
| 398 | Ga0105237_10039367 | 3300009545 | Bacteria | 4772 |
| 399 | Ga0105237_10046059 | 3300009545 | Bacteria | 4388 |
| 400 | Ga0105237_10067784 | 3300009545 | Bacteria | 3562 |
| 401 | Ga0105237_10140314 | 3300009545 | Bacteria | 2411 |
| 402 | Ga0105238_10231208 | 3300009551 | Bacteria | 1826 |
| 403 | Ga0105238_10261602 | 3300009551 | Bacteria | 1710 |
| 404 | Ga0105238_10279811 | 3300009551 | Bacteria | 1649 |
| 405 | Ga0105249_10029669 | 3300009553 | Bacteria | 4940 |
| 406 | Ga0105249_10061954 | 3300009553 | Bacteria | 3434 |
| 407 | Ga0105249_10142703 | 3300009553 | Bacteria | 2298 |
| 408 | Ga0105249_10325201 | 3300009553 | Bacteria | 1550 |
| 409 | Ga0105249_10394324 | 3300009553 | Bacteria | 1413 |
| 410 | Ga0105239_10054294 | 3300010375 | Bacteria | 4394 |
| 411 | Ga0105239_10080934 | 3300010375 | Bacteria | 3574 |
| 412 | Ga0105239_10197284 | 3300010375 | Bacteria | 2254 |
| 413 | Ga0105239_10349579 | 3300010375 | Bacteria | 1669 |
| 414 | Ga0105239_10544274 | 3300010375 | Bacteria | 1322 |
| 415 | Ga0105246_10007028 | 3300011119 | Bacteria | 6890 |
| 416 | Ga0105246_10096405 | 3300011119 | Bacteria | 2144 |
| 417 | Ga0105246_10276547 | 3300011119 | Bacteria | 1345 |
| 418 | Ga0105246_10376654 | 3300011119 | Bacteria | 1171 |
| 419 | Ga0105246_10483828 | 3300011119 | Bacteria | 1048 |
| 420 | Ga0157335_1001212 | 3300012492 | Bacteria | 1371 |
| 421 | Ga0157345_1001625 | 3300012498 | Bacteria | 1579 |
| 422 | Ga0157371_10117919 | 3300013102 | Bacteria | 1887 |
| 423 | Ga0157370_10149088 | 3300013104 | Bacteria | 2177 |
| 424 | Ga0157374_10021097 | 3300013296 | Bacteria | 5789 |
| 425 | Ga0157374_10146030 | 3300013296 | Bacteria | 2297 |
| 426 | Ga0157378_10073544 | 3300013297 | Bacteria | 3073 |
| 427 | Ga0157378_10184872 | 3300013297 | Bacteria | 1962 |
| 428 | Ga0157378_10243177 | 3300013297 | Bacteria | 1720 |
| 429 | Ga0163162_10112141 | 3300013306 | Bacteria | 2826 |
| 430 | Ga0163162_10156876 | 3300013306 | Bacteria | 2396 |
| 431 | Ga0163162_10440066 | 3300013306 | Bacteria | 1436 |
| 432 | Ga0163162_10590212 | 3300013306 | Bacteria | 1237 |
| 433 | Ga0157372_10038501 | 3300013307 | Bacteria | 5277 |
| 434 | Ga0157372_10943540 | 3300013307 | Bacteria | 1000 |
| 435 | Ga0157375_10001031 | 3300013308 | Bacteria | 24026 |
| 436 | Ga0157375_10027552 | 3300013308 | Bacteria | 5312 |
| 437 | Ga0157375_10413884 | 3300013308 | Bacteria | 1514 |
| 438 | Ga0157375_10469505 | 3300013308 | Bacteria | 1423 |
| 439 | Ga0163163_10003323 | 3300014325 | Bacteria | 13641 |
| 440 | Ga0163163_10278369 | 3300014325 | Bacteria | 1725 |
| 441 | Ga0163163_10516572 | 3300014325 | Bacteria | 1257 |
| 442 | Ga0157380_10000726 | 3300014326 | Bacteria | 20528 |
| 443 | Ga0157380_10026147 | 3300014326 | Bacteria | 4431 |
| 444 | Ga0157380_10141957 | 3300014326 | Bacteria | 2065 |
| 445 | Ga0157380_10564885 | 3300014326 | Bacteria | 1119 |
| 446 | Ga0157377_10000324 | 3300014745 | Bacteria | 21481 |
| 447 | Ga0157379_10001193 | 3300014968 | Bacteria | 21154 |
| 448 | Ga0157379_10034362 | 3300014968 | Bacteria | 4521 |
| 449 | Ga0157379_10041558 | 3300014968 | Bacteria | 4105 |
| 450 | Ga0157379_10089280 | 3300014968 | Bacteria | 2765 |
| 451 | Ga0157376_10012211 | 3300014969 | Bacteria | 6366 |
| 452 | Ga0157376_10036819 | 3300014969 | Bacteria | 3966 |
| 453 | Ga0157376_10047064 | 3300014969 | Bacteria | 3560 |
| 454 | Ga0163161_10001040 | 3300017792 | Bacteria | 21136 |
| 455 | Ga0163161_10037784 | 3300017792 | Bacteria | 3462 |
| 456 | Ga0163161_10066417 | 3300017792 | Bacteria | 2634 |
| 457 | Ga0213874_10020981 | 3300021377 | Bacteria | 1797 |
| 458 | Ga0213876_10015303 | 3300021384 | Bacteria | 4061 |
| 459 | Ga0213876_10092962 | 3300021384 | Bacteria | 1598 |
| 460 | Ga0207666_1000034 | 3300025271 | Bacteria | 28645 |
| 461 | Ga0207666_1003558 | 3300025271 | Bacteria | 1918 |
| 462 | Ga0207673_1000061 | 3300025290 | Bacteria | 9198 |
| 463 | Ga0207697_10000280 | 3300025315 | Bacteria | 28276 |
| 464 | Ga0207656_10080624 | 3300025321 | Bacteria | 1462 |
| 465 | Ga0207653_10009627 | 3300025885 | Bacteria | 3012 |
| 466 | Ga0207682_10000134 | 3300025893 | Bacteria | 33520 |
| 467 | Ga0207692_10000073 | 3300025898 | Bacteria | 29005 |
| 468 | Ga0207692_10006215 | 3300025898 | Bacteria | 4836 |
| 469 | Ga0207692_10391109 | 3300025898 | Bacteria | 865 |
| 470 | Ga0207642_10010308 | 3300025899 | Bacteria | 3289 |
| 471 | Ga0207642_10141071 | 3300025899 | Bacteria | 1271 |
| 472 | Ga0207710_10003581 | 3300025900 | Bacteria | 6895 |
| 473 | Ga0207710_10007452 | 3300025900 | Bacteria | 4633 |
| 474 | Ga0207710_10010170 | 3300025900 | Bacteria | 3958 |
| 475 | Ga0207710_10037981 | 3300025900 | Bacteria | 2128 |
| 476 | Ga0207710_10046923 | 3300025900 | Bacteria | 1929 |
| 477 | Ga0207688_10000526 | 3300025901 | Bacteria | 18554 |
| 478 | Ga0207688_10000939 | 3300025901 | Bacteria | 14737 |
| 479 | Ga0207680_10014420 | 3300025903 | Bacteria | 4090 |
| 480 | Ga0207680_10033276 | 3300025903 | Bacteria | 2939 |
| 481 | Ga0207680_10040227 | 3300025903 | Bacteria | 2719 |
| 482 | Ga0207680_10047176 | 3300025903 | Bacteria | 2551 |
| 483 | Ga0207647_10016576 | 3300025904 | Bacteria | 5025 |
| 484 | Ga0207647_10027189 | 3300025904 | Bacteria | 3732 |
| 485 | Ga0207647_10042906 | 3300025904 | Bacteria | 2834 |
| 486 | Ga0207647_10115384 | 3300025904 | Bacteria | 1586 |
| 487 | Ga0207685_10002787 | 3300025905 | Bacteria | 4091 |
| 488 | Ga0207685_10026299 | 3300025905 | Bacteria | 2022 |
| 489 | Ga0207699_10001462 | 3300025906 | Bacteria | 11208 |
| 490 | Ga0207699_10001951 | 3300025906 | Bacteria | 9731 |
| 491 | Ga0207645_10020382 | 3300025907 | Bacteria | 4341 |
| 492 | Ga0207645_10037279 | 3300025907 | Bacteria | 3119 |
| 493 | Ga0207645_10039728 | 3300025907 | Bacteria | 3014 |
| 494 | Ga0207643_10000300 | 3300025908 | Bacteria | 34225 |
| 495 | Ga0207643_10000475 | 3300025908 | Bacteria | 25958 |
| 496 | Ga0207643_10136339 | 3300025908 | Bacteria | 1463 |
| 497 | Ga0207684_10171941 | 3300025910 | Bacteria | 1868 |
| 498 | Ga0207654_10006328 | 3300025911 | Bacteria | 5951 |
| 499 | Ga0207654_10055045 | 3300025911 | Bacteria | 2302 |
| 500 | Ga0207654_10065192 | 3300025911 | Bacteria | 2144 |
| 501 | Ga0207707_10026952 | 3300025912 | Bacteria | 5023 |
| 502 | Ga0207707_10069245 | 3300025912 | Bacteria | 3075 |
| 503 | Ga0207707_10203838 | 3300025912 | Bacteria | 1724 |
| 504 | Ga0207707_10376174 | 3300025912 | Bacteria | 1221 |
| 505 | Ga0207695_10279293 | 3300025913 | Bacteria | 1564 |
| 506 | Ga0207693_10005568 | 3300025915 | Bacteria | 10480 |
| 507 | Ga0207693_10022202 | 3300025915 | Bacteria | 5044 |
| 508 | Ga0207693_10032414 | 3300025915 | Bacteria | 4124 |
| 509 | Ga0207693_10051931 | 3300025915 | Bacteria | 3215 |
| 510 | Ga0207693_10145284 | 3300025915 | Bacteria | 1865 |
| 511 | Ga0207693_10152860 | 3300025915 | Bacteria | 1815 |
| 512 | Ga0207693_10288677 | 3300025915 | Bacteria | 1285 |
| 513 | Ga0207663_10032864 | 3300025916 | Bacteria | 3084 |
| 514 | Ga0207660_10126548 | 3300025917 | Bacteria | 1941 |
| 515 | Ga0207660_10260293 | 3300025917 | Bacteria | 1372 |
| 516 | Ga0207660_10409617 | 3300025917 | Bacteria | 1092 |
| 517 | Ga0207662_10000341 | 3300025918 | Bacteria | 21083 |
| 518 | Ga0207662_10000768 | 3300025918 | Bacteria | 14730 |
| 519 | Ga0207662_10138086 | 3300025918 | Bacteria | 1542 |
| 520 | Ga0207657_10008236 | 3300025919 | Bacteria | 10611 |
| 521 | Ga0207657_10036372 | 3300025919 | Bacteria | 4406 |
| 522 | Ga0207657_10080547 | 3300025919 | Bacteria | 2737 |
| 523 | Ga0207657_10081113 | 3300025919 | Bacteria | 2726 |
| 524 | Ga0207649_10000271 | 3300025920 | Bacteria | 40924 |
| 525 | Ga0207649_10056986 | 3300025920 | Bacteria | 2441 |
| 526 | Ga0207652_10079199 | 3300025921 | Bacteria | 2870 |
| 527 | Ga0207652_10101929 | 3300025921 | Bacteria | 2536 |
| 528 | Ga0207652_10154955 | 3300025921 | Bacteria | 2052 |
| 529 | Ga0207652_10326611 | 3300025921 | Bacteria | 1385 |
| 530 | Ga0207681_10000658 | 3300025923 | Bacteria | 22886 |
| 531 | Ga0207681_10387498 | 3300025923 | Bacteria | 1126 |
| 532 | Ga0207681_10393816 | 3300025923 | Bacteria | 1117 |
| 533 | Ga0207694_10037102 | 3300025924 | Bacteria | 3741 |
| 534 | Ga0207694_10228090 | 3300025924 | Bacteria | 1521 |
| 535 | Ga0207694_10290516 | 3300025924 | Bacteria | 1344 |
| 536 | Ga0207650_10014779 | 3300025925 | Bacteria | 5429 |
| 537 | Ga0207650_10031270 | 3300025925 | Bacteria | 3842 |
| 538 | Ga0207650_10044066 | 3300025925 | Bacteria | 3278 |
| 539 | Ga0207650_10088298 | 3300025925 | Bacteria | 2364 |
| 540 | Ga0207650_10296223 | 3300025925 | Bacteria | 1320 |
| 541 | Ga0207659_10000177 | 3300025926 | Bacteria | 38217 |
| 542 | Ga0207659_10008323 | 3300025926 | Bacteria | 6431 |
| 543 | Ga0207659_10058879 | 3300025926 | Bacteria | 2759 |
| 544 | Ga0207659_10207931 | 3300025926 | Bacteria | 1567 |
| 545 | Ga0207687_10000495 | 3300025927 | Bacteria | 26551 |
| 546 | Ga0207687_10008827 | 3300025927 | Bacteria | 6588 |
| 547 | Ga0207687_10011220 | 3300025927 | Bacteria | 5851 |
| 548 | Ga0207687_10071861 | 3300025927 | Bacteria | 2473 |
| 549 | Ga0207687_10078689 | 3300025927 | Bacteria | 2375 |
| 550 | Ga0207700_10000624 | 3300025928 | Bacteria | 20699 |
| 551 | Ga0207700_10012388 | 3300025928 | Bacteria | 5498 |
| 552 | Ga0207700_10082085 | 3300025928 | Bacteria | 2520 |
| 553 | Ga0207700_10223904 | 3300025928 | Bacteria | 1596 |
| 554 | Ga0207700_10517163 | 3300025928 | Bacteria | 1057 |
| 555 | Ga0207664_10002018 | 3300025929 | Bacteria | 13367 |
| 556 | Ga0207664_10099185 | 3300025929 | Bacteria | 2403 |
| 557 | Ga0207664_10120720 | 3300025929 | Bacteria | 2193 |
| 558 | Ga0207664_10141511 | 3300025929 | Bacteria | 2035 |
| 559 | Ga0207644_10000279 | 3300025931 | Bacteria | 33969 |
| 560 | Ga0207644_10006733 | 3300025931 | Bacteria | 7486 |
| 561 | Ga0207644_10007407 | 3300025931 | Bacteria | 7152 |
| 562 | Ga0207644_10008269 | 3300025931 | Bacteria | 6816 |
| 563 | Ga0207644_10155311 | 3300025931 | Bacteria | 1774 |
| 564 | Ga0207690_10008301 | 3300025932 | Bacteria | 6160 |
| 565 | Ga0207690_10024537 | 3300025932 | Bacteria | 3777 |
| 566 | Ga0207690_10035634 | 3300025932 | Bacteria | 3216 |
| 567 | Ga0207690_10239543 | 3300025932 | Bacteria | 1397 |
| 568 | Ga0207690_10244729 | 3300025932 | Bacteria | 1383 |
| 569 | Ga0207706_10005939 | 3300025933 | Bacteria | 11357 |
| 570 | Ga0207706_10016238 | 3300025933 | Bacteria | 6727 |
| 571 | Ga0207706_10081326 | 3300025933 | Bacteria | 2847 |
| 572 | Ga0207706_10114454 | 3300025933 | Bacteria | 2372 |
| 573 | Ga0207686_10005492 | 3300025934 | Bacteria | 6803 |
| 574 | Ga0207686_10028899 | 3300025934 | Bacteria | 3264 |
| 575 | Ga0207686_10141983 | 3300025934 | Bacteria | 1661 |
| 576 | Ga0207686_10181080 | 3300025934 | Bacteria | 1494 |
| 577 | Ga0207709_10000952 | 3300025935 | Bacteria | 21659 |
| 578 | Ga0207709_10028423 | 3300025935 | Bacteria | 3233 |
| 579 | Ga0207709_10080410 | 3300025935 | Bacteria | 2099 |
| 580 | Ga0207670_10000491 | 3300025936 | Bacteria | 21793 |
| 581 | Ga0207670_10021268 | 3300025936 | Bacteria | 4000 |
| 582 | Ga0207670_10038696 | 3300025936 | Bacteria | 3117 |
| 583 | Ga0207670_10170803 | 3300025936 | Bacteria | 1630 |
| 584 | Ga0207669_10008197 | 3300025937 | Bacteria | 4894 |
| 585 | Ga0207669_10013651 | 3300025937 | Bacteria | 4044 |
| 586 | Ga0207669_10179490 | 3300025937 | Bacteria | 1516 |
| 587 | Ga0207669_10342700 | 3300025937 | Bacteria | 1151 |
| 588 | Ga0207704_10008932 | 3300025938 | Bacteria | 4816 |
| 589 | Ga0207704_10080833 | 3300025938 | Bacteria | 2100 |
| 590 | Ga0207704_10125902 | 3300025938 | Bacteria | 1764 |
| 591 | Ga0207704_10471627 | 3300025938 | Bacteria | 1006 |
| 592 | Ga0207665_10001758 | 3300025939 | Bacteria | 14547 |
| 593 | Ga0207665_10045219 | 3300025939 | Bacteria | 2948 |
| 594 | Ga0207665_10093758 | 3300025939 | Bacteria | 2085 |
| 595 | Ga0207665_10176413 | 3300025939 | Bacteria | 1546 |
| 596 | Ga0207691_10002815 | 3300025940 | Bacteria | 16961 |
| 597 | Ga0207691_10024993 | 3300025940 | Bacteria | 5612 |
| 598 | Ga0207691_10110030 | 3300025940 | Bacteria | 2451 |
| 599 | Ga0207691_10160654 | 3300025940 | Bacteria | 1971 |
| 600 | Ga0207711_10001570 | 3300025941 | Bacteria | 21117 |
| 601 | Ga0207711_10008985 | 3300025941 | Bacteria | 8353 |
| 602 | Ga0207711_10025784 | 3300025941 | Bacteria | 4929 |
| 603 | Ga0207711_10331164 | 3300025941 | Bacteria | 1408 |
| 604 | Ga0207711_10343123 | 3300025941 | Bacteria | 1382 |
| 605 | Ga0207689_10003227 | 3300025942 | Bacteria | 14940 |
| 606 | Ga0207689_10017396 | 3300025942 | Bacteria | 6084 |
| 607 | Ga0207689_10027735 | 3300025942 | Bacteria | 4739 |
| 608 | Ga0207689_10050098 | 3300025942 | Bacteria | 3444 |
| 609 | Ga0207661_10000642 | 3300025944 | Bacteria | 22523 |
| 610 | Ga0207661_10047017 | 3300025944 | Bacteria | 3424 |
| 611 | Ga0207679_10000046 | 3300025945 | Bacteria | 119975 |
| 612 | Ga0207679_10025487 | 3300025945 | Bacteria | 4068 |
| 613 | Ga0207679_10528986 | 3300025945 | Bacteria | 1055 |
| 614 | Ga0207667_10007962 | 3300025949 | Bacteria | 12641 |
| 615 | Ga0207667_10440264 | 3300025949 | Bacteria | 1325 |
| 616 | Ga0207667_10612435 | 3300025949 | Bacteria | 1097 |
| 617 | Ga0207651_10000214 | 3300025960 | Bacteria | 24891 |
| 618 | Ga0207651_10008018 | 3300025960 | Bacteria | 5667 |
| 619 | Ga0207651_10531117 | 3300025960 | Bacteria | 1021 |
| 620 | Ga0207712_10003297 | 3300025961 | Bacteria | 10236 |
| 621 | Ga0207712_10019776 | 3300025961 | Bacteria | 4401 |
| 622 | Ga0207712_10035776 | 3300025961 | Bacteria | 3377 |
| 623 | Ga0207712_10199811 | 3300025961 | Bacteria | 1584 |
| 624 | Ga0207712_10228959 | 3300025961 | Bacteria | 1491 |
| 625 | Ga0207668_10000537 | 3300025972 | Bacteria | 23803 |
| 626 | Ga0207668_10082537 | 3300025972 | Bacteria | 2335 |
| 627 | Ga0207640_10002737 | 3300025981 | Bacteria | 9439 |
| 628 | Ga0207640_10060902 | 3300025981 | Bacteria | 2497 |
| 629 | Ga0207640_10107011 | 3300025981 | Bacteria | 1974 |
| 630 | Ga0207658_10001147 | 3300025986 | Bacteria | 21223 |
| 631 | Ga0207658_10018395 | 3300025986 | Bacteria | 4826 |
| 632 | Ga0207658_10188011 | 3300025986 | Bacteria | 1714 |
| 633 | Ga0207658_10228487 | 3300025986 | Bacteria | 1569 |
| 634 | Ga0207658_10584427 | 3300025986 | Bacteria | 1002 |
| 635 | Ga0207677_10015705 | 3300026023 | Bacteria | 4463 |
| 636 | Ga0207677_10047121 | 3300026023 | Bacteria | 2892 |
| 637 | Ga0207703_10000940 | 3300026035 | Bacteria | 28248 |
| 638 | Ga0207703_10023508 | 3300026035 | Bacteria | 4842 |
| 639 | Ga0207703_10243501 | 3300026035 | Bacteria | 1618 |
| 640 | Ga0207703_10328878 | 3300026035 | Bacteria | 1401 |
| 641 | Ga0207639_10000852 | 3300026041 | Bacteria | 20713 |
| 642 | Ga0207639_10016375 | 3300026041 | Bacteria | 5244 |
| 643 | Ga0207639_10188342 | 3300026041 | Bacteria | 1761 |
| 644 | Ga0207678_10007136 | 3300026067 | Bacteria | 9914 |
| 645 | Ga0207678_10015442 | 3300026067 | Bacteria | 6713 |
| 646 | Ga0207678_10018849 | 3300026067 | Bacteria | 6061 |
| 647 | Ga0207678_10032795 | 3300026067 | Bacteria | 4526 |
| 648 | Ga0207678_10354333 | 3300026067 | Bacteria | 1266 |
| 649 | Ga0207708_10001006 | 3300026075 | Bacteria | 21086 |
| 650 | Ga0207708_10003324 | 3300026075 | Bacteria | 11837 |
| 651 | Ga0207708_10027504 | 3300026075 | Bacteria | 4306 |
| 652 | Ga0207708_10054858 | 3300026075 | Bacteria | 3039 |
| 653 | Ga0207708_10240172 | 3300026075 | Bacteria | 1457 |
| 654 | Ga0207702_10002642 | 3300026078 | Bacteria | 16821 |
| 655 | Ga0207702_10463311 | 3300026078 | Bacteria | 1231 |
| 656 | Ga0207702_10474442 | 3300026078 | Bacteria | 1217 |
| 657 | Ga0207702_10539263 | 3300026078 | Bacteria | 1140 |
| 658 | Ga0207702_10685683 | 3300026078 | Bacteria | 1009 |
| 659 | Ga0207641_10001370 | 3300026088 | Bacteria | 24094 |
| 660 | Ga0207641_10028161 | 3300026088 | Bacteria | 4641 |
| 661 | Ga0207641_10714545 | 3300026088 | Bacteria | 987 |
| 662 | Ga0207648_10002036 | 3300026089 | Bacteria | 22064 |
| 663 | Ga0207648_10087764 | 3300026089 | Bacteria | 2715 |
| 664 | Ga0207648_10157247 | 3300026089 | Bacteria | 2007 |
| 665 | Ga0207676_10009322 | 3300026095 | Bacteria | 6984 |
| 666 | Ga0207676_10010200 | 3300026095 | Bacteria | 6683 |
| 667 | Ga0207676_10012380 | 3300026095 | Bacteria | 6111 |
| 668 | Ga0207676_10046571 | 3300026095 | Bacteria | 3356 |
| 669 | Ga0207674_10002956 | 3300026116 | Bacteria | 21106 |
| 670 | Ga0207674_10091332 | 3300026116 | Bacteria | 3035 |
| 671 | Ga0207674_10199991 | 3300026116 | Bacteria | 1948 |
| 672 | Ga0207675_100006209 | 3300026118 | Bacteria | 11346 |
| 673 | Ga0207675_100010512 | 3300026118 | Bacteria | 8673 |
| 674 | Ga0207675_100059869 | 3300026118 | Bacteria | 3555 |
| 675 | Ga0207675_100159664 | 3300026118 | Bacteria | 2150 |
| 676 | Ga0207675_100178387 | 3300026118 | Bacteria | 2033 |
| 677 | Ga0207683_10001099 | 3300026121 | Bacteria | 24626 |
| 678 | Ga0207683_10004449 | 3300026121 | Bacteria | 12105 |
| 679 | Ga0207683_10005034 | 3300026121 | Bacteria | 11346 |
| 680 | Ga0207683_10032902 | 3300026121 | Bacteria | 4505 |
| 681 | Ga0207683_10048304 | 3300026121 | Bacteria | 3726 |
| 682 | Ga0207698_10007930 | 3300026142 | Bacteria | 6690 |
| 683 | Ga0207698_10097681 | 3300026142 | Bacteria | 2424 |
| 684 | Ga0207698_10143522 | 3300026142 | Bacteria | 2061 |
| 685 | Ga0209995_1016685 | 3300027471 | Bacteria | 1207 |
| 686 | Ga0210002_1014782 | 3300027617 | Bacteria | 1227 |
| 687 | Ga0209983_1003857 | 3300027665 | Bacteria | 3176 |
| 688 | Ga0209971_1045187 | 3300027682 | Bacteria | 1062 |
| 689 | Ga0209966_1003556 | 3300027695 | Bacteria | 2625 |
| 690 | Ga0209998_10001538 | 3300027717 | Bacteria | 5544 |
| 691 | Ga0209998_10006389 | 3300027717 | Bacteria | 2447 |
| 692 | Ga0209813_10103483 | 3300027866 | Bacteria | 972 |
| 693 | Ga0209974_10012529 | 3300027876 | Bacteria | 2834 |
| 694 | Ga0207428_10000082 | 3300027907 | Bacteria | 133684 |
| 695 | Ga0207428_10001692 | 3300027907 | Bacteria | 22664 |
| 696 | Ga0207428_10029661 | 3300027907 | Bacteria | 4530 |
| 697 | Ga0207428_10054476 | 3300027907 | Bacteria | 3186 |
| 698 | Ga0207428_10112059 | 3300027907 | Bacteria | 2099 |
| 699 | Ga0207428_10175649 | 3300027907 | Bacteria | 1620 |
| 700 | Ga0268266_10006793 | 3300028379 | Bacteria | 10427 |
| 701 | Ga0268266_10092290 | 3300028379 | Bacteria | 2656 |
| 702 | Ga0268266_10308494 | 3300028379 | Bacteria | 1478 |
| 703 | Ga0268266_10536164 | 3300028379 | Bacteria | 1120 |
| 704 | Ga0268265_10000817 | 3300028380 | Bacteria | 29538 |
| 705 | Ga0268265_10025906 | 3300028380 | Bacteria | 4169 |
| 706 | Ga0268265_10315147 | 3300028380 | Bacteria | 1414 |
| 707 | Ga0268264_10001227 | 3300028381 | Bacteria | 24655 |
| 708 | Ga0268264_10016466 | 3300028381 | Bacteria | 6053 |
| 709 | Ga0268264_10053393 | 3300028381 | Bacteria | 3371 |
| 710 | Ga0268264_10539477 | 3300028381 | Bacteria | 1143 |
| 711 | Ga0268264_10896567 | 3300028381 | Bacteria | 890 |
