F492697

General Info

Members Datasets Scaffolds Average Seq Length
1296 453 1296 244

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0054487|Ga0501070_0054487_775_1554
Length 259
Sequence MSKAKPMNSATPVVLIVDDEVQIRRFLRTGFELNGFSVLEVGTGGEAIRSASLQAIDLVIVDLALPDIDGASVIERIRAWSTVPIIVLSVRSNESEKVRLLELGADDYVVKPFGMAELLARVRAALRRQMRAASGEPQVKIGPLTIDLAARAALLNGARLSLTPKEYRLLQVLAQHAGNVVTHQHLLKEVWGSVHVHDTHYLRIFVRKLRQKIEPDPNAPRILVTELGVGYRLAQNGEIDSPAWPHGGATAAAAGSKAG

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
128 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
133 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
136 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
144 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
241 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
242 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
243 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
244 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
245 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
248 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
249 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
250 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
251 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
252 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
253 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
254 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
255 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
256 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
257 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
258 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
259 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
262 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
263 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
264 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
265 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
266 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
268 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
270 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
271 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
272 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
273 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
274 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
275 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
276 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
277 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
278 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
279 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
280 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
281 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
282 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
293 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
294 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
295 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
296 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
297 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
298 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
299 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
300 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
301 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
302 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
303 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
304 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
305 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
306 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
307 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
308 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
309 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
310 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
311 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
312 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
313 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
314 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
315 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
318 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
319 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
320 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
321 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
322 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
323 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
324 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
325 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
326 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
327 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
328 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
329 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
330 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
331 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
332 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
333 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
334 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
335 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
336 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
339 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
340 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
341 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
342 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
343 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
346 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
347 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
348 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
349 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
350 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
351 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
352 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
353 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
356 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
357 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
358 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
359 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
360 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
361 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
362 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
363 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
364 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
367 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
368 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
369 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
370 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
371 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
372 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
373 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
374 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
375 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
376 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
377 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
378 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
379 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
380 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
381 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
382 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
383 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
384 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
385 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
386 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
387 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
388 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
389 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
390 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
391 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
392 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
393 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
394 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
412 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
413 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
414 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
415 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
416 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
417 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
418 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
419 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
420 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
423 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
424 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
425 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
426 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
427 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
428 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
429 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
430 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
431 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
432 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
433 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
434 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
435 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
436 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
437 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
438 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
439 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
440 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
441 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
442 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
443 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
444 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
445 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
446 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
447 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
448 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
449 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
450 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
451 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
452 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
453 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0
Rhizoplane 7.64
Rhizosphere 89.43
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214683824 2209111006 Bacteria 4569
2 ARcpr5oldR_c000960 3300000041 Bacteria 3121
3 ARSoilYngRDRAFT_c00484 3300000042 Bacteria 4727
4 ARcpr5yngRDRAFT_c000683 3300000043 Bacteria 4222
5 ARSoilOldRDRAFT_c000056 3300000044 Bacteria 23604
6 ARCol0oldRDRAFT_c00385 3300000045 Bacteria 4255
7 ARCol0yngRDRAFT_1000069 3300000652 Bacteria 18965
8 JGI24032J14994_101055 3300001430 Bacteria 1273
9 JGI24752J21851_1013427 3300001976 Bacteria 1069
10 JGI24746J21847_1001650 3300001977 Bacteria 3577
11 JGI24747J21853_1001844 3300001978 Bacteria 1650
12 JGI24739J22299_10014137 3300001989 Bacteria 2905
13 JGI24737J22298_10012901 3300001990 Bacteria 2723
14 JGI24737J22298_10020399 3300001990 Bacteria 2116
15 JGI24737J22298_10064859 3300001990 Bacteria 1095
16 JGI24743J22301_10004048 3300001991 Bacteria 2360
17 JGI24743J22301_10008333 3300001991 Bacteria 1817
18 JGI24750J21931_1000188 3300002070 Bacteria 10321
19 JGI24750J21931_1001196 3300002070 Bacteria 3311
20 JGI24745J21846_1008993 3300002073 Bacteria 1128
21 JGI24738J21930_10000068 3300002075 Bacteria 21789
22 JGI24749J21850_1011821 3300002076 Bacteria 1226
23 JGI24744J21845_10019934 3300002077 Bacteria 1324
24 JGI24035J26624_1000816 3300002126 Bacteria 2932
25 JGI24034J26672_10004654 3300002239 Bacteria 1950
26 JGI24742J22300_10003075 3300002244 Bacteria 2700
27 JGI24742J22300_10019847 3300002244 Bacteria 1143
28 JGI24751J29686_10002565 3300002459 Bacteria 3649
29 rootH1_10199197 3300003323 Bacteria 1507
30 JGI25407J50210_10025802 3300003373 Bacteria 1523
31 Ga0065716_1001578 3300005277 Bacteria 5949
32 Ga0065704_10020946 3300005289 Bacteria 1982
33 Ga0065712_10006735 3300005290 Bacteria 4677
34 Ga0065715_10002029 3300005293 Bacteria 5263
35 Ga0065715_10089172 3300005293 Bacteria 13154
36 Ga0065707_10122926 3300005295 Bacteria 2077
37 Ga0070658_10270701 3300005327 Bacteria 1445
38 Ga0070676_10030891 3300005328 Bacteria 3058
39 Ga0070683_100004718 3300005329 Bacteria 11267
40 Ga0070683_100106661 3300005329 Bacteria 2641
41 Ga0070683_100151902 3300005329 Bacteria 2195
42 Ga0070683_100177709 3300005329 Bacteria 2021
43 Ga0070683_100186261 3300005329 Bacteria 1970
44 Ga0070690_100001828 3300005330 Bacteria 11279
45 Ga0070690_100012134 3300005330 Bacteria 5064
46 Ga0070690_100085564 3300005330 Bacteria 2068
47 Ga0070690_100252195 3300005330 Bacteria 1248
48 Ga0070670_100001134 3300005331 Bacteria 21148
49 Ga0070670_100019346 3300005331 Bacteria 5841
50 Ga0070670_100022469 3300005331 Bacteria 5429
51 Ga0070670_100113430 3300005331 Bacteria 2336
52 Ga0070677_10004240 3300005333 Bacteria 4669
53 Ga0070677_10080424 3300005333 Bacteria 1393
54 Ga0068869_100002241 3300005334 Bacteria 11635
55 Ga0068869_100072509 3300005334 Bacteria 2551
56 Ga0070666_10241461 3300005335 Bacteria 1277
57 Ga0070666_10295572 3300005335 Bacteria 1153
58 Ga0070680_100024207 3300005336 Bacteria 4846
59 Ga0070680_100037746 3300005336 Bacteria 3904
60 Ga0070680_100134470 3300005336 Bacteria 2070
61 Ga0070680_100195912 3300005336 Bacteria 1703
62 Ga0070682_100048795 3300005337 Bacteria 2637
63 Ga0070682_100060135 3300005337 Bacteria 2402
64 Ga0068868_100045050 3300005338 Bacteria 3450
65 Ga0068868_100060072 3300005338 Bacteria 3008
66 Ga0070660_100000730 3300005339 Bacteria 21778
67 Ga0070660_100221561 3300005339 Bacteria 1538
68 Ga0070660_100236961 3300005339 Bacteria 1485
69 Ga0070689_100000601 3300005340 Bacteria 21783
70 Ga0070689_100011223 3300005340 Bacteria 6412
71 Ga0070689_100069420 3300005340 Bacteria 2749
72 Ga0070689_100131877 3300005340 Bacteria 2004
73 Ga0070691_10016213 3300005341 Bacteria 3423
74 Ga0070691_10025483 3300005341 Bacteria 2753
75 Ga0070691_10051909 3300005341 Bacteria 1960
76 Ga0070687_100000253 3300005343 Bacteria 18199
77 Ga0070661_100003564 3300005344 Bacteria 10720
78 Ga0070661_100005403 3300005344 Bacteria 8809
79 Ga0070692_10000060 3300005345 Bacteria 21392
80 Ga0070692_10018948 3300005345 Bacteria 3316
81 Ga0070668_100096911 3300005347 Bacteria 2332
82 Ga0070668_100187304 3300005347 Bacteria 1693
83 Ga0070668_100315543 3300005347 Bacteria 1314
84 Ga0070669_100000888 3300005353 Bacteria 21753
85 Ga0070669_100062339 3300005353 Bacteria 2741
86 Ga0070669_100207881 3300005353 Bacteria 1543
87 Ga0070669_100397683 3300005353 Bacteria 1127
88 Ga0070675_100000441 3300005354 Bacteria 28206
89 Ga0070675_100087502 3300005354 Bacteria 2605
90 Ga0070675_100220573 3300005354 Bacteria 1651
91 Ga0070675_100273203 3300005354 Bacteria 1484
92 Ga0070675_100307546 3300005354 Bacteria 1398
93 Ga0070675_100361184 3300005354 Bacteria 1289
94 Ga0070671_100012431 3300005355 Bacteria 6855
95 Ga0070671_100038653 3300005355 Bacteria 3961
96 Ga0070671_100086982 3300005355 Bacteria 2616
97 Ga0070674_100000723 3300005356 Bacteria 16855
98 Ga0070674_100035549 3300005356 Bacteria 3337
99 Ga0070674_100045634 3300005356 Bacteria 2994
100 Ga0070674_100071279 3300005356 Bacteria 2457
101 Ga0070674_100305399 3300005356 Bacteria 1270
102 Ga0070673_100000456 3300005364 Bacteria 21637
103 Ga0070673_100006931 3300005364 Bacteria 7413
104 Ga0070673_100023232 3300005364 Bacteria 4529
105 Ga0070673_100036643 3300005364 Bacteria 3730
106 Ga0070673_100278696 3300005364 Bacteria 1466
107 Ga0070673_100593512 3300005364 Bacteria 1010
108 Ga0070673_100981390 3300005364 Bacteria 786
109 Ga0070688_100016044 3300005365 Bacteria 4274
110 Ga0070688_100068213 3300005365 Bacteria 2267
111 Ga0070659_100071077 3300005366 Bacteria 2766
112 Ga0070659_100149522 3300005366 Bacteria 1904
113 Ga0070659_100294699 3300005366 Bacteria 1351
114 Ga0070667_100004366 3300005367 Bacteria 11932
115 Ga0070667_100028530 3300005367 Bacteria 4647
116 Ga0070667_100042342 3300005367 Bacteria 3821
117 Ga0070667_100054032 3300005367 Bacteria 3391
118 Ga0070667_100110696 3300005367 Bacteria 2381
119 Ga0070667_100218666 3300005367 Bacteria 1695
120 Ga0070667_100297760 3300005367 Bacteria 1452
121 Ga0070703_10142656 3300005406 Bacteria 892
122 Ga0070709_10012396 3300005434 Bacteria 4771
123 Ga0070709_10064725 3300005434 Bacteria 2338
124 Ga0070709_10267256 3300005434 Bacteria 1238
125 Ga0070714_100001717 3300005435 Bacteria 15944
126 Ga0070714_100072401 3300005435 Bacteria 2983
127 Ga0070714_100092964 3300005435 Bacteria 2644
128 Ga0070713_100008626 3300005436 Bacteria 7242
129 Ga0070713_100025030 3300005436 Bacteria 4660
130 Ga0070713_100051947 3300005436 Bacteria 3392
131 Ga0070713_100073307 3300005436 Bacteria 2898
132 Ga0070713_100099211 3300005436 Bacteria 2519
133 Ga0070713_100337916 3300005436 Bacteria 1395
134 Ga0070710_10014117 3300005437 Bacteria 4013
135 Ga0070710_10014261 3300005437 Bacteria 3997
136 Ga0070710_10021851 3300005437 Bacteria 3339
137 Ga0070710_10030745 3300005437 Bacteria 2891
138 Ga0070701_10000150 3300005438 Bacteria 21357
139 Ga0070701_10028731 3300005438 Bacteria 2735
140 Ga0070701_10040980 3300005438 Bacteria 2357
141 Ga0070711_100115737 3300005439 Bacteria 1975
142 Ga0070711_100136053 3300005439 Bacteria 1836
143 Ga0070705_100115517 3300005440 Bacteria 1723
144 Ga0070705_100404685 3300005440 Bacteria 1011
145 Ga0070705_100611149 3300005440 Bacteria 845
146 Ga0070700_100001083 3300005441 Bacteria 13532
147 Ga0070700_100014797 3300005441 Bacteria 4409
148 Ga0070700_100073585 3300005441 Bacteria 2187
149 Ga0070700_100096905 3300005441 Bacteria 1936
150 Ga0070700_100172225 3300005441 Bacteria 1500
151 Ga0070700_100299024 3300005441 Bacteria 1174
152 Ga0070694_100005807 3300005444 Bacteria 7485
153 Ga0070694_100019456 3300005444 Bacteria 4318
154 Ga0070694_100202123 3300005444 Bacteria 1482
155 Ga0070694_100766443 3300005444 Bacteria 789
156 Ga0070708_100482556 3300005445 Bacteria 1169
157 Ga0070663_100012921 3300005455 Bacteria 5301
158 Ga0070663_100055519 3300005455 Bacteria 2835
159 Ga0070663_100061112 3300005455 Bacteria 2712
160 Ga0070663_100235138 3300005455 Bacteria 1444
161 Ga0070678_100000199 3300005456 Bacteria 26434
162 Ga0070678_100019407 3300005456 Bacteria 4431
163 Ga0070678_100032267 3300005456 Bacteria 3623
164 Ga0070678_100141386 3300005456 Bacteria 1926
165 Ga0070678_100344074 3300005456 Unclassified 1280
166 Ga0070662_100067575 3300005457 Bacteria 2625
167 Ga0070662_100203962 3300005457 Bacteria 1570
168 Ga0070681_10001398 3300005458 Bacteria 21148
169 Ga0070681_10051334 3300005458 Bacteria 4113
170 Ga0070681_10281525 3300005458 Bacteria 1573
171 Ga0070681_10471298 3300005458 Bacteria 1168
172 Ga0070681_10611962 3300005458 Bacteria 1004
173 Ga0068867_100070864 3300005459 Bacteria 2606
174 Ga0068867_100135265 3300005459 Bacteria 1920
175 Ga0070685_10012971 3300005466 Bacteria 4388
176 Ga0070685_10012988 3300005466 Bacteria 4386
177 Ga0070685_10070280 3300005466 Bacteria 2072
178 Ga0070685_10156737 3300005466 Bacteria 1448
179 Ga0070685_10232234 3300005466 Bacteria 1214
180 Ga0070699_100010246 3300005518 Bacteria 8108
181 Ga0070679_100003933 3300005530 Bacteria 13668
182 Ga0070679_100109379 3300005530 Bacteria 2750
183 Ga0070679_100163896 3300005530 Bacteria 2197
184 Ga0070679_100200367 3300005530 Bacteria 1963
185 Ga0070684_100008219 3300005535 Bacteria 8153
186 Ga0070684_100033102 3300005535 Bacteria 4410
187 Ga0070684_100100028 3300005535 Bacteria 2589
188 Ga0070684_100811840 3300005535 Bacteria 875
189 Ga0070697_100528546 3300005536 Bacteria 1033
190 Ga0070672_100035421 3300005543 Bacteria 3795
191 Ga0070672_100084911 3300005543 Bacteria 2543
192 Ga0070672_100281702 3300005543 Bacteria 1406
193 Ga0070672_100282939 3300005543 Bacteria 1402
194 Ga0070686_100000746 3300005544 Bacteria 18847
195 Ga0070686_100003612 3300005544 Bacteria 8488
196 Ga0070686_100010778 3300005544 Bacteria 5168
197 Ga0070686_100013596 3300005544 Bacteria 4667
198 Ga0070686_100376233 3300005544 Bacteria 1074
199 Ga0070695_100180484 3300005545 Bacteria 1495
200 Ga0070696_100140069 3300005546 Bacteria 1767
201 Ga0070693_100000613 3300005547 Bacteria 15823
202 Ga0070693_100025946 3300005547 Bacteria 3157
203 Ga0070665_100023806 3300005548 Bacteria 6169
204 Ga0070665_100056129 3300005548 Bacteria 3949
205 Ga0070704_100111030 3300005549 Bacteria 2086
206 Ga0070704_100161117 3300005549 Bacteria 1774
207 Ga0070704_100195506 3300005549 Bacteria 1629
208 Ga0068855_100004415 3300005563 Bacteria 17183
209 Ga0068855_100208336 3300005563 Bacteria 2198
210 Ga0070664_100023220 3300005564 Bacteria 5122
211 Ga0070664_100306345 3300005564 Bacteria 1436
212 Ga0070664_100405256 3300005564 Bacteria 1247
213 Ga0068857_100010463 3300005577 Bacteria 8063
214 Ga0068857_100048107 3300005577 Bacteria 3787
215 Ga0068857_100385003 3300005577 Bacteria 1303
216 Ga0068854_100022931 3300005578 Bacteria 4259
217 Ga0068854_100038064 3300005578 Bacteria 3380
218 Ga0068854_100151074 3300005578 Bacteria 1791
219 Ga0068856_100001340 3300005614 Bacteria 25903
220 Ga0068856_100045746 3300005614 Bacteria 4310
221 Ga0068856_100120449 3300005614 Bacteria 2625
222 Ga0068856_100330525 3300005614 Bacteria 1542
223 Ga0068856_100638112 3300005614 Bacteria 1086
224 Ga0070702_100000293 3300005615 Bacteria 17107
225 Ga0070702_100005192 3300005615 Bacteria 6032
226 Ga0070702_100113030 3300005615 Bacteria 1687
227 Ga0068852_100028469 3300005616 Bacteria 4574
228 Ga0068852_100087901 3300005616 Bacteria 2774
229 Ga0068859_100001767 3300005617 Bacteria 21986
230 Ga0068859_100020118 3300005617 Bacteria 6701
231 Ga0068859_100060567 3300005617 Bacteria 3814
232 Ga0068859_100108650 3300005617 Bacteria 2835
233 Ga0068859_100358863 3300005617 Bacteria 1552
234 Ga0068864_100003544 3300005618 Bacteria 12907
235 Ga0068864_100022792 3300005618 Bacteria 5252
236 Ga0068864_100182279 3300005618 Bacteria 1920
237 Ga0068864_100996407 3300005618 Bacteria 831
238 Ga0068866_10000372 3300005718 Bacteria 21128
239 Ga0068866_10065626 3300005718 Bacteria 1899
240 Ga0068866_10075107 3300005718 Bacteria 1799
241 Ga0068861_100067567 3300005719 Bacteria 2759
242 Ga0068861_100090261 3300005719 Bacteria 2417
243 Ga0068861_100238331 3300005719 Bacteria 1546
244 Ga0068851_10011533 3300005834 Bacteria 4147
245 Ga0068851_10067204 3300005834 Bacteria 1849
246 Ga0068870_10000207 3300005840 Bacteria 21125
247 Ga0068870_10007460 3300005840 Bacteria 4876
248 Ga0068863_100028324 3300005841 Bacteria 5348
249 Ga0068863_100034537 3300005841 Bacteria 4817
250 Ga0068863_100047285 3300005841 Bacteria 4082
251 Ga0068863_100300993 3300005841 Bacteria 1556
252 Ga0068858_100004999 3300005842 Bacteria 12990
253 Ga0068858_100238575 3300005842 Bacteria 1724
254 Ga0068858_100601218 3300005842 Bacteria 1067
255 Ga0068860_100019087 3300005843 Bacteria 6656
256 Ga0068860_100110596 3300005843 Bacteria 2626
257 Ga0068860_100510993 3300005843 Bacteria 1200
258 Ga0068860_100563699 3300005843 Bacteria 1142
259 Ga0068862_100030660 3300005844 Bacteria 4533
260 Ga0068862_100051221 3300005844 Bacteria 3530
261 Ga0081455_10000002 3300005937 Bacteria 460472
262 Ga0081455_10017616 3300005937 Bacteria 6838
263 Ga0081455_10018858 3300005937 Bacteria 6546
264 Ga0081455_10082492 3300005937 Bacteria 2630
265 Ga0081455_10407144 3300005937 Bacteria 942
266 Ga0081538_10009357 3300005981 Bacteria 8187
267 Ga0081538_10017589 3300005981 Bacteria 5417
268 Ga0081540_1004734 3300005983 Bacteria 10288
269 Ga0081540_1010142 3300005983 Bacteria 6411
270 Ga0081540_1023475 3300005983 Bacteria 3605
271 Ga0081540_1127389 3300005983 Bacteria 1045
272 Ga0070717_10005256 3300006028 Bacteria 9433
273 Ga0070717_10159756 3300006028 Bacteria 1955
274 Ga0070717_10229996 3300006028 Bacteria 1632
275 Ga0070717_10259779 3300006028 Bacteria 1536
276 Ga0070717_10269131 3300006028 Bacteria 1509
277 Ga0070717_10284299 3300006028 Bacteria 1468
278 Ga0070717_10391947 3300006028 Bacteria 1247
279 Ga0070717_10456719 3300006028 Bacteria 1152
280 Ga0070717_10708378 3300006028 Bacteria 915
281 Ga0075363_100026063 3300006048 Bacteria 2989
282 Ga0075364_10108613 3300006051 Bacteria 1850
283 Ga0075364_10189800 3300006051 Bacteria 1391
284 Ga0075432_10010313 3300006058 Bacteria 3169
285 Ga0075432_10060363 3300006058 Bacteria 1349
286 Ga0070715_10039488 3300006163 Bacteria 1966
287 Ga0070716_100002237 3300006173 Bacteria 8916
288 Ga0070716_100171043 3300006173 Bacteria 1418
289 Ga0070716_100312353 3300006173 Bacteria 1098
290 Ga0070712_100184118 3300006175 Bacteria 1630
291 Ga0075362_10019167 3300006177 Bacteria 2842
292 Ga0075362_10072275 3300006177 Bacteria 1578
293 Ga0075366_10137332 3300006195 Bacteria 1477
294 Ga0075366_10238531 3300006195 Bacteria 1108
295 Ga0097621_100026392 3300006237 Bacteria 4556
296 Ga0097621_100045181 3300006237 Bacteria 3556
297 Ga0097621_100172544 3300006237 Bacteria 1865
298 Ga0097621_100397358 3300006237 Bacteria 1233
299 Ga0075370_10013697 3300006353 Bacteria 4316
300 Ga0068871_100007371 3300006358 Bacteria 7851
301 Ga0068871_100078310 3300006358 Bacteria 2733
302 Ga0068871_100078591 3300006358 Bacteria 2728
303 Ga0068871_100697189 3300006358 Bacteria 930
304 Ga0075428_100001802 3300006844 Bacteria 22929
305 Ga0075428_100010200 3300006844 Bacteria 10427
306 Ga0075428_100010216 3300006844 Bacteria 10422
307 Ga0075428_100103269 3300006844 Bacteria 3109
308 Ga0075428_100186326 3300006844 Bacteria 2245
309 Ga0075430_100001483 3300006846 Bacteria 19129
310 Ga0075430_100003861 3300006846 Bacteria 12622
311 Ga0075430_100056700 3300006846 Bacteria 3295
312 Ga0075430_100228568 3300006846 Bacteria 1543
313 Ga0075431_100001018 3300006847 Bacteria 24961
314 Ga0075431_100017410 3300006847 Bacteria 7302
315 Ga0075431_100055912 3300006847 Bacteria 4071
316 Ga0075431_100097874 3300006847 Bacteria 3029
317 Ga0075431_100498757 3300006847 Bacteria 1209
318 Ga0075433_10002052 3300006852 Bacteria 15222
319 Ga0075433_10019693 3300006852 Bacteria 5628
320 Ga0075433_10031620 3300006852 Bacteria 4525
321 Ga0075433_10184035 3300006852 Bacteria 1859
322 Ga0075433_10222295 3300006852 Bacteria 1677
323 Ga0075433_10316169 3300006852 Bacteria 1382
324 Ga0075433_10367375 3300006852 Bacteria 1271
325 Ga0075434_100001473 3300006871 Bacteria 19815
326 Ga0075434_100003814 3300006871 Bacteria 13476
327 Ga0075434_100031871 3300006871 Bacteria 5198
328 Ga0075434_100060134 3300006871 Bacteria 3778
329 Ga0075434_100071882 3300006871 Bacteria 3451
330 Ga0075434_100110966 3300006871 Bacteria 2753
331 Ga0075434_100135632 3300006871 Bacteria 2480
332 Ga0075434_100160232 3300006871 Bacteria 2270
333 Ga0075434_100529770 3300006871 Bacteria 1198
334 Ga0075429_100005294 3300006880 Bacteria 11102
335 Ga0075429_100030953 3300006880 Bacteria 4651
336 Ga0075429_100082444 3300006880 Bacteria 2803
337 Ga0075429_100142052 3300006880 Bacteria 2102
338 Ga0075429_100582962 3300006880 Bacteria 980
339 Ga0068865_100000537 3300006881 Bacteria 21125
340 Ga0068865_100021335 3300006881 Bacteria 4210
341 Ga0068865_100063296 3300006881 Bacteria 2599
342 Ga0068865_100112839 3300006881 Bacteria 2008
343 Ga0068865_100405001 3300006881 Bacteria 1118
344 Ga0075436_100026165 3300006914 Bacteria 4017
345 Ga0075436_100249389 3300006914 Bacteria 1264
346 Ga0075436_100406007 3300006914 Bacteria 988
347 Ga0097620_100001767 3300006931 Bacteria 21986
348 Ga0097620_100020117 3300006931 Bacteria 6701
349 Ga0097620_100060567 3300006931 Bacteria 3814
350 Ga0097620_100108648 3300006931 Bacteria 2835
351 Ga0097620_100358823 3300006931 Bacteria 1552
352 Ga0075435_100024384 3300007076 Bacteria 4694
353 Ga0075435_100247914 3300007076 Bacteria 1516
354 Ga0075435_100452317 3300007076 Bacteria 1107
355 Ga0099794_10021139 3300007265 Bacteria 2954
356 Ga0099795_10013800 3300007788 Bacteria 2490
357 Ga0105240_10175883 3300009093 Bacteria 2530
358 Ga0105240_10192164 3300009093 Bacteria 2399
359 Ga0105240_10486749 3300009093 Bacteria 1374
360 Ga0111539_10000200 3300009094 Bacteria 70531
361 Ga0111539_10008538 3300009094 Bacteria 13014
362 Ga0111539_10012114 3300009094 Bacteria 10820
363 Ga0111539_10094883 3300009094 Bacteria 3505
364 Ga0111539_10250757 3300009094 Bacteria 2061
365 Ga0111539_10273679 3300009094 Bacteria 1965
366 Ga0111539_10318811 3300009094 Bacteria 1809
367 Ga0111539_10465254 3300009094 Bacteria 1472
368 Ga0111539_10484660 3300009094 Bacteria 1440
369 Ga0105245_10000888 3300009098 Bacteria 27206
370 Ga0105245_10052837 3300009098 Bacteria 3645
371 Ga0105245_10130933 3300009098 Bacteria 2353
372 Ga0105247_10047293 3300009101 Bacteria 2641
373 Ga0105247_10083629 3300009101 Bacteria 2016
374 Ga0105247_10135152 3300009101 Bacteria 1611
375 Ga0114129_10000205 3300009147 Bacteria 65770
376 Ga0114129_10011166 3300009147 Bacteria 12804
377 Ga0114129_10022387 3300009147 Bacteria 8973
378 Ga0114129_10046549 3300009147 Bacteria 6095
379 Ga0114129_10061852 3300009147 Bacteria 5232
380 Ga0114129_10135358 3300009147 Bacteria 3381
381 Ga0114129_10375341 3300009147 Bacteria 1879
382 Ga0114129_10416397 3300009147 Bacteria 1768
383 Ga0114129_11377658 3300009147 Bacteria 871
384 Ga0105243_10076858 3300009148 Bacteria 2714
385 Ga0105243_10085706 3300009148 Bacteria 2582
386 Ga0105243_10114907 3300009148 Bacteria 2259
387 Ga0105243_10148864 3300009148 Bacteria 2006
388 Ga0105243_10163891 3300009148 Bacteria 1919
389 Ga0105243_10196764 3300009148 Bacteria 1765
390 Ga0105241_10000662 3300009174 Bacteria 25854
391 Ga0105241_10165889 3300009174 Bacteria 1820
392 Ga0105242_10014624 3300009176 Bacteria 6076
393 Ga0105242_10053790 3300009176 Bacteria 3289
394 Ga0105242_10312002 3300009176 Bacteria 1439
395 Ga0105248_10002336 3300009177 Bacteria 21042
396 Ga0105248_10031394 3300009177 Bacteria 5938
397 Ga0105248_10460221 3300009177 Bacteria 1434
398 Ga0105237_10039367 3300009545 Bacteria 4772
399 Ga0105237_10046059 3300009545 Bacteria 4388
400 Ga0105237_10067784 3300009545 Bacteria 3562
401 Ga0105237_10140314 3300009545 Bacteria 2411
402 Ga0105238_10231208 3300009551 Bacteria 1826
403 Ga0105238_10261602 3300009551 Bacteria 1710
404 Ga0105238_10279811 3300009551 Bacteria 1649
405 Ga0105249_10029669 3300009553 Bacteria 4940
406 Ga0105249_10061954 3300009553 Bacteria 3434
407 Ga0105249_10142703 3300009553 Bacteria 2298
408 Ga0105249_10325201 3300009553 Bacteria 1550
409 Ga0105249_10394324 3300009553 Bacteria 1413
410 Ga0105239_10054294 3300010375 Bacteria 4394
411 Ga0105239_10080934 3300010375 Bacteria 3574
412 Ga0105239_10197284 3300010375 Bacteria 2254
413 Ga0105239_10349579 3300010375 Bacteria 1669
414 Ga0105239_10544274 3300010375 Bacteria 1322
415 Ga0105246_10007028 3300011119 Bacteria 6890
416 Ga0105246_10096405 3300011119 Bacteria 2144
417 Ga0105246_10276547 3300011119 Bacteria 1345
418 Ga0105246_10376654 3300011119 Bacteria 1171
419 Ga0105246_10483828 3300011119 Bacteria 1048
420 Ga0157335_1001212 3300012492 Bacteria 1371
421 Ga0157345_1001625 3300012498 Bacteria 1579
422 Ga0157371_10117919 3300013102 Bacteria 1887
423 Ga0157370_10149088 3300013104 Bacteria 2177
424 Ga0157374_10021097 3300013296 Bacteria 5789
425 Ga0157374_10146030 3300013296 Bacteria 2297
426 Ga0157378_10073544 3300013297 Bacteria 3073
427 Ga0157378_10184872 3300013297 Bacteria 1962
428 Ga0157378_10243177 3300013297 Bacteria 1720
429 Ga0163162_10112141 3300013306 Bacteria 2826
430 Ga0163162_10156876 3300013306 Bacteria 2396
431 Ga0163162_10440066 3300013306 Bacteria 1436
432 Ga0163162_10590212 3300013306 Bacteria 1237
433 Ga0157372_10038501 3300013307 Bacteria 5277
434 Ga0157372_10943540 3300013307 Bacteria 1000
435 Ga0157375_10001031 3300013308 Bacteria 24026
436 Ga0157375_10027552 3300013308 Bacteria 5312
437 Ga0157375_10413884 3300013308 Bacteria 1514
438 Ga0157375_10469505 3300013308 Bacteria 1423
439 Ga0163163_10003323 3300014325 Bacteria 13641
440 Ga0163163_10278369 3300014325 Bacteria 1725
441 Ga0163163_10516572 3300014325 Bacteria 1257
442 Ga0157380_10000726 3300014326 Bacteria 20528
443 Ga0157380_10026147 3300014326 Bacteria 4431
444 Ga0157380_10141957 3300014326 Bacteria 2065
445 Ga0157380_10564885 3300014326 Bacteria 1119
446 Ga0157377_10000324 3300014745 Bacteria 21481
447 Ga0157379_10001193 3300014968 Bacteria 21154
448 Ga0157379_10034362 3300014968 Bacteria 4521
449 Ga0157379_10041558 3300014968 Bacteria 4105
450 Ga0157379_10089280 3300014968 Bacteria 2765