| 712 | Ga0265338_10074286 | 3300028800 | Bacteria | 2893 |
| 713 | Ga0265330_10029267 | 3300031235 | Bacteria | 2478 |
| 714 | Ga0265332_10002206 | 3300031238 | Bacteria | 9991 |
| 715 | Ga0265332_10041593 | 3300031238 | Bacteria | 1988 |
| 716 | Ga0265325_10000043 | 3300031241 | Bacteria | 89158 |
| 717 | Ga0265325_10006484 | 3300031241 | Bacteria | 7095 |
| 718 | Ga0265325_10047267 | 3300031241 | Bacteria | 2228 |
| 719 | Ga0265325_10058826 | 3300031241 | Bacteria | 1956 |
| 720 | Ga0265340_10001844 | 3300031247 | Bacteria | 12103 |
| 721 | Ga0265340_10042254 | 3300031247 | Bacteria | 2238 |
| 722 | Ga0265340_10081766 | 3300031247 | Bacteria | 1520 |
| 723 | Ga0265339_10000071 | 3300031249 | Bacteria | 88416 |
| 724 | Ga0265339_10004871 | 3300031249 | Bacteria | 9058 |
| 725 | Ga0265339_10130160 | 3300031249 | Bacteria | 1288 |
| 726 | Ga0265331_10093489 | 3300031250 | Bacteria | 1389 |
| 727 | Ga0265316_10093930 | 3300031344 | Bacteria | 2285 |
| 728 | Ga0265316_10210451 | 3300031344 | Bacteria | 1438 |
| 729 | Ga0265313_10000087 | 3300031595 | Bacteria | 91132 |
| 730 | Ga0265313_10000415 | 3300031595 | Bacteria | 45805 |
| 731 | Ga0265313_10012080 | 3300031595 | Bacteria | 5317 |
| 732 | Ga0316579_10041829 | 3300031691 | Bacteria | 2127 |
| 733 | Ga0265314_10003840 | 3300031711 | Bacteria | 14341 |
| 734 | Ga0265342_10001555 | 3300031712 | Bacteria | 21212 |
| 735 | Ga0265342_10083995 | 3300031712 | Bacteria | 1834 |
| 736 | Ga0265342_10256916 | 3300031712 | Bacteria | 931 |
| 737 | Ga0316583_10002720 | 3300032133 | Bacteria | 6181 |
| 738 | Ga0373930_0001507 | 3300034816 | Bacteria | 3483 |
| 739 | Ga0373948_0000117 | 3300034817 | Bacteria | 8265 |
| 740 | Ga0373948_0003110 | 3300034817 | Bacteria | 2522 |
| 741 | Ga0373948_0043525 | 3300034817 | Bacteria | 946 |
| 742 | Ga0373950_0000396 | 3300034818 | Bacteria | 5346 |
| 743 | Ga0373950_0008305 | 3300034818 | Bacteria | 1631 |
| 744 | Ga0373958_0010662 | 3300034819 | Bacteria | 1537 |
| 745 | Ga0373938_0005774 | 3300034957 | Bacteria | 2115 |
| 746 | Ga0373938_0014640 | 3300034957 | Bacteria | 1508 |
| 747 | Ga0373938_0050141 | 3300034957 | Bacteria | 952 |
| 748 | Ga0373926_0006274 | 3300035083 | Bacteria | 3946 |
| 749 | Ga0373926_0036369 | 3300035083 | Bacteria | 1749 |
| 750 | Ga0373926_0068555 | 3300035083 | Bacteria | 1300 |
| 751 | Ga0373928_0006026 | 3300035084 | Bacteria | 2323 |
| 752 | Ga0373929_0000961 | 3300035085 | Bacteria | 5594 |
| 753 | Ga0373934_0009209 | 3300035086 | Bacteria | 3696 |
| 754 | Ga0373934_0074324 | 3300035086 | Bacteria | 1362 |
| 755 | Ga0373940_0001118 | 3300035088 | Bacteria | 4677 |
| 756 | Ga0373940_0041710 | 3300035088 | Bacteria | 1262 |
| 757 | Ga0373944_0003334 | 3300035089 | Bacteria | 4138 |
| 758 | Ga0373944_0007277 | 3300035089 | Bacteria | 2961 |
| 759 | Ga0373944_0009507 | 3300035089 | Bacteria | 2637 |
| 760 | Ga0373949_0004216 | 3300035090 | Bacteria | 3319 |
| 761 | Ga0373949_0005436 | 3300035090 | Bacteria | 2841 |
| 762 | Ga0373951_0013415 | 3300035091 | Bacteria | 1842 |
| 763 | Ga0373952_0002861 | 3300035092 | Bacteria | 3119 |
| 764 | Ga0373923_0007076 | 3300035111 | Bacteria | 3924 |
| 765 | Ga0373923_0164423 | 3300035111 | Bacteria | 1014 |
| 766 | Ga0373932_0000255 | 3300035112 | Bacteria | 16212 |
| 767 | Ga0373932_0000703 | 3300035112 | Bacteria | 10116 |
| 768 | Ga0373932_0007745 | 3300035112 | Bacteria | 2563 |
| 769 | Ga0373936_0005552 | 3300035113 | Bacteria | 4761 |
| 770 | Ga0373936_0045306 | 3300035113 | Bacteria | 1771 |
| 771 | Ga0373936_0079399 | 3300035113 | Bacteria | 1364 |
| 772 | Ga0373939_0002267 | 3300035114 | Bacteria | 4551 |
| 773 | Ga0373939_0021302 | 3300035114 | Bacteria | 1772 |
| 774 | Ga0373941_0004229 | 3300035115 | Bacteria | 3300 |
| 775 | Ga0373945_0026010 | 3300035116 | Bacteria | 2036 |
| 776 | Ga0373953_0001186 | 3300035117 | Bacteria | 7410 |
| 777 | Ga0373953_0017303 | 3300035117 | Bacteria | 2648 |
| 778 | Ga0373953_0125982 | 3300035117 | Bacteria | 1090 |
| 779 | Ga0373956_0013246 | 3300035119 | Bacteria | 3430 |
| 780 | Ga0373956_0027556 | 3300035119 | Bacteria | 2468 |
| 781 | Ga0373956_0046875 | 3300035119 | Bacteria | 1932 |
| 782 | Ga0373957_0057040 | 3300035120 | Bacteria | 1505 |
| 783 | Ga0373960_0005847 | 3300035121 | Bacteria | 2862 |
| 784 | Ga0373960_0007815 | 3300035121 | Bacteria | 2543 |
| 785 | Ga0373960_0026800 | 3300035121 | Bacteria | 1577 |
| 786 | Ga0373943_0008559 | 3300035170 | Bacteria | 4586 |
| 787 | Ga0373943_0021286 | 3300035170 | Bacteria | 2993 |
| 788 | Ga0373943_0051473 | 3300035170 | Bacteria | 2027 |
| 789 | Ga0373946_0076193 | 3300035171 | Bacteria | 1459 |
| 790 | Ga0373955_0008111 | 3300035172 | Bacteria | 4859 |
| 791 | Ga0373942_0012638 | 3300035207 | Bacteria | 2021 |
| 792 | Ga0373942_0053398 | 3300035207 | Bacteria | 1139 |
| 793 | Ga0373961_0003260 | 3300035241 | Bacteria | 4042 |
| 794 | Ga0373961_0003856 | 3300035241 | Bacteria | 3659 |
| 795 | Ga0373961_0025734 | 3300035241 | Bacteria | 1602 |
| 796 | Ga0373961_0059420 | 3300035241 | Bacteria | 1156 |
| 797 | Ga0373962_0019976 | 3300035242 | Bacteria | 1756 |
| 798 | Ga0373962_0035508 | 3300035242 | Bacteria | 1384 |
| 799 | Ga0373924_0032147 | 3300035410 | Bacteria | 2113 |
| 800 | Ga0373924_0234516 | 3300035410 | Bacteria | 811 |
| 801 | Ga0373931_0007315 | 3300035691 | Bacteria | 5195 |
| 802 | Ga0373931_0023751 | 3300035691 | Bacteria | 3097 |
| 803 | Ga0373931_0056043 | 3300035691 | Bacteria | 2111 |
| 804 | Ga0373935_0006957 | 3300035692 | Bacteria | 6753 |
| 805 | Ga0373935_0131752 | 3300035692 | Bacteria | 1680 |
| 806 | Ga0373935_0411473 | 3300035692 | Bacteria | 972 |
| 807 | Ga0373927_0036539 | 3300035695 | Bacteria | 3194 |
| 808 | Ga0373927_0048608 | 3300035695 | Bacteria | 2744 |
| 809 | Ga0373927_0077672 | 3300035695 | Bacteria | 2150 |
| 810 | Ga0373933_0001224 | 3300035724 | Bacteria | 15196 |
| 811 | Ga0373933_0013762 | 3300035724 | Bacteria | 4488 |
| 812 | Ga0373933_0024904 | 3300035724 | Bacteria | 3429 |
| 813 | Ga0373933_0049313 | 3300035724 | Bacteria | 2510 |
| 814 | Ga0373947_0032762 | 3300035725 | Bacteria | 3064 |
| 815 | Ga0373947_0083977 | 3300035725 | Bacteria | 1975 |
| 816 | Ga0373937_0000849 | 3300036401 | Bacteria | 26229 |
| 817 | Ga0373937_0016602 | 3300036401 | Bacteria | 6541 |
| 818 | Ga0373937_0034021 | 3300036401 | Bacteria | 4633 |
| 819 | Ga0373937_0047581 | 3300036401 | Bacteria | 3924 |
| 820 | Ga0373937_0138833 | 3300036401 | Bacteria | 2273 |
| 821 | Ga0316582_0054719 | 3300036647 | Bacteria | 2542 |
| 822 | Ga0373925_0023317 | 3300037068 | Bacteria | 4516 |
| 823 | Ga0373925_0033508 | 3300037068 | Bacteria | 3785 |
| 824 | Ga0373925_0042182 | 3300037068 | Bacteria | 3384 |
| 825 | Ga0395900_0184789 | 3300037418 | Bacteria | 2116 |
| 826 | Ga0395901_0098532 | 3300038443 | Bacteria | 3065 |
| 827 | Ga0436365_1174025 | 3300039437 | Bacteria | 6936 |
| 828 | Ga0436365_1295969 | 3300039437 | Bacteria | 2534 |
| 829 | Ga0436360_0816965 | 3300039438 | Bacteria | 1154 |
| 830 | Ga0436361_0189718 | 3300039447 | Bacteria | 5293 |
| 831 | Ga0436363_0315669 | 3300039450 | Bacteria | 1810 |
| 832 | Ga0436363_0817259 | 3300039450 | Bacteria | 905 |
| 833 | Ga0436362_0096256 | 3300039453 | Bacteria | 5488 |
| 834 | Ga0439453_0018755 | 3300041408 | Bacteria | 1226 |
| 835 | Ga0451789_0709386 | 3300041443 | Bacteria | 1038 |
| 836 | Ga0451841_1135030 | 3300041498 | Bacteria | 1156 |
| 837 | Ga0439450_003393 | 3300042008 | Bacteria | 2630 |
| 838 | Ga0439435_0002597 | 3300042436 | Bacteria | 3617 |
| 839 | Ga0439460_0058776 | 3300042461 | Bacteria | 1169 |
| 840 | Ga0451577_0052576 | 3300042876 | Bacteria | 3637 |
| 841 | Ga0439440_0077929 | 3300042993 | Bacteria | 872 |
| 842 | Ga0466963_0015149 | 3300044694 | Bacteria | 4769 |
| 843 | Ga0466957_0225226 | 3300044842 | Bacteria | 1239 |
| 844 | Ga0466959_0313519 | 3300045049 | Bacteria | 1073 |
| 845 | Ga0451576_0040952 | 3300045051 | Bacteria | 4898 |
| 846 | Ga0466958_0008358 | 3300045836 | Bacteria | 5737 |
| 847 | Ga0466958_0079220 | 3300045836 | Bacteria | 2020 |
| 848 | Ga0495617_013564 | 3300046452 | Bacteria | 2774 |
| 849 | Ga0495592_0031170 | 3300046454 | Bacteria | 4030 |
| 850 | Ga0495592_0114759 | 3300046454 | Bacteria | 1902 |
| 851 | Ga0495592_0124090 | 3300046454 | Bacteria | 1813 |
| 852 | Ga0495592_0330381 | 3300046454 | Bacteria | 983 |
| 853 | Ga0495603_0033576 | 3300046455 | Bacteria | 3087 |
| 854 | Ga0495590_0065920 | 3300046457 | Bacteria | 1268 |
| 855 | Ga0495629_0000062 | 3300046459 | Bacteria | 97169 |
| 856 | Ga0495638_0121599 | 3300046460 | Bacteria | 1542 |
| 857 | Ga0495641_0042022 | 3300046461 | Bacteria | 2121 |
| 858 | Ga0495641_0072448 | 3300046461 | Bacteria | 1545 |
| 859 | Ga0495651_0020865 | 3300046462 | Bacteria | 5085 |
| 860 | Ga0495651_0022743 | 3300046462 | Bacteria | 4873 |
| 861 | Ga0495651_0150412 | 3300046462 | Bacteria | 1679 |
| 862 | Ga0495653_0048987 | 3300046463 | Bacteria | 3258 |
| 863 | Ga0495653_0117336 | 3300046463 | Bacteria | 1902 |
| 864 | Ga0495580_0092029 | 3300046472 | Bacteria | 2110 |
| 865 | Ga0495582_0017090 | 3300046473 | Bacteria | 3971 |
| 866 | Ga0495582_0232168 | 3300046473 | Bacteria | 1056 |
| 867 | Ga0495639_0008961 | 3300046475 | Bacteria | 4288 |
| 868 | Ga0495639_0035781 | 3300046475 | Bacteria | 2222 |
| 869 | Ga0495662_0006739 | 3300046476 | Bacteria | 5719 |
| 870 | Ga0495662_0022613 | 3300046476 | Bacteria | 3035 |
| 871 | Ga0495664_0020123 | 3300046477 | Bacteria | 3845 |
| 872 | Ga0495664_0078940 | 3300046477 | Bacteria | 1972 |
| 873 | Ga0495664_0170208 | 3300046477 | Bacteria | 1321 |
| 874 | Ga0495584_0021105 | 3300046491 | Bacteria | 3307 |
| 875 | Ga0495584_0133249 | 3300046491 | Bacteria | 1261 |
| 876 | Ga0495585_0002429 | 3300046492 | Bacteria | 13343 |
| 877 | Ga0495585_0057057 | 3300046492 | Bacteria | 2156 |
| 878 | Ga0495594_0028654 | 3300046499 | Bacteria | 3006 |
| 879 | Ga0495594_0174336 | 3300046499 | Bacteria | 1223 |
| 880 | Ga0495596_0068793 | 3300046500 | Bacteria | 1376 |
| 881 | Ga0495608_0001948 | 3300046511 | Bacteria | 14809 |
| 882 | Ga0495608_0055984 | 3300046511 | Bacteria | 2605 |
| 883 | Ga0495608_0197846 | 3300046511 | Bacteria | 1267 |
| 884 | Ga0495618_0025063 | 3300046514 | Bacteria | 3700 |
| 885 | Ga0495618_0050959 | 3300046514 | Bacteria | 2615 |
| 886 | Ga0495628_0009783 | 3300046516 | Bacteria | 8169 |
| 887 | Ga0495628_0012772 | 3300046516 | Bacteria | 7070 |
| 888 | Ga0495628_0071647 | 3300046516 | Bacteria | 2701 |
| 889 | Ga0495630_0111010 | 3300046517 | Bacteria | 2077 |
| 890 | Ga0495630_0501288 | 3300046517 | Bacteria | 931 |
| 891 | Ga0495631_0176986 | 3300046518 | Bacteria | 914 |
| 892 | Ga0495637_0083539 | 3300046520 | Bacteria | 1270 |
| 893 | Ga0495644_0004855 | 3300046523 | Bacteria | 5279 |
| 894 | Ga0495666_0030778 | 3300046526 | Bacteria | 2632 |
| 895 | Ga0495652_0023129 | 3300046529 | Bacteria | 5510 |
| 896 | Ga0495652_0093555 | 3300046529 | Bacteria | 2454 |
| 897 | Ga0495652_0200517 | 3300046529 | Bacteria | 1515 |
| 898 | Ga0495652_0352197 | 3300046529 | Bacteria | 1054 |
| 899 | Ga0495665_0034160 | 3300046531 | Bacteria | 2719 |
| 900 | Ga0495665_0140281 | 3300046531 | Bacteria | 1263 |
| 901 | Ga0495640_0103700 | 3300046533 | Bacteria | 1864 |
| 902 | Ga0495640_0105939 | 3300046533 | Bacteria | 1841 |
| 903 | Ga0495640_0136159 | 3300046533 | Bacteria | 1586 |
| 904 | Ga0495640_0140984 | 3300046533 | Bacteria | 1554 |
| 905 | Ga0495586_0053241 | 3300046535 | Bacteria | 2192 |
| 906 | Ga0495587_0030802 | 3300046536 | Bacteria | 3252 |
| 907 | Ga0495609_0034143 | 3300046538 | Bacteria | 2307 |
| 908 | Ga0495609_0143510 | 3300046538 | Bacteria | 1018 |
| 909 | Ga0495621_0015610 | 3300046539 | Bacteria | 2425 |
| 910 | Ga0495645_0020277 | 3300046543 | Bacteria | 4793 |
| 911 | Ga0495622_0015379 | 3300046557 | Bacteria | 3557 |
| 912 | Ga0495633_0103793 | 3300046558 | Bacteria | 1319 |
| 913 | Ga0495667_0001067 | 3300046559 | Bacteria | 17817 |
| 914 | Ga0495667_0013909 | 3300046559 | Bacteria | 5434 |
| 915 | Ga0495667_0117677 | 3300046559 | Bacteria | 1716 |
| 916 | Ga0495667_0337744 | 3300046559 | Bacteria | 952 |
| 917 | Ga0495656_0002593 | 3300046615 | Bacteria | 6029 |
| 918 | Ga0495656_0049233 | 3300046615 | Bacteria | 1794 |
| 919 | Ga0495668_0079881 | 3300046616 | Bacteria | 1795 |
| 920 | Ga0495611_0020648 | 3300046648 | Bacteria | 2837 |
| 921 | Ga0495635_0019587 | 3300046663 | Bacteria | 4715 |
| 922 | Ga0495635_0065327 | 3300046663 | Bacteria | 2496 |
| 923 | Ga0495635_0090619 | 3300046663 | Bacteria | 2091 |
| 924 | Ga0495635_0107543 | 3300046663 | Bacteria | 1905 |
| 925 | Ga0495659_0006541 | 3300046664 | Bacteria | 3680 |
| 926 | Ga0495661_0039661 | 3300046665 | Bacteria | 2925 |
| 927 | Ga0495588_0019088 | 3300046674 | Bacteria | 3354 |
| 928 | Ga0495588_0039698 | 3300046674 | Bacteria | 2399 |
| 929 | Ga0495657_0016143 | 3300046675 | Bacteria | 5445 |
| 930 | Ga0495657_0033154 | 3300046675 | Bacteria | 3598 |
| 931 | Ga0495657_0033991 | 3300046675 | Bacteria | 3545 |
| 932 | Ga0495657_0339765 | 3300046675 | Bacteria | 890 |
| 933 | Ga0495599_0002423 | 3300046678 | Bacteria | 10863 |
| 934 | Ga0495599_0002462 | 3300046678 | Bacteria | 10788 |
| 935 | Ga0495599_0027197 | 3300046678 | Bacteria | 3585 |
| 936 | Ga0495623_0003667 | 3300046679 | Bacteria | 10141 |
| 937 | Ga0495623_0039933 | 3300046679 | Bacteria | 2997 |
| 938 | Ga0495646_0001912 | 3300046680 | Bacteria | 12528 |
| 939 | Ga0495646_0024134 | 3300046680 | Bacteria | 3829 |
| 940 | Ga0495647_0160541 | 3300046681 | Bacteria | 968 |
| 941 | Ga0495658_0015226 | 3300046683 | Bacteria | 3943 |
| 942 | Ga0495658_0058438 | 3300046683 | Bacteria | 2206 |
| 943 | Ga0495658_0078615 | 3300046683 | Bacteria | 1931 |
| 944 | Ga0495669_0173001 | 3300046684 | Bacteria | 1028 |
| 945 | Ga0495613_0030125 | 3300046689 | Bacteria | 4031 |
| 946 | Ga0495613_0081327 | 3300046689 | Bacteria | 2353 |
| 947 | Ga0495624_0066588 | 3300046690 | Bacteria | 2248 |
| 948 | Ga0495624_0231751 | 3300046690 | Bacteria | 1118 |
| 949 | Ga0495670_0001352 | 3300046691 | Bacteria | 11967 |
| 950 | Ga0495670_0162092 | 3300046691 | Bacteria | 1175 |
| 951 | Ga0495600_0005044 | 3300046809 | Bacteria | 7932 |
| 952 | Ga0495600_0030328 | 3300046809 | Bacteria | 3503 |
| 953 | Ga0495600_0031854 | 3300046809 | Bacteria | 3418 |
| 954 | Ga0495581_0013989 | 3300047315 | Bacteria | 4654 |
| 955 | Ga0495581_0062351 | 3300047315 | Bacteria | 2154 |
| 956 | Ga0495604_0004097 | 3300047317 | Bacteria | 11579 |
| 957 | Ga0495604_0009091 | 3300047317 | Bacteria | 7862 |
| 958 | Ga0495604_0013822 | 3300047317 | Bacteria | 6438 |
| 959 | Ga0495604_0028326 | 3300047317 | Bacteria | 4456 |
| 960 | Ga0495674_0026001 | 3300047319 | Bacteria | 5357 |
| 961 | Ga0495674_0084024 | 3300047319 | Bacteria | 2729 |
| 962 | Ga0495674_0120293 | 3300047319 | Bacteria | 2219 |
| 963 | Ga0495676_0132214 | 3300047321 | Bacteria | 1799 |
| 964 | Ga0495680_0014800 | 3300047322 | Bacteria | 6745 |
| 965 | Ga0495680_0055329 | 3300047322 | Bacteria | 3078 |
| 966 | Ga0495680_0180576 | 3300047322 | Bacteria | 1523 |
| 967 | Ga0495680_0408230 | 3300047322 | Bacteria | 936 |
| 968 | Ga0495675_0001338 | 3300047444 | Bacteria | 14916 |
| 969 | Ga0495675_0035048 | 3300047444 | Bacteria | 3206 |
| 970 | Ga0495675_0058231 | 3300047444 | Bacteria | 2450 |
| 971 | Ga0495681_0133276 | 3300047470 | Bacteria | 1056 |
| 972 | Ga0495684_0034589 | 3300047471 | Bacteria | 3876 |
| 973 | Ga0495593_0018657 | 3300047673 | Bacteria | 3896 |
| 974 | Ga0495593_0066459 | 3300047673 | Bacteria | 1879 |
| 975 | Ga0495593_0074108 | 3300047673 | Bacteria | 1765 |
| 976 | Ga0495602_0002392 | 3300048088 | Bacteria | 19051 |
| 977 | Ga0495602_0040040 | 3300048088 | Bacteria | 4306 |
| 978 | Ga0495614_0016010 | 3300048089 | Bacteria | 3265 |
| 979 | Ga0495626_0053820 | 3300048091 | Bacteria | 1851 |
| 980 | Ga0496100_0002059 | 3300048903 | Bacteria | 10095 |
| 981 | Ga0496100_0081168 | 3300048903 | Bacteria | 2190 |
| 982 | Ga0496100_0191509 | 3300048903 | Bacteria | 1485 |
| 983 | Ga0496100_0235230 | 3300048903 | Bacteria | 1349 |
| 984 | Ga0496101_0001022 | 3300048904 | Bacteria | 16502 |
| 985 | Ga0496101_0001738 | 3300048904 | Bacteria | 13045 |
| 986 | Ga0496101_0008336 | 3300048904 | Bacteria | 6771 |
| 987 | Ga0496101_0049036 | 3300048904 | Bacteria | 3036 |
| 988 | Ga0496101_0059913 | 3300048904 | Bacteria | 2760 |
| 989 | Ga0496101_0411135 | 3300048904 | Bacteria | 1066 |
| 990 | Ga0496102_0001427 | 3300048905 | Bacteria | 21201 |
| 991 | Ga0496102_0009899 | 3300048905 | Bacteria | 8196 |
| 992 | Ga0496102_0010246 | 3300048905 | Bacteria | 8059 |
| 993 | Ga0496102_0103422 | 3300048905 | Bacteria | 2649 |
| 994 | Ga0496102_0322617 | 3300048905 | Bacteria | 1455 |
| 995 | Ga0496103_0004101 | 3300048906 | Bacteria | 8854 |
| 996 | Ga0496103_0025906 | 3300048906 | Bacteria | 3547 |
| 997 | Ga0496103_0028858 | 3300048906 | Bacteria | 3369 |
| 998 | Ga0496103_0052832 | 3300048906 | Bacteria | 2517 |
| 999 | Ga0496104_0000528 | 3300048907 | Bacteria | 32836 |
| 1000 | Ga0496104_0001202 | 3300048907 | Bacteria | 22309 |
| 1001 | Ga0496104_0009710 | 3300048907 | Bacteria | 8577 |
| 1002 | Ga0496104_0019198 | 3300048907 | Bacteria | 6250 |
| 1003 | Ga0496104_0050759 | 3300048907 | Bacteria | 3914 |
| 1004 | Ga0496104_0053102 | 3300048907 | Bacteria | 3828 |
| 1005 | Ga0496104_0068688 | 3300048907 | Bacteria | 3367 |
| 1006 | Ga0496104_0150963 | 3300048907 | Bacteria | 2230 |
| 1007 | Ga0496104_0695566 | 3300048907 | Bacteria | 924 |
| 1008 | Ga0496105_0001587 | 3300048908 | Bacteria | 16099 |
| 1009 | Ga0496105_0012029 | 3300048908 | Bacteria | 6851 |
| 1010 | Ga0496105_0018797 | 3300048908 | Bacteria | 5564 |
| 1011 | Ga0496105_0043589 | 3300048908 | Bacteria | 3700 |
| 1012 | Ga0496105_0101523 | 3300048908 | Bacteria | 2375 |
| 1013 | Ga0496105_0231257 | 3300048908 | Bacteria | 1502 |
| 1014 | Ga0496106_0000644 | 3300048909 | Bacteria | 24997 |
| 1015 | Ga0496106_0010684 | 3300048909 | Bacteria | 6785 |
| 1016 | Ga0496106_0019556 | 3300048909 | Bacteria | 5024 |
| 1017 | Ga0496106_0032399 | 3300048909 | Bacteria | 3896 |
| 1018 | Ga0496106_0061507 | 3300048909 | Bacteria | 2849 |
| 1019 | Ga0496106_0079835 | 3300048909 | Bacteria | 2512 |
| 1020 | Ga0496106_0090672 | 3300048909 | Bacteria | 2359 |
| 1021 | Ga0496106_0171288 | 3300048909 | Bacteria | 1721 |
| 1022 | Ga0496106_0187467 | 3300048909 | Bacteria | 1643 |
| 1023 | Ga0496106_0285497 | 3300048909 | Bacteria | 1322 |
| 1024 | Ga0496107_0013215 | 3300048910 | Bacteria | 5768 |
| 1025 | Ga0496107_0021482 | 3300048910 | Bacteria | 4561 |
| 1026 | Ga0496107_0024486 | 3300048910 | Bacteria | 4270 |
| 1027 | Ga0496107_0034610 | 3300048910 | Bacteria | 3618 |
| 1028 | Ga0496107_0096950 | 3300048910 | Bacteria | 2158 |
| 1029 | Ga0496107_0109961 | 3300048910 | Bacteria | 2025 |
| 1030 | Ga0496107_0129718 | 3300048910 | Bacteria | 1861 |