451 Ga0157376_10012211 3300014969 Bacteria 6366
452 Ga0157376_10036819 3300014969 Bacteria 3966
453 Ga0157376_10047064 3300014969 Bacteria 3560
454 Ga0163161_10001040 3300017792 Bacteria 21136
455 Ga0163161_10037784 3300017792 Bacteria 3462
456 Ga0163161_10066417 3300017792 Bacteria 2634
457 Ga0213874_10020981 3300021377 Bacteria 1797
458 Ga0213876_10015303 3300021384 Bacteria 4061
459 Ga0213876_10092962 3300021384 Bacteria 1598
460 Ga0207666_1000034 3300025271 Bacteria 28645
461 Ga0207666_1003558 3300025271 Bacteria 1918
462 Ga0207673_1000061 3300025290 Bacteria 9198
463 Ga0207697_10000280 3300025315 Bacteria 28276
464 Ga0207656_10080624 3300025321 Bacteria 1462
465 Ga0207653_10009627 3300025885 Bacteria 3012
466 Ga0207682_10000134 3300025893 Bacteria 33520
467 Ga0207692_10000073 3300025898 Bacteria 29005
468 Ga0207692_10006215 3300025898 Bacteria 4836
469 Ga0207692_10391109 3300025898 Bacteria 865
470 Ga0207642_10010308 3300025899 Bacteria 3289
471 Ga0207642_10141071 3300025899 Bacteria 1271
472 Ga0207710_10003581 3300025900 Bacteria 6895
473 Ga0207710_10007452 3300025900 Bacteria 4633
474 Ga0207710_10010170 3300025900 Bacteria 3958
475 Ga0207710_10037981 3300025900 Bacteria 2128
476 Ga0207710_10046923 3300025900 Bacteria 1929
477 Ga0207688_10000526 3300025901 Bacteria 18554
478 Ga0207688_10000939 3300025901 Bacteria 14737
479 Ga0207680_10014420 3300025903 Bacteria 4090
480 Ga0207680_10033276 3300025903 Bacteria 2939
481 Ga0207680_10040227 3300025903 Bacteria 2719
482 Ga0207680_10047176 3300025903 Bacteria 2551
483 Ga0207647_10016576 3300025904 Bacteria 5025
484 Ga0207647_10027189 3300025904 Bacteria 3732
485 Ga0207647_10042906 3300025904 Bacteria 2834
486 Ga0207647_10115384 3300025904 Bacteria 1586
487 Ga0207685_10002787 3300025905 Bacteria 4091
488 Ga0207685_10026299 3300025905 Bacteria 2022
489 Ga0207699_10001462 3300025906 Bacteria 11208
490 Ga0207699_10001951 3300025906 Bacteria 9731
491 Ga0207645_10020382 3300025907 Bacteria 4341
492 Ga0207645_10037279 3300025907 Bacteria 3119
493 Ga0207645_10039728 3300025907 Bacteria 3014
494 Ga0207643_10000300 3300025908 Bacteria 34225
495 Ga0207643_10000475 3300025908 Bacteria 25958
496 Ga0207643_10136339 3300025908 Bacteria 1463
497 Ga0207684_10171941 3300025910 Bacteria 1868
498 Ga0207654_10006328 3300025911 Bacteria 5951
499 Ga0207654_10055045 3300025911 Bacteria 2302
500 Ga0207654_10065192 3300025911 Bacteria 2144
501 Ga0207707_10026952 3300025912 Bacteria 5023
502 Ga0207707_10069245 3300025912 Bacteria 3075
503 Ga0207707_10203838 3300025912 Bacteria 1724
504 Ga0207707_10376174 3300025912 Bacteria 1221
505 Ga0207695_10279293 3300025913 Bacteria 1564
506 Ga0207693_10005568 3300025915 Bacteria 10480
507 Ga0207693_10022202 3300025915 Bacteria 5044
508 Ga0207693_10032414 3300025915 Bacteria 4124
509 Ga0207693_10051931 3300025915 Bacteria 3215
510 Ga0207693_10145284 3300025915 Bacteria 1865
511 Ga0207693_10152860 3300025915 Bacteria 1815
512 Ga0207693_10288677 3300025915 Bacteria 1285
513 Ga0207663_10032864 3300025916 Bacteria 3084
514 Ga0207660_10126548 3300025917 Bacteria 1941
515 Ga0207660_10260293 3300025917 Bacteria 1372
516 Ga0207660_10409617 3300025917 Bacteria 1092
517 Ga0207662_10000341 3300025918 Bacteria 21083
518 Ga0207662_10000768 3300025918 Bacteria 14730
519 Ga0207662_10138086 3300025918 Bacteria 1542
520 Ga0207657_10008236 3300025919 Bacteria 10611
521 Ga0207657_10036372 3300025919 Bacteria 4406
522 Ga0207657_10080547 3300025919 Bacteria 2737
523 Ga0207657_10081113 3300025919 Bacteria 2726
524 Ga0207649_10000271 3300025920 Bacteria 40924
525 Ga0207649_10056986 3300025920 Bacteria 2441
526 Ga0207652_10079199 3300025921 Bacteria 2870
527 Ga0207652_10101929 3300025921 Bacteria 2536
528 Ga0207652_10154955 3300025921 Bacteria 2052
529 Ga0207652_10326611 3300025921 Bacteria 1385
530 Ga0207681_10000658 3300025923 Bacteria 22886
531 Ga0207681_10387498 3300025923 Bacteria 1126
532 Ga0207681_10393816 3300025923 Bacteria 1117
533 Ga0207694_10037102 3300025924 Bacteria 3741
534 Ga0207694_10228090 3300025924 Bacteria 1521
535 Ga0207694_10290516 3300025924 Bacteria 1344
536 Ga0207650_10014779 3300025925 Bacteria 5429
537 Ga0207650_10031270 3300025925 Bacteria 3842
538 Ga0207650_10044066 3300025925 Bacteria 3278
539 Ga0207650_10088298 3300025925 Bacteria 2364
540 Ga0207650_10296223 3300025925 Bacteria 1320
541 Ga0207659_10000177 3300025926 Bacteria 38217
542 Ga0207659_10008323 3300025926 Bacteria 6431
543 Ga0207659_10058879 3300025926 Bacteria 2759
544 Ga0207659_10207931 3300025926 Bacteria 1567
545 Ga0207687_10000495 3300025927 Bacteria 26551
546 Ga0207687_10008827 3300025927 Bacteria 6588
547 Ga0207687_10011220 3300025927 Bacteria 5851
548 Ga0207687_10071861 3300025927 Bacteria 2473
549 Ga0207687_10078689 3300025927 Bacteria 2375
550 Ga0207700_10000624 3300025928 Bacteria 20699
551 Ga0207700_10012388 3300025928 Bacteria 5498
552 Ga0207700_10082085 3300025928 Bacteria 2520
553 Ga0207700_10223904 3300025928 Bacteria 1596
554 Ga0207700_10517163 3300025928 Bacteria 1057
555 Ga0207664_10002018 3300025929 Bacteria 13367
556 Ga0207664_10099185 3300025929 Bacteria 2403
557 Ga0207664_10120720 3300025929 Bacteria 2193
558 Ga0207664_10141511 3300025929 Bacteria 2035
559 Ga0207644_10000279 3300025931 Bacteria 33969
560 Ga0207644_10006733 3300025931 Bacteria 7486
561 Ga0207644_10007407 3300025931 Bacteria 7152
562 Ga0207644_10008269 3300025931 Bacteria 6816
563 Ga0207644_10155311 3300025931 Bacteria 1774
564 Ga0207690_10008301 3300025932 Bacteria 6160
565 Ga0207690_10024537 3300025932 Bacteria 3777
566 Ga0207690_10035634 3300025932 Bacteria 3216
567 Ga0207690_10239543 3300025932 Bacteria 1397
568 Ga0207690_10244729 3300025932 Bacteria 1383
569 Ga0207706_10005939 3300025933 Bacteria 11357
570 Ga0207706_10016238 3300025933 Bacteria 6727
571 Ga0207706_10081326 3300025933 Bacteria 2847
572 Ga0207706_10114454 3300025933 Bacteria 2372
573 Ga0207686_10005492 3300025934 Bacteria 6803
574 Ga0207686_10028899 3300025934 Bacteria 3264
575 Ga0207686_10141983 3300025934 Bacteria 1661
576 Ga0207686_10181080 3300025934 Bacteria 1494
577 Ga0207709_10000952 3300025935 Bacteria 21659
578 Ga0207709_10028423 3300025935 Bacteria 3233
579 Ga0207709_10080410 3300025935 Bacteria 2099
580 Ga0207670_10000491 3300025936 Bacteria 21793
581 Ga0207670_10021268 3300025936 Bacteria 4000
582 Ga0207670_10038696 3300025936 Bacteria 3117
583 Ga0207670_10170803 3300025936 Bacteria 1630
584 Ga0207669_10008197 3300025937 Bacteria 4894
585 Ga0207669_10013651 3300025937 Bacteria 4044
586 Ga0207669_10179490 3300025937 Bacteria 1516
587 Ga0207669_10342700 3300025937 Bacteria 1151
588 Ga0207704_10008932 3300025938 Bacteria 4816
589 Ga0207704_10080833 3300025938 Bacteria 2100
590 Ga0207704_10125902 3300025938 Bacteria 1764
591 Ga0207704_10471627 3300025938 Bacteria 1006
592 Ga0207665_10001758 3300025939 Bacteria 14547
593 Ga0207665_10045219 3300025939 Bacteria 2948
594 Ga0207665_10093758 3300025939 Bacteria 2085
595 Ga0207665_10176413 3300025939 Bacteria 1546
596 Ga0207691_10002815 3300025940 Bacteria 16961
597 Ga0207691_10024993 3300025940 Bacteria 5612
598 Ga0207691_10110030 3300025940 Bacteria 2451
599 Ga0207691_10160654 3300025940 Bacteria 1971
600 Ga0207711_10001570 3300025941 Bacteria 21117
601 Ga0207711_10008985 3300025941 Bacteria 8353
602 Ga0207711_10025784 3300025941 Bacteria 4929
603 Ga0207711_10331164 3300025941 Bacteria 1408
604 Ga0207711_10343123 3300025941 Bacteria 1382
605 Ga0207689_10003227 3300025942 Bacteria 14940
606 Ga0207689_10017396 3300025942 Bacteria 6084
607 Ga0207689_10027735 3300025942 Bacteria 4739
608 Ga0207689_10050098 3300025942 Bacteria 3444
609 Ga0207661_10000642 3300025944 Bacteria 22523
610 Ga0207661_10047017 3300025944 Bacteria 3424
611 Ga0207679_10000046 3300025945 Bacteria 119975
612 Ga0207679_10025487 3300025945 Bacteria 4068
613 Ga0207679_10528986 3300025945 Bacteria 1055
614 Ga0207667_10007962 3300025949 Bacteria 12641
615 Ga0207667_10440264 3300025949 Bacteria 1325
616 Ga0207667_10612435 3300025949 Bacteria 1097
617 Ga0207651_10000214 3300025960 Bacteria 24891
618 Ga0207651_10008018 3300025960 Bacteria 5667
619 Ga0207651_10531117 3300025960 Bacteria 1021
620 Ga0207712_10003297 3300025961 Bacteria 10236
621 Ga0207712_10019776 3300025961 Bacteria 4401
622 Ga0207712_10035776 3300025961 Bacteria 3377
623 Ga0207712_10199811 3300025961 Bacteria 1584
624 Ga0207712_10228959 3300025961 Bacteria 1491
625 Ga0207668_10000537 3300025972 Bacteria 23803
626 Ga0207668_10082537 3300025972 Bacteria 2335
627 Ga0207640_10002737 3300025981 Bacteria 9439
628 Ga0207640_10060902 3300025981 Bacteria 2497
629 Ga0207640_10107011 3300025981 Bacteria 1974
630 Ga0207658_10001147 3300025986 Bacteria 21223
631 Ga0207658_10018395 3300025986 Bacteria 4826
632 Ga0207658_10188011 3300025986 Bacteria 1714
633 Ga0207658_10228487 3300025986 Bacteria 1569
634 Ga0207658_10584427 3300025986 Bacteria 1002
635 Ga0207677_10015705 3300026023 Bacteria 4463
636 Ga0207677_10047121 3300026023 Bacteria 2892
637 Ga0207703_10000940 3300026035 Bacteria 28248
638 Ga0207703_10023508 3300026035 Bacteria 4842
639 Ga0207703_10243501 3300026035 Bacteria 1618
640 Ga0207703_10328878 3300026035 Bacteria 1401
641 Ga0207639_10000852 3300026041 Bacteria 20713
642 Ga0207639_10016375 3300026041 Bacteria 5244
643 Ga0207639_10188342 3300026041 Bacteria 1761
644 Ga0207678_10007136 3300026067 Bacteria 9914
645 Ga0207678_10015442 3300026067 Bacteria 6713
646 Ga0207678_10018849 3300026067 Bacteria 6061
647 Ga0207678_10032795 3300026067 Bacteria 4526
648 Ga0207678_10354333 3300026067 Bacteria 1266
649 Ga0207708_10001006 3300026075 Bacteria 21086
650 Ga0207708_10003324 3300026075 Bacteria 11837
651 Ga0207708_10027504 3300026075 Bacteria 4306
652 Ga0207708_10054858 3300026075 Bacteria 3039
653 Ga0207708_10240172 3300026075 Bacteria 1457
654 Ga0207702_10002642 3300026078 Bacteria 16821
655 Ga0207702_10463311 3300026078 Bacteria 1231
656 Ga0207702_10474442 3300026078 Bacteria 1217
657 Ga0207702_10539263 3300026078 Bacteria 1140
658 Ga0207702_10685683 3300026078 Bacteria 1009
659 Ga0207641_10001370 3300026088 Bacteria 24094
660 Ga0207641_10028161 3300026088 Bacteria 4641
661 Ga0207641_10714545 3300026088 Bacteria 987
662 Ga0207648_10002036 3300026089 Bacteria 22064
663 Ga0207648_10087764 3300026089 Bacteria 2715
664 Ga0207648_10157247 3300026089 Bacteria 2007
665 Ga0207676_10009322 3300026095 Bacteria 6984
666 Ga0207676_10010200 3300026095 Bacteria 6683
667 Ga0207676_10012380 3300026095 Bacteria 6111
668 Ga0207676_10046571 3300026095 Bacteria 3356
669 Ga0207674_10002956 3300026116 Bacteria 21106
670 Ga0207674_10091332 3300026116 Bacteria 3035
671 Ga0207674_10199991 3300026116 Bacteria 1948
672 Ga0207675_100006209 3300026118 Bacteria 11346
673 Ga0207675_100010512 3300026118 Bacteria 8673
674 Ga0207675_100059869 3300026118 Bacteria 3555
675 Ga0207675_100159664 3300026118 Bacteria 2150
676 Ga0207675_100178387 3300026118 Bacteria 2033
677 Ga0207683_10001099 3300026121 Bacteria 24626
678 Ga0207683_10004449 3300026121 Bacteria 12105
679 Ga0207683_10005034 3300026121 Bacteria 11346
680 Ga0207683_10032902 3300026121 Bacteria 4505
681 Ga0207683_10048304 3300026121 Bacteria 3726
682 Ga0207698_10007930 3300026142 Bacteria 6690
683 Ga0207698_10097681 3300026142 Bacteria 2424
684 Ga0207698_10143522 3300026142 Bacteria 2061
685 Ga0209995_1016685 3300027471 Bacteria 1207
686 Ga0210002_1014782 3300027617 Bacteria 1227
687 Ga0209983_1003857 3300027665 Bacteria 3176
688 Ga0209971_1045187 3300027682 Bacteria 1062
689 Ga0209966_1003556 3300027695 Bacteria 2625
690 Ga0209998_10001538 3300027717 Bacteria 5544
691 Ga0209998_10006389 3300027717 Bacteria 2447
692 Ga0209813_10103483 3300027866 Bacteria 972
693 Ga0209974_10012529 3300027876 Bacteria 2834
694 Ga0207428_10000082 3300027907 Bacteria 133684
695 Ga0207428_10001692 3300027907 Bacteria 22664
696 Ga0207428_10029661 3300027907 Bacteria 4530
697 Ga0207428_10054476 3300027907 Bacteria 3186
698 Ga0207428_10112059 3300027907 Bacteria 2099
699 Ga0207428_10175649 3300027907 Bacteria 1620
700 Ga0268266_10006793 3300028379 Bacteria 10427
701 Ga0268266_10092290 3300028379 Bacteria 2656
702 Ga0268266_10308494 3300028379 Bacteria 1478
703 Ga0268266_10536164 3300028379 Bacteria 1120
704 Ga0268265_10000817 3300028380 Bacteria 29538
705 Ga0268265_10025906 3300028380 Bacteria 4169
706 Ga0268265_10315147 3300028380 Bacteria 1414
707 Ga0268264_10001227 3300028381 Bacteria 24655
708 Ga0268264_10016466 3300028381 Bacteria 6053
709 Ga0268264_10053393 3300028381 Bacteria 3371
710 Ga0268264_10539477 3300028381 Bacteria 1143
711 Ga0268264_10896567 3300028381 Bacteria 890
712 Ga0265338_10074286 3300028800 Bacteria 2893
713 Ga0265330_10029267 3300031235 Bacteria 2478
714 Ga0265332_10002206 3300031238 Bacteria 9991
715 Ga0265332_10041593 3300031238 Bacteria 1988
716 Ga0265325_10000043 3300031241 Bacteria 89158
717 Ga0265325_10006484 3300031241 Bacteria 7095
718 Ga0265325_10047267 3300031241 Bacteria 2228
719 Ga0265325_10058826 3300031241 Bacteria 1956
720 Ga0265340_10001844 3300031247 Bacteria 12103
721 Ga0265340_10042254 3300031247 Bacteria 2238
722 Ga0265340_10081766 3300031247 Bacteria 1520
723 Ga0265339_10000071 3300031249 Bacteria 88416
724 Ga0265339_10004871 3300031249 Bacteria 9058
725 Ga0265339_10130160 3300031249 Bacteria 1288
726 Ga0265331_10093489 3300031250 Bacteria 1389
727 Ga0265316_10093930 3300031344 Bacteria 2285
728 Ga0265316_10210451 3300031344 Bacteria 1438
729 Ga0265313_10000087 3300031595 Bacteria 91132
730 Ga0265313_10000415 3300031595 Bacteria 45805
731 Ga0265313_10012080 3300031595 Bacteria 5317
732 Ga0316579_10041829 3300031691 Bacteria 2127
733 Ga0265314_10003840 3300031711 Bacteria 14341
734 Ga0265342_10001555 3300031712 Bacteria 21212
735 Ga0265342_10083995 3300031712 Bacteria 1834
736 Ga0265342_10256916 3300031712 Bacteria 931
737 Ga0316583_10002720 3300032133 Bacteria 6181
738 Ga0373930_0001507 3300034816 Bacteria 3483
739 Ga0373948_0000117 3300034817 Bacteria 8265
740 Ga0373948_0003110 3300034817 Bacteria 2522
741 Ga0373948_0043525 3300034817 Bacteria 946
742 Ga0373950_0000396 3300034818 Bacteria 5346
743 Ga0373950_0008305 3300034818 Bacteria 1631
744 Ga0373958_0010662 3300034819 Bacteria 1537
745 Ga0373938_0005774 3300034957 Bacteria 2115
746 Ga0373938_0014640 3300034957 Bacteria 1508
747 Ga0373938_0050141 3300034957 Bacteria 952
748 Ga0373926_0006274 3300035083 Bacteria 3946
749 Ga0373926_0036369 3300035083 Bacteria 1749
750 Ga0373926_0068555 3300035083 Bacteria 1300
751 Ga0373928_0006026 3300035084 Bacteria 2323
752 Ga0373929_0000961 3300035085 Bacteria 5594
753 Ga0373934_0009209 3300035086 Bacteria 3696
754 Ga0373934_0074324 3300035086 Bacteria 1362
755 Ga0373940_0001118 3300035088 Bacteria 4677
756 Ga0373940_0041710 3300035088 Bacteria 1262
757 Ga0373944_0003334 3300035089 Bacteria 4138
758 Ga0373944_0007277 3300035089 Bacteria 2961
759 Ga0373944_0009507 3300035089 Bacteria 2637
760 Ga0373949_0004216 3300035090 Bacteria 3319
761 Ga0373949_0005436 3300035090 Bacteria 2841
762 Ga0373951_0013415 3300035091 Bacteria 1842
763 Ga0373952_0002861 3300035092 Bacteria 3119
764 Ga0373923_0007076 3300035111 Bacteria 3924
765 Ga0373923_0164423 3300035111 Bacteria 1014
766 Ga0373932_0000255 3300035112 Bacteria 16212
767 Ga0373932_0000703 3300035112 Bacteria 10116
768 Ga0373932_0007745 3300035112 Bacteria 2563
769 Ga0373936_0005552 3300035113 Bacteria 4761
770 Ga0373936_0045306 3300035113 Bacteria 1771
771 Ga0373936_0079399 3300035113 Bacteria 1364
772 Ga0373939_0002267 3300035114 Bacteria 4551
773 Ga0373939_0021302 3300035114 Bacteria 1772
774 Ga0373941_0004229 3300035115 Bacteria 3300
775 Ga0373945_0026010 3300035116 Bacteria 2036
776 Ga0373953_0001186 3300035117 Bacteria 7410
777 Ga0373953_0017303 3300035117 Bacteria 2648
778 Ga0373953_0125982 3300035117 Bacteria 1090
779 Ga0373956_0013246 3300035119 Bacteria 3430
780 Ga0373956_0027556 3300035119 Bacteria 2468
781 Ga0373956_0046875 3300035119 Bacteria 1932
782 Ga0373957_0057040 3300035120 Bacteria 1505
783 Ga0373960_0005847 3300035121 Bacteria 2862
784 Ga0373960_0007815 3300035121 Bacteria 2543
785 Ga0373960_0026800 3300035121 Bacteria 1577
786 Ga0373943_0008559 3300035170 Bacteria 4586
787 Ga0373943_0021286 3300035170 Bacteria 2993
788 Ga0373943_0051473 3300035170 Bacteria 2027