| 1031 | Ga0496108_0002310 | 3300048911 | Bacteria | 15266 |
| 1032 | Ga0496108_0019323 | 3300048911 | Bacteria | 5594 |
| 1033 | Ga0496108_0026579 | 3300048911 | Bacteria | 4774 |
| 1034 | Ga0496108_0058607 | 3300048911 | Bacteria | 3237 |
| 1035 | Ga0496108_0084028 | 3300048911 | Bacteria | 2701 |
| 1036 | Ga0496108_0246053 | 3300048911 | Bacteria | 1555 |
| 1037 | Ga0496108_0343744 | 3300048911 | Bacteria | 1302 |
| 1038 | Ga0496108_0377511 | 3300048911 | Bacteria | 1238 |
| 1039 | Ga0496109_0000644 | 3300048912 | Bacteria | 28962 |
| 1040 | Ga0496109_0010936 | 3300048912 | Bacteria | 7775 |
| 1041 | Ga0496109_0012832 | 3300048912 | Bacteria | 7242 |
| 1042 | Ga0496109_0026513 | 3300048912 | Bacteria | 5168 |
| 1043 | Ga0496109_0291611 | 3300048912 | Bacteria | 1538 |
| 1044 | Ga0496109_0375200 | 3300048912 | Bacteria | 1343 |
| 1045 | Ga0496110_0019757 | 3300048913 | Bacteria | 5676 |
| 1046 | Ga0496110_0096572 | 3300048913 | Bacteria | 2648 |
| 1047 | Ga0496110_0180951 | 3300048913 | Bacteria | 1914 |
| 1048 | Ga0496110_0524359 | 3300048913 | Bacteria | 1077 |
| 1049 | Ga0496111_0014335 | 3300048914 | Bacteria | 5413 |
| 1050 | Ga0496111_0030481 | 3300048914 | Bacteria | 3835 |
| 1051 | Ga0496111_0108616 | 3300048914 | Bacteria | 2042 |
| 1052 | Ga0496111_0115205 | 3300048914 | Bacteria | 1981 |
| 1053 | Ga0496112_0001548 | 3300048915 | Bacteria | 17768 |
| 1054 | Ga0496112_0036518 | 3300048915 | Bacteria | 4793 |
| 1055 | Ga0496112_0198972 | 3300048915 | Bacteria | 1964 |
| 1056 | Ga0496112_0201926 | 3300048915 | Bacteria | 1947 |
| 1057 | Ga0496112_0238505 | 3300048915 | Bacteria | 1771 |
| 1058 | Ga0496112_0264067 | 3300048915 | Bacteria | 1670 |
| 1059 | Ga0496112_0358767 | 3300048915 | Bacteria | 1400 |
| 1060 | Ga0496112_0376951 | 3300048915 | Bacteria | 1360 |
| 1061 | Ga0496113_0001777 | 3300048916 | Bacteria | 12233 |
| 1062 | Ga0496113_0009092 | 3300048916 | Bacteria | 6509 |
| 1063 | Ga0496113_0066487 | 3300048916 | Bacteria | 2731 |
| 1064 | Ga0496113_0068360 | 3300048916 | Bacteria | 2695 |
| 1065 | Ga0496113_0088624 | 3300048916 | Bacteria | 2380 |
| 1066 | Ga0496113_0099606 | 3300048916 | Bacteria | 2251 |
| 1067 | Ga0496113_0102944 | 3300048916 | Bacteria | 2214 |
| 1068 | Ga0496114_0025740 | 3300048917 | Bacteria | 4811 |
| 1069 | Ga0496114_0029429 | 3300048917 | Bacteria | 4514 |
| 1070 | Ga0496114_0035315 | 3300048917 | Bacteria | 4127 |
| 1071 | Ga0496114_0041072 | 3300048917 | Bacteria | 3833 |
| 1072 | Ga0496114_0056359 | 3300048917 | Bacteria | 3279 |
| 1073 | Ga0496115_0013652 | 3300048918 | Bacteria | 6147 |
| 1074 | Ga0496115_0033804 | 3300048918 | Bacteria | 4039 |
| 1075 | Ga0496115_0124905 | 3300048918 | Bacteria | 2119 |
| 1076 | Ga0496115_0472621 | 3300048918 | Bacteria | 1010 |
| 1077 | Ga0496115_0487196 | 3300048918 | Bacteria | 992 |
| 1078 | Ga0501031_0020371 | 3300049568 | Bacteria | 4323 |
| 1079 | Ga0501032_0015452 | 3300049569 | Bacteria | 5384 |
| 1080 | Ga0501032_0109728 | 3300049569 | Bacteria | 1826 |
| 1081 | Ga0501032_0158989 | 3300049569 | Bacteria | 1484 |
| 1082 | Ga0501032_0296011 | 3300049569 | Bacteria | 1046 |
| 1083 | Ga0501032_0438946 | 3300049569 | Bacteria | 837 |
| 1084 | Ga0501033_0062788 | 3300049570 | Bacteria | 2735 |
| 1085 | Ga0501033_0099714 | 3300049570 | Bacteria | 2120 |
| 1086 | Ga0501033_0144981 | 3300049570 | Bacteria | 1715 |
| 1087 | Ga0501034_0000673 | 3300049571 | Bacteria | 51868 |
| 1088 | Ga0501034_0000933 | 3300049571 | Bacteria | 42599 |
| 1089 | Ga0501034_0049224 | 3300049571 | Bacteria | 4253 |
| 1090 | Ga0501034_0141364 | 3300049571 | Bacteria | 2386 |
| 1091 | Ga0501034_0149522 | 3300049571 | Bacteria | 2311 |
| 1092 | Ga0501034_0213866 | 3300049571 | Bacteria | 1882 |
| 1093 | Ga0501034_0306070 | 3300049571 | Bacteria | 1525 |
| 1094 | Ga0501034_0328591 | 3300049571 | Bacteria | 1461 |
| 1095 | Ga0501034_0564418 | 3300049571 | Bacteria | 1046 |
| 1096 | Ga0501034_0648632 | 3300049571 | Bacteria | 957 |
| 1097 | Ga0501036_0000242 | 3300049572 | Bacteria | 36845 |
| 1098 | Ga0501036_0029281 | 3300049572 | Bacteria | 4654 |
| 1099 | Ga0501036_0533322 | 3300049572 | Bacteria | 976 |
| 1100 | Ga0501036_0626245 | 3300049572 | Bacteria | 891 |
| 1101 | Ga0501037_0045754 | 3300049573 | Bacteria | 3211 |
| 1102 | Ga0501037_0195792 | 3300049573 | Bacteria | 1429 |
| 1103 | Ga0501038_0020142 | 3300049574 | Bacteria | 6002 |
| 1104 | Ga0501038_0060730 | 3300049574 | Bacteria | 3234 |
| 1105 | Ga0501038_0082622 | 3300049574 | Bacteria | 2705 |
| 1106 | Ga0501038_0517881 | 3300049574 | Bacteria | 910 |
| 1107 | Ga0501039_0011358 | 3300049575 | Bacteria | 6782 |
| 1108 | Ga0501039_0041604 | 3300049575 | Bacteria | 3550 |
| 1109 | Ga0501039_0077787 | 3300049575 | Bacteria | 2580 |
| 1110 | Ga0501039_0115865 | 3300049575 | Bacteria | 2097 |
| 1111 | Ga0501039_0185820 | 3300049575 | Bacteria | 1634 |
| 1112 | Ga0501042_0033741 | 3300049578 | Bacteria | 3629 |
| 1113 | Ga0501042_0318627 | 3300049578 | Bacteria | 1123 |
| 1114 | Ga0501043_0020786 | 3300049579 | Bacteria | 5148 |
| 1115 | Ga0501043_0039482 | 3300049579 | Bacteria | 3709 |
| 1116 | Ga0501043_0059304 | 3300049579 | Bacteria | 3003 |
| 1117 | Ga0501043_0061077 | 3300049579 | Bacteria | 2960 |
| 1118 | Ga0501043_0409708 | 3300049579 | Bacteria | 1023 |
| 1119 | Ga0501043_0434837 | 3300049579 | Bacteria | 988 |
| 1120 | Ga0501046_0051469 | 3300049580 | Bacteria | 3249 |
| 1121 | Ga0501046_0256706 | 3300049580 | Bacteria | 1285 |
| 1122 | Ga0501046_0317360 | 3300049580 | Bacteria | 1136 |
| 1123 | Ga0501047_0000073 | 3300049581 | Bacteria | 125990 |
| 1124 | Ga0501047_0008654 | 3300049581 | Bacteria | 9614 |
| 1125 | Ga0501047_0009026 | 3300049581 | Bacteria | 9414 |
| 1126 | Ga0501047_0022462 | 3300049581 | Bacteria | 6059 |
| 1127 | Ga0501047_0137238 | 3300049581 | Bacteria | 2325 |
| 1128 | Ga0501047_0159148 | 3300049581 | Bacteria | 2130 |
| 1129 | Ga0501047_0238321 | 3300049581 | Bacteria | 1670 |
| 1130 | Ga0501047_0253659 | 3300049581 | Bacteria | 1607 |
| 1131 | Ga0501047_0547731 | 3300049581 | Bacteria | 981 |
| 1132 | Ga0501048_0000014 | 3300049582 | Bacteria | 75001 |
| 1133 | Ga0501048_0040161 | 3300049582 | Bacteria | 3353 |
| 1134 | Ga0501048_0161666 | 3300049582 | Bacteria | 1585 |
| 1135 | Ga0501067_0020704 | 3300049583 | Bacteria | 3639 |
| 1136 | Ga0501068_0029404 | 3300049584 | Bacteria | 3253 |
| 1137 | Ga0501068_0064873 | 3300049584 | Bacteria | 2222 |
| 1138 | Ga0501069_0015321 | 3300049585 | Bacteria | 4108 |
| 1139 | Ga0501069_0090149 | 3300049585 | Bacteria | 1733 |
| 1140 | Ga0501070_0007266 | 3300049586 | Bacteria | 9403 |
| 1141 | Ga0501070_0008335 | 3300049586 | Bacteria | 8757 |
| 1142 | Ga0501070_0010033 | 3300049586 | Bacteria | 8011 |
| 1143 | Ga0501070_0054012 | 3300049586 | Bacteria | 3331 |
| 1144 | Ga0501070_0054487 | 3300049586 | Bacteria | 3316 |
| 1145 | Ga0501070_0065404 | 3300049586 | Bacteria | 3010 |
| 1146 | Ga0501070_0076867 | 3300049586 | Bacteria | 2763 |
| 1147 | Ga0501070_0080098 | 3300049586 | Bacteria | 2702 |
| 1148 | Ga0501070_0080241 | 3300049586 | Bacteria | 2699 |
| 1149 | Ga0501070_0395903 | 3300049586 | Bacteria | 1118 |
| 1150 | Ga0501070_0576837 | 3300049586 | Bacteria | 898 |
| 1151 | Ga0501071_0031037 | 3300049587 | Bacteria | 3784 |
| 1152 | Ga0501071_0397558 | 3300049587 | Bacteria | 1052 |
| 1153 | Ga0501071_0586898 | 3300049587 | Bacteria | 856 |
| 1154 | Ga0501072_0006127 | 3300049588 | Bacteria | 9173 |
| 1155 | Ga0501072_0030800 | 3300049588 | Bacteria | 4197 |
| 1156 | Ga0501072_0128291 | 3300049588 | Bacteria | 2021 |
| 1157 | Ga0501072_0432583 | 3300049588 | Bacteria | 1043 |
| 1158 | Ga0501072_0578020 | 3300049588 | Bacteria | 886 |
| 1159 | Ga0501073_0021369 | 3300049589 | Bacteria | 4665 |
| 1160 | Ga0501073_0087946 | 3300049589 | Bacteria | 2160 |
| 1161 | Ga0501073_0130841 | 3300049589 | Bacteria | 1739 |
| 1162 | Ga0501074_0027570 | 3300049590 | Bacteria | 4118 |
| 1163 | Ga0501074_0028405 | 3300049590 | Bacteria | 4054 |
| 1164 | Ga0501074_0029008 | 3300049590 | Bacteria | 4008 |
| 1165 | Ga0501074_0057083 | 3300049590 | Bacteria | 2812 |
| 1166 | Ga0501074_0142212 | 3300049590 | Bacteria | 1716 |
| 1167 | Ga0501075_0050477 | 3300049591 | Bacteria | 3127 |
| 1168 | Ga0501075_0079925 | 3300049591 | Bacteria | 2475 |
| 1169 | Ga0501077_0023267 | 3300049593 | Bacteria | 3928 |
| 1170 | Ga0501077_0171763 | 3300049593 | Bacteria | 1377 |
| 1171 | Ga0501079_0049238 | 3300049741 | Bacteria | 3252 |
| 1172 | Ga0501079_0229645 | 3300049741 | Bacteria | 1450 |
| 1173 | Ga0501079_0338954 | 3300049741 | Bacteria | 1178 |
| 1174 | Ga0501080_0000187 | 3300049742 | Bacteria | 45224 |
| 1175 | Ga0501080_0012377 | 3300049742 | Bacteria | 7820 |
| 1176 | Ga0501080_0019883 | 3300049742 | Bacteria | 6218 |
| 1177 | Ga0501080_0122736 | 3300049742 | Bacteria | 2406 |
| 1178 | Ga0501080_0135524 | 3300049742 | Bacteria | 2279 |
| 1179 | Ga0501080_0195503 | 3300049742 | Bacteria | 1858 |
| 1180 | Ga0501083_0000398 | 3300049744 | Bacteria | 27675 |
| 1181 | Ga0501083_0020659 | 3300049744 | Bacteria | 4578 |
| 1182 | Ga0501083_0030907 | 3300049744 | Bacteria | 3676 |
| 1183 | Ga0501083_0116762 | 3300049744 | Bacteria | 1751 |
| 1184 | Ga0501083_0119904 | 3300049744 | Bacteria | 1726 |
| 1185 | Ga0501035_0000621 | 3300049822 | Bacteria | 39045 |
| 1186 | Ga0501035_0112073 | 3300049822 | Bacteria | 2390 |
| 1187 | Ga0501035_0129023 | 3300049822 | Bacteria | 2205 |
| 1188 | Ga0501035_0195703 | 3300049822 | Bacteria | 1736 |
| 1189 | Ga0501035_0593388 | 3300049822 | Bacteria | 903 |
| 1190 | Ga0501044_0021597 | 3300049823 | Bacteria | 6864 |
| 1191 | Ga0501044_0061157 | 3300049823 | Bacteria | 3853 |
| 1192 | Ga0501044_0063316 | 3300049823 | Bacteria | 3779 |
| 1193 | Ga0501044_0091612 | 3300049823 | Bacteria | 3066 |
| 1194 | Ga0501044_0159451 | 3300049823 | Bacteria | 2234 |
| 1195 | Ga0501044_0408868 | 3300049823 | Bacteria | 1268 |
| 1196 | Ga0501044_0413560 | 3300049823 | Bacteria | 1259 |
| 1197 | Ga0501044_0422212 | 3300049823 | Bacteria | 1243 |
| 1198 | Ga0501044_0642863 | 3300049823 | Bacteria | 950 |
| 1199 | Ga0501045_0093236 | 3300049824 | Bacteria | 2227 |
| 1200 | nmdc:mga03n38_151130_c1 | 3300050490 | Bacteria | 1168 |
| 1201 | nmdc:mga03n38_166197_c1 | 3300050490 | Bacteria | 1120 |
| 1202 | nmdc:mga03n38_29520_c1 | 3300050490 | Bacteria | 2296 |
| 1203 | nmdc:mga00v17_271812_c1 | 3300050491 | Bacteria | 1100 |
| 1204 | nmdc:mga00v17_455043_c1 | 3300050491 | Bacteria | 831 |
| 1205 | nmdc:mga0yw44_35055_c1 | 3300050492 | Bacteria | 2946 |
| 1206 | nmdc:mga0yw44_426623_c1 | 3300050492 | Bacteria | 898 |
| 1207 | nmdc:mga0k408_207655_c1 | 3300050493 | Bacteria | 1169 |
| 1208 | nmdc:mga06z11_24085_c1 | 3300050494 | Bacteria | 2868 |
| 1209 | nmdc:mga07m45_9776_c1 | 3300050496 | Bacteria | 4990 |
| 1210 | nmdc:mga05p37_146_c1 | 3300050507 | Bacteria | 27217 |
| 1211 | nmdc:mga05p37_19_c3 | 3300050507 | Bacteria | 27587 |
| 1212 | nmdc:mga05p37_330381_c1 | 3300050507 | Bacteria | 1801 |
| 1213 | nmdc:mga05p37_34032_c1 | 3300050507 | Bacteria | 6241 |
| 1214 | nmdc:mga05p37_410288_c1 | 3300050507 | Bacteria | 1579 |
| 1215 | nmdc:mga05p37_57300_c1 | 3300050507 | Bacteria | 4799 |
| 1216 | nmdc:mga05p37_80216_c1 | 3300050507 | Bacteria | 4020 |
| 1217 | nmdc:mga05p37_965436_c1 | 3300050507 | Bacteria | 910 |
| 1218 | nmdc:mga09592_124551_c1 | 3300050508 | Bacteria | 2215 |
| 1219 | nmdc:mga09592_180873_c1 | 3300050508 | Bacteria | 1824 |
| 1220 | nmdc:mga09592_758_c1 | 3300050508 | Bacteria | 24836 |
| 1221 | nmdc:mga0qj67_1526_c1 | 3300050509 | Bacteria | 16241 |
| 1222 | nmdc:mga0qj67_1779_c1 | 3300050509 | Bacteria | 15251 |
| 1223 | nmdc:mga0qj67_219847_c1 | 3300050509 | Bacteria | 1542 |
| 1224 | nmdc:mga0qj67_25401_c1 | 3300050509 | Bacteria | 4576 |
| 1225 | nmdc:mga06r32_168966_c1 | 3300050510 | Bacteria | 2170 |
| 1226 | nmdc:mga06r32_212768_c1 | 3300050510 | Bacteria | 1921 |
| 1227 | nmdc:mga06r32_27869_c1 | 3300050510 | Bacteria | 5282 |
| 1228 | nmdc:mga06r32_347_c1 | 3300050510 | Bacteria | 38541 |
| 1229 | nmdc:mga06r32_4145_c1 | 3300050510 | Bacteria | 12980 |
| 1230 | nmdc:mga06r32_446218_c1 | 3300050510 | Bacteria | 1273 |
| 1231 | nmdc:mga06r32_663117_c1 | 3300050510 | Bacteria | 1011 |
| 1232 | nmdc:mga06r32_67440_c1 | 3300050510 | Bacteria | 3454 |
| 1233 | nmdc:mga08y16_18763_c1 | 3300050511 | Bacteria | 7287 |
| 1234 | nmdc:mga08y16_238686_c1 | 3300050511 | Bacteria | 1879 |
| 1235 | nmdc:mga08y16_248059_c1 | 3300050511 | Bacteria | 1840 |
| 1236 | nmdc:mga08y16_253307_c1 | 3300050511 | Bacteria | 1819 |
| 1237 | nmdc:mga08y16_268952_c1 | 3300050511 | Bacteria | 1760 |
| 1238 | nmdc:mga08y16_328_c1 | 3300050511 | Bacteria | 33166 |
| 1239 | nmdc:mga08y16_46719_c1 | 3300050511 | Bacteria | 4533 |
| 1240 | nmdc:mga08y16_513855_c1 | 3300050511 | Bacteria | 1216 |
| 1241 | nmdc:mga0n895_1021766_c1 | 3300050512 | Bacteria | 807 |
| 1242 | nmdc:mga0n895_114593_c1 | 3300050512 | Bacteria | 2714 |
| 1243 | nmdc:mga0n895_11616_c1 | 3300050512 | Bacteria | 7865 |
| 1244 | nmdc:mga0n895_1573_c1 | 3300050512 | Bacteria | 17177 |
| 1245 | nmdc:mga0n895_1698_c1 | 3300050512 | Bacteria | 16639 |
| 1246 | nmdc:mga0n895_21673_c1 | 3300050512 | Bacteria | 6014 |
| 1247 | nmdc:mga0n895_375865_c1 | 3300050512 | Bacteria | 1438 |
| 1248 | nmdc:mga0n895_4270_c1 | 3300050512 | Bacteria | 11692 |
| 1249 | nmdc:mga0rr50_32274_c1 | 3300050513 | Bacteria | 3730 |
| 1250 | nmdc:mga0rr50_351658_c1 | 3300050513 | Bacteria | 1239 |
| 1251 | nmdc:mga0rr50_390_c1 | 3300050513 | Bacteria | 23898 |
| 1252 | nmdc:mga08x19_191526_c1 | 3300050514 | Bacteria | 1399 |
| 1253 | nmdc:mga08x19_42973_c1 | 3300050514 | Bacteria | 2882 |
| 1254 | nmdc:mga08x19_85416_c1 | 3300050514 | Bacteria | 2077 |
| 1255 | nmdc:mga0a205_20171_c1 | 3300050515 | Bacteria | 6287 |
| 1256 | nmdc:mga0a205_251229_c1 | 3300050515 | Bacteria | 1648 |
| 1257 | nmdc:mga0a205_343307_c1 | 3300050515 | Bacteria | 1361 |
| 1258 | nmdc:mga0a205_399671_c1 | 3300050515 | Bacteria | 1238 |
| 1259 | nmdc:mga0a205_681_c1 | 3300050515 | Bacteria | 27171 |
| 1260 | nmdc:mga0a205_79345_c1 | 3300050515 | Bacteria | 3172 |
| 1261 | Ga0495601_0000680 | 3300053077 | Bacteria | 18168 |
| 1262 | Ga0495601_0003107 | 3300053077 | Bacteria | 9484 |
| 1263 | Ga0495601_0068588 | 3300053077 | Bacteria | 2260 |
| 1264 | Ga0495601_0116155 | 3300053077 | Bacteria | 1735 |
| 1265 | Ga0495612_0004246 | 3300053078 | Bacteria | 5948 |
| 1266 | Ga0495612_0040633 | 3300053078 | Bacteria | 1895 |
| 1267 | Ga0495612_0044087 | 3300053078 | Bacteria | 1824 |
| 1268 | Ga0495595_0000365 | 3300053084 | Bacteria | 17161 |
| 1269 | Ga0495595_0003679 | 3300053084 | Bacteria | 6096 |
| 1270 | Ga0495595_0023228 | 3300053084 | Bacteria | 2728 |
| 1271 | Ga0495595_0024605 | 3300053084 | Bacteria | 2660 |
| 1272 | Ga0495619_0000378 | 3300053085 | Bacteria | 30722 |
| 1273 | Ga0495619_0000897 | 3300053085 | Bacteria | 19498 |
| 1274 | Ga0495619_0006229 | 3300053085 | Bacteria | 7566 |
| 1275 | Ga0495619_0024786 | 3300053085 | Bacteria | 3848 |
| 1276 | Ga0495619_0030107 | 3300053085 | Bacteria | 3512 |
| 1277 | Ga0495619_0085476 | 3300053085 | Bacteria | 2130 |
| 1278 | Ga0495619_0121249 | 3300053085 | Bacteria | 1793 |
| 1279 | Ga0495619_0291015 | 3300053085 | Bacteria | 1131 |
| 1280 | Ga0500644_0001590 | 3300053088 | Bacteria | 5944 |
| 1281 | Ga0500651_0023030 | 3300053093 | Bacteria | 3897 |
| 1282 | Ga0500566_0164389 | 3300053094 | Bacteria | 1153 |
| 1283 | Ga0500650_0127020 | 3300053098 | Bacteria | 1186 |
| 1284 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1285 | Ga0500642_0053753 | 3300053130 | Bacteria | 1786 |
| 1286 | Ga0500652_000938 | 3300053131 | Bacteria | 9643 |
| 1287 | Ga0500658_0169935 | 3300053134 | Bacteria | 990 |
| 1288 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1289 | Ga0500645_002376 | 3300053730 | Bacteria | 8468 |
| 1290 | Ga0501084_0168169 | 3300054114 | Bacteria | 1850 |
| 1291 | Ga0501084_0210060 | 3300054114 | Bacteria | 1642 |
| 1292 | Ga0501084_0530436 | 3300054114 | Bacteria | 995 |
| 1293 | Ga0501082_0022360 | 3300060353 | Bacteria | 5447 |
| 1294 | Ga0501082_0078165 | 3300060353 | Bacteria | 2854 |
| 1295 | Ga0501082_0120087 | 3300060353 | Bacteria | 2278 |
| 1296 | Ga0501082_0245798 | 3300060353 | Bacteria | 1557 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005981 | Ga0081538_10009357 | Ga0081538_100093579 | 211 |
| 2 | 3300006844 | Ga0075428_100010216 | Ga0075428_1000102168 | 211 |
| 3 | 3300006846 | Ga0075430_100228568 | Ga0075430_1002285682 | 211 |
| 4 | 3300006847 | Ga0075431_100055912 | Ga0075431_1000559123 | 211 |
| 5 | 3300006852 | Ga0075433_10222295 | Ga0075433_102222952 | 211 |
| 6 | 3300006871 | Ga0075434_100160232 | Ga0075434_1001602322 | 211 |
| 7 | 3300006880 | Ga0075429_100082444 | Ga0075429_1000824445 | 211 |
| 8 | 3300009094 | Ga0111539_10012114 | Ga0111539_100121148 | 211 |
| 9 | 3300009147 | Ga0114129_10022387 | Ga0114129_100223871 | 211 |
| 10 | 3300027907 | Ga0207428_10029661 | Ga0207428_100296612 | 211 |
| 11 | 3300050507 | nmdc:mga05p37_57300_c1 | nmdc:mga05p37_57300_c1_2762_3457 | 211 |
| 12 | 3300050509 | nmdc:mga0qj67_219847_c1 | nmdc:mga0qj67_219847_c1_416_1111 | 211 |
| 13 | 3300050510 | nmdc:mga06r32_27869_c1 | nmdc:mga06r32_27869_c1_3982_4677 | 211 |
| 14 | 3300050511 | nmdc:mga08y16_18763_c1 | nmdc:mga08y16_18763_c1_844_1539 | 211 |
| 15 | 3300050512 | nmdc:mga0n895_21673_c1 | nmdc:mga0n895_21673_c1_3872_4567 | 211 |
| 16 | 3300050515 | nmdc:mga0a205_399671_c1 | nmdc:mga0a205_399671_c1_409_1104 | 211 |
| 17 | 3300053098 | Ga0500650_0127020 | Ga0500650_0127020_172_924 | 215 |
| 18 | 3300006051 | Ga0075364_10189800 | Ga0075364_101898002 | 219 |
| 19 | 3300006195 | Ga0075366_10238531 | Ga0075366_102385312 | 219 |
| 20 | 3300006353 | Ga0075370_10013697 | Ga0075370_100136972 | 219 |
| 21 | 3300027866 | Ga0209813_10103483 | Ga0209813_101034831 | 219 |
| 22 | 3300050490 | nmdc:mga03n38_29520_c1 | nmdc:mga03n38_29520_c1_505_1221 | 219 |
| 23 | 3300050494 | nmdc:mga06z11_24085_c1 | nmdc:mga06z11_24085_c1_30_746 | 219 |
| 24 | 3300050496 | nmdc:mga07m45_9776_c1 | nmdc:mga07m45_9776_c1_1056_1772 | 219 |
| 25 | 3300053134 | Ga0500658_0169935 | Ga0500658_0169935_191_907 | 219 |
| 26 | 3300044842 | Ga0466957_0225226 | Ga0466957_0225226_75_830 | 221 |
| 27 | 3300045836 | Ga0466958_0079220 | Ga0466958_0079220_85_840 | 221 |
| 28 | 3300005456 | Ga0070678_100344074 | Ga0070678_1003440741 | 224 |
| 29 | 3300049590 | Ga0501074_0027570 | Ga0501074_0027570_3414_4106 | 226 |
| 30 | 3300006177 | Ga0075362_10019167 | Ga0075362_100191672 | 227 |
| 31 | 3300050491 | nmdc:mga00v17_271812_c1 | nmdc:mga00v17_271812_c1_187_903 | 227 |
| 32 | 3300005347 | Ga0070668_100096911 | Ga0070668_1000969113 | 229 |
| 33 | 3300005438 | Ga0070701_10040980 | Ga0070701_100409802 | 229 |
| 34 | 3300005441 | Ga0070700_100096905 | Ga0070700_1000969052 | 229 |
| 35 | 3300005719 | Ga0068861_100238331 | Ga0068861_1002383311 | 229 |