789 Ga0373946_0076193 3300035171 Bacteria 1459
790 Ga0373955_0008111 3300035172 Bacteria 4859
791 Ga0373942_0012638 3300035207 Bacteria 2021
792 Ga0373942_0053398 3300035207 Bacteria 1139
793 Ga0373961_0003260 3300035241 Bacteria 4042
794 Ga0373961_0003856 3300035241 Bacteria 3659
795 Ga0373961_0025734 3300035241 Bacteria 1602
796 Ga0373961_0059420 3300035241 Bacteria 1156
797 Ga0373962_0019976 3300035242 Bacteria 1756
798 Ga0373962_0035508 3300035242 Bacteria 1384
799 Ga0373924_0032147 3300035410 Bacteria 2113
800 Ga0373924_0234516 3300035410 Bacteria 811
801 Ga0373931_0007315 3300035691 Bacteria 5195
802 Ga0373931_0023751 3300035691 Bacteria 3097
803 Ga0373931_0056043 3300035691 Bacteria 2111
804 Ga0373935_0006957 3300035692 Bacteria 6753
805 Ga0373935_0131752 3300035692 Bacteria 1680
806 Ga0373935_0411473 3300035692 Bacteria 972
807 Ga0373927_0036539 3300035695 Bacteria 3194
808 Ga0373927_0048608 3300035695 Bacteria 2744
809 Ga0373927_0077672 3300035695 Bacteria 2150
810 Ga0373933_0001224 3300035724 Bacteria 15196
811 Ga0373933_0013762 3300035724 Bacteria 4488
812 Ga0373933_0024904 3300035724 Bacteria 3429
813 Ga0373933_0049313 3300035724 Bacteria 2510
814 Ga0373947_0032762 3300035725 Bacteria 3064
815 Ga0373947_0083977 3300035725 Bacteria 1975
816 Ga0373937_0000849 3300036401 Bacteria 26229
817 Ga0373937_0016602 3300036401 Bacteria 6541
818 Ga0373937_0034021 3300036401 Bacteria 4633
819 Ga0373937_0047581 3300036401 Bacteria 3924
820 Ga0373937_0138833 3300036401 Bacteria 2273
821 Ga0316582_0054719 3300036647 Bacteria 2542
822 Ga0373925_0023317 3300037068 Bacteria 4516
823 Ga0373925_0033508 3300037068 Bacteria 3785
824 Ga0373925_0042182 3300037068 Bacteria 3384
825 Ga0395900_0184789 3300037418 Bacteria 2116
826 Ga0395901_0098532 3300038443 Bacteria 3065
827 Ga0436365_1174025 3300039437 Bacteria 6936
828 Ga0436365_1295969 3300039437 Bacteria 2534
829 Ga0436360_0816965 3300039438 Bacteria 1154
830 Ga0436361_0189718 3300039447 Bacteria 5293
831 Ga0436363_0315669 3300039450 Bacteria 1810
832 Ga0436363_0817259 3300039450 Bacteria 905
833 Ga0436362_0096256 3300039453 Bacteria 5488
834 Ga0439453_0018755 3300041408 Bacteria 1226
835 Ga0451789_0709386 3300041443 Bacteria 1038
836 Ga0451841_1135030 3300041498 Bacteria 1156
837 Ga0439450_003393 3300042008 Bacteria 2630
838 Ga0439435_0002597 3300042436 Bacteria 3617
839 Ga0439460_0058776 3300042461 Bacteria 1169
840 Ga0451577_0052576 3300042876 Bacteria 3637
841 Ga0439440_0077929 3300042993 Bacteria 872
842 Ga0466963_0015149 3300044694 Bacteria 4769
843 Ga0466957_0225226 3300044842 Bacteria 1239
844 Ga0466959_0313519 3300045049 Bacteria 1073
845 Ga0451576_0040952 3300045051 Bacteria 4898
846 Ga0466958_0008358 3300045836 Bacteria 5737
847 Ga0466958_0079220 3300045836 Bacteria 2020
848 Ga0495617_013564 3300046452 Bacteria 2774
849 Ga0495592_0031170 3300046454 Bacteria 4030
850 Ga0495592_0114759 3300046454 Bacteria 1902
851 Ga0495592_0124090 3300046454 Bacteria 1813
852 Ga0495592_0330381 3300046454 Bacteria 983
853 Ga0495603_0033576 3300046455 Bacteria 3087
854 Ga0495590_0065920 3300046457 Bacteria 1268
855 Ga0495629_0000062 3300046459 Bacteria 97169
856 Ga0495638_0121599 3300046460 Bacteria 1542
857 Ga0495641_0042022 3300046461 Bacteria 2121
858 Ga0495641_0072448 3300046461 Bacteria 1545
859 Ga0495651_0020865 3300046462 Bacteria 5085
860 Ga0495651_0022743 3300046462 Bacteria 4873
861 Ga0495651_0150412 3300046462 Bacteria 1679
862 Ga0495653_0048987 3300046463 Bacteria 3258
863 Ga0495653_0117336 3300046463 Bacteria 1902
864 Ga0495580_0092029 3300046472 Bacteria 2110
865 Ga0495582_0017090 3300046473 Bacteria 3971
866 Ga0495582_0232168 3300046473 Bacteria 1056
867 Ga0495639_0008961 3300046475 Bacteria 4288
868 Ga0495639_0035781 3300046475 Bacteria 2222
869 Ga0495662_0006739 3300046476 Bacteria 5719
870 Ga0495662_0022613 3300046476 Bacteria 3035
871 Ga0495664_0020123 3300046477 Bacteria 3845
872 Ga0495664_0078940 3300046477 Bacteria 1972
873 Ga0495664_0170208 3300046477 Bacteria 1321
874 Ga0495584_0021105 3300046491 Bacteria 3307
875 Ga0495584_0133249 3300046491 Bacteria 1261
876 Ga0495585_0002429 3300046492 Bacteria 13343
877 Ga0495585_0057057 3300046492 Bacteria 2156
878 Ga0495594_0028654 3300046499 Bacteria 3006
879 Ga0495594_0174336 3300046499 Bacteria 1223
880 Ga0495596_0068793 3300046500 Bacteria 1376
881 Ga0495608_0001948 3300046511 Bacteria 14809
882 Ga0495608_0055984 3300046511 Bacteria 2605
883 Ga0495608_0197846 3300046511 Bacteria 1267
884 Ga0495618_0025063 3300046514 Bacteria 3700
885 Ga0495618_0050959 3300046514 Bacteria 2615
886 Ga0495628_0009783 3300046516 Bacteria 8169
887 Ga0495628_0012772 3300046516 Bacteria 7070
888 Ga0495628_0071647 3300046516 Bacteria 2701
889 Ga0495630_0111010 3300046517 Bacteria 2077
890 Ga0495630_0501288 3300046517 Bacteria 931
891 Ga0495631_0176986 3300046518 Bacteria 914
892 Ga0495637_0083539 3300046520 Bacteria 1270
893 Ga0495644_0004855 3300046523 Bacteria 5279
894 Ga0495666_0030778 3300046526 Bacteria 2632
895 Ga0495652_0023129 3300046529 Bacteria 5510
896 Ga0495652_0093555 3300046529 Bacteria 2454
897 Ga0495652_0200517 3300046529 Bacteria 1515
898 Ga0495652_0352197 3300046529 Bacteria 1054
899 Ga0495665_0034160 3300046531 Bacteria 2719
900 Ga0495665_0140281 3300046531 Bacteria 1263
901 Ga0495640_0103700 3300046533 Bacteria 1864
902 Ga0495640_0105939 3300046533 Bacteria 1841
903 Ga0495640_0136159 3300046533 Bacteria 1586
904 Ga0495640_0140984 3300046533 Bacteria 1554
905 Ga0495586_0053241 3300046535 Bacteria 2192
906 Ga0495587_0030802 3300046536 Bacteria 3252
907 Ga0495609_0034143 3300046538 Bacteria 2307
908 Ga0495609_0143510 3300046538 Bacteria 1018
909 Ga0495621_0015610 3300046539 Bacteria 2425
910 Ga0495645_0020277 3300046543 Bacteria 4793
911 Ga0495622_0015379 3300046557 Bacteria 3557
912 Ga0495633_0103793 3300046558 Bacteria 1319
913 Ga0495667_0001067 3300046559 Bacteria 17817
914 Ga0495667_0013909 3300046559 Bacteria 5434
915 Ga0495667_0117677 3300046559 Bacteria 1716
916 Ga0495667_0337744 3300046559 Bacteria 952
917 Ga0495656_0002593 3300046615 Bacteria 6029
918 Ga0495656_0049233 3300046615 Bacteria 1794
919 Ga0495668_0079881 3300046616 Bacteria 1795
920 Ga0495611_0020648 3300046648 Bacteria 2837
921 Ga0495635_0019587 3300046663 Bacteria 4715
922 Ga0495635_0065327 3300046663 Bacteria 2496
923 Ga0495635_0090619 3300046663 Bacteria 2091
924 Ga0495635_0107543 3300046663 Bacteria 1905
925 Ga0495659_0006541 3300046664 Bacteria 3680
926 Ga0495661_0039661 3300046665 Bacteria 2925
927 Ga0495588_0019088 3300046674 Bacteria 3354
928 Ga0495588_0039698 3300046674 Bacteria 2399
929 Ga0495657_0016143 3300046675 Bacteria 5445
930 Ga0495657_0033154 3300046675 Bacteria 3598
931 Ga0495657_0033991 3300046675 Bacteria 3545
932 Ga0495657_0339765 3300046675 Bacteria 890
933 Ga0495599_0002423 3300046678 Bacteria 10863
934 Ga0495599_0002462 3300046678 Bacteria 10788
935 Ga0495599_0027197 3300046678 Bacteria 3585
936 Ga0495623_0003667 3300046679 Bacteria 10141
937 Ga0495623_0039933 3300046679 Bacteria 2997
938 Ga0495646_0001912 3300046680 Bacteria 12528
939 Ga0495646_0024134 3300046680 Bacteria 3829
940 Ga0495647_0160541 3300046681 Bacteria 968
941 Ga0495658_0015226 3300046683 Bacteria 3943
942 Ga0495658_0058438 3300046683 Bacteria 2206
943 Ga0495658_0078615 3300046683 Bacteria 1931
944 Ga0495669_0173001 3300046684 Bacteria 1028
945 Ga0495613_0030125 3300046689 Bacteria 4031
946 Ga0495613_0081327 3300046689 Bacteria 2353
947 Ga0495624_0066588 3300046690 Bacteria 2248
948 Ga0495624_0231751 3300046690 Bacteria 1118
949 Ga0495670_0001352 3300046691 Bacteria 11967
950 Ga0495670_0162092 3300046691 Bacteria 1175
951 Ga0495600_0005044 3300046809 Bacteria 7932
952 Ga0495600_0030328 3300046809 Bacteria 3503
953 Ga0495600_0031854 3300046809 Bacteria 3418
954 Ga0495581_0013989 3300047315 Bacteria 4654
955 Ga0495581_0062351 3300047315 Bacteria 2154
956 Ga0495604_0004097 3300047317 Bacteria 11579
957 Ga0495604_0009091 3300047317 Bacteria 7862
958 Ga0495604_0013822 3300047317 Bacteria 6438
959 Ga0495604_0028326 3300047317 Bacteria 4456
960 Ga0495674_0026001 3300047319 Bacteria 5357
961 Ga0495674_0084024 3300047319 Bacteria 2729
962 Ga0495674_0120293 3300047319 Bacteria 2219
963 Ga0495676_0132214 3300047321 Bacteria 1799
964 Ga0495680_0014800 3300047322 Bacteria 6745
965 Ga0495680_0055329 3300047322 Bacteria 3078
966 Ga0495680_0180576 3300047322 Bacteria 1523
967 Ga0495680_0408230 3300047322 Bacteria 936
968 Ga0495675_0001338 3300047444 Bacteria 14916
969 Ga0495675_0035048 3300047444 Bacteria 3206
970 Ga0495675_0058231 3300047444 Bacteria 2450
971 Ga0495681_0133276 3300047470 Bacteria 1056
972 Ga0495684_0034589 3300047471 Bacteria 3876
973 Ga0495593_0018657 3300047673 Bacteria 3896
974 Ga0495593_0066459 3300047673 Bacteria 1879
975 Ga0495593_0074108 3300047673 Bacteria 1765
976 Ga0495602_0002392 3300048088 Bacteria 19051
977 Ga0495602_0040040 3300048088 Bacteria 4306
978 Ga0495614_0016010 3300048089 Bacteria 3265
979 Ga0495626_0053820 3300048091 Bacteria 1851
980 Ga0496100_0002059 3300048903 Bacteria 10095
981 Ga0496100_0081168 3300048903 Bacteria 2190
982 Ga0496100_0191509 3300048903 Bacteria 1485
983 Ga0496100_0235230 3300048903 Bacteria 1349
984 Ga0496101_0001022 3300048904 Bacteria 16502
985 Ga0496101_0001738 3300048904 Bacteria 13045
986 Ga0496101_0008336 3300048904 Bacteria 6771
987 Ga0496101_0049036 3300048904 Bacteria 3036
988 Ga0496101_0059913 3300048904 Bacteria 2760
989 Ga0496101_0411135 3300048904 Bacteria 1066
990 Ga0496102_0001427 3300048905 Bacteria 21201
991 Ga0496102_0009899 3300048905 Bacteria 8196
992 Ga0496102_0010246 3300048905 Bacteria 8059
993 Ga0496102_0103422 3300048905 Bacteria 2649
994 Ga0496102_0322617 3300048905 Bacteria 1455
995 Ga0496103_0004101 3300048906 Bacteria 8854
996 Ga0496103_0025906 3300048906 Bacteria 3547
997 Ga0496103_0028858 3300048906 Bacteria 3369
998 Ga0496103_0052832 3300048906 Bacteria 2517
999 Ga0496104_0000528 3300048907 Bacteria 32836
1000 Ga0496104_0001202 3300048907 Bacteria 22309
1001 Ga0496104_0009710 3300048907 Bacteria 8577
1002 Ga0496104_0019198 3300048907 Bacteria 6250
1003 Ga0496104_0050759 3300048907 Bacteria 3914
1004 Ga0496104_0053102 3300048907 Bacteria 3828
1005 Ga0496104_0068688 3300048907 Bacteria 3367
1006 Ga0496104_0150963 3300048907 Bacteria 2230
1007 Ga0496104_0695566 3300048907 Bacteria 924
1008 Ga0496105_0001587 3300048908 Bacteria 16099
1009 Ga0496105_0012029 3300048908 Bacteria 6851
1010 Ga0496105_0018797 3300048908 Bacteria 5564
1011 Ga0496105_0043589 3300048908 Bacteria 3700
1012 Ga0496105_0101523 3300048908 Bacteria 2375
1013 Ga0496105_0231257 3300048908 Bacteria 1502
1014 Ga0496106_0000644 3300048909 Bacteria 24997
1015 Ga0496106_0010684 3300048909 Bacteria 6785
1016 Ga0496106_0019556 3300048909 Bacteria 5024
1017 Ga0496106_0032399 3300048909 Bacteria 3896
1018 Ga0496106_0061507 3300048909 Bacteria 2849
1019 Ga0496106_0079835 3300048909 Bacteria 2512
1020 Ga0496106_0090672 3300048909 Bacteria 2359
1021 Ga0496106_0171288 3300048909 Bacteria 1721
1022 Ga0496106_0187467 3300048909 Bacteria 1643
1023 Ga0496106_0285497 3300048909 Bacteria 1322
1024 Ga0496107_0013215 3300048910 Bacteria 5768
1025 Ga0496107_0021482 3300048910 Bacteria 4561
1026 Ga0496107_0024486 3300048910 Bacteria 4270
1027 Ga0496107_0034610 3300048910 Bacteria 3618
1028 Ga0496107_0096950 3300048910 Bacteria 2158
1029 Ga0496107_0109961 3300048910 Bacteria 2025
1030 Ga0496107_0129718 3300048910 Bacteria 1861
1031 Ga0496108_0002310 3300048911 Bacteria 15266
1032 Ga0496108_0019323 3300048911 Bacteria 5594
1033 Ga0496108_0026579 3300048911 Bacteria 4774
1034 Ga0496108_0058607 3300048911 Bacteria 3237
1035 Ga0496108_0084028 3300048911 Bacteria 2701
1036 Ga0496108_0246053 3300048911 Bacteria 1555
1037 Ga0496108_0343744 3300048911 Bacteria 1302
1038 Ga0496108_0377511 3300048911 Bacteria 1238
1039 Ga0496109_0000644 3300048912 Bacteria 28962
1040 Ga0496109_0010936 3300048912 Bacteria 7775
1041 Ga0496109_0012832 3300048912 Bacteria 7242
1042 Ga0496109_0026513 3300048912 Bacteria 5168
1043 Ga0496109_0291611 3300048912 Bacteria 1538
1044 Ga0496109_0375200 3300048912 Bacteria 1343
1045 Ga0496110_0019757 3300048913 Bacteria 5676
1046 Ga0496110_0096572 3300048913 Bacteria 2648
1047 Ga0496110_0180951 3300048913 Bacteria 1914
1048 Ga0496110_0524359 3300048913 Bacteria 1077
1049 Ga0496111_0014335 3300048914 Bacteria 5413
1050 Ga0496111_0030481 3300048914 Bacteria 3835
1051 Ga0496111_0108616 3300048914 Bacteria 2042
1052 Ga0496111_0115205 3300048914 Bacteria 1981
1053 Ga0496112_0001548 3300048915 Bacteria 17768
1054 Ga0496112_0036518 3300048915 Bacteria 4793
1055 Ga0496112_0198972 3300048915 Bacteria 1964
1056 Ga0496112_0201926 3300048915 Bacteria 1947
1057 Ga0496112_0238505 3300048915 Bacteria 1771
1058 Ga0496112_0264067 3300048915 Bacteria 1670
1059 Ga0496112_0358767 3300048915 Bacteria 1400
1060 Ga0496112_0376951 3300048915 Bacteria 1360
1061 Ga0496113_0001777 3300048916 Bacteria 12233
1062 Ga0496113_0009092 3300048916 Bacteria 6509
1063 Ga0496113_0066487 3300048916 Bacteria 2731
1064 Ga0496113_0068360 3300048916 Bacteria 2695
1065 Ga0496113_0088624 3300048916 Bacteria 2380
1066 Ga0496113_0099606 3300048916 Bacteria 2251
1067 Ga0496113_0102944 3300048916 Bacteria 2214
1068 Ga0496114_0025740 3300048917 Bacteria 4811
1069 Ga0496114_0029429 3300048917 Bacteria 4514
1070 Ga0496114_0035315 3300048917 Bacteria 4127
1071 Ga0496114_0041072 3300048917 Bacteria 3833
1072 Ga0496114_0056359 3300048917 Bacteria 3279
1073 Ga0496115_0013652 3300048918 Bacteria 6147
1074 Ga0496115_0033804 3300048918 Bacteria 4039
1075 Ga0496115_0124905 3300048918 Bacteria 2119
1076 Ga0496115_0472621 3300048918 Bacteria 1010
1077 Ga0496115_0487196 3300048918 Bacteria 992
1078 Ga0501031_0020371 3300049568 Bacteria 4323
1079 Ga0501032_0015452 3300049569 Bacteria 5384
1080 Ga0501032_0109728 3300049569 Bacteria 1826
1081 Ga0501032_0158989 3300049569 Bacteria 1484
1082 Ga0501032_0296011 3300049569 Bacteria 1046
1083 Ga0501032_0438946 3300049569 Bacteria 837
1084 Ga0501033_0062788 3300049570 Bacteria 2735
1085 Ga0501033_0099714 3300049570 Bacteria 2120
1086 Ga0501033_0144981 3300049570 Bacteria 1715
1087 Ga0501034_0000673 3300049571 Bacteria 51868
1088 Ga0501034_0000933 3300049571 Bacteria 42599
1089 Ga0501034_0049224 3300049571 Bacteria 4253
1090 Ga0501034_0141364 3300049571 Bacteria 2386
1091 Ga0501034_0149522 3300049571 Bacteria 2311
1092 Ga0501034_0213866 3300049571 Bacteria 1882
1093 Ga0501034_0306070 3300049571 Bacteria 1525
1094 Ga0501034_0328591 3300049571 Bacteria 1461
1095 Ga0501034_0564418 3300049571 Bacteria 1046
1096 Ga0501034_0648632 3300049571 Bacteria 957
1097 Ga0501036_0000242 3300049572 Bacteria 36845
1098 Ga0501036_0029281 3300049572 Bacteria 4654
1099 Ga0501036_0533322 3300049572 Bacteria 976
1100 Ga0501036_0626245 3300049572 Bacteria 891
1101 Ga0501037_0045754 3300049573 Bacteria 3211
1102 Ga0501037_0195792 3300049573 Bacteria 1429
1103 Ga0501038_0020142 3300049574 Bacteria 6002
1104 Ga0501038_0060730 3300049574 Bacteria 3234
1105 Ga0501038_0082622 3300049574 Bacteria 2705
1106 Ga0501038_0517881 3300049574 Bacteria 910
1107 Ga0501039_0011358 3300049575 Bacteria 6782
1108 Ga0501039_0041604 3300049575 Bacteria 3550
1109 Ga0501039_0077787 3300049575 Bacteria 2580
1110 Ga0501039_0115865 3300049575 Bacteria 2097
1111 Ga0501039_0185820 3300049575 Bacteria 1634
1112 Ga0501042_0033741 3300049578 Bacteria 3629
1113 Ga0501042_0318627 3300049578 Bacteria 1123
1114 Ga0501043_0020786 3300049579 Bacteria 5148
1115 Ga0501043_0039482 3300049579 Bacteria 3709
1116 Ga0501043_0059304 3300049579 Bacteria 3003
1117 Ga0501043_0061077 3300049579 Bacteria 2960
1118 Ga0501043_0409708 3300049579 Bacteria 1023
1119 Ga0501043_0434837 3300049579 Bacteria 988
1120 Ga0501046_0051469 3300049580 Bacteria 3249
1121 Ga0501046_0256706 3300049580 Bacteria 1285
1122 Ga0501046_0317360 3300049580 Bacteria 1136
1123 Ga0501047_0000073 3300049581 Bacteria 125990
1124 Ga0501047_0008654 3300049581 Bacteria 9614
1125 Ga0501047_0009026 3300049581 Bacteria 9414
1126 Ga0501047_0022462 3300049581 Bacteria 6059
1127 Ga0501047_0137238 3300049581 Bacteria 2325
1128 Ga0501047_0159148 3300049581 Bacteria 2130
1129 Ga0501047_0238321 3300049581 Bacteria 1670
1130 Ga0501047_0253659 3300049581 Bacteria 1607