| 36 | 3300026075 | Ga0207708_10240172 | Ga0207708_102401722 | 229 |
| 37 | 3300026118 | Ga0207675_100059869 | Ga0207675_1000598694 | 229 |
| 38 | 3300046675 | Ga0495657_0033991 | Ga0495657_0033991_1769_2512 | 230 |
| 39 | 3300047444 | Ga0495675_0058231 | Ga0495675_0058231_394_1137 | 230 |
| 40 | 3300049579 | Ga0501043_0059304 | Ga0501043_0059304_35_793 | 230 |
| 41 | 3300049581 | Ga0501047_0159148 | Ga0501047_0159148_287_1045 | 230 |
| 42 | 3300053077 | Ga0495601_0116155 | Ga0495601_0116155_274_1017 | 230 |
| 43 | 3300053084 | Ga0495595_0024605 | Ga0495595_0024605_846_1589 | 230 |
| 44 | 3300005331 | Ga0070670_100113430 | Ga0070670_1001134302 | 232 |
| 45 | 3300005353 | Ga0070669_100207881 | Ga0070669_1002078812 | 232 |
| 46 | 3300005354 | Ga0070675_100087502 | Ga0070675_1000875023 | 232 |
| 47 | 3300005364 | Ga0070673_100278696 | Ga0070673_1002786962 | 232 |
| 48 | 3300005466 | Ga0070685_10156737 | Ga0070685_101567371 | 232 |
| 49 | 3300005617 | Ga0068859_100108650 | Ga0068859_1001086502 | 232 |
| 50 | 3300005618 | Ga0068864_100182279 | Ga0068864_1001822792 | 232 |
| 51 | 3300005841 | Ga0068863_100300993 | Ga0068863_1003009931 | 232 |
| 52 | 3300006237 | Ga0097621_100172544 | Ga0097621_1001725441 | 232 |
| 53 | 3300006358 | Ga0068871_100697189 | Ga0068871_1006971892 | 232 |
| 54 | 3300006844 | Ga0075428_100001802 | Ga0075428_1000018026 | 232 |
| 55 | 3300006846 | Ga0075430_100056700 | Ga0075430_1000567004 | 232 |
| 56 | 3300006847 | Ga0075431_100001018 | Ga0075431_10000101815 | 232 |
| 57 | 3300006880 | Ga0075429_100030953 | Ga0075429_1000309532 | 232 |
| 58 | 3300006931 | Ga0097620_100108648 | Ga0097620_1001086482 | 232 |
| 59 | 3300009094 | Ga0111539_10000200 | Ga0111539_1000020041 | 232 |
| 60 | 3300009094 | Ga0111539_10484660 | Ga0111539_104846602 | 232 |
| 61 | 3300009147 | Ga0114129_10000205 | Ga0114129_1000020537 | 232 |
| 62 | 3300009148 | Ga0105243_10085706 | Ga0105243_100857064 | 232 |
| 63 | 3300011119 | Ga0105246_10096405 | Ga0105246_100964053 | 232 |
| 64 | 3300014325 | Ga0163163_10516572 | Ga0163163_105165721 | 232 |
| 65 | 3300025900 | Ga0207710_10037981 | Ga0207710_100379811 | 232 |
| 66 | 3300025908 | Ga0207643_10136339 | Ga0207643_101363392 | 232 |
| 67 | 3300025918 | Ga0207662_10138086 | Ga0207662_101380862 | 232 |
| 68 | 3300025925 | Ga0207650_10296223 | Ga0207650_102962232 | 232 |
| 69 | 3300025927 | Ga0207687_10071861 | Ga0207687_100718612 | 232 |
| 70 | 3300025941 | Ga0207711_10331164 | Ga0207711_103311641 | 232 |
| 71 | 3300025942 | Ga0207689_10027735 | Ga0207689_100277353 | 232 |
| 72 | 3300026035 | Ga0207703_10328878 | Ga0207703_103288782 | 232 |
| 73 | 3300026095 | Ga0207676_10046571 | Ga0207676_100465712 | 232 |
| 74 | 3300026116 | Ga0207674_10091332 | Ga0207674_100913324 | 232 |
| 75 | 3300026118 | Ga0207675_100159664 | Ga0207675_1001596642 | 232 |
| 76 | 3300027907 | Ga0207428_10001692 | Ga0207428_100016929 | 232 |
| 77 | 3300041408 | Ga0439453_0018755 | Ga0439453_0018755_219_917 | 232 |
| 78 | 3300042436 | Ga0439435_0002597 | Ga0439435_0002597_172_870 | 232 |
| 79 | 3300042993 | Ga0439440_0077929 | Ga0439440_0077929_53_751 | 232 |
| 80 | 3300048915 | Ga0496112_0376951 | Ga0496112_0376951_469_1167 | 232 |
| 81 | 3300050507 | nmdc:mga05p37_146_c1 | nmdc:mga05p37_146_c1_8272_8970 | 232 |
| 82 | 3300050508 | nmdc:mga09592_124551_c1 | nmdc:mga09592_124551_c1_110_808 | 232 |
| 83 | 3300050509 | nmdc:mga0qj67_25401_c1 | nmdc:mga0qj67_25401_c1_1994_2692 | 232 |
| 84 | 3300050510 | nmdc:mga06r32_347_c1 | nmdc:mga06r32_347_c1_27860_28558 | 232 |
| 85 | 3300050511 | nmdc:mga08y16_328_c1 | nmdc:mga08y16_328_c1_18284_18982 | 232 |
| 86 | 3300005354 | Ga0070675_100273203 | Ga0070675_1002732032 | 233 |
| 87 | 3300005354 | Ga0070675_100361184 | Ga0070675_1003611842 | 233 |
| 88 | 3300005356 | Ga0070674_100305399 | Ga0070674_1003053992 | 233 |
| 89 | 3300005456 | Ga0070678_100019407 | Ga0070678_1000194075 | 233 |
| 90 | 3300005543 | Ga0070672_100281702 | Ga0070672_1002817022 | 233 |
| 91 | 3300005618 | Ga0068864_100996407 | Ga0068864_1009964071 | 233 |
| 92 | 3300005843 | Ga0068860_100563699 | Ga0068860_1005636992 | 233 |
| 93 | 3300006028 | Ga0070717_10159756 | Ga0070717_101597562 | 233 |
| 94 | 3300006195 | Ga0075366_10137332 | Ga0075366_101373322 | 233 |
| 95 | 3300006881 | Ga0068865_100405001 | Ga0068865_1004050012 | 233 |
| 96 | 3300009094 | Ga0111539_10250757 | Ga0111539_102507572 | 233 |
| 97 | 3300013306 | Ga0163162_10590212 | Ga0163162_105902121 | 233 |
| 98 | 3300025904 | Ga0207647_10115384 | Ga0207647_101153842 | 233 |
| 99 | 3300025923 | Ga0207681_10387498 | Ga0207681_103874982 | 233 |
| 100 | 3300025926 | Ga0207659_10207931 | Ga0207659_102079312 | 233 |
| 101 | 3300025937 | Ga0207669_10179490 | Ga0207669_101794902 | 233 |
| 102 | 3300025938 | Ga0207704_10471627 | Ga0207704_104716272 | 233 |
| 103 | 3300025940 | Ga0207691_10160654 | Ga0207691_101606542 | 233 |
| 104 | 3300026121 | Ga0207683_10048304 | Ga0207683_100483044 | 233 |
| 105 | 3300049571 | Ga0501034_0648632 | Ga0501034_0648632_110_868 | 233 |
| 106 | 3300049572 | Ga0501036_0626245 | Ga0501036_0626245_29_787 | 233 |
| 107 | 3300049574 | Ga0501038_0517881 | Ga0501038_0517881_93_851 | 233 |
| 108 | 3300049586 | Ga0501070_0576837 | Ga0501070_0576837_82_840 | 233 |
| 109 | 3300049587 | Ga0501071_0397558 | Ga0501071_0397558_300_1001 | 233 |
| 110 | 3300049742 | Ga0501080_0012377 | Ga0501080_0012377_110_868 | 233 |
| 111 | 3300049822 | Ga0501035_0593388 | Ga0501035_0593388_82_840 | 233 |
| 112 | 3300050493 | nmdc:mga0k408_207655_c1 | nmdc:mga0k408_207655_c1_330_1031 | 233 |
| 113 | 3300003323 | rootH1_10199197 | rootH1_101991972 | 234 |
| 114 | 3300005457 | Ga0070662_100067575 | Ga0070662_1000675752 | 234 |
| 115 | 3300005544 | Ga0070686_100376233 | Ga0070686_1003762332 | 234 |
| 116 | 3300006871 | Ga0075434_100110966 | Ga0075434_1001109662 | 234 |
| 117 | 3300009094 | Ga0111539_10465254 | Ga0111539_104652542 | 234 |
| 118 | 3300014326 | Ga0157380_10026147 | Ga0157380_100261472 | 234 |
| 119 | 3300025931 | Ga0207644_10007407 | Ga0207644_100074077 | 234 |
| 120 | 3300025933 | Ga0207706_10114454 | Ga0207706_101144542 | 234 |
| 121 | 3300048903 | Ga0496100_0191509 | Ga0496100_0191509_505_1242 | 234 |
| 122 | 3300048904 | Ga0496101_0008336 | Ga0496101_0008336_5726_6463 | 234 |
| 123 | 3300048911 | Ga0496108_0058607 | Ga0496108_0058607_997_1734 | 234 |
| 124 | 3300050512 | nmdc:mga0n895_11616_c1 | nmdc:mga0n895_11616_c1_6933_7637 | 234 |
| 125 | 3300006028 | Ga0070717_10456719 | Ga0070717_104567192 | 236 |
| 126 | 3300049571 | Ga0501034_0049224 | Ga0501034_0049224_1383_2162 | 236 |
| 127 | 3300049581 | Ga0501047_0022462 | Ga0501047_0022462_2817_3596 | 236 |
| 128 | 3300049584 | Ga0501068_0029404 | Ga0501068_0029404_1897_2676 | 236 |
| 129 | 3300049585 | Ga0501069_0015321 | Ga0501069_0015321_681_1460 | 236 |
| 130 | 3300049586 | Ga0501070_0054012 | Ga0501070_0054012_762_1541 | 236 |
| 131 | 3300049588 | Ga0501072_0128291 | Ga0501072_0128291_1088_1867 | 236 |
| 132 | 3300049589 | Ga0501073_0130841 | Ga0501073_0130841_596_1375 | 236 |
| 133 | 3300049590 | Ga0501074_0028405 | Ga0501074_0028405_588_1367 | 236 |
| 134 | 3300049741 | Ga0501079_0338954 | Ga0501079_0338954_135_914 | 236 |
| 135 | 3300049742 | Ga0501080_0122736 | Ga0501080_0122736_1568_2347 | 236 |
| 136 | 3300049823 | Ga0501044_0061157 | Ga0501044_0061157_686_1465 | 236 |
| 137 | 3300005981 | Ga0081538_10017589 | Ga0081538_100175892 | 237 |
| 138 | 3300001990 | JGI24737J22298_10064859 | JGI24737J22298_100648591 | 238 |
| 139 | 3300001991 | JGI24743J22301_10008333 | JGI24743J22301_100083332 | 238 |
| 140 | 3300002070 | JGI24750J21931_1001196 | JGI24750J21931_10011962 | 238 |
| 141 | 3300002076 | JGI24749J21850_1011821 | JGI24749J21850_10118212 | 238 |
| 142 | 3300002244 | JGI24742J22300_10003075 | JGI24742J22300_100030752 | 238 |
| 143 | 3300003373 | JGI25407J50210_10025802 | JGI25407J50210_100258024 | 238 |
| 144 | 3300005327 | Ga0070658_10270701 | Ga0070658_102707012 | 238 |
| 145 | 3300005329 | Ga0070683_100106661 | Ga0070683_1001066611 | 238 |
| 146 | 3300005329 | Ga0070683_100177709 | Ga0070683_1001777092 | 238 |
| 147 | 3300005330 | Ga0070690_100252195 | Ga0070690_1002521952 | 238 |
| 148 | 3300005331 | Ga0070670_100019346 | Ga0070670_1000193462 | 238 |
| 149 | 3300005333 | Ga0070677_10080424 | Ga0070677_100804242 | 238 |
| 150 | 3300005335 | Ga0070666_10295572 | Ga0070666_102955722 | 238 |
| 151 | 3300005338 | Ga0068868_100045050 | Ga0068868_1000450501 | 238 |
| 152 | 3300005339 | Ga0070660_100236961 | Ga0070660_1002369612 | 238 |
| 153 | 3300005340 | Ga0070689_100011223 | Ga0070689_1000112233 | 238 |
| 154 | 3300005341 | Ga0070691_10016213 | Ga0070691_100162133 | 238 |
| 155 | 3300005347 | Ga0070668_100187304 | Ga0070668_1001873042 | 238 |
| 156 | 3300005353 | Ga0070669_100397683 | Ga0070669_1003976832 | 238 |
| 157 | 3300005355 | Ga0070671_100038653 | Ga0070671_1000386533 | 238 |
| 158 | 3300005356 | Ga0070674_100045634 | Ga0070674_1000456343 | 238 |
| 159 | 3300005364 | Ga0070673_100023232 | Ga0070673_1000232324 | 238 |
| 160 | 3300005364 | Ga0070673_100981390 | Ga0070673_1009813901 | 238 |
| 161 | 3300005365 | Ga0070688_100016044 | Ga0070688_1000160442 | 238 |
| 162 | 3300005366 | Ga0070659_100294699 | Ga0070659_1002946992 | 238 |
| 163 | 3300005367 | Ga0070667_100054032 | Ga0070667_1000540323 | 238 |
| 164 | 3300005435 | Ga0070714_100001717 | Ga0070714_10000171710 | 238 |
| 165 | 3300005436 | Ga0070713_100008626 | Ga0070713_1000086265 | 238 |
| 166 | 3300005436 | Ga0070713_100337916 | Ga0070713_1003379162 | 238 |
| 167 | 3300005437 | Ga0070710_10014261 | Ga0070710_100142612 | 238 |
| 168 | 3300005439 | Ga0070711_100115737 | Ga0070711_1001157372 | 238 |
| 169 | 3300005439 | Ga0070711_100136053 | Ga0070711_1001360531 | 238 |
| 170 | 3300005440 | Ga0070705_100611149 | Ga0070705_1006111491 | 238 |
| 171 | 3300005441 | Ga0070700_100073585 | Ga0070700_1000735853 | 238 |
| 172 | 3300005444 | Ga0070694_100766443 | Ga0070694_1007664431 | 238 |
| 173 | 3300005455 | Ga0070663_100061112 | Ga0070663_1000611123 | 238 |
| 174 | 3300005456 | Ga0070678_100141386 | Ga0070678_1001413863 | 238 |
| 175 | 3300005466 | Ga0070685_10012988 | Ga0070685_100129884 | 238 |
| 176 | 3300005535 | Ga0070684_100100028 | Ga0070684_1001000282 | 238 |
| 177 | 3300005535 | Ga0070684_100811840 | Ga0070684_1008118402 | 238 |
| 178 | 3300005543 | Ga0070672_100035421 | Ga0070672_1000354213 | 238 |
| 179 | 3300005544 | Ga0070686_100010778 | Ga0070686_1000107783 | 238 |
| 180 | 3300005548 | Ga0070665_100023806 | Ga0070665_1000238064 | 238 |
| 181 | 3300005549 | Ga0070704_100195506 | Ga0070704_1001955062 | 238 |
| 182 | 3300005564 | Ga0070664_100023220 | Ga0070664_1000232204 | 238 |
| 183 | 3300005577 | Ga0068857_100048107 | Ga0068857_1000481072 | 238 |
| 184 | 3300005578 | Ga0068854_100022931 | Ga0068854_1000229312 | 238 |
| 185 | 3300005614 | Ga0068856_100045746 | Ga0068856_1000457462 | 238 |
| 186 | 3300005615 | Ga0070702_100113030 | Ga0070702_1001130301 | 238 |
| 187 | 3300005616 | Ga0068852_100028469 | Ga0068852_1000284693 | 238 |
| 188 | 3300005617 | Ga0068859_100020118 | Ga0068859_1000201187 | 238 |
| 189 | 3300005618 | Ga0068864_100022792 | Ga0068864_1000227924 | 238 |
| 190 | 3300005718 | Ga0068866_10075107 | Ga0068866_100751072 | 238 |
| 191 | 3300005834 | Ga0068851_10011533 | Ga0068851_100115332 | 238 |
| 192 | 3300005840 | Ga0068870_10007460 | Ga0068870_100074605 | 238 |
| 193 | 3300005841 | Ga0068863_100034537 | Ga0068863_1000345373 | 238 |
| 194 | 3300005841 | Ga0068863_100047285 | Ga0068863_1000472854 | 238 |
| 195 | 3300005843 | Ga0068860_100510993 | Ga0068860_1005109932 | 238 |
| 196 | 3300005844 | Ga0068862_100051221 | Ga0068862_1000512213 | 238 |
| 197 | 3300005937 | Ga0081455_10017616 | Ga0081455_100176163 | 238 |
| 198 | 3300006028 | Ga0070717_10005256 | Ga0070717_100052568 | 238 |
| 199 | 3300006028 | Ga0070717_10284299 | Ga0070717_102842992 | 238 |
| 200 | 3300006028 | Ga0070717_10391947 | Ga0070717_103919472 | 238 |
| 201 | 3300006028 | Ga0070717_10708378 | Ga0070717_107083782 | 238 |
| 202 | 3300006048 | Ga0075363_100026063 | Ga0075363_1000260632 | 238 |
| 203 | 3300006051 | Ga0075364_10108613 | Ga0075364_101086131 | 238 |
| 204 | 3300006163 | Ga0070715_10039488 | Ga0070715_100394882 | 238 |
| 205 | 3300006175 | Ga0070712_100184118 | Ga0070712_1001841182 | 238 |
| 206 | 3300006237 | Ga0097621_100397358 | Ga0097621_1003973581 | 238 |
| 207 | 3300006844 | Ga0075428_100103269 | Ga0075428_1001032694 | 238 |
| 208 | 3300006844 | Ga0075428_100186326 | Ga0075428_1001863261 | 238 |
| 209 | 3300006846 | Ga0075430_100003861 | Ga0075430_1000038614 | 238 |
| 210 | 3300006847 | Ga0075431_100097874 | Ga0075431_1000978744 | 238 |
| 211 | 3300006847 | Ga0075431_100498757 | Ga0075431_1004987572 | 238 |
| 212 | 3300006852 | Ga0075433_10031620 | Ga0075433_100316203 | 238 |
| 213 | 3300006852 | Ga0075433_10367375 | Ga0075433_103673752 | 238 |
| 214 | 3300006871 | Ga0075434_100003814 | Ga0075434_1000038142 | 238 |
| 215 | 3300006871 | Ga0075434_100031871 | Ga0075434_1000318712 | 238 |
| 216 | 3300006871 | Ga0075434_100060134 | Ga0075434_1000601342 | 238 |
| 217 | 3300006871 | Ga0075434_100071882 | Ga0075434_1000718822 | 238 |
| 218 | 3300006880 | Ga0075429_100142052 | Ga0075429_1001420523 | 238 |
| 219 | 3300006881 | Ga0068865_100021335 | Ga0068865_1000213353 | 238 |
| 220 | 3300006914 | Ga0075436_100249389 | Ga0075436_1002493892 | 238 |
| 221 | 3300006931 | Ga0097620_100020117 | Ga0097620_1000201177 | 238 |
| 222 | 3300007788 | Ga0099795_10013800 | Ga0099795_100138003 | 238 |
| 223 | 3300009098 | Ga0105245_10052837 | Ga0105245_100528374 | 238 |
| 224 | 3300009101 | Ga0105247_10047293 | Ga0105247_100472934 | 238 |
| 225 | 3300009147 | Ga0114129_10011166 | Ga0114129_100111664 | 238 |
| 226 | 3300009147 | Ga0114129_10135358 | Ga0114129_101353582 | 238 |
| 227 | 3300009147 | Ga0114129_10375341 | Ga0114129_103753412 | 238 |
| 228 | 3300009147 | Ga0114129_10416397 | Ga0114129_104163972 | 238 |
| 229 | 3300009147 | Ga0114129_11377658 | Ga0114129_113776582 | 238 |
| 230 | 3300009148 | Ga0105243_10163891 | Ga0105243_101638912 | 238 |
| 231 | 3300009176 | Ga0105242_10312002 | Ga0105242_103120022 | 238 |
| 232 | 3300009177 | Ga0105248_10031394 | Ga0105248_100313943 | 238 |
| 233 | 3300009545 | Ga0105237_10140314 | Ga0105237_101403143 | 238 |
| 234 | 3300009551 | Ga0105238_10261602 | Ga0105238_102616021 | 238 |
| 235 | 3300009553 | Ga0105249_10029669 | Ga0105249_100296695 | 238 |
| 236 | 3300009553 | Ga0105249_10061954 | Ga0105249_100619543 | 238 |
| 237 | 3300010375 | Ga0105239_10054294 | Ga0105239_100542942 | 238 |
| 238 | 3300011119 | Ga0105246_10276547 | Ga0105246_102765472 | 238 |
| 239 | 3300013296 | Ga0157374_10021097 | Ga0157374_100210974 | 238 |
| 240 | 3300013307 | Ga0157372_10943540 | Ga0157372_109435401 | 238 |
| 241 | 3300013308 | Ga0157375_10469505 | Ga0157375_104695052 | 238 |
| 242 | 3300014325 | Ga0163163_10278369 | Ga0163163_102783692 | 238 |
| 243 | 3300014326 | Ga0157380_10141957 | Ga0157380_101419573 | 238 |
| 244 | 3300014968 | Ga0157379_10041558 | Ga0157379_100415582 | 238 |
| 245 | 3300014969 | Ga0157376_10047064 | Ga0157376_100470645 | 238 |
| 246 | 3300017792 | Ga0163161_10037784 | Ga0163161_100377843 | 238 |
| 247 | 3300021377 | Ga0213874_10020981 | Ga0213874_100209812 | 238 |
| 248 | 3300025898 | Ga0207692_10000073 | Ga0207692_1000007318 | 238 |
| 249 | 3300025900 | Ga0207710_10007452 | Ga0207710_100074522 | 238 |
| 250 | 3300025901 | Ga0207688_10000939 | Ga0207688_100009393 | 238 |
| 251 | 3300025903 | Ga0207680_10040227 | Ga0207680_100402274 | 238 |
| 252 | 3300025904 | Ga0207647_10042906 | Ga0207647_100429062 | 238 |
| 253 | 3300025905 | Ga0207685_10002787 | Ga0207685_100027872 | 238 |
| 254 | 3300025906 | Ga0207699_10001951 | Ga0207699_100019514 | 238 |
| 255 | 3300025907 | Ga0207645_10020382 | Ga0207645_100203823 | 238 |
| 256 | 3300025908 | Ga0207643_10000300 | Ga0207643_1000030036 | 238 |
| 257 | 3300025915 | Ga0207693_10145284 | Ga0207693_101452842 | 238 |
| 258 | 3300025915 | Ga0207693_10152860 | Ga0207693_101528601 | 238 |
| 259 | 3300025916 | Ga0207663_10032864 | Ga0207663_100328643 | 238 |
| 260 | 3300025918 | Ga0207662_10000768 | Ga0207662_1000076813 | 238 |
| 261 | 3300025919 | Ga0207657_10008236 | Ga0207657_100082363 | 238 |
| 262 | 3300025920 | Ga0207649_10056986 | Ga0207649_100569861 | 238 |
| 263 | 3300025924 | Ga0207694_10290516 | Ga0207694_102905161 | 238 |
| 264 | 3300025925 | Ga0207650_10014779 | Ga0207650_100147796 | 238 |
| 265 | 3300025925 | Ga0207650_10088298 | Ga0207650_100882983 | 238 |
| 266 | 3300025926 | Ga0207659_10008323 | Ga0207659_100083234 | 238 |
| 267 | 3300025927 | Ga0207687_10008827 | Ga0207687_100088275 | 238 |
| 268 | 3300025928 | Ga0207700_10012388 | Ga0207700_100123882 | 238 |
| 269 | 3300025929 | Ga0207664_10002018 | Ga0207664_100020183 | 238 |
| 270 | 3300025931 | Ga0207644_10008269 | Ga0207644_100082693 | 238 |
| 271 | 3300025932 | Ga0207690_10024537 | Ga0207690_100245372 | 238 |
| 272 | 3300025933 | Ga0207706_10081326 | Ga0207706_100813262 | 238 |
| 273 | 3300025934 | Ga0207686_10141983 | Ga0207686_101419832 | 238 |
| 274 | 3300025935 | Ga0207709_10028423 | Ga0207709_100284232 | 238 |
| 275 | 3300025936 | Ga0207670_10038696 | Ga0207670_100386963 | 238 |
| 276 | 3300025937 | Ga0207669_10013651 | Ga0207669_100136512 | 238 |
| 277 | 3300025938 | Ga0207704_10080833 | Ga0207704_100808332 | 238 |
| 278 | 3300025939 | Ga0207665_10176413 | Ga0207665_101764132 | 238 |
| 279 | 3300025940 | Ga0207691_10024993 | Ga0207691_100249935 | 238 |
| 280 | 3300025941 | Ga0207711_10025784 | Ga0207711_100257844 | 238 |
| 281 | 3300025942 | Ga0207689_10017396 | Ga0207689_100173963 | 238 |
| 282 | 3300025944 | Ga0207661_10047017 | Ga0207661_100470173 | 238 |
| 283 | 3300025945 | Ga0207679_10025487 | Ga0207679_100254872 | 238 |
| 284 | 3300025949 | Ga0207667_10612435 | Ga0207667_106124352 | 238 |
| 285 | 3300025960 | Ga0207651_10008018 | Ga0207651_100080186 | 238 |
| 286 | 3300025960 | Ga0207651_10531117 | Ga0207651_105311171 | 238 |
| 287 | 3300025961 | Ga0207712_10019776 | Ga0207712_100197762 | 238 |
| 288 | 3300025961 | Ga0207712_10199811 | Ga0207712_101998112 | 238 |
| 289 | 3300025972 | Ga0207668_10082537 | Ga0207668_100825372 | 238 |
| 290 | 3300025981 | Ga0207640_10060902 | Ga0207640_100609022 | 238 |
| 291 | 3300025986 | Ga0207658_10228487 | Ga0207658_102284873 | 238 |
| 292 | 3300026023 | Ga0207677_10015705 | Ga0207677_100157053 | 238 |
| 293 | 3300026041 | Ga0207639_10016375 | Ga0207639_100163754 | 238 |
| 294 | 3300026067 | Ga0207678_10032795 | Ga0207678_100327952 | 238 |
| 295 | 3300026067 | Ga0207678_10354333 | Ga0207678_103543332 | 238 |
| 296 | 3300026075 | Ga0207708_10003324 | Ga0207708_100033244 | 238 |
| 297 | 3300026078 | Ga0207702_10474442 | Ga0207702_104744422 | 238 |
| 298 | 3300026088 | Ga0207641_10028161 | Ga0207641_100281612 | 238 |