1131 Ga0501047_0547731 3300049581 Bacteria 981
1132 Ga0501048_0000014 3300049582 Bacteria 75001
1133 Ga0501048_0040161 3300049582 Bacteria 3353
1134 Ga0501048_0161666 3300049582 Bacteria 1585
1135 Ga0501067_0020704 3300049583 Bacteria 3639
1136 Ga0501068_0029404 3300049584 Bacteria 3253
1137 Ga0501068_0064873 3300049584 Bacteria 2222
1138 Ga0501069_0015321 3300049585 Bacteria 4108
1139 Ga0501069_0090149 3300049585 Bacteria 1733
1140 Ga0501070_0007266 3300049586 Bacteria 9403
1141 Ga0501070_0008335 3300049586 Bacteria 8757
1142 Ga0501070_0010033 3300049586 Bacteria 8011
1143 Ga0501070_0054012 3300049586 Bacteria 3331
1144 Ga0501070_0054487 3300049586 Bacteria 3316
1145 Ga0501070_0065404 3300049586 Bacteria 3010
1146 Ga0501070_0076867 3300049586 Bacteria 2763
1147 Ga0501070_0080098 3300049586 Bacteria 2702
1148 Ga0501070_0080241 3300049586 Bacteria 2699
1149 Ga0501070_0395903 3300049586 Bacteria 1118
1150 Ga0501070_0576837 3300049586 Bacteria 898
1151 Ga0501071_0031037 3300049587 Bacteria 3784
1152 Ga0501071_0397558 3300049587 Bacteria 1052
1153 Ga0501071_0586898 3300049587 Bacteria 856
1154 Ga0501072_0006127 3300049588 Bacteria 9173
1155 Ga0501072_0030800 3300049588 Bacteria 4197
1156 Ga0501072_0128291 3300049588 Bacteria 2021
1157 Ga0501072_0432583 3300049588 Bacteria 1043
1158 Ga0501072_0578020 3300049588 Bacteria 886
1159 Ga0501073_0021369 3300049589 Bacteria 4665
1160 Ga0501073_0087946 3300049589 Bacteria 2160
1161 Ga0501073_0130841 3300049589 Bacteria 1739
1162 Ga0501074_0027570 3300049590 Bacteria 4118
1163 Ga0501074_0028405 3300049590 Bacteria 4054
1164 Ga0501074_0029008 3300049590 Bacteria 4008
1165 Ga0501074_0057083 3300049590 Bacteria 2812
1166 Ga0501074_0142212 3300049590 Bacteria 1716
1167 Ga0501075_0050477 3300049591 Bacteria 3127
1168 Ga0501075_0079925 3300049591 Bacteria 2475
1169 Ga0501077_0023267 3300049593 Bacteria 3928
1170 Ga0501077_0171763 3300049593 Bacteria 1377
1171 Ga0501079_0049238 3300049741 Bacteria 3252
1172 Ga0501079_0229645 3300049741 Bacteria 1450
1173 Ga0501079_0338954 3300049741 Bacteria 1178
1174 Ga0501080_0000187 3300049742 Bacteria 45224
1175 Ga0501080_0012377 3300049742 Bacteria 7820
1176 Ga0501080_0019883 3300049742 Bacteria 6218
1177 Ga0501080_0122736 3300049742 Bacteria 2406
1178 Ga0501080_0135524 3300049742 Bacteria 2279
1179 Ga0501080_0195503 3300049742 Bacteria 1858
1180 Ga0501083_0000398 3300049744 Bacteria 27675
1181 Ga0501083_0020659 3300049744 Bacteria 4578
1182 Ga0501083_0030907 3300049744 Bacteria 3676
1183 Ga0501083_0116762 3300049744 Bacteria 1751
1184 Ga0501083_0119904 3300049744 Bacteria 1726
1185 Ga0501035_0000621 3300049822 Bacteria 39045
1186 Ga0501035_0112073 3300049822 Bacteria 2390
1187 Ga0501035_0129023 3300049822 Bacteria 2205
1188 Ga0501035_0195703 3300049822 Bacteria 1736
1189 Ga0501035_0593388 3300049822 Bacteria 903
1190 Ga0501044_0021597 3300049823 Bacteria 6864
1191 Ga0501044_0061157 3300049823 Bacteria 3853
1192 Ga0501044_0063316 3300049823 Bacteria 3779
1193 Ga0501044_0091612 3300049823 Bacteria 3066
1194 Ga0501044_0159451 3300049823 Bacteria 2234
1195 Ga0501044_0408868 3300049823 Bacteria 1268
1196 Ga0501044_0413560 3300049823 Bacteria 1259
1197 Ga0501044_0422212 3300049823 Bacteria 1243
1198 Ga0501044_0642863 3300049823 Bacteria 950
1199 Ga0501045_0093236 3300049824 Bacteria 2227
1200 nmdc:mga03n38_151130_c1 3300050490 Bacteria 1168
1201 nmdc:mga03n38_166197_c1 3300050490 Bacteria 1120
1202 nmdc:mga03n38_29520_c1 3300050490 Bacteria 2296
1203 nmdc:mga00v17_271812_c1 3300050491 Bacteria 1100
1204 nmdc:mga00v17_455043_c1 3300050491 Bacteria 831
1205 nmdc:mga0yw44_35055_c1 3300050492 Bacteria 2946
1206 nmdc:mga0yw44_426623_c1 3300050492 Bacteria 898
1207 nmdc:mga0k408_207655_c1 3300050493 Bacteria 1169
1208 nmdc:mga06z11_24085_c1 3300050494 Bacteria 2868
1209 nmdc:mga07m45_9776_c1 3300050496 Bacteria 4990
1210 nmdc:mga05p37_146_c1 3300050507 Bacteria 27217
1211 nmdc:mga05p37_19_c3 3300050507 Bacteria 27587
1212 nmdc:mga05p37_330381_c1 3300050507 Bacteria 1801
1213 nmdc:mga05p37_34032_c1 3300050507 Bacteria 6241
1214 nmdc:mga05p37_410288_c1 3300050507 Bacteria 1579
1215 nmdc:mga05p37_57300_c1 3300050507 Bacteria 4799
1216 nmdc:mga05p37_80216_c1 3300050507 Bacteria 4020
1217 nmdc:mga05p37_965436_c1 3300050507 Bacteria 910
1218 nmdc:mga09592_124551_c1 3300050508 Bacteria 2215
1219 nmdc:mga09592_180873_c1 3300050508 Bacteria 1824
1220 nmdc:mga09592_758_c1 3300050508 Bacteria 24836
1221 nmdc:mga0qj67_1526_c1 3300050509 Bacteria 16241
1222 nmdc:mga0qj67_1779_c1 3300050509 Bacteria 15251
1223 nmdc:mga0qj67_219847_c1 3300050509 Bacteria 1542
1224 nmdc:mga0qj67_25401_c1 3300050509 Bacteria 4576
1225 nmdc:mga06r32_168966_c1 3300050510 Bacteria 2170
1226 nmdc:mga06r32_212768_c1 3300050510 Bacteria 1921
1227 nmdc:mga06r32_27869_c1 3300050510 Bacteria 5282
1228 nmdc:mga06r32_347_c1 3300050510 Bacteria 38541
1229 nmdc:mga06r32_4145_c1 3300050510 Bacteria 12980
1230 nmdc:mga06r32_446218_c1 3300050510 Bacteria 1273
1231 nmdc:mga06r32_663117_c1 3300050510 Bacteria 1011
1232 nmdc:mga06r32_67440_c1 3300050510 Bacteria 3454
1233 nmdc:mga08y16_18763_c1 3300050511 Bacteria 7287
1234 nmdc:mga08y16_238686_c1 3300050511 Bacteria 1879
1235 nmdc:mga08y16_248059_c1 3300050511 Bacteria 1840
1236 nmdc:mga08y16_253307_c1 3300050511 Bacteria 1819
1237 nmdc:mga08y16_268952_c1 3300050511 Bacteria 1760
1238 nmdc:mga08y16_328_c1 3300050511 Bacteria 33166
1239 nmdc:mga08y16_46719_c1 3300050511 Bacteria 4533
1240 nmdc:mga08y16_513855_c1 3300050511 Bacteria 1216
1241 nmdc:mga0n895_1021766_c1 3300050512 Bacteria 807
1242 nmdc:mga0n895_114593_c1 3300050512 Bacteria 2714
1243 nmdc:mga0n895_11616_c1 3300050512 Bacteria 7865
1244 nmdc:mga0n895_1573_c1 3300050512 Bacteria 17177
1245 nmdc:mga0n895_1698_c1 3300050512 Bacteria 16639
1246 nmdc:mga0n895_21673_c1 3300050512 Bacteria 6014
1247 nmdc:mga0n895_375865_c1 3300050512 Bacteria 1438
1248 nmdc:mga0n895_4270_c1 3300050512 Bacteria 11692
1249 nmdc:mga0rr50_32274_c1 3300050513 Bacteria 3730
1250 nmdc:mga0rr50_351658_c1 3300050513 Bacteria 1239
1251 nmdc:mga0rr50_390_c1 3300050513 Bacteria 23898
1252 nmdc:mga08x19_191526_c1 3300050514 Bacteria 1399
1253 nmdc:mga08x19_42973_c1 3300050514 Bacteria 2882
1254 nmdc:mga08x19_85416_c1 3300050514 Bacteria 2077
1255 nmdc:mga0a205_20171_c1 3300050515 Bacteria 6287
1256 nmdc:mga0a205_251229_c1 3300050515 Bacteria 1648
1257 nmdc:mga0a205_343307_c1 3300050515 Bacteria 1361
1258 nmdc:mga0a205_399671_c1 3300050515 Bacteria 1238
1259 nmdc:mga0a205_681_c1 3300050515 Bacteria 27171
1260 nmdc:mga0a205_79345_c1 3300050515 Bacteria 3172
1261 Ga0495601_0000680 3300053077 Bacteria 18168
1262 Ga0495601_0003107 3300053077 Bacteria 9484
1263 Ga0495601_0068588 3300053077 Bacteria 2260
1264 Ga0495601_0116155 3300053077 Bacteria 1735
1265 Ga0495612_0004246 3300053078 Bacteria 5948
1266 Ga0495612_0040633 3300053078 Bacteria 1895
1267 Ga0495612_0044087 3300053078 Bacteria 1824
1268 Ga0495595_0000365 3300053084 Bacteria 17161
1269 Ga0495595_0003679 3300053084 Bacteria 6096
1270 Ga0495595_0023228 3300053084 Bacteria 2728
1271 Ga0495595_0024605 3300053084 Bacteria 2660
1272 Ga0495619_0000378 3300053085 Bacteria 30722
1273 Ga0495619_0000897 3300053085 Bacteria 19498
1274 Ga0495619_0006229 3300053085 Bacteria 7566
1275 Ga0495619_0024786 3300053085 Bacteria 3848
1276 Ga0495619_0030107 3300053085 Bacteria 3512
1277 Ga0495619_0085476 3300053085 Bacteria 2130
1278 Ga0495619_0121249 3300053085 Bacteria 1793
1279 Ga0495619_0291015 3300053085 Bacteria 1131
1280 Ga0500644_0001590 3300053088 Bacteria 5944
1281 Ga0500651_0023030 3300053093 Bacteria 3897
1282 Ga0500566_0164389 3300053094 Bacteria 1153
1283 Ga0500650_0127020 3300053098 Bacteria 1186
1284 Ga0500595_000001 3300053119 Bacteria 1088438
1285 Ga0500642_0053753 3300053130 Bacteria 1786
1286 Ga0500652_000938 3300053131 Bacteria 9643
1287 Ga0500658_0169935 3300053134 Bacteria 990
1288 Ga0500616_0000001 3300053153 Bacteria 1986011
1289 Ga0500645_002376 3300053730 Bacteria 8468
1290 Ga0501084_0168169 3300054114 Bacteria 1850
1291 Ga0501084_0210060 3300054114 Bacteria 1642
1292 Ga0501084_0530436 3300054114 Bacteria 995
1293 Ga0501082_0022360 3300060353 Bacteria 5447
1294 Ga0501082_0078165 3300060353 Bacteria 2854
1295 Ga0501082_0120087 3300060353 Bacteria 2278
1296 Ga0501082_0245798 3300060353 Bacteria 1557

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10009357 Ga0081538_100093579 211
2 3300006844 Ga0075428_100010216 Ga0075428_1000102168 211
3 3300006846 Ga0075430_100228568 Ga0075430_1002285682 211
4 3300006847 Ga0075431_100055912 Ga0075431_1000559123 211
5 3300006852 Ga0075433_10222295 Ga0075433_102222952 211
6 3300006871 Ga0075434_100160232 Ga0075434_1001602322 211
7 3300006880 Ga0075429_100082444 Ga0075429_1000824445 211
8 3300009094 Ga0111539_10012114 Ga0111539_100121148 211
9 3300009147 Ga0114129_10022387 Ga0114129_100223871 211
10 3300027907 Ga0207428_10029661 Ga0207428_100296612 211
11 3300050507 nmdc:mga05p37_57300_c1 nmdc:mga05p37_57300_c1_2762_3457 211
12 3300050509 nmdc:mga0qj67_219847_c1 nmdc:mga0qj67_219847_c1_416_1111 211
13 3300050510 nmdc:mga06r32_27869_c1 nmdc:mga06r32_27869_c1_3982_4677 211
14 3300050511 nmdc:mga08y16_18763_c1 nmdc:mga08y16_18763_c1_844_1539 211
15 3300050512 nmdc:mga0n895_21673_c1 nmdc:mga0n895_21673_c1_3872_4567 211
16 3300050515 nmdc:mga0a205_399671_c1 nmdc:mga0a205_399671_c1_409_1104 211
17 3300053098 Ga0500650_0127020 Ga0500650_0127020_172_924 215
18 3300006051 Ga0075364_10189800 Ga0075364_101898002 219
19 3300006195 Ga0075366_10238531 Ga0075366_102385312 219
20 3300006353 Ga0075370_10013697 Ga0075370_100136972 219
21 3300027866 Ga0209813_10103483 Ga0209813_101034831 219
22 3300050490 nmdc:mga03n38_29520_c1 nmdc:mga03n38_29520_c1_505_1221 219
23 3300050494 nmdc:mga06z11_24085_c1 nmdc:mga06z11_24085_c1_30_746 219
24 3300050496 nmdc:mga07m45_9776_c1 nmdc:mga07m45_9776_c1_1056_1772 219
25 3300053134 Ga0500658_0169935 Ga0500658_0169935_191_907 219
26 3300044842 Ga0466957_0225226 Ga0466957_0225226_75_830 221
27 3300045836 Ga0466958_0079220 Ga0466958_0079220_85_840 221
28 3300005456 Ga0070678_100344074 Ga0070678_1003440741 224
29 3300049590 Ga0501074_0027570 Ga0501074_0027570_3414_4106 226
30 3300006177 Ga0075362_10019167 Ga0075362_100191672 227
31 3300050491 nmdc:mga00v17_271812_c1 nmdc:mga00v17_271812_c1_187_903 227
32 3300005347 Ga0070668_100096911 Ga0070668_1000969113 229
33 3300005438 Ga0070701_10040980 Ga0070701_100409802 229
34 3300005441 Ga0070700_100096905 Ga0070700_1000969052 229
35 3300005719 Ga0068861_100238331 Ga0068861_1002383311 229
36 3300026075 Ga0207708_10240172 Ga0207708_102401722 229
37 3300026118 Ga0207675_100059869 Ga0207675_1000598694 229
38 3300046675 Ga0495657_0033991 Ga0495657_0033991_1769_2512 230
39 3300047444 Ga0495675_0058231 Ga0495675_0058231_394_1137 230
40 3300049579 Ga0501043_0059304 Ga0501043_0059304_35_793 230
41 3300049581 Ga0501047_0159148 Ga0501047_0159148_287_1045 230
42 3300053077 Ga0495601_0116155 Ga0495601_0116155_274_1017 230
43 3300053084 Ga0495595_0024605 Ga0495595_0024605_846_1589 230
44 3300005331 Ga0070670_100113430 Ga0070670_1001134302 232
45 3300005353 Ga0070669_100207881 Ga0070669_1002078812 232
46 3300005354 Ga0070675_100087502 Ga0070675_1000875023 232
47 3300005364 Ga0070673_100278696 Ga0070673_1002786962 232
48 3300005466 Ga0070685_10156737 Ga0070685_101567371 232
49 3300005617 Ga0068859_100108650 Ga0068859_1001086502 232
50 3300005618 Ga0068864_100182279 Ga0068864_1001822792 232
51 3300005841 Ga0068863_100300993 Ga0068863_1003009931 232
52 3300006237 Ga0097621_100172544 Ga0097621_1001725441 232
53 3300006358 Ga0068871_100697189 Ga0068871_1006971892 232
54 3300006844 Ga0075428_100001802 Ga0075428_1000018026 232
55 3300006846 Ga0075430_100056700 Ga0075430_1000567004 232
56 3300006847 Ga0075431_100001018 Ga0075431_10000101815 232
57 3300006880 Ga0075429_100030953 Ga0075429_1000309532 232
58 3300006931 Ga0097620_100108648 Ga0097620_1001086482 232
59 3300009094 Ga0111539_10000200 Ga0111539_1000020041 232
60 3300009094 Ga0111539_10484660 Ga0111539_104846602 232
61 3300009147 Ga0114129_10000205 Ga0114129_1000020537 232
62 3300009148 Ga0105243_10085706 Ga0105243_100857064 232
63 3300011119 Ga0105246_10096405 Ga0105246_100964053 232
64 3300014325 Ga0163163_10516572 Ga0163163_105165721 232
65 3300025900 Ga0207710_10037981 Ga0207710_100379811 232
66 3300025908 Ga0207643_10136339 Ga0207643_101363392 232
67 3300025918 Ga0207662_10138086 Ga0207662_101380862 232
68 3300025925 Ga0207650_10296223 Ga0207650_102962232 232
69 3300025927 Ga0207687_10071861 Ga0207687_100718612 232
70 3300025941 Ga0207711_10331164 Ga0207711_103311641 232
71 3300025942 Ga0207689_10027735 Ga0207689_100277353 232
72 3300026035 Ga0207703_10328878 Ga0207703_103288782 232
73 3300026095 Ga0207676_10046571 Ga0207676_100465712 232
74 3300026116 Ga0207674_10091332 Ga0207674_100913324 232
75 3300026118 Ga0207675_100159664 Ga0207675_1001596642 232
76 3300027907 Ga0207428_10001692 Ga0207428_100016929 232
77 3300041408 Ga0439453_0018755 Ga0439453_0018755_219_917 232
78 3300042436 Ga0439435_0002597 Ga0439435_0002597_172_870 232
79 3300042993 Ga0439440_0077929 Ga0439440_0077929_53_751 232
80 3300048915 Ga0496112_0376951 Ga0496112_0376951_469_1167 232
81 3300050507 nmdc:mga05p37_146_c1 nmdc:mga05p37_146_c1_8272_8970 232
82 3300050508 nmdc:mga09592_124551_c1 nmdc:mga09592_124551_c1_110_808 232
83 3300050509 nmdc:mga0qj67_25401_c1 nmdc:mga0qj67_25401_c1_1994_2692 232
84 3300050510 nmdc:mga06r32_347_c1 nmdc:mga06r32_347_c1_27860_28558 232
85 3300050511 nmdc:mga08y16_328_c1 nmdc:mga08y16_328_c1_18284_18982 232
86 3300005354 Ga0070675_100273203 Ga0070675_1002732032 233
87 3300005354 Ga0070675_100361184 Ga0070675_1003611842 233
88 3300005356 Ga0070674_100305399 Ga0070674_1003053992 233
89 3300005456 Ga0070678_100019407 Ga0070678_1000194075 233
90 3300005543 Ga0070672_100281702 Ga0070672_1002817022 233
91 3300005618 Ga0068864_100996407 Ga0068864_1009964071 233
92 3300005843 Ga0068860_100563699 Ga0068860_1005636992 233
93 3300006028 Ga0070717_10159756 Ga0070717_101597562 233
94 3300006195 Ga0075366_10137332 Ga0075366_101373322 233
95 3300006881 Ga0068865_100405001 Ga0068865_1004050012 233
96 3300009094 Ga0111539_10250757 Ga0111539_102507572 233
97 3300013306 Ga0163162_10590212 Ga0163162_105902121 233
98 3300025904 Ga0207647_10115384 Ga0207647_101153842 233
99 3300025923 Ga0207681_10387498 Ga0207681_103874982 233
100 3300025926 Ga0207659_10207931 Ga0207659_102079312 233
101 3300025937 Ga0207669_10179490 Ga0207669_101794902 233
102 3300025938 Ga0207704_10471627 Ga0207704_104716272 233
103 3300025940 Ga0207691_10160654 Ga0207691_101606542 233
104 3300026121 Ga0207683_10048304 Ga0207683_100483044 233
105 3300049571 Ga0501034_0648632 Ga0501034_0648632_110_868 233
106 3300049572 Ga0501036_0626245 Ga0501036_0626245_29_787 233
107 3300049574 Ga0501038_0517881 Ga0501038_0517881_93_851 233
108 3300049586 Ga0501070_0576837 Ga0501070_0576837_82_840 233
109 3300049587 Ga0501071_0397558 Ga0501071_0397558_300_1001 233
110 3300049742 Ga0501080_0012377 Ga0501080_0012377_110_868 233
111 3300049822 Ga0501035_0593388 Ga0501035_0593388_82_840 233
112 3300050493 nmdc:mga0k408_207655_c1 nmdc:mga0k408_207655_c1_330_1031 233
113 3300003323 rootH1_10199197 rootH1_101991972 234
114 3300005457 Ga0070662_100067575 Ga0070662_1000675752 234
115 3300005544 Ga0070686_100376233 Ga0070686_1003762332 234
116 3300006871 Ga0075434_100110966 Ga0075434_1001109662 234
117 3300009094 Ga0111539_10465254 Ga0111539_104652542 234
118 3300014326 Ga0157380_10026147 Ga0157380_100261472 234
119 3300025931 Ga0207644_10007407 Ga0207644_100074077 234
120 3300025933 Ga0207706_10114454 Ga0207706_101144542 234
121 3300048903 Ga0496100_0191509 Ga0496100_0191509_505_1242 234
122 3300048904 Ga0496101_0008336 Ga0496101_0008336_5726_6463 234
123 3300048911 Ga0496108_0058607 Ga0496108_0058607_997_1734 234
124 3300050512 nmdc:mga0n895_11616_c1 nmdc:mga0n895_11616_c1_6933_7637 234
125 3300006028 Ga0070717_10456719 Ga0070717_104567192 236
126 3300049571 Ga0501034_0049224 Ga0501034_0049224_1383_2162 236
127 3300049581 Ga0501047_0022462 Ga0501047_0022462_2817_3596 236
128 3300049584 Ga0501068_0029404 Ga0501068_0029404_1897_2676 236
129 3300049585 Ga0501069_0015321 Ga0501069_0015321_681_1460 236
130 3300049586 Ga0501070_0054012 Ga0501070_0054012_762_1541 236
131 3300049588 Ga0501072_0128291 Ga0501072_0128291_1088_1867 236
132 3300049589 Ga0501073_0130841 Ga0501073_0130841_596_1375 236
133 3300049590 Ga0501074_0028405 Ga0501074_0028405_588_1367 236
134 3300049741 Ga0501079_0338954 Ga0501079_0338954_135_914 236
135 3300049742 Ga0501080_0122736 Ga0501080_0122736_1568_2347 236
136 3300049823 Ga0501044_0061157 Ga0501044_0061157_686_1465 236
137 3300005981 Ga0081538_10017589 Ga0081538_100175892 237
138 3300001990 JGI24737J22298_10064859 JGI24737J22298_100648591 238
139 3300001991 JGI24743J22301_10008333 JGI24743J22301_100083332 238
140 3300002070 JGI24750J21931_1001196 JGI24750J21931_10011962 238
141 3300002076 JGI24749J21850_1011821 JGI24749J21850_10118212 238
142 3300002244 JGI24742J22300_10003075 JGI24742J22300_100030752 238
143 3300003373 JGI25407J50210_10025802 JGI25407J50210_100258024 238
144 3300005327 Ga0070658_10270701 Ga0070658_102707012 238
145 3300005329 Ga0070683_100106661 Ga0070683_1001066611 238
146 3300005329 Ga0070683_100177709 Ga0070683_1001777092 238
147 3300005330 Ga0070690_100252195 Ga0070690_1002521952 238
148 3300005331 Ga0070670_100019346 Ga0070670_1000193462 238
149 3300005333 Ga0070677_10080424 Ga0070677_100804242 238
150 3300005335 Ga0070666_10295572 Ga0070666_102955722 238
151 3300005338 Ga0068868_100045050 Ga0068868_1000450501 238
152 3300005339 Ga0070660_100236961 Ga0070660_1002369612 238
153 3300005340 Ga0070689_100011223 Ga0070689_1000112233 238
154 3300005341 Ga0070691_10016213 Ga0070691_100162133 238
155 3300005347 Ga0070668_100187304 Ga0070668_1001873042 238
156 3300005353 Ga0070669_100397683 Ga0070669_1003976832 238
157 3300005355 Ga0070671_100038653 Ga0070671_1000386533 238
158 3300005356 Ga0070674_100045634 Ga0070674_1000456343 238
159 3300005364 Ga0070673_100023232 Ga0070673_1000232324 238
160 3300005364 Ga0070673_100981390 Ga0070673_1009813901 238
161 3300005365 Ga0070688_100016044 Ga0070688_1000160442 238
162 3300005366 Ga0070659_100294699 Ga0070659_1002946992 238
163 3300005367 Ga0070667_100054032 Ga0070667_1000540323 238
164 3300005435 Ga0070714_100001717 Ga0070714_10000171710 238
165 3300005436 Ga0070713_100008626 Ga0070713_1000086265 238
166 3300005436 Ga0070713_100337916 Ga0070713_1003379162 238
167 3300005437 Ga0070710_10014261 Ga0070710_100142612 238
168 3300005439 Ga0070711_100115737 Ga0070711_1001157372 238
169 3300005439 Ga0070711_100136053 Ga0070711_1001360531 238
170 3300005440 Ga0070705_100611149 Ga0070705_1006111491 238
171 3300005441 Ga0070700_100073585 Ga0070700_1000735853 238
172 3300005444 Ga0070694_100766443 Ga0070694_1007664431 238
173 3300005455 Ga0070663_100061112 Ga0070663_1000611123 238
174 3300005456 Ga0070678_100141386 Ga0070678_1001413863 238
175 3300005466 Ga0070685_10012988 Ga0070685_100129884 238
176 3300005535 Ga0070684_100100028 Ga0070684_1001000282 238
177 3300005535 Ga0070684_100811840 Ga0070684_1008118402 238
178 3300005543 Ga0070672_100035421 Ga0070672_1000354213 238
179 3300005544 Ga0070686_100010778 Ga0070686_1000107783 238
180 3300005548 Ga0070665_100023806 Ga0070665_1000238064 238
181 3300005549 Ga0070704_100195506 Ga0070704_1001955062 238
182 3300005564 Ga0070664_100023220 Ga0070664_1000232204 238
183 3300005577 Ga0068857_100048107 Ga0068857_1000481072 238
184 3300005578 Ga0068854_100022931 Ga0068854_1000229312 238
185 3300005614 Ga0068856_100045746 Ga0068856_1000457462 238
186 3300005615 Ga0070702_100113030 Ga0070702_1001130301 238
187 3300005616 Ga0068852_100028469 Ga0068852_1000284693 238
188 3300005617 Ga0068859_100020118 Ga0068859_1000201187 238
189 3300005618 Ga0068864_100022792 Ga0068864_1000227924 238
190 3300005718 Ga0068866_10075107 Ga0068866_100751072 238
191 3300005834 Ga0068851_10011533 Ga0068851_100115332 238
192 3300005840 Ga0068870_10007460 Ga0068870_100074605 238
193 3300005841 Ga0068863_100034537 Ga0068863_1000345373 238
194 3300005841 Ga0068863_100047285 Ga0068863_1000472854 238
195 3300005843 Ga0068860_100510993 Ga0068860_1005109932 238
196 3300005844 Ga0068862_100051221 Ga0068862_1000512213 238
197 3300005937 Ga0081455_10017616 Ga0081455_100176163 238
198 3300006028 Ga0070717_10005256 Ga0070717_100052568 238
199 3300006028 Ga0070717_10284299 Ga0070717_102842992 238
200 3300006028 Ga0070717_10391947 Ga0070717_103919472 238
201 3300006028 Ga0070717_10708378 Ga0070717_107083782 238
202 3300006048 Ga0075363_100026063 Ga0075363_1000260632 238
203 3300006051 Ga0075364_10108613 Ga0075364_101086131 238
204 3300006163 Ga0070715_10039488 Ga0070715_100394882 238
205 3300006175 Ga0070712_100184118 Ga0070712_1001841182 238
206 3300006237 Ga0097621_100397358 Ga0097621_1003973581 238
207 3300006844 Ga0075428_100103269 Ga0075428_1001032694 238
208 3300006844 Ga0075428_100186326 Ga0075428_1001863261 238
209 3300006846 Ga0075430_100003861 Ga0075430_1000038614 238
210 3300006847 Ga0075431_100097874 Ga0075431_1000978744 238
211 3300006847 Ga0075431_100498757 Ga0075431_1004987572 238
212 3300006852 Ga0075433_10031620 Ga0075433_100316203 238
213 3300006852 Ga0075433_10367375 Ga0075433_103673752 238
214 3300006871 Ga0075434_100003814 Ga0075434_1000038142 238
215 3300006871 Ga0075434_100031871 Ga0075434_1000318712 238
216 3300006871 Ga0075434_100060134 Ga0075434_1000601342 238
217 3300006871 Ga0075434_100071882 Ga0075434_1000718822 238
218 3300006880 Ga0075429_100142052 Ga0075429_1001420523 238
219 3300006881 Ga0068865_100021335 Ga0068865_1000213353 238
220 3300006914 Ga0075436_100249389 Ga0075436_1002493892 238
221 3300006931 Ga0097620_100020117 Ga0097620_1000201177 238
222 3300007788 Ga0099795_10013800 Ga0099795_100138003 238
223 3300009098 Ga0105245_10052837 Ga0105245_100528374 238
224 3300009101 Ga0105247_10047293 Ga0105247_100472934 238
225 3300009147 Ga0114129_10011166 Ga0114129_100111664 238
226 3300009147 Ga0114129_10135358 Ga0114129_101353582 238
227 3300009147 Ga0114129_10375341 Ga0114129_103753412 238
228 3300009147 Ga0114129_10416397 Ga0114129_104163972 238
229 3300009147 Ga0114129_11377658 Ga0114129_113776582 238
230 3300009148 Ga0105243_10163891 Ga0105243_101638912 238
231 3300009176 Ga0105242_10312002 Ga0105242_103120022 238
232 3300009177 Ga0105248_10031394 Ga0105248_100313943 238
233 3300009545 Ga0105237_10140314 Ga0105237_101403143 238
234 3300009551 Ga0105238_10261602 Ga0105238_102616021 238
235 3300009553 Ga0105249_10029669 Ga0105249_100296695 238
236 3300009553 Ga0105249_10061954 Ga0105249_100619543 238
237 3300010375 Ga0105239_10054294 Ga0105239_100542942 238
238 3300011119 Ga0105246_10276547 Ga0105246_102765472 238
239 3300013296 Ga0157374_10021097 Ga0157374_100210974 238
240 3300013307 Ga0157372_10943540 Ga0157372_109435401 238
241 3300013308 Ga0157375_10469505 Ga0157375_104695052 238
242 3300014325 Ga0163163_10278369 Ga0163163_102783692 238
243 3300014326 Ga0157380_10141957 Ga0157380_101419573 238
244 3300014968 Ga0157379_10041558 Ga0157379_100415582 238
245 3300014969 Ga0157376_10047064 Ga0157376_100470645 238
246 3300017792 Ga0163161_10037784 Ga0163161_100377843 238
247 3300021377 Ga0213874_10020981 Ga0213874_100209812 238
248 3300025898 Ga0207692_10000073 Ga0207692_1000007318 238
249 3300025900 Ga0207710_10007452 Ga0207710_100074522 238
250 3300025901 Ga0207688_10000939 Ga0207688_100009393 238
251 3300025903 Ga0207680_10040227 Ga0207680_100402274 238
252 3300025904 Ga0207647_10042906 Ga0207647_100429062 238
253 3300025905 Ga0207685_10002787 Ga0207685_100027872 238
254 3300025906 Ga0207699_10001951 Ga0207699_100019514 238
255 3300025907 Ga0207645_10020382 Ga0207645_100203823 238
256 3300025908 Ga0207643_10000300 Ga0207643_1000030036 238
257 3300025915 Ga0207693_10145284 Ga0207693_101452842 238
258 3300025915 Ga0207693_10152860 Ga0207693_101528601 238
259 3300025916 Ga0207663_10032864 Ga0207663_100328643 238
260 3300025918 Ga0207662_10000768 Ga0207662_1000076813 238
261 3300025919 Ga0207657_10008236 Ga0207657_100082363 238
262 3300025920 Ga0207649_10056986 Ga0207649_100569861 238
263 3300025924 Ga0207694_10290516 Ga0207694_102905161 238
264 3300025925 Ga0207650_10014779 Ga0207650_100147796 238
265 3300025925 Ga0207650_10088298 Ga0207650_100882983 238
266 3300025926 Ga0207659_10008323 Ga0207659_100083234 238
267 3300025927 Ga0207687_10008827 Ga0207687_100088275 238
268 3300025928 Ga0207700_10012388 Ga0207700_100123882 238
269 3300025929 Ga0207664_10002018 Ga0207664_100020183 238
270 3300025931 Ga0207644_10008269 Ga0207644_100082693 238
271 3300025932 Ga0207690_10024537 Ga0207690_100245372 238
272 3300025933 Ga0207706_10081326 Ga0207706_100813262 238
273 3300025934 Ga0207686_10141983 Ga0207686_101419832 238
274 3300025935 Ga0207709_10028423 Ga0207709_100284232 238
275 3300025936 Ga0207670_10038696 Ga0207670_100386963 238
276 3300025937 Ga0207669_10013651 Ga0207669_100136512 238
277 3300025938 Ga0207704_10080833 Ga0207704_100808332 238
278 3300025939 Ga0207665_10176413 Ga0207665_101764132 238
279 3300025940 Ga0207691_10024993 Ga0207691_100249935 238
280 3300025941 Ga0207711_10025784 Ga0207711_100257844 238
281 3300025942 Ga0207689_10017396 Ga0207689_100173963 238
282 3300025944 Ga0207661_10047017 Ga0207661_100470173 238
283 3300025945 Ga0207679_10025487 Ga0207679_100254872 238
284 3300025949 Ga0207667_10612435 Ga0207667_106124352 238
285 3300025960 Ga0207651_10008018 Ga0207651_100080186 238
286 3300025960 Ga0207651_10531117 Ga0207651_105311171 238
287 3300025961 Ga0207712_10019776 Ga0207712_100197762 238
288 3300025961 Ga0207712_10199811 Ga0207712_101998112 238
289 3300025972 Ga0207668_10082537 Ga0207668_100825372 238
290 3300025981 Ga0207640_10060902 Ga0207640_100609022 238
291 3300025986 Ga0207658_10228487 Ga0207658_102284873 238
292 3300026023 Ga0207677_10015705 Ga0207677_100157053 238
293 3300026041 Ga0207639_10016375 Ga0207639_100163754 238
294 3300026067 Ga0207678_10032795 Ga0207678_100327952 238
295 3300026067 Ga0207678_10354333 Ga0207678_103543332 238
296 3300026075 Ga0207708_10003324 Ga0207708_100033244 238
297 3300026078 Ga0207702_10474442 Ga0207702_104744422 238
298 3300026088 Ga0207641_10028161 Ga0207641_100281612 238
299 3300026088 Ga0207641_10714545 Ga0207641_107145452 238
300 3300026095 Ga0207676_10012380 Ga0207676_100123804 238
301 3300026116 Ga0207674_10199991 Ga0207674_101999912 238
302 3300026118 Ga0207675_100010512 Ga0207675_1000105123 238
303 3300026121 Ga0207683_10005034 Ga0207683_100050343 238
304 3300026142 Ga0207698_10097681 Ga0207698_100976812 238
305 3300027907 Ga0207428_10054476 Ga0207428_100544762 238
306 3300028379 Ga0268266_10092290 Ga0268266_100922901 238
307 3300028379 Ga0268266_10308494 Ga0268266_103084941 238
308 3300028380 Ga0268265_10025906 Ga0268265_100259062 238
309 3300028381 Ga0268264_10053393 Ga0268264_100533933 238
310 3300028381 Ga0268264_10896567 Ga0268264_108965672 238
311 3300031241 Ga0265325_10006484 Ga0265325_100064844 238
312 3300031595 Ga0265313_10000087 Ga0265313_1000008788 238
313 3300031595 Ga0265313_10012080 Ga0265313_100120803 238
314 3300034957 Ga0373938_0050141 Ga0373938_0050141_66_782 238
315 3300035083 Ga0373926_0036369 Ga0373926_0036369_861_1577 238
316 3300035111 Ga0373923_0164423 Ga0373923_0164423_82_798 238
317 3300035117 Ga0373953_0017303 Ga0373953_0017303_1889_2605 238
318 3300035171 Ga0373946_0076193 Ga0373946_0076193_278_994 238
319 3300035241 Ga0373961_0059420 Ga0373961_0059420_422_1138 238
320 3300035242 Ga0373962_0019976 Ga0373962_0019976_596_1312 238
321 3300035410 Ga0373924_0234516 Ga0373924_0234516_85_801 238
322 3300035691 Ga0373931_0056043 Ga0373931_0056043_1018_1734 238
323 3300035692 Ga0373935_0411473 Ga0373935_0411473_107_823 238
324 3300035695 Ga0373927_0036539 Ga0373927_0036539_2281_2997 238
325 3300035695 Ga0373927_0077672 Ga0373927_0077672_1192_1908 238
326 3300035724 Ga0373933_0049313 Ga0373933_0049313_667_1383 238
327 3300036401 Ga0373937_0016602 Ga0373937_0016602_3172_3888 238
328 3300037068 Ga0373925_0033508 Ga0373925_0033508_1070_1786 238
329 3300037418 Ga0395900_0184789 Ga0395900_0184789_386_1102 238
330 3300038443 Ga0395901_0098532 Ga0395901_0098532_608_1324 238
331 3300039450 Ga0436363_0315669 Ga0436363_0315669_911_1627 238
332 3300041443 Ga0451789_0709386 Ga0451789_0709386_261_977 238
333 3300041498 Ga0451841_1135030 Ga0451841_1135030_43_759 238
334 3300046454 Ga0495592_0330381 Ga0495592_0330381_157_873 238
335 3300046457 Ga0495590_0065920 Ga0495590_0065920_194_910 238
336 3300046473 Ga0495582_0017090 Ga0495582_0017090_839_1555 238
337 3300046473 Ga0495582_0232168 Ga0495582_0232168_236_952 238
338 3300046491 Ga0495584_0133249 Ga0495584_0133249_330_1046 238
339 3300046492 Ga0495585_0057057 Ga0495585_0057057_479_1195 238
340 3300046500 Ga0495596_0068793 Ga0495596_0068793_456_1172 238
341 3300046517 Ga0495630_0111010 Ga0495630_0111010_1292_2008 238
342 3300046517 Ga0495630_0501288 Ga0495630_0501288_203_919 238
343 3300046518 Ga0495631_0176986 Ga0495631_0176986_161_877 238
344 3300046520 Ga0495637_0083539 Ga0495637_0083539_159_875 238
345 3300046529 Ga0495652_0200517 Ga0495652_0200517_355_1071 238
346 3300046533 Ga0495640_0140984 Ga0495640_0140984_233_949 238
347 3300046539 Ga0495621_0015610 Ga0495621_0015610_24_740 238
348 3300046557 Ga0495622_0015379 Ga0495622_0015379_1876_2592 238
349 3300046616 Ga0495668_0079881 Ga0495668_0079881_433_1149 238
350 3300046683 Ga0495658_0015226 Ga0495658_0015226_1388_2104 238
351 3300046684 Ga0495669_0173001 Ga0495669_0173001_106_822 238
352 3300046691 Ga0495670_0162092 Ga0495670_0162092_65_781 238
353 3300047319 Ga0495674_0120293 Ga0495674_0120293_391_1107 238
354 3300047321 Ga0495676_0132214 Ga0495676_0132214_755_1471 238
355 3300047470 Ga0495681_0133276 Ga0495681_0133276_20_736 238
356 3300047673 Ga0495593_0066459 Ga0495593_0066459_575_1291 238
357 3300048091 Ga0495626_0053820 Ga0495626_0053820_874_1590 238
358 3300048904 Ga0496101_0001022 Ga0496101_0001022_5084_5800 238
359 3300048904 Ga0496101_0059913 Ga0496101_0059913_1444_2160 238
360 3300048904 Ga0496101_0411135 Ga0496101_0411135_151_867 238
361 3300048905 Ga0496102_0010246 Ga0496102_0010246_970_1686 238
362 3300048905 Ga0496102_0103422 Ga0496102_0103422_1227_1943 238
363 3300048906 Ga0496103_0025906 Ga0496103_0025906_1179_1895 238
364 3300048907 Ga0496104_0009710 Ga0496104_0009710_4599_5315 238
365 3300048907 Ga0496104_0019198 Ga0496104_0019198_4693_5409 238
366 3300048908 Ga0496105_0012029 Ga0496105_0012029_3567_4283 238
367 3300048908 Ga0496105_0018797 Ga0496105_0018797_3099_3815 238
368 3300048909 Ga0496106_0019556 Ga0496106_0019556_3365_4081 238
369 3300048909 Ga0496106_0032399 Ga0496106_0032399_2116_2832 238
370 3300048909 Ga0496106_0090672 Ga0496106_0090672_1601_2317 238
371 3300048909 Ga0496106_0171288 Ga0496106_0171288_964_1680 238
372 3300048910 Ga0496107_0013215 Ga0496107_0013215_3251_3967 238
373 3300048910 Ga0496107_0024486 Ga0496107_0024486_2672_3388 238
374 3300048911 Ga0496108_0019323 Ga0496108_0019323_261_977 238
375 3300048911 Ga0496108_0026579 Ga0496108_0026579_1771_2487 238
376 3300048912 Ga0496109_0000644 Ga0496109_0000644_1680_2396 238
377 3300048912 Ga0496109_0026513 Ga0496109_0026513_2839_3555 238
378 3300048913 Ga0496110_0019757 Ga0496110_0019757_2900_3616 238
379 3300048914 Ga0496111_0014335 Ga0496111_0014335_2389_3105 238
380 3300048914 Ga0496111_0030481 Ga0496111_0030481_1461_2177 238
381 3300048915 Ga0496112_0001548 Ga0496112_0001548_4558_5274 238
382 3300048915 Ga0496112_0036518 Ga0496112_0036518_3236_3952 238
383 3300048915 Ga0496112_0358767 Ga0496112_0358767_300_1016 238
384 3300048916 Ga0496113_0001777 Ga0496113_0001777_3839_4555 238
385 3300048916 Ga0496113_0009092 Ga0496113_0009092_3236_3952 238
386 3300048917 Ga0496114_0025740 Ga0496114_0025740_2325_3041 238
387 3300048918 Ga0496115_0013652 Ga0496115_0013652_3701_4417 238
388 3300048918 Ga0496115_0487196 Ga0496115_0487196_228_944 238
389 3300049580 Ga0501046_0317360 Ga0501046_0317360_49_765 238
390 3300049586 Ga0501070_0395903 Ga0501070_0395903_275_991 238
391 3300049588 Ga0501072_0432583 Ga0501072_0432583_90_806 238
392 3300049590 Ga0501074_0142212 Ga0501074_0142212_234_950 238
393 3300049593 Ga0501077_0171763 Ga0501077_0171763_527_1243 238
394 3300049741 Ga0501079_0229645 Ga0501079_0229645_130_846 238
395 3300050491 nmdc:mga00v17_455043_c1 nmdc:mga00v17_455043_c1_17_733 238
396 3300050492 nmdc:mga0yw44_35055_c1 nmdc:mga0yw44_35055_c1_1453_2169 238