| 299 | 3300026088 | Ga0207641_10714545 | Ga0207641_107145452 | 238 |
| 300 | 3300026095 | Ga0207676_10012380 | Ga0207676_100123804 | 238 |
| 301 | 3300026116 | Ga0207674_10199991 | Ga0207674_101999912 | 238 |
| 302 | 3300026118 | Ga0207675_100010512 | Ga0207675_1000105123 | 238 |
| 303 | 3300026121 | Ga0207683_10005034 | Ga0207683_100050343 | 238 |
| 304 | 3300026142 | Ga0207698_10097681 | Ga0207698_100976812 | 238 |
| 305 | 3300027907 | Ga0207428_10054476 | Ga0207428_100544762 | 238 |
| 306 | 3300028379 | Ga0268266_10092290 | Ga0268266_100922901 | 238 |
| 307 | 3300028379 | Ga0268266_10308494 | Ga0268266_103084941 | 238 |
| 308 | 3300028380 | Ga0268265_10025906 | Ga0268265_100259062 | 238 |
| 309 | 3300028381 | Ga0268264_10053393 | Ga0268264_100533933 | 238 |
| 310 | 3300028381 | Ga0268264_10896567 | Ga0268264_108965672 | 238 |
| 311 | 3300031241 | Ga0265325_10006484 | Ga0265325_100064844 | 238 |
| 312 | 3300031595 | Ga0265313_10000087 | Ga0265313_1000008788 | 238 |
| 313 | 3300031595 | Ga0265313_10012080 | Ga0265313_100120803 | 238 |
| 314 | 3300034957 | Ga0373938_0050141 | Ga0373938_0050141_66_782 | 238 |
| 315 | 3300035083 | Ga0373926_0036369 | Ga0373926_0036369_861_1577 | 238 |
| 316 | 3300035111 | Ga0373923_0164423 | Ga0373923_0164423_82_798 | 238 |
| 317 | 3300035117 | Ga0373953_0017303 | Ga0373953_0017303_1889_2605 | 238 |
| 318 | 3300035171 | Ga0373946_0076193 | Ga0373946_0076193_278_994 | 238 |
| 319 | 3300035241 | Ga0373961_0059420 | Ga0373961_0059420_422_1138 | 238 |
| 320 | 3300035242 | Ga0373962_0019976 | Ga0373962_0019976_596_1312 | 238 |
| 321 | 3300035410 | Ga0373924_0234516 | Ga0373924_0234516_85_801 | 238 |
| 322 | 3300035691 | Ga0373931_0056043 | Ga0373931_0056043_1018_1734 | 238 |
| 323 | 3300035692 | Ga0373935_0411473 | Ga0373935_0411473_107_823 | 238 |
| 324 | 3300035695 | Ga0373927_0036539 | Ga0373927_0036539_2281_2997 | 238 |
| 325 | 3300035695 | Ga0373927_0077672 | Ga0373927_0077672_1192_1908 | 238 |
| 326 | 3300035724 | Ga0373933_0049313 | Ga0373933_0049313_667_1383 | 238 |
| 327 | 3300036401 | Ga0373937_0016602 | Ga0373937_0016602_3172_3888 | 238 |
| 328 | 3300037068 | Ga0373925_0033508 | Ga0373925_0033508_1070_1786 | 238 |
| 329 | 3300037418 | Ga0395900_0184789 | Ga0395900_0184789_386_1102 | 238 |
| 330 | 3300038443 | Ga0395901_0098532 | Ga0395901_0098532_608_1324 | 238 |
| 331 | 3300039450 | Ga0436363_0315669 | Ga0436363_0315669_911_1627 | 238 |
| 332 | 3300041443 | Ga0451789_0709386 | Ga0451789_0709386_261_977 | 238 |
| 333 | 3300041498 | Ga0451841_1135030 | Ga0451841_1135030_43_759 | 238 |
| 334 | 3300046454 | Ga0495592_0330381 | Ga0495592_0330381_157_873 | 238 |
| 335 | 3300046457 | Ga0495590_0065920 | Ga0495590_0065920_194_910 | 238 |
| 336 | 3300046473 | Ga0495582_0017090 | Ga0495582_0017090_839_1555 | 238 |
| 337 | 3300046473 | Ga0495582_0232168 | Ga0495582_0232168_236_952 | 238 |
| 338 | 3300046491 | Ga0495584_0133249 | Ga0495584_0133249_330_1046 | 238 |
| 339 | 3300046492 | Ga0495585_0057057 | Ga0495585_0057057_479_1195 | 238 |
| 340 | 3300046500 | Ga0495596_0068793 | Ga0495596_0068793_456_1172 | 238 |
| 341 | 3300046517 | Ga0495630_0111010 | Ga0495630_0111010_1292_2008 | 238 |
| 342 | 3300046517 | Ga0495630_0501288 | Ga0495630_0501288_203_919 | 238 |
| 343 | 3300046518 | Ga0495631_0176986 | Ga0495631_0176986_161_877 | 238 |
| 344 | 3300046520 | Ga0495637_0083539 | Ga0495637_0083539_159_875 | 238 |
| 345 | 3300046529 | Ga0495652_0200517 | Ga0495652_0200517_355_1071 | 238 |
| 346 | 3300046533 | Ga0495640_0140984 | Ga0495640_0140984_233_949 | 238 |
| 347 | 3300046539 | Ga0495621_0015610 | Ga0495621_0015610_24_740 | 238 |
| 348 | 3300046557 | Ga0495622_0015379 | Ga0495622_0015379_1876_2592 | 238 |
| 349 | 3300046616 | Ga0495668_0079881 | Ga0495668_0079881_433_1149 | 238 |
| 350 | 3300046683 | Ga0495658_0015226 | Ga0495658_0015226_1388_2104 | 238 |
| 351 | 3300046684 | Ga0495669_0173001 | Ga0495669_0173001_106_822 | 238 |
| 352 | 3300046691 | Ga0495670_0162092 | Ga0495670_0162092_65_781 | 238 |
| 353 | 3300047319 | Ga0495674_0120293 | Ga0495674_0120293_391_1107 | 238 |
| 354 | 3300047321 | Ga0495676_0132214 | Ga0495676_0132214_755_1471 | 238 |
| 355 | 3300047470 | Ga0495681_0133276 | Ga0495681_0133276_20_736 | 238 |
| 356 | 3300047673 | Ga0495593_0066459 | Ga0495593_0066459_575_1291 | 238 |
| 357 | 3300048091 | Ga0495626_0053820 | Ga0495626_0053820_874_1590 | 238 |
| 358 | 3300048904 | Ga0496101_0001022 | Ga0496101_0001022_5084_5800 | 238 |
| 359 | 3300048904 | Ga0496101_0059913 | Ga0496101_0059913_1444_2160 | 238 |
| 360 | 3300048904 | Ga0496101_0411135 | Ga0496101_0411135_151_867 | 238 |
| 361 | 3300048905 | Ga0496102_0010246 | Ga0496102_0010246_970_1686 | 238 |
| 362 | 3300048905 | Ga0496102_0103422 | Ga0496102_0103422_1227_1943 | 238 |
| 363 | 3300048906 | Ga0496103_0025906 | Ga0496103_0025906_1179_1895 | 238 |
| 364 | 3300048907 | Ga0496104_0009710 | Ga0496104_0009710_4599_5315 | 238 |
| 365 | 3300048907 | Ga0496104_0019198 | Ga0496104_0019198_4693_5409 | 238 |
| 366 | 3300048908 | Ga0496105_0012029 | Ga0496105_0012029_3567_4283 | 238 |
| 367 | 3300048908 | Ga0496105_0018797 | Ga0496105_0018797_3099_3815 | 238 |
| 368 | 3300048909 | Ga0496106_0019556 | Ga0496106_0019556_3365_4081 | 238 |
| 369 | 3300048909 | Ga0496106_0032399 | Ga0496106_0032399_2116_2832 | 238 |
| 370 | 3300048909 | Ga0496106_0090672 | Ga0496106_0090672_1601_2317 | 238 |
| 371 | 3300048909 | Ga0496106_0171288 | Ga0496106_0171288_964_1680 | 238 |
| 372 | 3300048910 | Ga0496107_0013215 | Ga0496107_0013215_3251_3967 | 238 |
| 373 | 3300048910 | Ga0496107_0024486 | Ga0496107_0024486_2672_3388 | 238 |
| 374 | 3300048911 | Ga0496108_0019323 | Ga0496108_0019323_261_977 | 238 |
| 375 | 3300048911 | Ga0496108_0026579 | Ga0496108_0026579_1771_2487 | 238 |
| 376 | 3300048912 | Ga0496109_0000644 | Ga0496109_0000644_1680_2396 | 238 |
| 377 | 3300048912 | Ga0496109_0026513 | Ga0496109_0026513_2839_3555 | 238 |
| 378 | 3300048913 | Ga0496110_0019757 | Ga0496110_0019757_2900_3616 | 238 |
| 379 | 3300048914 | Ga0496111_0014335 | Ga0496111_0014335_2389_3105 | 238 |
| 380 | 3300048914 | Ga0496111_0030481 | Ga0496111_0030481_1461_2177 | 238 |
| 381 | 3300048915 | Ga0496112_0001548 | Ga0496112_0001548_4558_5274 | 238 |
| 382 | 3300048915 | Ga0496112_0036518 | Ga0496112_0036518_3236_3952 | 238 |
| 383 | 3300048915 | Ga0496112_0358767 | Ga0496112_0358767_300_1016 | 238 |
| 384 | 3300048916 | Ga0496113_0001777 | Ga0496113_0001777_3839_4555 | 238 |
| 385 | 3300048916 | Ga0496113_0009092 | Ga0496113_0009092_3236_3952 | 238 |
| 386 | 3300048917 | Ga0496114_0025740 | Ga0496114_0025740_2325_3041 | 238 |
| 387 | 3300048918 | Ga0496115_0013652 | Ga0496115_0013652_3701_4417 | 238 |
| 388 | 3300048918 | Ga0496115_0487196 | Ga0496115_0487196_228_944 | 238 |
| 389 | 3300049580 | Ga0501046_0317360 | Ga0501046_0317360_49_765 | 238 |
| 390 | 3300049586 | Ga0501070_0395903 | Ga0501070_0395903_275_991 | 238 |
| 391 | 3300049588 | Ga0501072_0432583 | Ga0501072_0432583_90_806 | 238 |
| 392 | 3300049590 | Ga0501074_0142212 | Ga0501074_0142212_234_950 | 238 |
| 393 | 3300049593 | Ga0501077_0171763 | Ga0501077_0171763_527_1243 | 238 |
| 394 | 3300049741 | Ga0501079_0229645 | Ga0501079_0229645_130_846 | 238 |
| 395 | 3300050491 | nmdc:mga00v17_455043_c1 | nmdc:mga00v17_455043_c1_17_733 | 238 |
| 396 | 3300050492 | nmdc:mga0yw44_35055_c1 | nmdc:mga0yw44_35055_c1_1453_2169 | 238 |
| 397 | 3300050492 | nmdc:mga0yw44_426623_c1 | nmdc:mga0yw44_426623_c1_65_781 | 238 |
| 398 | 3300050507 | nmdc:mga05p37_34032_c1 | nmdc:mga05p37_34032_c1_3657_4373 | 238 |
| 399 | 3300050507 | nmdc:mga05p37_410288_c1 | nmdc:mga05p37_410288_c1_206_922 | 238 |
| 400 | 3300050507 | nmdc:mga05p37_80216_c1 | nmdc:mga05p37_80216_c1_1522_2244 | 238 |
| 401 | 3300050509 | nmdc:mga0qj67_1526_c1 | nmdc:mga0qj67_1526_c1_7139_7855 | 238 |
| 402 | 3300050510 | nmdc:mga06r32_212768_c1 | nmdc:mga06r32_212768_c1_682_1398 | 238 |
| 403 | 3300050510 | nmdc:mga06r32_446218_c1 | nmdc:mga06r32_446218_c1_39_755 | 238 |
| 404 | 3300050510 | nmdc:mga06r32_663117_c1 | nmdc:mga06r32_663117_c1_162_878 | 238 |
| 405 | 3300050510 | nmdc:mga06r32_67440_c1 | nmdc:mga06r32_67440_c1_1149_1865 | 238 |
| 406 | 3300050511 | nmdc:mga08y16_248059_c1 | nmdc:mga08y16_248059_c1_637_1353 | 238 |
| 407 | 3300050511 | nmdc:mga08y16_268952_c1 | nmdc:mga08y16_268952_c1_173_889 | 238 |
| 408 | 3300050512 | nmdc:mga0n895_114593_c1 | nmdc:mga0n895_114593_c1_426_1142 | 238 |
| 409 | 3300050512 | nmdc:mga0n895_4270_c1 | nmdc:mga0n895_4270_c1_2148_2864 | 238 |
| 410 | 3300050513 | nmdc:mga0rr50_351658_c1 | nmdc:mga0rr50_351658_c1_204_920 | 238 |
| 411 | 3300050514 | nmdc:mga08x19_191526_c1 | nmdc:mga08x19_191526_c1_567_1283 | 238 |
| 412 | 3300050515 | nmdc:mga0a205_20171_c1 | nmdc:mga0a205_20171_c1_2295_3011 | 238 |
| 413 | 3300050515 | nmdc:mga0a205_343307_c1 | nmdc:mga0a205_343307_c1_550_1266 | 238 |
| 414 | 3300053085 | Ga0495619_0030107 | Ga0495619_0030107_891_1607 | 238 |
| 415 | 3300005329 | Ga0070683_100151902 | Ga0070683_1001519022 | 239 |
| 416 | 3300005337 | Ga0070682_100060135 | Ga0070682_1000601352 | 239 |
| 417 | 3300005354 | Ga0070675_100307546 | Ga0070675_1003075461 | 239 |
| 418 | 3300005364 | Ga0070673_100593512 | Ga0070673_1005935122 | 239 |
| 419 | 3300005367 | Ga0070667_100297760 | Ga0070667_1002977601 | 239 |
| 420 | 3300005406 | Ga0070703_10142656 | Ga0070703_101426561 | 239 |
| 421 | 3300005577 | Ga0068857_100385003 | Ga0068857_1003850031 | 239 |
| 422 | 3300005842 | Ga0068858_100601218 | Ga0068858_1006012182 | 239 |
| 423 | 3300005983 | Ga0081540_1004734 | Ga0081540_10047344 | 239 |
| 424 | 3300005983 | Ga0081540_1010142 | Ga0081540_10101421 | 239 |
| 425 | 3300005983 | Ga0081540_1023475 | Ga0081540_10234752 | 239 |
| 426 | 3300006177 | Ga0075362_10072275 | Ga0075362_100722752 | 239 |
| 427 | 3300006880 | Ga0075429_100582962 | Ga0075429_1005829621 | 239 |
| 428 | 3300009553 | Ga0105249_10325201 | Ga0105249_103252012 | 239 |
| 429 | 3300013306 | Ga0163162_10440066 | Ga0163162_104400661 | 239 |
| 430 | 3300025898 | Ga0207692_10391109 | Ga0207692_103911091 | 239 |
| 431 | 3300025986 | Ga0207658_10584427 | Ga0207658_105844272 | 239 |
| 432 | 3300028380 | Ga0268265_10315147 | Ga0268265_103151472 | 239 |
| 433 | 3300031235 | Ga0265330_10029267 | Ga0265330_100292673 | 239 |
| 434 | 3300031238 | Ga0265332_10002206 | Ga0265332_100022064 | 239 |
| 435 | 3300031238 | Ga0265332_10041593 | Ga0265332_100415932 | 239 |
| 436 | 3300031241 | Ga0265325_10058826 | Ga0265325_100588262 | 239 |
| 437 | 3300031247 | Ga0265340_10001844 | Ga0265340_100018443 | 239 |
| 438 | 3300031247 | Ga0265340_10042254 | Ga0265340_100422543 | 239 |
| 439 | 3300031249 | Ga0265339_10004871 | Ga0265339_100048714 | 239 |
| 440 | 3300031249 | Ga0265339_10130160 | Ga0265339_101301602 | 239 |
| 441 | 3300031344 | Ga0265316_10210451 | Ga0265316_102104512 | 239 |
| 442 | 3300031712 | Ga0265342_10001555 | Ga0265342_1000155510 | 239 |
| 443 | 3300031712 | Ga0265342_10083995 | Ga0265342_100839952 | 239 |
| 444 | 3300039450 | Ga0436363_0817259 | Ga0436363_0817259_22_741 | 239 |
| 445 | 3300046460 | Ga0495638_0121599 | Ga0495638_0121599_753_1472 | 239 |
| 446 | 3300046558 | Ga0495633_0103793 | Ga0495633_0103793_45_764 | 239 |
| 447 | 3300046615 | Ga0495656_0049233 | Ga0495656_0049233_508_1227 | 239 |
| 448 | 3300048904 | Ga0496101_0049036 | Ga0496101_0049036_784_1503 | 239 |
| 449 | 3300048907 | Ga0496104_0050759 | Ga0496104_0050759_2217_2936 | 239 |
| 450 | 3300048911 | Ga0496108_0343744 | Ga0496108_0343744_33_752 | 239 |
| 451 | 3300048917 | Ga0496114_0041072 | Ga0496114_0041072_1443_2162 | 239 |
| 452 | 3300048918 | Ga0496115_0472621 | Ga0496115_0472621_167_886 | 239 |
| 453 | 3300049569 | Ga0501032_0438946 | Ga0501032_0438946_50_805 | 239 |
| 454 | 3300049571 | Ga0501034_0306070 | Ga0501034_0306070_203_922 | 239 |
| 455 | 3300049582 | Ga0501048_0161666 | Ga0501048_0161666_789_1508 | 239 |
| 456 | 3300049744 | Ga0501083_0119904 | Ga0501083_0119904_649_1368 | 239 |
| 457 | 3300050507 | nmdc:mga05p37_330381_c1 | nmdc:mga05p37_330381_c1_169_888 | 239 |
| 458 | 3300050507 | nmdc:mga05p37_965436_c1 | nmdc:mga05p37_965436_c1_117_836 | 239 |
| 459 | 3300050508 | nmdc:mga09592_180873_c1 | nmdc:mga09592_180873_c1_360_1079 | 239 |
| 460 | 3300050510 | nmdc:mga06r32_168966_c1 | nmdc:mga06r32_168966_c1_1092_1811 | 239 |
| 461 | 3300053085 | Ga0495619_0006229 | Ga0495619_0006229_4328_5047 | 239 |
| 462 | 3300054114 | Ga0501084_0168169 | Ga0501084_0168169_1081_1800 | 239 |
| 463 | 3300060353 | Ga0501082_0078165 | Ga0501082_0078165_539_1258 | 239 |
| 464 | 3300005336 | Ga0070680_100134470 | Ga0070680_1001344702 | 240 |
| 465 | 3300005435 | Ga0070714_100092964 | Ga0070714_1000929642 | 240 |
| 466 | 3300005436 | Ga0070713_100073307 | Ga0070713_1000733073 | 240 |
| 467 | 3300005436 | Ga0070713_100099211 | Ga0070713_1000992112 | 240 |
| 468 | 3300005437 | Ga0070710_10021851 | Ga0070710_100218512 | 240 |
| 469 | 3300005445 | Ga0070708_100482556 | Ga0070708_1004825561 | 240 |
| 470 | 3300005458 | Ga0070681_10051334 | Ga0070681_100513344 | 240 |
| 471 | 3300005518 | Ga0070699_100010246 | Ga0070699_1000102462 | 240 |
| 472 | 3300005535 | Ga0070684_100033102 | Ga0070684_1000331024 | 240 |
| 473 | 3300005937 | Ga0081455_10082492 | Ga0081455_100824922 | 240 |
| 474 | 3300005983 | Ga0081540_1127389 | Ga0081540_11273891 | 240 |
| 475 | 3300006028 | Ga0070717_10229996 | Ga0070717_102299962 | 240 |
| 476 | 3300006173 | Ga0070716_100171043 | Ga0070716_1001710432 | 240 |
| 477 | 3300006914 | Ga0075436_100406007 | Ga0075436_1004060072 | 240 |
| 478 | 3300007265 | Ga0099794_10021139 | Ga0099794_100211392 | 240 |
| 479 | 3300009093 | Ga0105240_10175883 | Ga0105240_101758832 | 240 |
| 480 | 3300009174 | Ga0105241_10165889 | Ga0105241_101658892 | 240 |
| 481 | 3300013104 | Ga0157370_10149088 | Ga0157370_101490882 | 240 |
| 482 | 3300025910 | Ga0207684_10171941 | Ga0207684_101719412 | 240 |
| 483 | 3300025911 | Ga0207654_10065192 | Ga0207654_100651924 | 240 |
| 484 | 3300025912 | Ga0207707_10203838 | Ga0207707_102038382 | 240 |
| 485 | 3300025915 | Ga0207693_10051931 | Ga0207693_100519313 | 240 |
| 486 | 3300025915 | Ga0207693_10288677 | Ga0207693_102886772 | 240 |
| 487 | 3300025928 | Ga0207700_10517163 | Ga0207700_105171632 | 240 |
| 488 | 3300025929 | Ga0207664_10099185 | Ga0207664_100991852 | 240 |
| 489 | 3300025929 | Ga0207664_10120720 | Ga0207664_101207202 | 240 |
| 490 | 3300031249 | Ga0265339_10000071 | Ga0265339_1000007154 | 240 |
| 491 | 3300031595 | Ga0265313_10000415 | Ga0265313_1000041515 | 240 |
| 492 | 3300039438 | Ga0436360_0816965 | Ga0436360_0816965_408_1130 | 240 |
| 493 | 3300039447 | Ga0436361_0189718 | Ga0436361_0189718_2410_3132 | 240 |
| 494 | 3300048905 | Ga0496102_0322617 | Ga0496102_0322617_295_1017 | 240 |
| 495 | 3300048907 | Ga0496104_0001202 | Ga0496104_0001202_8940_9662 | 240 |
| 496 | 3300048907 | Ga0496104_0068688 | Ga0496104_0068688_999_1721 | 240 |
| 497 | 3300048909 | Ga0496106_0079835 | Ga0496106_0079835_980_1702 | 240 |
| 498 | 3300048910 | Ga0496107_0109961 | Ga0496107_0109961_838_1560 | 240 |
| 499 | 3300048911 | Ga0496108_0377511 | Ga0496108_0377511_38_760 | 240 |
| 500 | 3300048916 | Ga0496113_0099606 | Ga0496113_0099606_1278_2000 | 240 |
| 501 | 3300048918 | Ga0496115_0033804 | Ga0496115_0033804_503_1225 | 240 |
| 502 | 3300050512 | nmdc:mga0n895_1021766_c1 | nmdc:mga0n895_1021766_c1_55_777 | 240 |
| 503 | 3300049568 | Ga0501031_0020371 | Ga0501031_0020371_2781_3512 | 242 |
| 504 | 3300049570 | Ga0501033_0099714 | Ga0501033_0099714_1088_1819 | 242 |
| 505 | 3300049571 | Ga0501034_0149522 | Ga0501034_0149522_514_1245 | 242 |
| 506 | 3300049822 | Ga0501035_0129023 | Ga0501035_0129023_297_1028 | 242 |
| 507 | 3300001430 | JGI24032J14994_101055 | JGI24032J14994_1010551 | 244 |
| 508 | 3300001976 | JGI24752J21851_1013427 | JGI24752J21851_10134271 | 244 |
| 509 | 3300001977 | JGI24746J21847_1001650 | JGI24746J21847_10016502 | 244 |
| 510 | 3300001978 | JGI24747J21853_1001844 | JGI24747J21853_10018442 | 244 |
| 511 | 3300001989 | JGI24739J22299_10014137 | JGI24739J22299_100141372 | 244 |
| 512 | 3300001990 | JGI24737J22298_10012901 | JGI24737J22298_100129013 | 244 |
| 513 | 3300001991 | JGI24743J22301_10004048 | JGI24743J22301_100040481 | 244 |
| 514 | 3300002070 | JGI24750J21931_1000188 | JGI24750J21931_10001882 | 244 |
| 515 | 3300002073 | JGI24745J21846_1008993 | JGI24745J21846_10089931 | 244 |
| 516 | 3300002075 | JGI24738J21930_10000068 | JGI24738J21930_1000006816 | 244 |
| 517 | 3300002077 | JGI24744J21845_10019934 | JGI24744J21845_100199341 | 244 |
| 518 | 3300002126 | JGI24035J26624_1000816 | JGI24035J26624_10008162 | 244 |
| 519 | 3300002239 | JGI24034J26672_10004654 | JGI24034J26672_100046542 | 244 |
| 520 | 3300002244 | JGI24742J22300_10019847 | JGI24742J22300_100198472 | 244 |
| 521 | 3300002459 | JGI24751J29686_10002565 | JGI24751J29686_100025651 | 244 |
| 522 | 3300005293 | Ga0065715_10089172 | Ga0065715_1008917213 | 244 |
| 523 | 3300005329 | Ga0070683_100004718 | Ga0070683_10000471813 | 244 |
| 524 | 3300005330 | Ga0070690_100001828 | Ga0070690_1000018281 | 244 |
| 525 | 3300005331 | Ga0070670_100001134 | Ga0070670_1000011341 | 244 |
| 526 | 3300005333 | Ga0070677_10004240 | Ga0070677_100042405 | 244 |
| 527 | 3300005334 | Ga0068869_100002241 | Ga0068869_1000022413 | 244 |
| 528 | 3300005335 | Ga0070666_10241461 | Ga0070666_102414611 | 244 |
| 529 | 3300005336 | Ga0070680_100037746 | Ga0070680_1000377466 | 244 |
| 530 | 3300005336 | Ga0070680_100195912 | Ga0070680_1001959121 | 244 |
| 531 | 3300005338 | Ga0068868_100060072 | Ga0068868_1000600723 | 244 |
| 532 | 3300005339 | Ga0070660_100000730 | Ga0070660_1000007303 | 244 |
| 533 | 3300005340 | Ga0070689_100000601 | Ga0070689_1000006013 | 244 |
| 534 | 3300005343 | Ga0070687_100000253 | Ga0070687_1000002531 | 244 |
| 535 | 3300005344 | Ga0070661_100003564 | Ga0070661_1000035641 | 244 |
| 536 | 3300005345 | Ga0070692_10000060 | Ga0070692_100000602 | 244 |
| 537 | 3300005353 | Ga0070669_100000888 | Ga0070669_10000088817 | 244 |
| 538 | 3300005354 | Ga0070675_100000441 | Ga0070675_1000004419 | 244 |
| 539 | 3300005355 | Ga0070671_100012431 | Ga0070671_1000124318 | 244 |
| 540 | 3300005356 | Ga0070674_100000723 | Ga0070674_1000007231 | 244 |
| 541 | 3300005364 | Ga0070673_100000456 | Ga0070673_10000045617 | 244 |
| 542 | 3300005366 | Ga0070659_100071077 | Ga0070659_1000710773 | 244 |
| 543 | 3300005367 | Ga0070667_100004366 | Ga0070667_10000436612 | 244 |
| 544 | 3300005438 | Ga0070701_10000150 | Ga0070701_1000015017 | 244 |
| 545 | 3300005441 | Ga0070700_100001083 | Ga0070700_10000108314 | 244 |
| 546 | 3300005444 | Ga0070694_100005807 | Ga0070694_1000058073 | 244 |
| 547 | 3300005455 | Ga0070663_100235138 | Ga0070663_1002351381 | 244 |
| 548 | 3300005456 | Ga0070678_100000199 | Ga0070678_1000001998 | 244 |
| 549 | 3300005458 | Ga0070681_10001398 | Ga0070681_100013981 | 244 |
| 550 | 3300005458 | Ga0070681_10471298 | Ga0070681_104712981 | 244 |
| 551 | 3300005459 | Ga0068867_100070864 | Ga0068867_1000708641 | 244 |
| 552 | 3300005466 | Ga0070685_10070280 | Ga0070685_100702802 | 244 |
| 553 | 3300005530 | Ga0070679_100003933 | Ga0070679_1000039334 | 244 |
| 554 | 3300005530 | Ga0070679_100109379 | Ga0070679_1001093791 | 244 |
| 555 | 3300005535 | Ga0070684_100008219 | Ga0070684_1000082196 | 244 |
| 556 | 3300005543 | Ga0070672_100084911 | Ga0070672_1000849111 | 244 |
| 557 | 3300005544 | Ga0070686_100000746 | Ga0070686_10000074617 | 244 |
| 558 | 3300005545 | Ga0070695_100180484 | Ga0070695_1001804842 | 244 |
| 559 | 3300005547 | Ga0070693_100000613 | Ga0070693_10000061316 | 244 |
| 560 | 3300005549 | Ga0070704_100161117 | Ga0070704_1001611172 | 244 |
| 561 | 3300005564 | Ga0070664_100405256 | Ga0070664_1004052561 | 244 |
| 562 | 3300005577 | Ga0068857_100010463 | Ga0068857_1000104639 | 244 |
| 563 | 3300005578 | Ga0068854_100038064 | Ga0068854_1000380644 | 244 |
| 564 | 3300005614 | Ga0068856_100001340 | Ga0068856_1000013407 | 244 |
| 565 | 3300005615 | Ga0070702_100000293 | Ga0070702_10000029311 | 244 |
| 566 | 3300005616 | Ga0068852_100087901 | Ga0068852_1000879011 | 244 |
| 567 | 3300005617 | Ga0068859_100001767 | Ga0068859_1000017673 | 244 |
| 568 | 3300005618 | Ga0068864_100003544 | Ga0068864_10000354413 | 244 |
| 569 | 3300005718 | Ga0068866_10000372 | Ga0068866_100003721 | 244 |
| 570 | 3300005840 | Ga0068870_10000207 | Ga0068870_100002071 | 244 |
| 571 | 3300005841 | Ga0068863_100028324 | Ga0068863_1000283243 | 244 |
| 572 | 3300005842 | Ga0068858_100004999 | Ga0068858_1000049997 | 244 |
| 573 | 3300005843 | Ga0068860_100019087 | Ga0068860_1000190878 | 244 |
| 574 | 3300006058 | Ga0075432_10060363 | Ga0075432_100603631 | 244 |
| 575 | 3300006237 | Ga0097621_100045181 | Ga0097621_1000451813 | 244 |
| 576 | 3300006358 | Ga0068871_100078591 | Ga0068871_1000785913 | 244 |
| 577 | 3300006852 | Ga0075433_10019693 | Ga0075433_100196932 | 244 |
| 578 | 3300006871 | Ga0075434_100529770 | Ga0075434_1005297702 | 244 |
| 579 | 3300006881 | Ga0068865_100000537 | Ga0068865_10000053716 | 244 |
| 580 | 3300006931 | Ga0097620_100001767 | Ga0097620_1000017673 | 244 |
| 581 | 3300009093 | Ga0105240_10192164 | Ga0105240_101921642 | 244 |
| 582 | 3300009094 | Ga0111539_10273679 | Ga0111539_102736792 | 244 |
| 583 | 3300009098 | Ga0105245_10000888 | Ga0105245_1000088812 | 244 |
| 584 | 3300009101 | Ga0105247_10135152 | Ga0105247_101351522 | 244 |
| 585 | 3300009148 | Ga0105243_10196764 | Ga0105243_101967642 | 244 |
| 586 | 3300009174 | Ga0105241_10000662 | Ga0105241_1000066211 | 244 |
| 587 | 3300009177 | Ga0105248_10002336 | Ga0105248_1000233616 | 244 |
| 588 | 3300009545 | Ga0105237_10046059 | Ga0105237_100460591 | 244 |
| 589 | 3300009551 | Ga0105238_10279811 | Ga0105238_102798112 | 244 |
| 590 | 3300009553 | Ga0105249_10394324 | Ga0105249_103943241 | 244 |
| 591 | 3300010375 | Ga0105239_10080934 | Ga0105239_100809343 | 244 |
| 592 | 3300011119 | Ga0105246_10007028 | Ga0105246_100070288 | 244 |
| 593 | 3300013102 | Ga0157371_10117919 | Ga0157371_101179191 | 244 |
| 594 | 3300013296 | Ga0157374_10146030 | Ga0157374_101460302 | 244 |
| 595 | 3300013297 | Ga0157378_10073544 | Ga0157378_100735443 | 244 |
| 596 | 3300013306 | Ga0163162_10112141 | Ga0163162_101121412 | 244 |
| 597 | 3300013307 | Ga0157372_10038501 | Ga0157372_100385018 | 244 |
| 598 | 3300013308 | Ga0157375_10001031 | Ga0157375_1000103116 | 244 |
| 599 | 3300014326 | Ga0157380_10000726 | Ga0157380_100007261 | 244 |
| 600 | 3300014745 | Ga0157377_10000324 | Ga0157377_100003242 | 244 |
| 601 | 3300014968 | Ga0157379_10001193 | Ga0157379_100011931 | 244 |
| 602 | 3300014969 | Ga0157376_10012211 | Ga0157376_100122112 | 244 |
| 603 | 3300017792 | Ga0163161_10001040 | Ga0163161_1000104016 | 244 |
| 604 | 3300025271 | Ga0207666_1000034 | Ga0207666_100003416 | 244 |
| 605 | 3300025315 | Ga0207697_10000280 | Ga0207697_1000028016 | 244 |
| 606 | 3300025885 | Ga0207653_10009627 | Ga0207653_100096273 | 244 |
| 607 | 3300025893 | Ga0207682_10000134 | Ga0207682_1000013415 | 244 |
| 608 | 3300025899 | Ga0207642_10010308 | Ga0207642_100103085 | 244 |
| 609 | 3300025900 | Ga0207710_10003581 | Ga0207710_100035812 | 244 |
| 610 | 3300025901 | Ga0207688_10000526 | Ga0207688_100005261 | 244 |
| 611 | 3300025903 | Ga0207680_10033276 | Ga0207680_100332762 | 244 |
| 612 | 3300025904 | Ga0207647_10016576 | Ga0207647_100165761 | 244 |
| 613 | 3300025907 | Ga0207645_10039728 | Ga0207645_100397283 | 244 |
| 614 | 3300025908 | Ga0207643_10000475 | Ga0207643_1000047526 | 244 |
| 615 | 3300025911 | Ga0207654_10006328 | Ga0207654_100063287 | 244 |
| 616 | 3300025912 | Ga0207707_10069245 | Ga0207707_100692453 | 244 |
| 617 | 3300025913 | Ga0207695_10279293 | Ga0207695_102792932 | 244 |
| 618 | 3300025917 | Ga0207660_10260293 | Ga0207660_102602933 | 244 |
| 619 | 3300025917 | Ga0207660_10409617 | Ga0207660_104096172 | 244 |
| 620 | 3300025918 | Ga0207662_10000341 | Ga0207662_100003411 | 244 |
| 621 | 3300025919 | Ga0207657_10081113 | Ga0207657_100811131 | 244 |
| 622 | 3300025920 | Ga0207649_10000271 | Ga0207649_1000027116 | 244 |
| 623 | 3300025921 | Ga0207652_10101929 | Ga0207652_101019292 | 244 |
| 624 | 3300025921 | Ga0207652_10154955 | Ga0207652_101549553 | 244 |
| 625 | 3300025923 | Ga0207681_10000658 | Ga0207681_1000065816 | 244 |
| 626 | 3300025924 | Ga0207694_10228090 | Ga0207694_102280902 | 244 |
| 627 | 3300025925 | Ga0207650_10031270 | Ga0207650_100312706 | 244 |
| 628 | 3300025926 | Ga0207659_10000177 | Ga0207659_100001778 | 244 |
| 629 | 3300025927 | Ga0207687_10000495 | Ga0207687_1000049516 | 244 |
| 630 | 3300025931 | Ga0207644_10000279 | Ga0207644_1000027915 | 244 |
| 631 | 3300025932 | Ga0207690_10008301 | Ga0207690_100083013 | 244 |
| 632 | 3300025933 | Ga0207706_10005939 | Ga0207706_100059391 | 244 |
| 633 | 3300025934 | Ga0207686_10181080 | Ga0207686_101810802 | 244 |
| 634 | 3300025935 | Ga0207709_10000952 | Ga0207709_1000095216 | 244 |
| 635 | 3300025936 | Ga0207670_10000491 | Ga0207670_1000049116 | 244 |
| 636 | 3300025937 | Ga0207669_10342700 | Ga0207669_103427002 | 244 |
| 637 | 3300025938 | Ga0207704_10008932 | Ga0207704_100089321 | 244 |
| 638 | 3300025940 | Ga0207691_10002815 | Ga0207691_1000281515 | 244 |
| 639 | 3300025941 | Ga0207711_10001570 | Ga0207711_1000157016 | 244 |
| 640 | 3300025942 | Ga0207689_10003227 | Ga0207689_1000322714 | 244 |
| 641 | 3300025944 | Ga0207661_10000642 | Ga0207661_100006421 | 244 |
| 642 | 3300025945 | Ga0207679_10000046 | Ga0207679_100000466 | 244 |
| 643 | 3300025949 | Ga0207667_10007962 | Ga0207667_1000796213 | 244 |
| 644 | 3300025960 | Ga0207651_10000214 | Ga0207651_1000021416 | 244 |
| 645 | 3300025961 | Ga0207712_10003297 | Ga0207712_1000329712 | 244 |
| 646 | 3300025972 | Ga0207668_10000537 | Ga0207668_1000053716 | 244 |
| 647 | 3300025981 | Ga0207640_10002737 | Ga0207640_100027375 | 244 |
| 648 | 3300025986 | Ga0207658_10001147 | Ga0207658_100011472 | 244 |
| 649 | 3300026035 | Ga0207703_10000940 | Ga0207703_1000094010 | 244 |
| 650 | 3300026041 | Ga0207639_10000852 | Ga0207639_1000085216 | 244 |
| 651 | 3300026067 | Ga0207678_10007136 | Ga0207678_1000713610 | 244 |
| 652 | 3300026075 | Ga0207708_10001006 | Ga0207708_100010061 | 244 |
| 653 | 3300026078 | Ga0207702_10002642 | Ga0207702_100026428 | 244 |
| 654 | 3300026088 | Ga0207641_10001370 | Ga0207641_1000137016 | 244 |
| 655 | 3300026089 | Ga0207648_10087764 | Ga0207648_100877643 | 244 |
| 656 | 3300026095 | Ga0207676_10010200 | Ga0207676_100102006 | 244 |
| 657 | 3300026116 | Ga0207674_10002956 | Ga0207674_1000295616 | 244 |
| 658 | 3300026118 | Ga0207675_100006209 | Ga0207675_1000062091 | 244 |
| 659 | 3300026121 | Ga0207683_10004449 | Ga0207683_100044493 | 244 |
| 660 | 3300026142 | Ga0207698_10007930 | Ga0207698_100079303 | 244 |
| 661 | 3300027617 | Ga0210002_1014782 | Ga0210002_10147821 | 244 |
| 662 | 3300027717 | Ga0209998_10001538 | Ga0209998_100015382 | 244 |
| 663 | 3300027876 | Ga0209974_10012529 | Ga0209974_100125293 | 244 |
| 664 | 3300027907 | Ga0207428_10112059 | Ga0207428_101120593 | 244 |
| 665 | 3300028380 | Ga0268265_10000817 | Ga0268265_1000081710 | 244 |
| 666 | 3300028381 | Ga0268264_10001227 | Ga0268264_1000122716 | 244 |
| 667 | 3300034817 | Ga0373948_0003110 | Ga0373948_0003110_97_846 | 244 |
| 668 | 3300034957 | Ga0373938_0014640 | Ga0373938_0014640_612_1361 | 244 |
| 669 | 3300035088 | Ga0373940_0041710 | Ga0373940_0041710_403_1152 | 244 |
| 670 | 3300035090 | Ga0373949_0005436 | Ga0373949_0005436_225_974 | 244 |
| 671 | 3300035092 | Ga0373952_0002861 | Ga0373952_0002861_671_1420 | 244 |
| 672 | 3300035112 | Ga0373932_0000703 | Ga0373932_0000703_8374_9123 | 244 |
| 673 | 3300035114 | Ga0373939_0002267 | Ga0373939_0002267_905_1654 | 244 |
| 674 | 3300035121 | Ga0373960_0026800 | Ga0373960_0026800_442_1191 | 244 |
| 675 | 3300035207 | Ga0373942_0053398 | Ga0373942_0053398_240_989 | 244 |
| 676 | 3300035241 | Ga0373961_0003856 | Ga0373961_0003856_210_959 | 244 |
| 677 | 3300035691 | Ga0373931_0007315 | Ga0373931_0007315_3569_4318 | 244 |
| 678 | 3300046538 | Ga0495609_0034143 | Ga0495609_0034143_756_1505 | 244 |
| 679 | 3300048903 | Ga0496100_0002059 | Ga0496100_0002059_8533_9282 | 244 |
| 680 | 3300048904 | Ga0496101_0001738 | Ga0496101_0001738_4593_5342 | 244 |
| 681 | 3300048905 | Ga0496102_0001427 | Ga0496102_0001427_336_1085 | 244 |
| 682 | 3300048906 | Ga0496103_0004101 | Ga0496103_0004101_2818_3567 | 244 |
| 683 | 3300048909 | Ga0496106_0000644 | Ga0496106_0000644_20143_20892 | 244 |
| 684 | 3300048911 | Ga0496108_0084028 | Ga0496108_0084028_1718_2467 | 244 |
| 685 | 3300048912 | Ga0496109_0010936 | Ga0496109_0010936_246_995 | 244 |
| 686 | 3300048913 | Ga0496110_0096572 | Ga0496110_0096572_1733_2482 | 244 |
| 687 | 3300048915 | Ga0496112_0201926 | Ga0496112_0201926_1058_1807 | 244 |
| 688 | 3300048916 | Ga0496113_0088624 | Ga0496113_0088624_1096_1845 | 244 |
| 689 | 3300048917 | Ga0496114_0029429 | Ga0496114_0029429_1773_2522 | 244 |
| 690 | 3300048918 | Ga0496115_0124905 | Ga0496115_0124905_149_898 | 244 |
| 691 | 3300049575 | Ga0501039_0011358 | Ga0501039_0011358_756_1490 | 244 |
| 692 | 3300049578 | Ga0501042_0318627 | Ga0501042_0318627_87_821 | 244 |
| 693 | 3300049588 | Ga0501072_0006127 | Ga0501072_0006127_3532_4266 | 244 |
| 694 | 3300049591 | Ga0501075_0050477 | Ga0501075_0050477_615_1349 | 244 |
| 695 | 3300049741 | Ga0501079_0049238 | Ga0501079_0049238_2105_2839 | 244 |
| 696 | 3300050511 | nmdc:mga08y16_513855_c1 | nmdc:mga08y16_513855_c1_220_969 | 244 |
| 697 | 3300050512 | nmdc:mga0n895_1698_c1 | nmdc:mga0n895_1698_c1_67_816 | 244 |
| 698 | 3300050515 | nmdc:mga0a205_251229_c1 | nmdc:mga0a205_251229_c1_502_1251 | 244 |
| 699 | 3300053094 | Ga0500566_0164389 | Ga0500566_0164389_21_761 | 244 |
| 700 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_520161_520901 | 244 |
| 701 | 3300054114 | Ga0501084_0530436 | Ga0501084_0530436_25_759 | 244 |
| 702 | 3300005344 | Ga0070661_100005403 | Ga0070661_1000054039 | 245 |
| 703 | 3300005563 | Ga0068855_100004415 | Ga0068855_10000441515 | 245 |
| 704 | 3300005937 | Ga0081455_10000002 | Ga0081455_10000002480 | 245 |
| 705 | 3300025928 | Ga0207700_10082085 | Ga0207700_100820852 | 245 |
| 706 | 3300026078 | Ga0207702_10539263 | Ga0207702_105392631 | 245 |
| 707 | 3300027665 | Ga0209983_1003857 | Ga0209983_10038572 | 245 |
| 708 | 3300044694 | Ga0466963_0015149 | Ga0466963_0015149_2340_3092 | 245 |
| 709 | 3300045049 | Ga0466959_0313519 | Ga0466959_0313519_17_769 | 245 |
| 710 | 3300045836 | Ga0466958_0008358 | Ga0466958_0008358_321_1073 | 245 |
| 711 | 3300049570 | Ga0501033_0062788 | Ga0501033_0062788_1334_2074 | 245 |
| 712 | 3300049571 | Ga0501034_0213866 | Ga0501034_0213866_405_1154 | 245 |
| 713 | 3300049579 | Ga0501043_0061077 | Ga0501043_0061077_1070_1810 | 245 |
| 714 | 3300049580 | Ga0501046_0256706 | Ga0501046_0256706_26_766 | 245 |
| 715 | 3300049581 | Ga0501047_0009026 | Ga0501047_0009026_3986_4726 | 245 |
| 716 | 3300049586 | Ga0501070_0010033 | Ga0501070_0010033_1557_2297 | 245 |
| 717 | 3300049586 | Ga0501070_0080098 | Ga0501070_0080098_1878_2627 | 245 |
| 718 | 3300049742 | Ga0501080_0135524 | Ga0501080_0135524_1122_1871 | 245 |
| 719 | 3300049744 | Ga0501083_0030907 | Ga0501083_0030907_1420_2169 | 245 |
| 720 | 3300049823 | Ga0501044_0021597 | Ga0501044_0021597_1703_2443 | 245 |
| 721 | 3300049823 | Ga0501044_0642863 | Ga0501044_0642863_134_874 | 245 |
| 722 | 3300021384 | Ga0213876_10092962 | Ga0213876_100929622 | 246 |
| 723 | 3300031691 | Ga0316579_10041829 | Ga0316579_100418292 | 246 |
| 724 | 3300036647 | Ga0316582_0054719 | Ga0316582_0054719_1500_2255 | 246 |
| 725 | 3300039437 | Ga0436365_1295969 | Ga0436365_1295969_1670_2410 | 246 |
| 726 | 3300049569 | Ga0501032_0015452 | Ga0501032_0015452_1017_1775 | 246 |
| 727 | 3300049569 | Ga0501032_0109728 | Ga0501032_0109728_125_877 | 246 |
| 728 | 3300049569 | Ga0501032_0296011 | Ga0501032_0296011_125_877 | 246 |
| 729 | 3300049570 | Ga0501033_0144981 | Ga0501033_0144981_523_1275 | 246 |
| 730 | 3300049571 | Ga0501034_0000673 | Ga0501034_0000673_35368_36120 | 246 |
| 731 | 3300049571 | Ga0501034_0000933 | Ga0501034_0000933_27293_28051 | 246 |
| 732 | 3300049571 | Ga0501034_0564418 | Ga0501034_0564418_170_922 | 246 |
| 733 | 3300049572 | Ga0501036_0000242 | Ga0501036_0000242_35876_36634 | 246 |
| 734 | 3300049573 | Ga0501037_0045754 | Ga0501037_0045754_1719_2471 | 246 |
| 735 | 3300049573 | Ga0501037_0195792 | Ga0501037_0195792_82_834 | 246 |
| 736 | 3300049574 | Ga0501038_0020142 | Ga0501038_0020142_1379_2131 | 246 |
| 737 | 3300049575 | Ga0501039_0115865 | Ga0501039_0115865_125_877 | 246 |
| 738 | 3300049575 | Ga0501039_0185820 | Ga0501039_0185820_125_877 | 246 |
| 739 | 3300049578 | Ga0501042_0033741 | Ga0501042_0033741_2059_2811 | 246 |
| 740 | 3300049579 | Ga0501043_0020786 | Ga0501043_0020786_2750_3508 | 246 |
| 741 | 3300049579 | Ga0501043_0039482 | Ga0501043_0039482_2291_3049 | 246 |
| 742 | 3300049579 | Ga0501043_0409708 | Ga0501043_0409708_214_966 | 246 |
| 743 | 3300049580 | Ga0501046_0051469 | Ga0501046_0051469_2322_3074 | 246 |
| 744 | 3300049581 | Ga0501047_0000073 | Ga0501047_0000073_62549_63307 | 246 |
| 745 | 3300049581 | Ga0501047_0238321 | Ga0501047_0238321_470_1222 | 246 |
| 746 | 3300049581 | Ga0501047_0253659 | Ga0501047_0253659_65_817 | 246 |
| 747 | 3300049582 | Ga0501048_0000014 | Ga0501048_0000014_30116_30874 | 246 |
| 748 | 3300049582 | Ga0501048_0040161 | Ga0501048_0040161_2135_2887 | 246 |
| 749 | 3300049583 | Ga0501067_0020704 | Ga0501067_0020704_1365_2117 | 246 |
| 750 | 3300049584 | Ga0501068_0064873 | Ga0501068_0064873_125_877 | 246 |
| 751 | 3300049586 | Ga0501070_0007266 | Ga0501070_0007266_187_945 | 246 |
| 752 | 3300049586 | Ga0501070_0076867 | Ga0501070_0076867_1887_2639 | 246 |
| 753 | 3300049586 | Ga0501070_0080241 | Ga0501070_0080241_125_877 | 246 |
| 754 | 3300049587 | Ga0501071_0031037 | Ga0501071_0031037_553_1305 | 246 |
| 755 | 3300049588 | Ga0501072_0030800 | Ga0501072_0030800_384_1136 | 246 |
| 756 | 3300049588 | Ga0501072_0578020 | Ga0501072_0578020_124_876 | 246 |
| 757 | 3300049589 | Ga0501073_0087946 | Ga0501073_0087946_1307_2059 | 246 |
| 758 | 3300049590 | Ga0501074_0029008 | Ga0501074_0029008_149_907 | 246 |
| 759 | 3300049590 | Ga0501074_0057083 | Ga0501074_0057083_266_1018 | 246 |
| 760 | 3300049742 | Ga0501080_0000187 | Ga0501080_0000187_30997_31755 | 246 |
| 761 | 3300049742 | Ga0501080_0019883 | Ga0501080_0019883_396_1148 | 246 |
| 762 | 3300049744 | Ga0501083_0000398 | Ga0501083_0000398_8400_9158 | 246 |
| 763 | 3300049744 | Ga0501083_0116762 | Ga0501083_0116762_876_1628 | 246 |
| 764 | 3300049822 | Ga0501035_0195703 | Ga0501035_0195703_125_877 | 246 |
| 765 | 3300049823 | Ga0501044_0091612 | Ga0501044_0091612_2215_2967 | 246 |
| 766 | 3300049823 | Ga0501044_0408868 | Ga0501044_0408868_53_811 | 246 |
| 767 | 3300049823 | Ga0501044_0413560 | Ga0501044_0413560_383_1135 | 246 |
| 768 | 3300049824 | Ga0501045_0093236 | Ga0501045_0093236_1364_2116 | 246 |
| 769 | 3300050490 | nmdc:mga03n38_166197_c1 | nmdc:mga03n38_166197_c1_153_893 | 246 |
| 770 | 3300053088 | Ga0500644_0001590 | Ga0500644_0001590_3353_4093 | 246 |
| 771 | 3300053131 | Ga0500652_000938 | Ga0500652_000938_4290_5030 | 246 |
| 772 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_1465976_1466716 | 246 |
| 773 | 3300053730 | Ga0500645_002376 | Ga0500645_002376_5964_6704 | 246 |
| 774 | 3300054114 | Ga0501084_0210060 | Ga0501084_0210060_442_1194 | 246 |
| 775 | 3300060353 | Ga0501082_0120087 | Ga0501082_0120087_1066_1824 | 246 |
| 776 | 3300005563 | Ga0068855_100208336 | Ga0068855_1002083361 | 247 |
| 777 | 3300005614 | Ga0068856_100120449 | Ga0068856_1001204492 | 247 |
| 778 | 3300026078 | Ga0207702_10463311 | Ga0207702_104633112 | 247 |
| 779 | 3300031711 | Ga0265314_10003840 | Ga0265314_1000384011 | 247 |
| 780 | 3300053093 | Ga0500651_0023030 | Ga0500651_0023030_1324_2067 | 247 |
| 781 | 3300053130 | Ga0500642_0053753 | Ga0500642_0053753_698_1441 | 247 |
| 782 | 3300028800 | Ga0265338_10074286 | Ga0265338_100742862 | 248 |
| 783 | 3300031247 | Ga0265340_10081766 | Ga0265340_100817662 | 248 |
| 784 | 3300032133 | Ga0316583_10002720 | Ga0316583_100027202 | 248 |
| 785 | 3300046462 | Ga0495651_0150412 | Ga0495651_0150412_474_1220 | 248 |
| 786 | 3300048915 | Ga0496112_0198972 | Ga0496112_0198972_265_1041 | 248 |
| 787 | 3300049569 | Ga0501032_0158989 | Ga0501032_0158989_179_937 | 248 |
| 788 | 3300049571 | Ga0501034_0328591 | Ga0501034_0328591_221_976 | 248 |
| 789 | 3300049572 | Ga0501036_0533322 | Ga0501036_0533322_113_868 | 248 |
| 790 | 3300049574 | Ga0501038_0060730 | Ga0501038_0060730_120_869 | 248 |
| 791 | 3300049574 | Ga0501038_0082622 | Ga0501038_0082622_1238_1996 | 248 |
| 792 | 3300049575 | Ga0501039_0041604 | Ga0501039_0041604_2475_3224 | 248 |
| 793 | 3300049575 | Ga0501039_0077787 | Ga0501039_0077787_488_1246 | 248 |
| 794 | 3300049579 | Ga0501043_0434837 | Ga0501043_0434837_154_912 | 248 |
| 795 | 3300049581 | Ga0501047_0008654 | Ga0501047_0008654_4408_5166 | 248 |
| 796 | 3300049581 | Ga0501047_0137238 | Ga0501047_0137238_1118_1873 | 248 |
| 797 | 3300049585 | Ga0501069_0090149 | Ga0501069_0090149_722_1483 | 248 |
| 798 | 3300049586 | Ga0501070_0008335 | Ga0501070_0008335_813_1589 | 248 |
| 799 | 3300049586 | Ga0501070_0054487 | Ga0501070_0054487_775_1554 | 248 |
| 800 | 3300049586 | Ga0501070_0065404 | Ga0501070_0065404_2088_2837 | 248 |
| 801 | 3300049587 | Ga0501071_0586898 | Ga0501071_0586898_89_844 | 248 |
| 802 | 3300049589 | Ga0501073_0021369 | Ga0501073_0021369_2311_3069 | 248 |
| 803 | 3300049744 | Ga0501083_0020659 | Ga0501083_0020659_1597_2355 | 248 |
| 804 | 3300049822 | Ga0501035_0000621 | Ga0501035_0000621_8856_9635 | 248 |
| 805 | 3300049822 | Ga0501035_0112073 | Ga0501035_0112073_140_895 | 248 |
| 806 | 3300049823 | Ga0501044_0063316 | Ga0501044_0063316_1295_2053 | 248 |
| 807 | 3300049823 | Ga0501044_0159451 | Ga0501044_0159451_309_1064 | 248 |