397 3300050492 nmdc:mga0yw44_426623_c1 nmdc:mga0yw44_426623_c1_65_781 238
398 3300050507 nmdc:mga05p37_34032_c1 nmdc:mga05p37_34032_c1_3657_4373 238
399 3300050507 nmdc:mga05p37_410288_c1 nmdc:mga05p37_410288_c1_206_922 238
400 3300050507 nmdc:mga05p37_80216_c1 nmdc:mga05p37_80216_c1_1522_2244 238
401 3300050509 nmdc:mga0qj67_1526_c1 nmdc:mga0qj67_1526_c1_7139_7855 238
402 3300050510 nmdc:mga06r32_212768_c1 nmdc:mga06r32_212768_c1_682_1398 238
403 3300050510 nmdc:mga06r32_446218_c1 nmdc:mga06r32_446218_c1_39_755 238
404 3300050510 nmdc:mga06r32_663117_c1 nmdc:mga06r32_663117_c1_162_878 238
405 3300050510 nmdc:mga06r32_67440_c1 nmdc:mga06r32_67440_c1_1149_1865 238
406 3300050511 nmdc:mga08y16_248059_c1 nmdc:mga08y16_248059_c1_637_1353 238
407 3300050511 nmdc:mga08y16_268952_c1 nmdc:mga08y16_268952_c1_173_889 238
408 3300050512 nmdc:mga0n895_114593_c1 nmdc:mga0n895_114593_c1_426_1142 238
409 3300050512 nmdc:mga0n895_4270_c1 nmdc:mga0n895_4270_c1_2148_2864 238
410 3300050513 nmdc:mga0rr50_351658_c1 nmdc:mga0rr50_351658_c1_204_920 238
411 3300050514 nmdc:mga08x19_191526_c1 nmdc:mga08x19_191526_c1_567_1283 238
412 3300050515 nmdc:mga0a205_20171_c1 nmdc:mga0a205_20171_c1_2295_3011 238
413 3300050515 nmdc:mga0a205_343307_c1 nmdc:mga0a205_343307_c1_550_1266 238
414 3300053085 Ga0495619_0030107 Ga0495619_0030107_891_1607 238
415 3300005329 Ga0070683_100151902 Ga0070683_1001519022 239
416 3300005337 Ga0070682_100060135 Ga0070682_1000601352 239
417 3300005354 Ga0070675_100307546 Ga0070675_1003075461 239
418 3300005364 Ga0070673_100593512 Ga0070673_1005935122 239
419 3300005367 Ga0070667_100297760 Ga0070667_1002977601 239
420 3300005406 Ga0070703_10142656 Ga0070703_101426561 239
421 3300005577 Ga0068857_100385003 Ga0068857_1003850031 239
422 3300005842 Ga0068858_100601218 Ga0068858_1006012182 239
423 3300005983 Ga0081540_1004734 Ga0081540_10047344 239
424 3300005983 Ga0081540_1010142 Ga0081540_10101421 239
425 3300005983 Ga0081540_1023475 Ga0081540_10234752 239
426 3300006177 Ga0075362_10072275 Ga0075362_100722752 239
427 3300006880 Ga0075429_100582962 Ga0075429_1005829621 239
428 3300009553 Ga0105249_10325201 Ga0105249_103252012 239
429 3300013306 Ga0163162_10440066 Ga0163162_104400661 239
430 3300025898 Ga0207692_10391109 Ga0207692_103911091 239
431 3300025986 Ga0207658_10584427 Ga0207658_105844272 239
432 3300028380 Ga0268265_10315147 Ga0268265_103151472 239
433 3300031235 Ga0265330_10029267 Ga0265330_100292673 239
434 3300031238 Ga0265332_10002206 Ga0265332_100022064 239
435 3300031238 Ga0265332_10041593 Ga0265332_100415932 239
436 3300031241 Ga0265325_10058826 Ga0265325_100588262 239
437 3300031247 Ga0265340_10001844 Ga0265340_100018443 239
438 3300031247 Ga0265340_10042254 Ga0265340_100422543 239
439 3300031249 Ga0265339_10004871 Ga0265339_100048714 239
440 3300031249 Ga0265339_10130160 Ga0265339_101301602 239
441 3300031344 Ga0265316_10210451 Ga0265316_102104512 239
442 3300031712 Ga0265342_10001555 Ga0265342_1000155510 239
443 3300031712 Ga0265342_10083995 Ga0265342_100839952 239
444 3300039450 Ga0436363_0817259 Ga0436363_0817259_22_741 239
445 3300046460 Ga0495638_0121599 Ga0495638_0121599_753_1472 239
446 3300046558 Ga0495633_0103793 Ga0495633_0103793_45_764 239
447 3300046615 Ga0495656_0049233 Ga0495656_0049233_508_1227 239
448 3300048904 Ga0496101_0049036 Ga0496101_0049036_784_1503 239
449 3300048907 Ga0496104_0050759 Ga0496104_0050759_2217_2936 239
450 3300048911 Ga0496108_0343744 Ga0496108_0343744_33_752 239
451 3300048917 Ga0496114_0041072 Ga0496114_0041072_1443_2162 239
452 3300048918 Ga0496115_0472621 Ga0496115_0472621_167_886 239
453 3300049569 Ga0501032_0438946 Ga0501032_0438946_50_805 239
454 3300049571 Ga0501034_0306070 Ga0501034_0306070_203_922 239
455 3300049582 Ga0501048_0161666 Ga0501048_0161666_789_1508 239
456 3300049744 Ga0501083_0119904 Ga0501083_0119904_649_1368 239
457 3300050507 nmdc:mga05p37_330381_c1 nmdc:mga05p37_330381_c1_169_888 239
458 3300050507 nmdc:mga05p37_965436_c1 nmdc:mga05p37_965436_c1_117_836 239
459 3300050508 nmdc:mga09592_180873_c1 nmdc:mga09592_180873_c1_360_1079 239
460 3300050510 nmdc:mga06r32_168966_c1 nmdc:mga06r32_168966_c1_1092_1811 239
461 3300053085 Ga0495619_0006229 Ga0495619_0006229_4328_5047 239
462 3300054114 Ga0501084_0168169 Ga0501084_0168169_1081_1800 239
463 3300060353 Ga0501082_0078165 Ga0501082_0078165_539_1258 239
464 3300005336 Ga0070680_100134470 Ga0070680_1001344702 240
465 3300005435 Ga0070714_100092964 Ga0070714_1000929642 240
466 3300005436 Ga0070713_100073307 Ga0070713_1000733073 240
467 3300005436 Ga0070713_100099211 Ga0070713_1000992112 240
468 3300005437 Ga0070710_10021851 Ga0070710_100218512 240
469 3300005445 Ga0070708_100482556 Ga0070708_1004825561 240
470 3300005458 Ga0070681_10051334 Ga0070681_100513344 240
471 3300005518 Ga0070699_100010246 Ga0070699_1000102462 240
472 3300005535 Ga0070684_100033102 Ga0070684_1000331024 240
473 3300005937 Ga0081455_10082492 Ga0081455_100824922 240
474 3300005983 Ga0081540_1127389 Ga0081540_11273891 240
475 3300006028 Ga0070717_10229996 Ga0070717_102299962 240
476 3300006173 Ga0070716_100171043 Ga0070716_1001710432 240
477 3300006914 Ga0075436_100406007 Ga0075436_1004060072 240
478 3300007265 Ga0099794_10021139 Ga0099794_100211392 240
479 3300009093 Ga0105240_10175883 Ga0105240_101758832 240
480 3300009174 Ga0105241_10165889 Ga0105241_101658892 240
481 3300013104 Ga0157370_10149088 Ga0157370_101490882 240
482 3300025910 Ga0207684_10171941 Ga0207684_101719412 240
483 3300025911 Ga0207654_10065192 Ga0207654_100651924 240
484 3300025912 Ga0207707_10203838 Ga0207707_102038382 240
485 3300025915 Ga0207693_10051931 Ga0207693_100519313 240
486 3300025915 Ga0207693_10288677 Ga0207693_102886772 240
487 3300025928 Ga0207700_10517163 Ga0207700_105171632 240
488 3300025929 Ga0207664_10099185 Ga0207664_100991852 240
489 3300025929 Ga0207664_10120720 Ga0207664_101207202 240
490 3300031249 Ga0265339_10000071 Ga0265339_1000007154 240
491 3300031595 Ga0265313_10000415 Ga0265313_1000041515 240
492 3300039438 Ga0436360_0816965 Ga0436360_0816965_408_1130 240
493 3300039447 Ga0436361_0189718 Ga0436361_0189718_2410_3132 240
494 3300048905 Ga0496102_0322617 Ga0496102_0322617_295_1017 240
495 3300048907 Ga0496104_0001202 Ga0496104_0001202_8940_9662 240
496 3300048907 Ga0496104_0068688 Ga0496104_0068688_999_1721 240
497 3300048909 Ga0496106_0079835 Ga0496106_0079835_980_1702 240
498 3300048910 Ga0496107_0109961 Ga0496107_0109961_838_1560 240
499 3300048911 Ga0496108_0377511 Ga0496108_0377511_38_760 240
500 3300048916 Ga0496113_0099606 Ga0496113_0099606_1278_2000 240
501 3300048918 Ga0496115_0033804 Ga0496115_0033804_503_1225 240
502 3300050512 nmdc:mga0n895_1021766_c1 nmdc:mga0n895_1021766_c1_55_777 240
503 3300049568 Ga0501031_0020371 Ga0501031_0020371_2781_3512 242
504 3300049570 Ga0501033_0099714 Ga0501033_0099714_1088_1819 242
505 3300049571 Ga0501034_0149522 Ga0501034_0149522_514_1245 242
506 3300049822 Ga0501035_0129023 Ga0501035_0129023_297_1028 242
507 3300001430 JGI24032J14994_101055 JGI24032J14994_1010551 244
508 3300001976 JGI24752J21851_1013427 JGI24752J21851_10134271 244
509 3300001977 JGI24746J21847_1001650 JGI24746J21847_10016502 244
510 3300001978 JGI24747J21853_1001844 JGI24747J21853_10018442 244
511 3300001989 JGI24739J22299_10014137 JGI24739J22299_100141372 244
512 3300001990 JGI24737J22298_10012901 JGI24737J22298_100129013 244
513 3300001991 JGI24743J22301_10004048 JGI24743J22301_100040481 244
514 3300002070 JGI24750J21931_1000188 JGI24750J21931_10001882 244
515 3300002073 JGI24745J21846_1008993 JGI24745J21846_10089931 244
516 3300002075 JGI24738J21930_10000068 JGI24738J21930_1000006816 244
517 3300002077 JGI24744J21845_10019934 JGI24744J21845_100199341 244
518 3300002126 JGI24035J26624_1000816 JGI24035J26624_10008162 244
519 3300002239 JGI24034J26672_10004654 JGI24034J26672_100046542 244
520 3300002244 JGI24742J22300_10019847 JGI24742J22300_100198472 244
521 3300002459 JGI24751J29686_10002565 JGI24751J29686_100025651 244
522 3300005293 Ga0065715_10089172 Ga0065715_1008917213 244
523 3300005329 Ga0070683_100004718 Ga0070683_10000471813 244
524 3300005330 Ga0070690_100001828 Ga0070690_1000018281 244
525 3300005331 Ga0070670_100001134 Ga0070670_1000011341 244
526 3300005333 Ga0070677_10004240 Ga0070677_100042405 244
527 3300005334 Ga0068869_100002241 Ga0068869_1000022413 244
528 3300005335 Ga0070666_10241461 Ga0070666_102414611 244
529 3300005336 Ga0070680_100037746 Ga0070680_1000377466 244
530 3300005336 Ga0070680_100195912 Ga0070680_1001959121 244
531 3300005338 Ga0068868_100060072 Ga0068868_1000600723 244
532 3300005339 Ga0070660_100000730 Ga0070660_1000007303 244
533 3300005340 Ga0070689_100000601 Ga0070689_1000006013 244
534 3300005343 Ga0070687_100000253 Ga0070687_1000002531 244
535 3300005344 Ga0070661_100003564 Ga0070661_1000035641 244
536 3300005345 Ga0070692_10000060 Ga0070692_100000602 244
537 3300005353 Ga0070669_100000888 Ga0070669_10000088817 244
538 3300005354 Ga0070675_100000441 Ga0070675_1000004419 244
539 3300005355 Ga0070671_100012431 Ga0070671_1000124318 244
540 3300005356 Ga0070674_100000723 Ga0070674_1000007231 244
541 3300005364 Ga0070673_100000456 Ga0070673_10000045617 244
542 3300005366 Ga0070659_100071077 Ga0070659_1000710773 244
543 3300005367 Ga0070667_100004366 Ga0070667_10000436612 244
544 3300005438 Ga0070701_10000150 Ga0070701_1000015017 244
545 3300005441 Ga0070700_100001083 Ga0070700_10000108314 244
546 3300005444 Ga0070694_100005807 Ga0070694_1000058073 244
547 3300005455 Ga0070663_100235138 Ga0070663_1002351381 244
548 3300005456 Ga0070678_100000199 Ga0070678_1000001998 244
549 3300005458 Ga0070681_10001398 Ga0070681_100013981 244
550 3300005458 Ga0070681_10471298 Ga0070681_104712981 244
551 3300005459 Ga0068867_100070864 Ga0068867_1000708641 244
552 3300005466 Ga0070685_10070280 Ga0070685_100702802 244
553 3300005530 Ga0070679_100003933 Ga0070679_1000039334 244
554 3300005530 Ga0070679_100109379 Ga0070679_1001093791 244
555 3300005535 Ga0070684_100008219 Ga0070684_1000082196 244
556 3300005543 Ga0070672_100084911 Ga0070672_1000849111 244
557 3300005544 Ga0070686_100000746 Ga0070686_10000074617 244
558 3300005545 Ga0070695_100180484 Ga0070695_1001804842 244
559 3300005547 Ga0070693_100000613 Ga0070693_10000061316 244
560 3300005549 Ga0070704_100161117 Ga0070704_1001611172 244
561 3300005564 Ga0070664_100405256 Ga0070664_1004052561 244
562 3300005577 Ga0068857_100010463 Ga0068857_1000104639 244
563 3300005578 Ga0068854_100038064 Ga0068854_1000380644 244
564 3300005614 Ga0068856_100001340 Ga0068856_1000013407 244
565 3300005615 Ga0070702_100000293 Ga0070702_10000029311 244
566 3300005616 Ga0068852_100087901 Ga0068852_1000879011 244
567 3300005617 Ga0068859_100001767 Ga0068859_1000017673 244
568 3300005618 Ga0068864_100003544 Ga0068864_10000354413 244
569 3300005718 Ga0068866_10000372 Ga0068866_100003721 244
570 3300005840 Ga0068870_10000207 Ga0068870_100002071 244
571 3300005841 Ga0068863_100028324 Ga0068863_1000283243 244
572 3300005842 Ga0068858_100004999 Ga0068858_1000049997 244
573 3300005843 Ga0068860_100019087 Ga0068860_1000190878 244
574 3300006058 Ga0075432_10060363 Ga0075432_100603631 244
575 3300006237 Ga0097621_100045181 Ga0097621_1000451813 244
576 3300006358 Ga0068871_100078591 Ga0068871_1000785913 244
577 3300006852 Ga0075433_10019693 Ga0075433_100196932 244
578 3300006871 Ga0075434_100529770 Ga0075434_1005297702 244
579 3300006881 Ga0068865_100000537 Ga0068865_10000053716 244
580 3300006931 Ga0097620_100001767 Ga0097620_1000017673 244
581 3300009093 Ga0105240_10192164 Ga0105240_101921642 244
582 3300009094 Ga0111539_10273679 Ga0111539_102736792 244
583 3300009098 Ga0105245_10000888 Ga0105245_1000088812 244
584 3300009101 Ga0105247_10135152 Ga0105247_101351522 244
585 3300009148 Ga0105243_10196764 Ga0105243_101967642 244
586 3300009174 Ga0105241_10000662 Ga0105241_1000066211 244
587 3300009177 Ga0105248_10002336 Ga0105248_1000233616 244
588 3300009545 Ga0105237_10046059 Ga0105237_100460591 244
589 3300009551 Ga0105238_10279811 Ga0105238_102798112 244
590 3300009553 Ga0105249_10394324 Ga0105249_103943241 244
591 3300010375 Ga0105239_10080934 Ga0105239_100809343 244
592 3300011119 Ga0105246_10007028 Ga0105246_100070288 244
593 3300013102 Ga0157371_10117919 Ga0157371_101179191 244
594 3300013296 Ga0157374_10146030 Ga0157374_101460302 244
595 3300013297 Ga0157378_10073544 Ga0157378_100735443 244
596 3300013306 Ga0163162_10112141 Ga0163162_101121412 244
597 3300013307 Ga0157372_10038501 Ga0157372_100385018 244
598 3300013308 Ga0157375_10001031 Ga0157375_1000103116 244
599 3300014326 Ga0157380_10000726 Ga0157380_100007261 244
600 3300014745 Ga0157377_10000324 Ga0157377_100003242 244
601 3300014968 Ga0157379_10001193 Ga0157379_100011931 244
602 3300014969 Ga0157376_10012211 Ga0157376_100122112 244
603 3300017792 Ga0163161_10001040 Ga0163161_1000104016 244
604 3300025271 Ga0207666_1000034 Ga0207666_100003416 244
605 3300025315 Ga0207697_10000280 Ga0207697_1000028016 244
606 3300025885 Ga0207653_10009627 Ga0207653_100096273 244
607 3300025893 Ga0207682_10000134 Ga0207682_1000013415 244
608 3300025899 Ga0207642_10010308 Ga0207642_100103085 244
609 3300025900 Ga0207710_10003581 Ga0207710_100035812 244
610 3300025901 Ga0207688_10000526 Ga0207688_100005261 244
611 3300025903 Ga0207680_10033276 Ga0207680_100332762 244
612 3300025904 Ga0207647_10016576 Ga0207647_100165761 244
613 3300025907 Ga0207645_10039728 Ga0207645_100397283 244
614 3300025908 Ga0207643_10000475 Ga0207643_1000047526 244
615 3300025911 Ga0207654_10006328 Ga0207654_100063287 244
616 3300025912 Ga0207707_10069245 Ga0207707_100692453 244
617 3300025913 Ga0207695_10279293 Ga0207695_102792932 244
618 3300025917 Ga0207660_10260293 Ga0207660_102602933 244
619 3300025917 Ga0207660_10409617 Ga0207660_104096172 244
620 3300025918 Ga0207662_10000341 Ga0207662_100003411 244
621 3300025919 Ga0207657_10081113 Ga0207657_100811131 244
622 3300025920 Ga0207649_10000271 Ga0207649_1000027116 244
623 3300025921 Ga0207652_10101929 Ga0207652_101019292 244
624 3300025921 Ga0207652_10154955 Ga0207652_101549553 244
625 3300025923 Ga0207681_10000658 Ga0207681_1000065816 244
626 3300025924 Ga0207694_10228090 Ga0207694_102280902 244
627 3300025925 Ga0207650_10031270 Ga0207650_100312706 244
628 3300025926 Ga0207659_10000177 Ga0207659_100001778 244
629 3300025927 Ga0207687_10000495 Ga0207687_1000049516 244
630 3300025931 Ga0207644_10000279 Ga0207644_1000027915 244
631 3300025932 Ga0207690_10008301 Ga0207690_100083013 244
632 3300025933 Ga0207706_10005939 Ga0207706_100059391 244
633 3300025934 Ga0207686_10181080 Ga0207686_101810802 244
634 3300025935 Ga0207709_10000952 Ga0207709_1000095216 244
635 3300025936 Ga0207670_10000491 Ga0207670_1000049116 244
636 3300025937 Ga0207669_10342700 Ga0207669_103427002 244
637 3300025938 Ga0207704_10008932 Ga0207704_100089321 244
638 3300025940 Ga0207691_10002815 Ga0207691_1000281515 244
639 3300025941 Ga0207711_10001570 Ga0207711_1000157016 244
640 3300025942 Ga0207689_10003227 Ga0207689_1000322714 244
641 3300025944 Ga0207661_10000642 Ga0207661_100006421 244
642 3300025945 Ga0207679_10000046 Ga0207679_100000466 244
643 3300025949 Ga0207667_10007962 Ga0207667_1000796213 244
644 3300025960 Ga0207651_10000214 Ga0207651_1000021416 244
645 3300025961 Ga0207712_10003297 Ga0207712_1000329712 244
646 3300025972 Ga0207668_10000537 Ga0207668_1000053716 244
647 3300025981 Ga0207640_10002737 Ga0207640_100027375 244
648 3300025986 Ga0207658_10001147 Ga0207658_100011472 244
649 3300026035 Ga0207703_10000940 Ga0207703_1000094010 244
650 3300026041 Ga0207639_10000852 Ga0207639_1000085216 244
651 3300026067 Ga0207678_10007136 Ga0207678_1000713610 244
652 3300026075 Ga0207708_10001006 Ga0207708_100010061 244
653 3300026078 Ga0207702_10002642 Ga0207702_100026428 244
654 3300026088 Ga0207641_10001370 Ga0207641_1000137016 244
655 3300026089 Ga0207648_10087764 Ga0207648_100877643 244
656 3300026095 Ga0207676_10010200 Ga0207676_100102006 244
657 3300026116 Ga0207674_10002956 Ga0207674_1000295616 244
658 3300026118 Ga0207675_100006209 Ga0207675_1000062091 244
659 3300026121 Ga0207683_10004449 Ga0207683_100044493 244
660 3300026142 Ga0207698_10007930 Ga0207698_100079303 244
661 3300027617 Ga0210002_1014782 Ga0210002_10147821 244