| 808 | 3300060353 | Ga0501082_0022360 | Ga0501082_0022360_3051_3809 | 248 |
| 809 | 3300060353 | Ga0501082_0245798 | Ga0501082_0245798_722_1477 | 248 |
| 810 | 3300005328 | Ga0070676_10030891 | Ga0070676_100308912 | 249 |
| 811 | 3300005329 | Ga0070683_100186261 | Ga0070683_1001862611 | 249 |
| 812 | 3300005330 | Ga0070690_100085564 | Ga0070690_1000855642 | 249 |
| 813 | 3300005334 | Ga0068869_100072509 | Ga0068869_1000725092 | 249 |
| 814 | 3300005337 | Ga0070682_100048795 | Ga0070682_1000487952 | 249 |
| 815 | 3300005339 | Ga0070660_100221561 | Ga0070660_1002215611 | 249 |
| 816 | 3300005341 | Ga0070691_10051909 | Ga0070691_100519092 | 249 |
| 817 | 3300005347 | Ga0070668_100315543 | Ga0070668_1003155432 | 249 |
| 818 | 3300005355 | Ga0070671_100086982 | Ga0070671_1000869821 | 249 |
| 819 | 3300005356 | Ga0070674_100071279 | Ga0070674_1000712792 | 249 |
| 820 | 3300005364 | Ga0070673_100006931 | Ga0070673_1000069312 | 249 |
| 821 | 3300005364 | Ga0070673_100036643 | Ga0070673_1000366433 | 249 |
| 822 | 3300005367 | Ga0070667_100028530 | Ga0070667_1000285302 | 249 |
| 823 | 3300005367 | Ga0070667_100110696 | Ga0070667_1001106962 | 249 |
| 824 | 3300005434 | Ga0070709_10012396 | Ga0070709_100123962 | 249 |
| 825 | 3300005434 | Ga0070709_10064725 | Ga0070709_100647253 | 249 |
| 826 | 3300005434 | Ga0070709_10267256 | Ga0070709_102672562 | 249 |
| 827 | 3300005435 | Ga0070714_100072401 | Ga0070714_1000724012 | 249 |
| 828 | 3300005436 | Ga0070713_100025030 | Ga0070713_1000250304 | 249 |
| 829 | 3300005436 | Ga0070713_100051947 | Ga0070713_1000519475 | 249 |
| 830 | 3300005437 | Ga0070710_10014117 | Ga0070710_100141174 | 249 |
| 831 | 3300005437 | Ga0070710_10030745 | Ga0070710_100307451 | 249 |
| 832 | 3300005440 | Ga0070705_100115517 | Ga0070705_1001155171 | 249 |
| 833 | 3300005441 | Ga0070700_100172225 | Ga0070700_1001722252 | 249 |
| 834 | 3300005441 | Ga0070700_100299024 | Ga0070700_1002990241 | 249 |
| 835 | 3300005444 | Ga0070694_100202123 | Ga0070694_1002021232 | 249 |
| 836 | 3300005455 | Ga0070663_100055519 | Ga0070663_1000555194 | 249 |
| 837 | 3300005456 | Ga0070678_100032267 | Ga0070678_1000322674 | 249 |
| 838 | 3300005458 | Ga0070681_10611962 | Ga0070681_106119621 | 249 |
| 839 | 3300005466 | Ga0070685_10012971 | Ga0070685_100129716 | 249 |
| 840 | 3300005530 | Ga0070679_100163896 | Ga0070679_1001638961 | 249 |
| 841 | 3300005530 | Ga0070679_100200367 | Ga0070679_1002003672 | 249 |
| 842 | 3300005536 | Ga0070697_100528546 | Ga0070697_1005285461 | 249 |
| 843 | 3300005543 | Ga0070672_100282939 | Ga0070672_1002829392 | 249 |
| 844 | 3300005544 | Ga0070686_100003612 | Ga0070686_1000036125 | 249 |
| 845 | 3300005547 | Ga0070693_100025946 | Ga0070693_1000259465 | 249 |
| 846 | 3300005548 | Ga0070665_100056129 | Ga0070665_1000561293 | 249 |
| 847 | 3300005564 | Ga0070664_100306345 | Ga0070664_1003063452 | 249 |
| 848 | 3300005578 | Ga0068854_100151074 | Ga0068854_1001510743 | 249 |
| 849 | 3300005614 | Ga0068856_100330525 | Ga0068856_1003305252 | 249 |
| 850 | 3300005614 | Ga0068856_100638112 | Ga0068856_1006381122 | 249 |
| 851 | 3300005615 | Ga0070702_100005192 | Ga0070702_1000051928 | 249 |
| 852 | 3300005718 | Ga0068866_10065626 | Ga0068866_100656263 | 249 |
| 853 | 3300005719 | Ga0068861_100090261 | Ga0068861_1000902612 | 249 |
| 854 | 3300005834 | Ga0068851_10067204 | Ga0068851_100672042 | 249 |
| 855 | 3300005843 | Ga0068860_100110596 | Ga0068860_1001105964 | 249 |
| 856 | 3300005937 | Ga0081455_10018858 | Ga0081455_100188586 | 249 |
| 857 | 3300005937 | Ga0081455_10407144 | Ga0081455_104071442 | 249 |
| 858 | 3300006028 | Ga0070717_10259779 | Ga0070717_102597792 | 249 |
| 859 | 3300006028 | Ga0070717_10269131 | Ga0070717_102691312 | 249 |
| 860 | 3300006058 | Ga0075432_10010313 | Ga0075432_100103132 | 249 |
| 861 | 3300006173 | Ga0070716_100002237 | Ga0070716_10000223710 | 249 |
| 862 | 3300006173 | Ga0070716_100312353 | Ga0070716_1003123532 | 249 |
| 863 | 3300006237 | Ga0097621_100026392 | Ga0097621_1000263921 | 249 |
| 864 | 3300006358 | Ga0068871_100007371 | Ga0068871_1000073719 | 249 |
| 865 | 3300006358 | Ga0068871_100078310 | Ga0068871_1000783102 | 249 |
| 866 | 3300006844 | Ga0075428_100010200 | Ga0075428_1000102003 | 249 |
| 867 | 3300006846 | Ga0075430_100001483 | Ga0075430_1000014833 | 249 |
| 868 | 3300006847 | Ga0075431_100017410 | Ga0075431_1000174108 | 249 |
| 869 | 3300006852 | Ga0075433_10002052 | Ga0075433_100020527 | 249 |
| 870 | 3300006852 | Ga0075433_10184035 | Ga0075433_101840352 | 249 |
| 871 | 3300006852 | Ga0075433_10316169 | Ga0075433_103161692 | 249 |
| 872 | 3300006871 | Ga0075434_100001473 | Ga0075434_1000014733 | 249 |
| 873 | 3300006871 | Ga0075434_100135632 | Ga0075434_1001356322 | 249 |
| 874 | 3300006880 | Ga0075429_100005294 | Ga0075429_10000529412 | 249 |
| 875 | 3300006881 | Ga0068865_100063296 | Ga0068865_1000632962 | 249 |
| 876 | 3300006914 | Ga0075436_100026165 | Ga0075436_1000261652 | 249 |
| 877 | 3300007076 | Ga0075435_100024384 | Ga0075435_1000243844 | 249 |
| 878 | 3300007076 | Ga0075435_100247914 | Ga0075435_1002479142 | 249 |
| 879 | 3300007076 | Ga0075435_100452317 | Ga0075435_1004523171 | 249 |
| 880 | 3300009093 | Ga0105240_10486749 | Ga0105240_104867492 | 249 |
| 881 | 3300009094 | Ga0111539_10008538 | Ga0111539_1000853813 | 249 |
| 882 | 3300009098 | Ga0105245_10130933 | Ga0105245_101309332 | 249 |
| 883 | 3300009147 | Ga0114129_10046549 | Ga0114129_100465497 | 249 |
| 884 | 3300009147 | Ga0114129_10061852 | Ga0114129_100618525 | 249 |
| 885 | 3300009148 | Ga0105243_10076858 | Ga0105243_100768582 | 249 |
| 886 | 3300009148 | Ga0105243_10148864 | Ga0105243_101488642 | 249 |
| 887 | 3300009176 | Ga0105242_10014624 | Ga0105242_100146247 | 249 |
| 888 | 3300009176 | Ga0105242_10053790 | Ga0105242_100537903 | 249 |
| 889 | 3300009545 | Ga0105237_10067784 | Ga0105237_100677843 | 249 |
| 890 | 3300009551 | Ga0105238_10231208 | Ga0105238_102312082 | 249 |
| 891 | 3300009553 | Ga0105249_10142703 | Ga0105249_101427032 | 249 |
| 892 | 3300010375 | Ga0105239_10349579 | Ga0105239_103495793 | 249 |
| 893 | 3300010375 | Ga0105239_10544274 | Ga0105239_105442741 | 249 |
| 894 | 3300011119 | Ga0105246_10376654 | Ga0105246_103766542 | 249 |
| 895 | 3300012498 | Ga0157345_1001625 | Ga0157345_10016252 | 249 |
| 896 | 3300013297 | Ga0157378_10184872 | Ga0157378_101848722 | 249 |
| 897 | 3300013297 | Ga0157378_10243177 | Ga0157378_102431771 | 249 |
| 898 | 3300013306 | Ga0163162_10156876 | Ga0163162_101568762 | 249 |
| 899 | 3300013308 | Ga0157375_10027552 | Ga0157375_100275522 | 249 |
| 900 | 3300014968 | Ga0157379_10034362 | Ga0157379_100343624 | 249 |
| 901 | 3300014969 | Ga0157376_10036819 | Ga0157376_100368192 | 249 |
| 902 | 3300017792 | Ga0163161_10066417 | Ga0163161_100664174 | 249 |
| 903 | 3300021384 | Ga0213876_10015303 | Ga0213876_100153035 | 249 |
| 904 | 3300025290 | Ga0207673_1000061 | Ga0207673_10000616 | 249 |
| 905 | 3300025321 | Ga0207656_10080624 | Ga0207656_100806242 | 249 |
| 906 | 3300025898 | Ga0207692_10006215 | Ga0207692_100062154 | 249 |
| 907 | 3300025899 | Ga0207642_10141071 | Ga0207642_101410712 | 249 |
| 908 | 3300025900 | Ga0207710_10010170 | Ga0207710_100101703 | 249 |
| 909 | 3300025903 | Ga0207680_10014420 | Ga0207680_100144204 | 249 |
| 910 | 3300025903 | Ga0207680_10047176 | Ga0207680_100471761 | 249 |
| 911 | 3300025905 | Ga0207685_10026299 | Ga0207685_100262992 | 249 |
| 912 | 3300025906 | Ga0207699_10001462 | Ga0207699_100014622 | 249 |
| 913 | 3300025907 | Ga0207645_10037279 | Ga0207645_100372792 | 249 |
| 914 | 3300025911 | Ga0207654_10055045 | Ga0207654_100550451 | 249 |
| 915 | 3300025912 | Ga0207707_10026952 | Ga0207707_100269527 | 249 |
| 916 | 3300025915 | Ga0207693_10005568 | Ga0207693_1000556813 | 249 |
| 917 | 3300025915 | Ga0207693_10022202 | Ga0207693_100222023 | 249 |
| 918 | 3300025915 | Ga0207693_10032414 | Ga0207693_100324145 | 249 |
| 919 | 3300025919 | Ga0207657_10036372 | Ga0207657_100363725 | 249 |
| 920 | 3300025921 | Ga0207652_10079199 | Ga0207652_100791993 | 249 |
| 921 | 3300025921 | Ga0207652_10326611 | Ga0207652_103266111 | 249 |
| 922 | 3300025924 | Ga0207694_10037102 | Ga0207694_100371022 | 249 |
| 923 | 3300025927 | Ga0207687_10011220 | Ga0207687_100112208 | 249 |
| 924 | 3300025927 | Ga0207687_10078689 | Ga0207687_100786893 | 249 |
| 925 | 3300025928 | Ga0207700_10000624 | Ga0207700_1000062423 | 249 |
| 926 | 3300025928 | Ga0207700_10223904 | Ga0207700_102239042 | 249 |
| 927 | 3300025929 | Ga0207664_10141511 | Ga0207664_101415112 | 249 |
| 928 | 3300025931 | Ga0207644_10006733 | Ga0207644_1000673310 | 249 |
| 929 | 3300025932 | Ga0207690_10035634 | Ga0207690_100356344 | 249 |
| 930 | 3300025932 | Ga0207690_10244729 | Ga0207690_102447292 | 249 |
| 931 | 3300025934 | Ga0207686_10005492 | Ga0207686_100054922 | 249 |
| 932 | 3300025934 | Ga0207686_10028899 | Ga0207686_100288992 | 249 |
| 933 | 3300025935 | Ga0207709_10080410 | Ga0207709_100804102 | 249 |
| 934 | 3300025936 | Ga0207670_10021268 | Ga0207670_100212684 | 249 |
| 935 | 3300025939 | Ga0207665_10001758 | Ga0207665_100017584 | 249 |
| 936 | 3300025939 | Ga0207665_10045219 | Ga0207665_100452193 | 249 |
| 937 | 3300025939 | Ga0207665_10093758 | Ga0207665_100937582 | 249 |
| 938 | 3300025940 | Ga0207691_10110030 | Ga0207691_101100302 | 249 |
| 939 | 3300025941 | Ga0207711_10008985 | Ga0207711_1000898510 | 249 |
| 940 | 3300025942 | Ga0207689_10050098 | Ga0207689_100500985 | 249 |
| 941 | 3300025949 | Ga0207667_10440264 | Ga0207667_104402641 | 249 |
| 942 | 3300025961 | Ga0207712_10035776 | Ga0207712_100357762 | 249 |
| 943 | 3300025981 | Ga0207640_10107011 | Ga0207640_101070112 | 249 |
| 944 | 3300025986 | Ga0207658_10188011 | Ga0207658_101880111 | 249 |
| 945 | 3300026023 | Ga0207677_10047121 | Ga0207677_100471212 | 249 |
| 946 | 3300026035 | Ga0207703_10023508 | Ga0207703_100235082 | 249 |
| 947 | 3300026067 | Ga0207678_10015442 | Ga0207678_100154422 | 249 |
| 948 | 3300026067 | Ga0207678_10018849 | Ga0207678_100188496 | 249 |
| 949 | 3300026075 | Ga0207708_10054858 | Ga0207708_100548583 | 249 |
| 950 | 3300026078 | Ga0207702_10685683 | Ga0207702_106856832 | 249 |
| 951 | 3300026089 | Ga0207648_10002036 | Ga0207648_1000203616 | 249 |
| 952 | 3300026095 | Ga0207676_10009322 | Ga0207676_100093229 | 249 |
| 953 | 3300026118 | Ga0207675_100178387 | Ga0207675_1001783872 | 249 |
| 954 | 3300026121 | Ga0207683_10001099 | Ga0207683_100010993 | 249 |
| 955 | 3300026121 | Ga0207683_10032902 | Ga0207683_100329028 | 249 |
| 956 | 3300027682 | Ga0209971_1045187 | Ga0209971_10451872 | 249 |
| 957 | 3300027907 | Ga0207428_10000082 | Ga0207428_1000008215 | 249 |
| 958 | 3300027907 | Ga0207428_10175649 | Ga0207428_101756491 | 249 |
| 959 | 3300028379 | Ga0268266_10006793 | Ga0268266_100067932 | 249 |
| 960 | 3300028379 | Ga0268266_10536164 | Ga0268266_105361642 | 249 |
| 961 | 3300028381 | Ga0268264_10016466 | Ga0268264_100164666 | 249 |
| 962 | 3300031241 | Ga0265325_10000043 | Ga0265325_1000004363 | 249 |
| 963 | 3300031241 | Ga0265325_10047267 | Ga0265325_100472672 | 249 |
| 964 | 3300031250 | Ga0265331_10093489 | Ga0265331_100934892 | 249 |
| 965 | 3300031712 | Ga0265342_10256916 | Ga0265342_102569161 | 249 |
| 966 | 3300034817 | Ga0373948_0043525 | Ga0373948_0043525_34_783 | 249 |
| 967 | 3300034818 | Ga0373950_0008305 | Ga0373950_0008305_774_1523 | 249 |
| 968 | 3300034819 | Ga0373958_0010662 | Ga0373958_0010662_387_1136 | 249 |
| 969 | 3300034957 | Ga0373938_0005774 | Ga0373938_0005774_551_1300 | 249 |
| 970 | 3300035083 | Ga0373926_0006274 | Ga0373926_0006274_1548_2297 | 249 |
| 971 | 3300035083 | Ga0373926_0068555 | Ga0373926_0068555_519_1274 | 249 |
| 972 | 3300035086 | Ga0373934_0009209 | Ga0373934_0009209_2830_3585 | 249 |
| 973 | 3300035086 | Ga0373934_0074324 | Ga0373934_0074324_447_1202 | 249 |
| 974 | 3300035089 | Ga0373944_0003334 | Ga0373944_0003334_2599_3354 | 249 |
| 975 | 3300035089 | Ga0373944_0007277 | Ga0373944_0007277_1818_2567 | 249 |
| 976 | 3300035089 | Ga0373944_0009507 | Ga0373944_0009507_1734_2483 | 249 |
| 977 | 3300035090 | Ga0373949_0004216 | Ga0373949_0004216_817_1566 | 249 |
| 978 | 3300035111 | Ga0373923_0007076 | Ga0373923_0007076_2002_2751 | 249 |
| 979 | 3300035112 | Ga0373932_0007745 | Ga0373932_0007745_162_911 | 249 |
| 980 | 3300035113 | Ga0373936_0005552 | Ga0373936_0005552_2378_3127 | 249 |
| 981 | 3300035113 | Ga0373936_0045306 | Ga0373936_0045306_65_820 | 249 |
| 982 | 3300035113 | Ga0373936_0079399 | Ga0373936_0079399_38_787 | 249 |
| 983 | 3300035115 | Ga0373941_0004229 | Ga0373941_0004229_1589_2338 | 249 |
| 984 | 3300035116 | Ga0373945_0026010 | Ga0373945_0026010_539_1288 | 249 |
| 985 | 3300035117 | Ga0373953_0001186 | Ga0373953_0001186_3887_4642 | 249 |
| 986 | 3300035117 | Ga0373953_0125982 | Ga0373953_0125982_195_950 | 249 |
| 987 | 3300035119 | Ga0373956_0013246 | Ga0373956_0013246_1015_1764 | 249 |
| 988 | 3300035119 | Ga0373956_0027556 | Ga0373956_0027556_826_1575 | 249 |
| 989 | 3300035119 | Ga0373956_0046875 | Ga0373956_0046875_1062_1817 | 249 |
| 990 | 3300035120 | Ga0373957_0057040 | Ga0373957_0057040_204_959 | 249 |
| 991 | 3300035121 | Ga0373960_0005847 | Ga0373960_0005847_1759_2508 | 249 |
| 992 | 3300035170 | Ga0373943_0008559 | Ga0373943_0008559_3364_4119 | 249 |
| 993 | 3300035170 | Ga0373943_0021286 | Ga0373943_0021286_790_1539 | 249 |
| 994 | 3300035170 | Ga0373943_0051473 | Ga0373943_0051473_740_1489 | 249 |
| 995 | 3300035172 | Ga0373955_0008111 | Ga0373955_0008111_821_1576 | 249 |
| 996 | 3300035207 | Ga0373942_0012638 | Ga0373942_0012638_637_1386 | 249 |
| 997 | 3300035241 | Ga0373961_0003260 | Ga0373961_0003260_1485_2234 | 249 |
| 998 | 3300035242 | Ga0373962_0035508 | Ga0373962_0035508_339_1088 | 249 |
| 999 | 3300035410 | Ga0373924_0032147 | Ga0373924_0032147_834_1589 | 249 |
| 1000 | 3300035691 | Ga0373931_0023751 | Ga0373931_0023751_2034_2783 | 249 |
| 1001 | 3300035692 | Ga0373935_0006957 | Ga0373935_0006957_5404_6153 | 249 |
| 1002 | 3300035692 | Ga0373935_0131752 | Ga0373935_0131752_602_1357 | 249 |
| 1003 | 3300035695 | Ga0373927_0048608 | Ga0373927_0048608_1310_2059 | 249 |
| 1004 | 3300035724 | Ga0373933_0001224 | Ga0373933_0001224_1379_2134 | 249 |
| 1005 | 3300035724 | Ga0373933_0013762 | Ga0373933_0013762_2181_2930 | 249 |
| 1006 | 3300035724 | Ga0373933_0024904 | Ga0373933_0024904_1832_2587 | 249 |
| 1007 | 3300035725 | Ga0373947_0032762 | Ga0373947_0032762_148_897 | 249 |
| 1008 | 3300035725 | Ga0373947_0083977 | Ga0373947_0083977_776_1531 | 249 |
| 1009 | 3300036401 | Ga0373937_0000849 | Ga0373937_0000849_10027_10782 | 249 |
| 1010 | 3300036401 | Ga0373937_0034021 | Ga0373937_0034021_1481_2230 | 249 |
| 1011 | 3300036401 | Ga0373937_0047581 | Ga0373937_0047581_1306_2061 | 249 |
| 1012 | 3300036401 | Ga0373937_0138833 | Ga0373937_0138833_943_1692 | 249 |
| 1013 | 3300037068 | Ga0373925_0023317 | Ga0373925_0023317_344_1099 | 249 |
| 1014 | 3300037068 | Ga0373925_0042182 | Ga0373925_0042182_1732_2487 | 249 |
| 1015 | 3300039437 | Ga0436365_1174025 | Ga0436365_1174025_1748_2497 | 249 |
| 1016 | 3300039453 | Ga0436362_0096256 | Ga0436362_0096256_3088_3837 | 249 |
| 1017 | 3300046452 | Ga0495617_013564 | Ga0495617_013564_305_1054 | 249 |
| 1018 | 3300046454 | Ga0495592_0031170 | Ga0495592_0031170_2270_3025 | 249 |
| 1019 | 3300046454 | Ga0495592_0114759 | Ga0495592_0114759_725_1474 | 249 |
| 1020 | 3300046454 | Ga0495592_0124090 | Ga0495592_0124090_726_1475 | 249 |
| 1021 | 3300046455 | Ga0495603_0033576 | Ga0495603_0033576_1604_2359 | 249 |
| 1022 | 3300046459 | Ga0495629_0000062 | Ga0495629_0000062_87879_88628 | 249 |
| 1023 | 3300046461 | Ga0495641_0042022 | Ga0495641_0042022_334_1089 | 249 |
| 1024 | 3300046461 | Ga0495641_0072448 | Ga0495641_0072448_18_767 | 249 |
| 1025 | 3300046462 | Ga0495651_0020865 | Ga0495651_0020865_1074_1829 | 249 |
| 1026 | 3300046462 | Ga0495651_0022743 | Ga0495651_0022743_840_1589 | 249 |
| 1027 | 3300046463 | Ga0495653_0048987 | Ga0495653_0048987_98_853 | 249 |
| 1028 | 3300046463 | Ga0495653_0117336 | Ga0495653_0117336_950_1705 | 249 |
| 1029 | 3300046472 | Ga0495580_0092029 | Ga0495580_0092029_1345_2094 | 249 |
| 1030 | 3300046475 | Ga0495639_0008961 | Ga0495639_0008961_848_1597 | 249 |
| 1031 | 3300046475 | Ga0495639_0035781 | Ga0495639_0035781_1335_2090 | 249 |
| 1032 | 3300046476 | Ga0495662_0006739 | Ga0495662_0006739_3182_3931 | 249 |
| 1033 | 3300046476 | Ga0495662_0022613 | Ga0495662_0022613_685_1440 | 249 |
| 1034 | 3300046477 | Ga0495664_0020123 | Ga0495664_0020123_1429_2178 | 249 |
| 1035 | 3300046477 | Ga0495664_0078940 | Ga0495664_0078940_1180_1935 | 249 |
| 1036 | 3300046477 | Ga0495664_0170208 | Ga0495664_0170208_451_1206 | 249 |
| 1037 | 3300046491 | Ga0495584_0021105 | Ga0495584_0021105_235_984 | 249 |
| 1038 | 3300046492 | Ga0495585_0002429 | Ga0495585_0002429_9679_10428 | 249 |
| 1039 | 3300046499 | Ga0495594_0028654 | Ga0495594_0028654_785_1534 | 249 |
| 1040 | 3300046499 | Ga0495594_0174336 | Ga0495594_0174336_347_1096 | 249 |
| 1041 | 3300046511 | Ga0495608_0001948 | Ga0495608_0001948_924_1679 | 249 |
| 1042 | 3300046511 | Ga0495608_0055984 | Ga0495608_0055984_1712_2461 | 249 |
| 1043 | 3300046511 | Ga0495608_0197846 | Ga0495608_0197846_206_961 | 249 |
| 1044 | 3300046514 | Ga0495618_0025063 | Ga0495618_0025063_1309_2064 | 249 |
| 1045 | 3300046514 | Ga0495618_0050959 | Ga0495618_0050959_696_1445 | 249 |
| 1046 | 3300046516 | Ga0495628_0009783 | Ga0495628_0009783_1765_2520 | 249 |
| 1047 | 3300046516 | Ga0495628_0012772 | Ga0495628_0012772_5364_6119 | 249 |
| 1048 | 3300046516 | Ga0495628_0071647 | Ga0495628_0071647_738_1487 | 249 |
| 1049 | 3300046523 | Ga0495644_0004855 | Ga0495644_0004855_2866_3615 | 249 |
| 1050 | 3300046526 | Ga0495666_0030778 | Ga0495666_0030778_1751_2500 | 249 |
| 1051 | 3300046529 | Ga0495652_0023129 | Ga0495652_0023129_1769_2524 | 249 |
| 1052 | 3300046529 | Ga0495652_0093555 | Ga0495652_0093555_1306_2061 | 249 |
| 1053 | 3300046529 | Ga0495652_0352197 | Ga0495652_0352197_175_924 | 249 |
| 1054 | 3300046531 | Ga0495665_0034160 | Ga0495665_0034160_106_861 | 249 |
| 1055 | 3300046531 | Ga0495665_0140281 | Ga0495665_0140281_340_1089 | 249 |
| 1056 | 3300046533 | Ga0495640_0103700 | Ga0495640_0103700_461_1210 | 249 |
| 1057 | 3300046533 | Ga0495640_0105939 | Ga0495640_0105939_135_890 | 249 |
| 1058 | 3300046533 | Ga0495640_0136159 | Ga0495640_0136159_760_1515 | 249 |
| 1059 | 3300046535 | Ga0495586_0053241 | Ga0495586_0053241_475_1230 | 249 |
| 1060 | 3300046536 | Ga0495587_0030802 | Ga0495587_0030802_956_1705 | 249 |
| 1061 | 3300046538 | Ga0495609_0143510 | Ga0495609_0143510_236_985 | 249 |
| 1062 | 3300046543 | Ga0495645_0020277 | Ga0495645_0020277_3064_3819 | 249 |
| 1063 | 3300046559 | Ga0495667_0001067 | Ga0495667_0001067_13064_13819 | 249 |
| 1064 | 3300046559 | Ga0495667_0013909 | Ga0495667_0013909_3656_4411 | 249 |
| 1065 | 3300046559 | Ga0495667_0117677 | Ga0495667_0117677_168_917 | 249 |