662 3300027717 Ga0209998_10001538 Ga0209998_100015382 244
663 3300027876 Ga0209974_10012529 Ga0209974_100125293 244
664 3300027907 Ga0207428_10112059 Ga0207428_101120593 244
665 3300028380 Ga0268265_10000817 Ga0268265_1000081710 244
666 3300028381 Ga0268264_10001227 Ga0268264_1000122716 244
667 3300034817 Ga0373948_0003110 Ga0373948_0003110_97_846 244
668 3300034957 Ga0373938_0014640 Ga0373938_0014640_612_1361 244
669 3300035088 Ga0373940_0041710 Ga0373940_0041710_403_1152 244
670 3300035090 Ga0373949_0005436 Ga0373949_0005436_225_974 244
671 3300035092 Ga0373952_0002861 Ga0373952_0002861_671_1420 244
672 3300035112 Ga0373932_0000703 Ga0373932_0000703_8374_9123 244
673 3300035114 Ga0373939_0002267 Ga0373939_0002267_905_1654 244
674 3300035121 Ga0373960_0026800 Ga0373960_0026800_442_1191 244
675 3300035207 Ga0373942_0053398 Ga0373942_0053398_240_989 244
676 3300035241 Ga0373961_0003856 Ga0373961_0003856_210_959 244
677 3300035691 Ga0373931_0007315 Ga0373931_0007315_3569_4318 244
678 3300046538 Ga0495609_0034143 Ga0495609_0034143_756_1505 244
679 3300048903 Ga0496100_0002059 Ga0496100_0002059_8533_9282 244
680 3300048904 Ga0496101_0001738 Ga0496101_0001738_4593_5342 244
681 3300048905 Ga0496102_0001427 Ga0496102_0001427_336_1085 244
682 3300048906 Ga0496103_0004101 Ga0496103_0004101_2818_3567 244
683 3300048909 Ga0496106_0000644 Ga0496106_0000644_20143_20892 244
684 3300048911 Ga0496108_0084028 Ga0496108_0084028_1718_2467 244
685 3300048912 Ga0496109_0010936 Ga0496109_0010936_246_995 244
686 3300048913 Ga0496110_0096572 Ga0496110_0096572_1733_2482 244
687 3300048915 Ga0496112_0201926 Ga0496112_0201926_1058_1807 244
688 3300048916 Ga0496113_0088624 Ga0496113_0088624_1096_1845 244
689 3300048917 Ga0496114_0029429 Ga0496114_0029429_1773_2522 244
690 3300048918 Ga0496115_0124905 Ga0496115_0124905_149_898 244
691 3300049575 Ga0501039_0011358 Ga0501039_0011358_756_1490 244
692 3300049578 Ga0501042_0318627 Ga0501042_0318627_87_821 244
693 3300049588 Ga0501072_0006127 Ga0501072_0006127_3532_4266 244
694 3300049591 Ga0501075_0050477 Ga0501075_0050477_615_1349 244
695 3300049741 Ga0501079_0049238 Ga0501079_0049238_2105_2839 244
696 3300050511 nmdc:mga08y16_513855_c1 nmdc:mga08y16_513855_c1_220_969 244
697 3300050512 nmdc:mga0n895_1698_c1 nmdc:mga0n895_1698_c1_67_816 244
698 3300050515 nmdc:mga0a205_251229_c1 nmdc:mga0a205_251229_c1_502_1251 244
699 3300053094 Ga0500566_0164389 Ga0500566_0164389_21_761 244
700 3300053119 Ga0500595_000001 Ga0500595_000001_520161_520901 244
701 3300054114 Ga0501084_0530436 Ga0501084_0530436_25_759 244
702 3300005344 Ga0070661_100005403 Ga0070661_1000054039 245
703 3300005563 Ga0068855_100004415 Ga0068855_10000441515 245
704 3300005937 Ga0081455_10000002 Ga0081455_10000002480 245
705 3300025928 Ga0207700_10082085 Ga0207700_100820852 245
706 3300026078 Ga0207702_10539263 Ga0207702_105392631 245
707 3300027665 Ga0209983_1003857 Ga0209983_10038572 245
708 3300044694 Ga0466963_0015149 Ga0466963_0015149_2340_3092 245
709 3300045049 Ga0466959_0313519 Ga0466959_0313519_17_769 245
710 3300045836 Ga0466958_0008358 Ga0466958_0008358_321_1073 245
711 3300049570 Ga0501033_0062788 Ga0501033_0062788_1334_2074 245
712 3300049571 Ga0501034_0213866 Ga0501034_0213866_405_1154 245
713 3300049579 Ga0501043_0061077 Ga0501043_0061077_1070_1810 245
714 3300049580 Ga0501046_0256706 Ga0501046_0256706_26_766 245
715 3300049581 Ga0501047_0009026 Ga0501047_0009026_3986_4726 245
716 3300049586 Ga0501070_0010033 Ga0501070_0010033_1557_2297 245
717 3300049586 Ga0501070_0080098 Ga0501070_0080098_1878_2627 245
718 3300049742 Ga0501080_0135524 Ga0501080_0135524_1122_1871 245
719 3300049744 Ga0501083_0030907 Ga0501083_0030907_1420_2169 245
720 3300049823 Ga0501044_0021597 Ga0501044_0021597_1703_2443 245
721 3300049823 Ga0501044_0642863 Ga0501044_0642863_134_874 245
722 3300021384 Ga0213876_10092962 Ga0213876_100929622 246
723 3300031691 Ga0316579_10041829 Ga0316579_100418292 246
724 3300036647 Ga0316582_0054719 Ga0316582_0054719_1500_2255 246
725 3300039437 Ga0436365_1295969 Ga0436365_1295969_1670_2410 246
726 3300049569 Ga0501032_0015452 Ga0501032_0015452_1017_1775 246
727 3300049569 Ga0501032_0109728 Ga0501032_0109728_125_877 246
728 3300049569 Ga0501032_0296011 Ga0501032_0296011_125_877 246
729 3300049570 Ga0501033_0144981 Ga0501033_0144981_523_1275 246
730 3300049571 Ga0501034_0000673 Ga0501034_0000673_35368_36120 246
731 3300049571 Ga0501034_0000933 Ga0501034_0000933_27293_28051 246
732 3300049571 Ga0501034_0564418 Ga0501034_0564418_170_922 246
733 3300049572 Ga0501036_0000242 Ga0501036_0000242_35876_36634 246
734 3300049573 Ga0501037_0045754 Ga0501037_0045754_1719_2471 246
735 3300049573 Ga0501037_0195792 Ga0501037_0195792_82_834 246
736 3300049574 Ga0501038_0020142 Ga0501038_0020142_1379_2131 246
737 3300049575 Ga0501039_0115865 Ga0501039_0115865_125_877 246
738 3300049575 Ga0501039_0185820 Ga0501039_0185820_125_877 246
739 3300049578 Ga0501042_0033741 Ga0501042_0033741_2059_2811 246
740 3300049579 Ga0501043_0020786 Ga0501043_0020786_2750_3508 246
741 3300049579 Ga0501043_0039482 Ga0501043_0039482_2291_3049 246
742 3300049579 Ga0501043_0409708 Ga0501043_0409708_214_966 246
743 3300049580 Ga0501046_0051469 Ga0501046_0051469_2322_3074 246
744 3300049581 Ga0501047_0000073 Ga0501047_0000073_62549_63307 246
745 3300049581 Ga0501047_0238321 Ga0501047_0238321_470_1222 246
746 3300049581 Ga0501047_0253659 Ga0501047_0253659_65_817 246
747 3300049582 Ga0501048_0000014 Ga0501048_0000014_30116_30874 246
748 3300049582 Ga0501048_0040161 Ga0501048_0040161_2135_2887 246
749 3300049583 Ga0501067_0020704 Ga0501067_0020704_1365_2117 246
750 3300049584 Ga0501068_0064873 Ga0501068_0064873_125_877 246
751 3300049586 Ga0501070_0007266 Ga0501070_0007266_187_945 246
752 3300049586 Ga0501070_0076867 Ga0501070_0076867_1887_2639 246
753 3300049586 Ga0501070_0080241 Ga0501070_0080241_125_877 246
754 3300049587 Ga0501071_0031037 Ga0501071_0031037_553_1305 246
755 3300049588 Ga0501072_0030800 Ga0501072_0030800_384_1136 246
756 3300049588 Ga0501072_0578020 Ga0501072_0578020_124_876 246
757 3300049589 Ga0501073_0087946 Ga0501073_0087946_1307_2059 246
758 3300049590 Ga0501074_0029008 Ga0501074_0029008_149_907 246
759 3300049590 Ga0501074_0057083 Ga0501074_0057083_266_1018 246
760 3300049742 Ga0501080_0000187 Ga0501080_0000187_30997_31755 246
761 3300049742 Ga0501080_0019883 Ga0501080_0019883_396_1148 246
762 3300049744 Ga0501083_0000398 Ga0501083_0000398_8400_9158 246
763 3300049744 Ga0501083_0116762 Ga0501083_0116762_876_1628 246
764 3300049822 Ga0501035_0195703 Ga0501035_0195703_125_877 246
765 3300049823 Ga0501044_0091612 Ga0501044_0091612_2215_2967 246
766 3300049823 Ga0501044_0408868 Ga0501044_0408868_53_811 246
767 3300049823 Ga0501044_0413560 Ga0501044_0413560_383_1135 246
768 3300049824 Ga0501045_0093236 Ga0501045_0093236_1364_2116 246
769 3300050490 nmdc:mga03n38_166197_c1 nmdc:mga03n38_166197_c1_153_893 246
770 3300053088 Ga0500644_0001590 Ga0500644_0001590_3353_4093 246
771 3300053131 Ga0500652_000938 Ga0500652_000938_4290_5030 246
772 3300053153 Ga0500616_0000001 Ga0500616_0000001_1465976_1466716 246
773 3300053730 Ga0500645_002376 Ga0500645_002376_5964_6704 246
774 3300054114 Ga0501084_0210060 Ga0501084_0210060_442_1194 246
775 3300060353 Ga0501082_0120087 Ga0501082_0120087_1066_1824 246
776 3300005563 Ga0068855_100208336 Ga0068855_1002083361 247
777 3300005614 Ga0068856_100120449 Ga0068856_1001204492 247
778 3300026078 Ga0207702_10463311 Ga0207702_104633112 247
779 3300031711 Ga0265314_10003840 Ga0265314_1000384011 247
780 3300053093 Ga0500651_0023030 Ga0500651_0023030_1324_2067 247
781 3300053130 Ga0500642_0053753 Ga0500642_0053753_698_1441 247
782 3300028800 Ga0265338_10074286 Ga0265338_100742862 248
783 3300031247 Ga0265340_10081766 Ga0265340_100817662 248
784 3300032133 Ga0316583_10002720 Ga0316583_100027202 248
785 3300046462 Ga0495651_0150412 Ga0495651_0150412_474_1220 248
786 3300048915 Ga0496112_0198972 Ga0496112_0198972_265_1041 248
787 3300049569 Ga0501032_0158989 Ga0501032_0158989_179_937 248
788 3300049571 Ga0501034_0328591 Ga0501034_0328591_221_976 248
789 3300049572 Ga0501036_0533322 Ga0501036_0533322_113_868 248
790 3300049574 Ga0501038_0060730 Ga0501038_0060730_120_869 248
791 3300049574 Ga0501038_0082622 Ga0501038_0082622_1238_1996 248
792 3300049575 Ga0501039_0041604 Ga0501039_0041604_2475_3224 248
793 3300049575 Ga0501039_0077787 Ga0501039_0077787_488_1246 248
794 3300049579 Ga0501043_0434837 Ga0501043_0434837_154_912 248
795 3300049581 Ga0501047_0008654 Ga0501047_0008654_4408_5166 248
796 3300049581 Ga0501047_0137238 Ga0501047_0137238_1118_1873 248
797 3300049585 Ga0501069_0090149 Ga0501069_0090149_722_1483 248
798 3300049586 Ga0501070_0008335 Ga0501070_0008335_813_1589 248
799 3300049586 Ga0501070_0054487 Ga0501070_0054487_775_1554 248
800 3300049586 Ga0501070_0065404 Ga0501070_0065404_2088_2837 248
801 3300049587 Ga0501071_0586898 Ga0501071_0586898_89_844 248
802 3300049589 Ga0501073_0021369 Ga0501073_0021369_2311_3069 248
803 3300049744 Ga0501083_0020659 Ga0501083_0020659_1597_2355 248
804 3300049822 Ga0501035_0000621 Ga0501035_0000621_8856_9635 248
805 3300049822 Ga0501035_0112073 Ga0501035_0112073_140_895 248
806 3300049823 Ga0501044_0063316 Ga0501044_0063316_1295_2053 248
807 3300049823 Ga0501044_0159451 Ga0501044_0159451_309_1064 248
808 3300060353 Ga0501082_0022360 Ga0501082_0022360_3051_3809 248
809 3300060353 Ga0501082_0245798 Ga0501082_0245798_722_1477 248
810 3300005328 Ga0070676_10030891 Ga0070676_100308912 249
811 3300005329 Ga0070683_100186261 Ga0070683_1001862611 249
812 3300005330 Ga0070690_100085564 Ga0070690_1000855642 249
813 3300005334 Ga0068869_100072509 Ga0068869_1000725092 249
814 3300005337 Ga0070682_100048795 Ga0070682_1000487952 249
815 3300005339 Ga0070660_100221561 Ga0070660_1002215611 249
816 3300005341 Ga0070691_10051909 Ga0070691_100519092 249
817 3300005347 Ga0070668_100315543 Ga0070668_1003155432 249
818 3300005355 Ga0070671_100086982 Ga0070671_1000869821 249
819 3300005356 Ga0070674_100071279 Ga0070674_1000712792 249
820 3300005364 Ga0070673_100006931 Ga0070673_1000069312 249
821 3300005364 Ga0070673_100036643 Ga0070673_1000366433 249
822 3300005367 Ga0070667_100028530 Ga0070667_1000285302 249
823 3300005367 Ga0070667_100110696 Ga0070667_1001106962 249
824 3300005434 Ga0070709_10012396 Ga0070709_100123962 249
825 3300005434 Ga0070709_10064725 Ga0070709_100647253 249
826 3300005434 Ga0070709_10267256 Ga0070709_102672562 249
827 3300005435 Ga0070714_100072401 Ga0070714_1000724012 249
828 3300005436 Ga0070713_100025030 Ga0070713_1000250304 249
829 3300005436 Ga0070713_100051947 Ga0070713_1000519475 249
830 3300005437 Ga0070710_10014117 Ga0070710_100141174 249
831 3300005437 Ga0070710_10030745 Ga0070710_100307451 249
832 3300005440 Ga0070705_100115517 Ga0070705_1001155171 249
833 3300005441 Ga0070700_100172225 Ga0070700_1001722252 249
834 3300005441 Ga0070700_100299024 Ga0070700_1002990241 249
835 3300005444 Ga0070694_100202123 Ga0070694_1002021232 249
836 3300005455 Ga0070663_100055519 Ga0070663_1000555194 249
837 3300005456 Ga0070678_100032267 Ga0070678_1000322674 249
838 3300005458 Ga0070681_10611962 Ga0070681_106119621 249
839 3300005466 Ga0070685_10012971 Ga0070685_100129716 249
840 3300005530 Ga0070679_100163896 Ga0070679_1001638961 249
841 3300005530 Ga0070679_100200367 Ga0070679_1002003672 249
842 3300005536 Ga0070697_100528546 Ga0070697_1005285461 249
843 3300005543 Ga0070672_100282939 Ga0070672_1002829392 249
844 3300005544 Ga0070686_100003612 Ga0070686_1000036125 249
845 3300005547 Ga0070693_100025946 Ga0070693_1000259465 249
846 3300005548 Ga0070665_100056129 Ga0070665_1000561293 249
847 3300005564 Ga0070664_100306345 Ga0070664_1003063452 249
848 3300005578 Ga0068854_100151074 Ga0068854_1001510743 249
849 3300005614 Ga0068856_100330525 Ga0068856_1003305252 249
850 3300005614 Ga0068856_100638112 Ga0068856_1006381122 249
851 3300005615 Ga0070702_100005192 Ga0070702_1000051928 249
852 3300005718 Ga0068866_10065626 Ga0068866_100656263 249
853 3300005719 Ga0068861_100090261 Ga0068861_1000902612 249
854 3300005834 Ga0068851_10067204 Ga0068851_100672042 249
855 3300005843 Ga0068860_100110596 Ga0068860_1001105964 249
856 3300005937 Ga0081455_10018858 Ga0081455_100188586 249
857 3300005937 Ga0081455_10407144 Ga0081455_104071442 249
858 3300006028 Ga0070717_10259779 Ga0070717_102597792 249
859 3300006028 Ga0070717_10269131 Ga0070717_102691312 249
860 3300006058 Ga0075432_10010313 Ga0075432_100103132 249
861 3300006173 Ga0070716_100002237 Ga0070716_10000223710 249
862 3300006173 Ga0070716_100312353 Ga0070716_1003123532 249
863 3300006237 Ga0097621_100026392 Ga0097621_1000263921 249
864 3300006358 Ga0068871_100007371 Ga0068871_1000073719 249
865 3300006358 Ga0068871_100078310 Ga0068871_1000783102 249
866 3300006844 Ga0075428_100010200 Ga0075428_1000102003 249
867 3300006846 Ga0075430_100001483 Ga0075430_1000014833 249
868 3300006847 Ga0075431_100017410 Ga0075431_1000174108 249
869 3300006852 Ga0075433_10002052 Ga0075433_100020527 249
870 3300006852 Ga0075433_10184035 Ga0075433_101840352 249
871 3300006852 Ga0075433_10316169 Ga0075433_103161692 249
872 3300006871 Ga0075434_100001473 Ga0075434_1000014733 249
873 3300006871 Ga0075434_100135632 Ga0075434_1001356322 249
874 3300006880 Ga0075429_100005294 Ga0075429_10000529412 249
875 3300006881 Ga0068865_100063296 Ga0068865_1000632962 249
876 3300006914 Ga0075436_100026165 Ga0075436_1000261652 249
877 3300007076 Ga0075435_100024384 Ga0075435_1000243844 249
878 3300007076 Ga0075435_100247914 Ga0075435_1002479142 249
879 3300007076 Ga0075435_100452317 Ga0075435_1004523171 249
880 3300009093 Ga0105240_10486749 Ga0105240_104867492 249
881 3300009094 Ga0111539_10008538 Ga0111539_1000853813 249
882 3300009098 Ga0105245_10130933 Ga0105245_101309332 249
883 3300009147 Ga0114129_10046549 Ga0114129_100465497 249
884 3300009147 Ga0114129_10061852 Ga0114129_100618525 249
885 3300009148 Ga0105243_10076858 Ga0105243_100768582 249
886 3300009148 Ga0105243_10148864 Ga0105243_101488642 249
887 3300009176 Ga0105242_10014624 Ga0105242_100146247 249
888 3300009176 Ga0105242_10053790 Ga0105242_100537903 249
889 3300009545 Ga0105237_10067784 Ga0105237_100677843 249
890 3300009551 Ga0105238_10231208 Ga0105238_102312082 249
891 3300009553 Ga0105249_10142703 Ga0105249_101427032 249
892 3300010375 Ga0105239_10349579 Ga0105239_103495793 249
893 3300010375 Ga0105239_10544274 Ga0105239_105442741 249
894 3300011119 Ga0105246_10376654 Ga0105246_103766542 249
895 3300012498 Ga0157345_1001625 Ga0157345_10016252 249
896 3300013297 Ga0157378_10184872 Ga0157378_101848722 249
897 3300013297 Ga0157378_10243177 Ga0157378_102431771 249
898 3300013306 Ga0163162_10156876 Ga0163162_101568762 249
899 3300013308 Ga0157375_10027552 Ga0157375_100275522 249
900 3300014968 Ga0157379_10034362 Ga0157379_100343624 249
901 3300014969 Ga0157376_10036819 Ga0157376_100368192 249
902 3300017792 Ga0163161_10066417 Ga0163161_100664174 249
903 3300021384 Ga0213876_10015303 Ga0213876_100153035 249
904 3300025290 Ga0207673_1000061 Ga0207673_10000616 249
905 3300025321 Ga0207656_10080624 Ga0207656_100806242 249
906 3300025898 Ga0207692_10006215 Ga0207692_100062154 249
907 3300025899 Ga0207642_10141071 Ga0207642_101410712 249
908 3300025900 Ga0207710_10010170 Ga0207710_100101703 249
909 3300025903 Ga0207680_10014420 Ga0207680_100144204 249
910 3300025903 Ga0207680_10047176 Ga0207680_100471761 249
911 3300025905 Ga0207685_10026299 Ga0207685_100262992 249
912 3300025906 Ga0207699_10001462 Ga0207699_100014622 249
913 3300025907 Ga0207645_10037279 Ga0207645_100372792 249
914 3300025911 Ga0207654_10055045 Ga0207654_100550451 249
915 3300025912 Ga0207707_10026952 Ga0207707_100269527 249
916 3300025915 Ga0207693_10005568 Ga0207693_1000556813 249
917 3300025915 Ga0207693_10022202 Ga0207693_100222023 249
918 3300025915 Ga0207693_10032414 Ga0207693_100324145 249
919 3300025919 Ga0207657_10036372 Ga0207657_100363725 249
920 3300025921 Ga0207652_10079199 Ga0207652_100791993 249
921 3300025921 Ga0207652_10326611 Ga0207652_103266111 249
922 3300025924 Ga0207694_10037102 Ga0207694_100371022 249
923 3300025927 Ga0207687_10011220 Ga0207687_100112208 249
924 3300025927 Ga0207687_10078689 Ga0207687_100786893 249
925 3300025928 Ga