| 1066 | 3300046559 | Ga0495667_0337744 | Ga0495667_0337744_117_866 | 249 |
| 1067 | 3300046615 | Ga0495656_0002593 | Ga0495656_0002593_3226_3975 | 249 |
| 1068 | 3300046648 | Ga0495611_0020648 | Ga0495611_0020648_22_771 | 249 |
| 1069 | 3300046663 | Ga0495635_0019587 | Ga0495635_0019587_1320_2069 | 249 |
| 1070 | 3300046663 | Ga0495635_0065327 | Ga0495635_0065327_1287_2036 | 249 |
| 1071 | 3300046663 | Ga0495635_0090619 | Ga0495635_0090619_1296_2051 | 249 |
| 1072 | 3300046663 | Ga0495635_0107543 | Ga0495635_0107543_142_897 | 249 |
| 1073 | 3300046664 | Ga0495659_0006541 | Ga0495659_0006541_1817_2566 | 249 |
| 1074 | 3300046665 | Ga0495661_0039661 | Ga0495661_0039661_310_1059 | 249 |
| 1075 | 3300046674 | Ga0495588_0019088 | Ga0495588_0019088_694_1443 | 249 |
| 1076 | 3300046674 | Ga0495588_0039698 | Ga0495588_0039698_885_1640 | 249 |
| 1077 | 3300046675 | Ga0495657_0016143 | Ga0495657_0016143_2529_3284 | 249 |
| 1078 | 3300046675 | Ga0495657_0033154 | Ga0495657_0033154_1122_1877 | 249 |
| 1079 | 3300046675 | Ga0495657_0339765 | Ga0495657_0339765_89_844 | 249 |
| 1080 | 3300046678 | Ga0495599_0002423 | Ga0495599_0002423_5200_5955 | 249 |
| 1081 | 3300046678 | Ga0495599_0002462 | Ga0495599_0002462_1427_2182 | 249 |
| 1082 | 3300046678 | Ga0495599_0027197 | Ga0495599_0027197_1174_1923 | 249 |
| 1083 | 3300046679 | Ga0495623_0003667 | Ga0495623_0003667_2147_2902 | 249 |
| 1084 | 3300046679 | Ga0495623_0039933 | Ga0495623_0039933_317_1072 | 249 |
| 1085 | 3300046680 | Ga0495646_0001912 | Ga0495646_0001912_9059_9808 | 249 |
| 1086 | 3300046680 | Ga0495646_0024134 | Ga0495646_0024134_2279_3034 | 249 |
| 1087 | 3300046681 | Ga0495647_0160541 | Ga0495647_0160541_186_935 | 249 |
| 1088 | 3300046683 | Ga0495658_0058438 | Ga0495658_0058438_235_984 | 249 |
| 1089 | 3300046683 | Ga0495658_0078615 | Ga0495658_0078615_347_1096 | 249 |
| 1090 | 3300046689 | Ga0495613_0030125 | Ga0495613_0030125_1046_1795 | 249 |
| 1091 | 3300046689 | Ga0495613_0081327 | Ga0495613_0081327_938_1687 | 249 |
| 1092 | 3300046690 | Ga0495624_0066588 | Ga0495624_0066588_722_1477 | 249 |
| 1093 | 3300046690 | Ga0495624_0231751 | Ga0495624_0231751_352_1101 | 249 |
| 1094 | 3300046691 | Ga0495670_0001352 | Ga0495670_0001352_6519_7268 | 249 |
| 1095 | 3300046809 | Ga0495600_0005044 | Ga0495600_0005044_2689_3438 | 249 |
| 1096 | 3300046809 | Ga0495600_0030328 | Ga0495600_0030328_1044_1799 | 249 |
| 1097 | 3300046809 | Ga0495600_0031854 | Ga0495600_0031854_1886_2641 | 249 |
| 1098 | 3300047315 | Ga0495581_0013989 | Ga0495581_0013989_841_1590 | 249 |
| 1099 | 3300047315 | Ga0495581_0062351 | Ga0495581_0062351_117_866 | 249 |
| 1100 | 3300047317 | Ga0495604_0004097 | Ga0495604_0004097_9159_9908 | 249 |
| 1101 | 3300047317 | Ga0495604_0009091 | Ga0495604_0009091_848_1603 | 249 |
| 1102 | 3300047317 | Ga0495604_0013822 | Ga0495604_0013822_4887_5642 | 249 |
| 1103 | 3300047317 | Ga0495604_0028326 | Ga0495604_0028326_2319_3068 | 249 |
| 1104 | 3300047319 | Ga0495674_0026001 | Ga0495674_0026001_812_1561 | 249 |
| 1105 | 3300047319 | Ga0495674_0084024 | Ga0495674_0084024_1155_1910 | 249 |
| 1106 | 3300047322 | Ga0495680_0014800 | Ga0495680_0014800_5945_6694 | 249 |
| 1107 | 3300047322 | Ga0495680_0055329 | Ga0495680_0055329_1485_2234 | 249 |
| 1108 | 3300047322 | Ga0495680_0180576 | Ga0495680_0180576_477_1232 | 249 |
| 1109 | 3300047322 | Ga0495680_0408230 | Ga0495680_0408230_18_773 | 249 |
| 1110 | 3300047444 | Ga0495675_0001338 | Ga0495675_0001338_12856_13611 | 249 |
| 1111 | 3300047444 | Ga0495675_0035048 | Ga0495675_0035048_1207_1962 | 249 |
| 1112 | 3300047471 | Ga0495684_0034589 | Ga0495684_0034589_1842_2591 | 249 |
| 1113 | 3300047673 | Ga0495593_0018657 | Ga0495593_0018657_2337_3086 | 249 |
| 1114 | 3300047673 | Ga0495593_0074108 | Ga0495593_0074108_110_859 | 249 |
| 1115 | 3300048088 | Ga0495602_0002392 | Ga0495602_0002392_5433_6188 | 249 |
| 1116 | 3300048088 | Ga0495602_0040040 | Ga0495602_0040040_1797_2552 | 249 |
| 1117 | 3300048089 | Ga0495614_0016010 | Ga0495614_0016010_1792_2541 | 249 |
| 1118 | 3300048903 | Ga0496100_0081168 | Ga0496100_0081168_1248_2003 | 249 |
| 1119 | 3300048903 | Ga0496100_0235230 | Ga0496100_0235230_170_919 | 249 |
| 1120 | 3300048906 | Ga0496103_0028858 | Ga0496103_0028858_1456_2205 | 249 |
| 1121 | 3300048907 | Ga0496104_0000528 | Ga0496104_0000528_29834_30589 | 249 |
| 1122 | 3300048907 | Ga0496104_0053102 | Ga0496104_0053102_1699_2454 | 249 |
| 1123 | 3300048907 | Ga0496104_0695566 | Ga0496104_0695566_43_792 | 249 |
| 1124 | 3300048908 | Ga0496105_0001587 | Ga0496105_0001587_10556_11311 | 249 |
| 1125 | 3300048908 | Ga0496105_0043589 | Ga0496105_0043589_2759_3514 | 249 |
| 1126 | 3300048908 | Ga0496105_0101523 | Ga0496105_0101523_172_921 | 249 |
| 1127 | 3300048908 | Ga0496105_0231257 | Ga0496105_0231257_170_919 | 249 |
| 1128 | 3300048909 | Ga0496106_0010684 | Ga0496106_0010684_16_771 | 249 |
| 1129 | 3300048909 | Ga0496106_0187467 | Ga0496106_0187467_268_1017 | 249 |
| 1130 | 3300048909 | Ga0496106_0285497 | Ga0496106_0285497_559_1308 | 249 |
| 1131 | 3300048910 | Ga0496107_0021482 | Ga0496107_0021482_1919_2668 | 249 |
| 1132 | 3300048910 | Ga0496107_0034610 | Ga0496107_0034610_2533_3288 | 249 |
| 1133 | 3300048911 | Ga0496108_0246053 | Ga0496108_0246053_635_1384 | 249 |
| 1134 | 3300048912 | Ga0496109_0375200 | Ga0496109_0375200_164_913 | 249 |
| 1135 | 3300048913 | Ga0496110_0524359 | Ga0496110_0524359_32_781 | 249 |
| 1136 | 3300048914 | Ga0496111_0108616 | Ga0496111_0108616_308_1057 | 249 |
| 1137 | 3300048915 | Ga0496112_0264067 | Ga0496112_0264067_105_854 | 249 |
| 1138 | 3300048916 | Ga0496113_0102944 | Ga0496113_0102944_592_1341 | 249 |
| 1139 | 3300048917 | Ga0496114_0035315 | Ga0496114_0035315_718_1473 | 249 |
| 1140 | 3300048917 | Ga0496114_0056359 | Ga0496114_0056359_1097_1846 | 249 |
| 1141 | 3300049571 | Ga0501034_0141364 | Ga0501034_0141364_1220_1972 | 249 |
| 1142 | 3300049572 | Ga0501036_0029281 | Ga0501036_0029281_2364_3116 | 249 |
| 1143 | 3300049581 | Ga0501047_0547731 | Ga0501047_0547731_82_834 | 249 |
| 1144 | 3300049823 | Ga0501044_0422212 | Ga0501044_0422212_271_1023 | 249 |
| 1145 | 3300050507 | nmdc:mga05p37_19_c3 | nmdc:mga05p37_19_c3_19255_20004 | 249 |
| 1146 | 3300050508 | nmdc:mga09592_758_c1 | nmdc:mga09592_758_c1_18010_18759 | 249 |
| 1147 | 3300050509 | nmdc:mga0qj67_1779_c1 | nmdc:mga0qj67_1779_c1_9339_10088 | 249 |
| 1148 | 3300050510 | nmdc:mga06r32_4145_c1 | nmdc:mga06r32_4145_c1_6154_6903 | 249 |
| 1149 | 3300050511 | nmdc:mga08y16_238686_c1 | nmdc:mga08y16_238686_c1_367_1116 | 249 |
| 1150 | 3300050511 | nmdc:mga08y16_46719_c1 | nmdc:mga08y16_46719_c1_725_1474 | 249 |
| 1151 | 3300050512 | nmdc:mga0n895_1573_c1 | nmdc:mga0n895_1573_c1_3059_3808 | 249 |
| 1152 | 3300050512 | nmdc:mga0n895_375865_c1 | nmdc:mga0n895_375865_c1_436_1185 | 249 |
| 1153 | 3300050513 | nmdc:mga0rr50_32274_c1 | nmdc:mga0rr50_32274_c1_431_1180 | 249 |
| 1154 | 3300050513 | nmdc:mga0rr50_390_c1 | nmdc:mga0rr50_390_c1_17320_18069 | 249 |
| 1155 | 3300050514 | nmdc:mga08x19_42973_c1 | nmdc:mga08x19_42973_c1_353_1102 | 249 |
| 1156 | 3300050514 | nmdc:mga08x19_85416_c1 | nmdc:mga08x19_85416_c1_52_801 | 249 |
| 1157 | 3300050515 | nmdc:mga0a205_681_c1 | nmdc:mga0a205_681_c1_21310_22059 | 249 |
| 1158 | 3300050515 | nmdc:mga0a205_79345_c1 | nmdc:mga0a205_79345_c1_2161_2910 | 249 |
| 1159 | 3300053077 | Ga0495601_0000680 | Ga0495601_0000680_13624_14379 | 249 |
| 1160 | 3300053077 | Ga0495601_0003107 | Ga0495601_0003107_2221_2970 | 249 |
| 1161 | 3300053077 | Ga0495601_0068588 | Ga0495601_0068588_1189_1944 | 249 |
| 1162 | 3300053078 | Ga0495612_0004246 | Ga0495612_0004246_3605_4360 | 249 |
| 1163 | 3300053078 | Ga0495612_0040633 | Ga0495612_0040633_917_1666 | 249 |
| 1164 | 3300053078 | Ga0495612_0044087 | Ga0495612_0044087_18_767 | 249 |
| 1165 | 3300053084 | Ga0495595_0000365 | Ga0495595_0000365_14799_15548 | 249 |
| 1166 | 3300053084 | Ga0495595_0003679 | Ga0495595_0003679_1722_2477 | 249 |
| 1167 | 3300053084 | Ga0495595_0023228 | Ga0495595_0023228_1550_2299 | 249 |
| 1168 | 3300053085 | Ga0495619_0000378 | Ga0495619_0000378_13377_14126 | 249 |
| 1169 | 3300053085 | Ga0495619_0000897 | Ga0495619_0000897_13746_14495 | 249 |
| 1170 | 3300053085 | Ga0495619_0024786 | Ga0495619_0024786_2561_3310 | 249 |
| 1171 | 3300053085 | Ga0495619_0085476 | Ga0495619_0085476_30_785 | 249 |
| 1172 | 3300053085 | Ga0495619_0291015 | Ga0495619_0291015_59_814 | 249 |
| 1173 | 2209111006 | 2214683824 | 2213702577 | 250 |
| 1174 | 3300000041 | ARcpr5oldR_c000960 | ARcpr5oldR_0009602 | 250 |
| 1175 | 3300000042 | ARSoilYngRDRAFT_c00484 | ARSoilYngRDRAFT_004847 | 250 |
| 1176 | 3300000043 | ARcpr5yngRDRAFT_c000683 | ARcpr5yngRDRAFT_0006836 | 250 |
| 1177 | 3300000044 | ARSoilOldRDRAFT_c000056 | ARSoilOldRDRAFT_00005623 | 250 |
| 1178 | 3300000045 | ARCol0oldRDRAFT_c00385 | ARCol0oldRDRAFT_003851 | 250 |
| 1179 | 3300000652 | ARCol0yngRDRAFT_1000069 | ARCol0yngRDRAFT_10000691 | 250 |
| 1180 | 3300001990 | JGI24737J22298_10020399 | JGI24737J22298_100203993 | 250 |
| 1181 | 3300005277 | Ga0065716_1001578 | Ga0065716_10015789 | 250 |
| 1182 | 3300005289 | Ga0065704_10020946 | Ga0065704_100209462 | 250 |
| 1183 | 3300005290 | Ga0065712_10006735 | Ga0065712_100067352 | 250 |
| 1184 | 3300005293 | Ga0065715_10002029 | Ga0065715_100020292 | 250 |
| 1185 | 3300005295 | Ga0065707_10122926 | Ga0065707_101229261 | 250 |
| 1186 | 3300005330 | Ga0070690_100012134 | Ga0070690_1000121341 | 250 |
| 1187 | 3300005331 | Ga0070670_100022469 | Ga0070670_1000224698 | 250 |
| 1188 | 3300005336 | Ga0070680_100024207 | Ga0070680_1000242075 | 250 |
| 1189 | 3300005340 | Ga0070689_100069420 | Ga0070689_1000694203 | 250 |
| 1190 | 3300005340 | Ga0070689_100131877 | Ga0070689_1001318771 | 250 |
| 1191 | 3300005341 | Ga0070691_10025483 | Ga0070691_100254831 | 250 |
| 1192 | 3300005345 | Ga0070692_10018948 | Ga0070692_100189482 | 250 |
| 1193 | 3300005353 | Ga0070669_100062339 | Ga0070669_1000623393 | 250 |
| 1194 | 3300005354 | Ga0070675_100220573 | Ga0070675_1002205732 | 250 |
| 1195 | 3300005356 | Ga0070674_100035549 | Ga0070674_1000355491 | 250 |
| 1196 | 3300005365 | Ga0070688_100068213 | Ga0070688_1000682131 | 250 |
| 1197 | 3300005366 | Ga0070659_100149522 | Ga0070659_1001495222 | 250 |
| 1198 | 3300005367 | Ga0070667_100042342 | Ga0070667_1000423426 | 250 |
| 1199 | 3300005367 | Ga0070667_100218666 | Ga0070667_1002186661 | 250 |
| 1200 | 3300005438 | Ga0070701_10028731 | Ga0070701_100287311 | 250 |
| 1201 | 3300005440 | Ga0070705_100404685 | Ga0070705_1004046852 | 250 |
| 1202 | 3300005441 | Ga0070700_100014797 | Ga0070700_1000147971 | 250 |
| 1203 | 3300005444 | Ga0070694_100019456 | Ga0070694_1000194565 | 250 |
| 1204 | 3300005455 | Ga0070663_100012921 | Ga0070663_1000129219 | 250 |
| 1205 | 3300005457 | Ga0070662_100203962 | Ga0070662_1002039622 | 250 |
| 1206 | 3300005458 | Ga0070681_10281525 | Ga0070681_102815251 | 250 |
| 1207 | 3300005459 | Ga0068867_100135265 | Ga0068867_1001352651 | 250 |
| 1208 | 3300005466 | Ga0070685_10232234 | Ga0070685_102322342 | 250 |
| 1209 | 3300005544 | Ga0070686_100013596 | Ga0070686_1000135962 | 250 |
| 1210 | 3300005546 | Ga0070696_100140069 | Ga0070696_1001400692 | 250 |
| 1211 | 3300005549 | Ga0070704_100111030 | Ga0070704_1001110302 | 250 |
| 1212 | 3300005617 | Ga0068859_100060567 | Ga0068859_1000605674 | 250 |
| 1213 | 3300005617 | Ga0068859_100358863 | Ga0068859_1003588632 | 250 |
| 1214 | 3300005719 | Ga0068861_100067567 | Ga0068861_1000675674 | 250 |
| 1215 | 3300005842 | Ga0068858_100238575 | Ga0068858_1002385752 | 250 |
| 1216 | 3300005844 | Ga0068862_100030660 | Ga0068862_1000306601 | 250 |
| 1217 | 3300006881 | Ga0068865_100112839 | Ga0068865_1001128392 | 250 |
| 1218 | 3300006931 | Ga0097620_100060567 | Ga0097620_1000605674 | 250 |
| 1219 | 3300006931 | Ga0097620_100358823 | Ga0097620_1003588231 | 250 |
| 1220 | 3300009094 | Ga0111539_10094883 | Ga0111539_100948833 | 250 |
| 1221 | 3300009094 | Ga0111539_10318811 | Ga0111539_103188112 | 250 |
| 1222 | 3300009101 | Ga0105247_10083629 | Ga0105247_100836292 | 250 |
| 1223 | 3300009148 | Ga0105243_10114907 | Ga0105243_101149072 | 250 |
| 1224 | 3300009177 | Ga0105248_10460221 | Ga0105248_104602211 | 250 |
| 1225 | 3300009545 | Ga0105237_10039367 | Ga0105237_100393675 | 250 |
| 1226 | 3300010375 | Ga0105239_10197284 | Ga0105239_101972841 | 250 |
| 1227 | 3300011119 | Ga0105246_10483828 | Ga0105246_104838282 | 250 |
| 1228 | 3300012492 | Ga0157335_1001212 | Ga0157335_10012122 | 250 |
| 1229 | 3300013308 | Ga0157375_10413884 | Ga0157375_104138841 | 250 |
| 1230 | 3300014325 | Ga0163163_10003323 | Ga0163163_100033231 | 250 |
| 1231 | 3300014326 | Ga0157380_10564885 | Ga0157380_105648852 | 250 |
| 1232 | 3300014968 | Ga0157379_10089280 | Ga0157379_100892801 | 250 |
| 1233 | 3300025271 | Ga0207666_1003558 | Ga0207666_10035581 | 250 |
| 1234 | 3300025900 | Ga0207710_10046923 | Ga0207710_100469231 | 250 |
| 1235 | 3300025904 | Ga0207647_10027189 | Ga0207647_100271893 | 250 |
| 1236 | 3300025912 | Ga0207707_10376174 | Ga0207707_103761741 | 250 |
| 1237 | 3300025917 | Ga0207660_10126548 | Ga0207660_101265481 | 250 |
| 1238 | 3300025919 | Ga0207657_10080547 | Ga0207657_100805471 | 250 |
| 1239 | 3300025923 | Ga0207681_10393816 | Ga0207681_103938161 | 250 |
| 1240 | 3300025925 | Ga0207650_10044066 | Ga0207650_100440662 | 250 |
| 1241 | 3300025926 | Ga0207659_10058879 | Ga0207659_100588793 | 250 |
| 1242 | 3300025931 | Ga0207644_10155311 | Ga0207644_101553111 | 250 |
| 1243 | 3300025932 | Ga0207690_10239543 | Ga0207690_102395431 | 250 |
| 1244 | 3300025933 | Ga0207706_10016238 | Ga0207706_1001623810 | 250 |
| 1245 | 3300025936 | Ga0207670_10170803 | Ga0207670_101708031 | 250 |
| 1246 | 3300025937 | Ga0207669_10008197 | Ga0207669_100081976 | 250 |
| 1247 | 3300025938 | Ga0207704_10125902 | Ga0207704_101259022 | 250 |
| 1248 | 3300025941 | Ga0207711_10343123 | Ga0207711_103431232 | 250 |
| 1249 | 3300025945 | Ga0207679_10528986 | Ga0207679_105289861 | 250 |
| 1250 | 3300025961 | Ga0207712_10228959 | Ga0207712_102289592 | 250 |
| 1251 | 3300025986 | Ga0207658_10018395 | Ga0207658_100183957 | 250 |
| 1252 | 3300026035 | Ga0207703_10243501 | Ga0207703_102435012 | 250 |
| 1253 | 3300026041 | Ga0207639_10188342 | Ga0207639_101883422 | 250 |
| 1254 | 3300026075 | Ga0207708_10027504 | Ga0207708_100275041 | 250 |
| 1255 | 3300026089 | Ga0207648_10157247 | Ga0207648_101572472 | 250 |
| 1256 | 3300026142 | Ga0207698_10143522 | Ga0207698_101435221 | 250 |
| 1257 | 3300027471 | Ga0209995_1016685 | Ga0209995_10166852 | 250 |
| 1258 | 3300027695 | Ga0209966_1003556 | Ga0209966_10035563 | 250 |
| 1259 | 3300027717 | Ga0209998_10006389 | Ga0209998_100063892 | 250 |
| 1260 | 3300028381 | Ga0268264_10539477 | Ga0268264_105394771 | 250 |
| 1261 | 3300031344 | Ga0265316_10093930 | Ga0265316_100939302 | 250 |
| 1262 | 3300034816 | Ga0373930_0001507 | Ga0373930_0001507_259_1011 | 250 |
| 1263 | 3300034817 | Ga0373948_0000117 | Ga0373948_0000117_5802_6554 | 250 |
| 1264 | 3300034818 | Ga0373950_0000396 | Ga0373950_0000396_3734_4486 | 250 |
| 1265 | 3300035084 | Ga0373928_0006026 | Ga0373928_0006026_697_1449 | 250 |
| 1266 | 3300035085 | Ga0373929_0000961 | Ga0373929_0000961_2893_3645 | 250 |
| 1267 | 3300035088 | Ga0373940_0001118 | Ga0373940_0001118_3566_4318 | 250 |
| 1268 | 3300035091 | Ga0373951_0013415 | Ga0373951_0013415_939_1691 | 250 |
| 1269 | 3300035112 | Ga0373932_0000255 | Ga0373932_0000255_864_1616 | 250 |
| 1270 | 3300035114 | Ga0373939_0021302 | Ga0373939_0021302_223_975 | 250 |
| 1271 | 3300035121 | Ga0373960_0007815 | Ga0373960_0007815_894_1646 | 250 |
| 1272 | 3300035241 | Ga0373961_0025734 | Ga0373961_0025734_619_1371 | 250 |
| 1273 | 3300042008 | Ga0439450_003393 | Ga0439450_003393_1813_2565 | 250 |
| 1274 | 3300042461 | Ga0439460_0058776 | Ga0439460_0058776_31_789 | 250 |
| 1275 | 3300042876 | Ga0451577_0052576 | Ga0451577_0052576_1735_2487 | 250 |
| 1276 | 3300045051 | Ga0451576_0040952 | Ga0451576_0040952_942_1694 | 250 |
| 1277 | 3300048905 | Ga0496102_0009899 | Ga0496102_0009899_1296_2048 | 250 |
| 1278 | 3300048906 | Ga0496103_0052832 | Ga0496103_0052832_223_975 | 250 |
| 1279 | 3300048907 | Ga0496104_0150963 | Ga0496104_0150963_998_1750 | 250 |
| 1280 | 3300048909 | Ga0496106_0061507 | Ga0496106_0061507_1736_2488 | 250 |
| 1281 | 3300048910 | Ga0496107_0096950 | Ga0496107_0096950_480_1232 | 250 |
| 1282 | 3300048910 | Ga0496107_0129718 | Ga0496107_0129718_903_1655 | 250 |
| 1283 | 3300048911 | Ga0496108_0002310 | Ga0496108_0002310_8128_8880 | 250 |
| 1284 | 3300048912 | Ga0496109_0012832 | Ga0496109_0012832_3512_4264 | 250 |
| 1285 | 3300048912 | Ga0496109_0291611 | Ga0496109_0291611_554_1306 | 250 |
| 1286 | 3300048913 | Ga0496110_0180951 | Ga0496110_0180951_419_1171 | 250 |
| 1287 | 3300048914 | Ga0496111_0115205 | Ga0496111_0115205_208_960 | 250 |
| 1288 | 3300048915 | Ga0496112_0238505 | Ga0496112_0238505_609_1361 | 250 |
| 1289 | 3300048916 | Ga0496113_0066487 | Ga0496113_0066487_981_1733 | 250 |
| 1290 | 3300048916 | Ga0496113_0068360 | Ga0496113_0068360_1534_2286 | 250 |
| 1291 | 3300049591 | Ga0501075_0079925 | Ga0501075_0079925_1562_2314 | 250 |
| 1292 | 3300049593 | Ga0501077_0023267 | Ga0501077_0023267_1732_2484 | 250 |
| 1293 | 3300049742 | Ga0501080_0195503 | Ga0501080_0195503_358_1110 | 250 |
| 1294 | 3300050490 | nmdc:mga03n38_151130_c1 | nmdc:mga03n38_151130_c1_159_911 | 250 |
| 1295 | 3300050511 | nmdc:mga08y16_253307_c1 | nmdc:mga08y16_253307_c1_838_1590 | 250 |
| 1296 | 3300053085 | Ga0495619_0121249 | Ga0495619_0121249_473_1225 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9842 | 7 | 122 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9809 | 6 | 124 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9803 | 7 | 122 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9789 | 7 | 122 |
| 6is2-assembly1.cif.gz_A | crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg | 0.9775 | 5 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9933 | 7 | 84 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9874 | 6 | 84 | 3.40.50.2300 |
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9785 | 6 | 84 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9784 | 6 | 84 | 3.40.50.2300 |
| af_P30843_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9782 | 7 | 84 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0Z4C2-F1-model_v4 | DNA-binding response regulator | 0.981 | 7 | 124 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A522UKK1-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9778 | 3 | 128 |
GO:0000155
|
| AF-A0A0G1YX15-F1-model_v4 | PAS domain S-box | 0.9767 | 5 | 125 |
GO:0000160
|
| AF-A0A7C1ETQ0-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9747 | 5 | 128 |
GO:0000155
|
| AF-A0A1F9VDU4-F1-model_v4 | Response regulatory domain-containing protein | 0.9744 | 1 | 121 |
GO:0000160
GO:0003677 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar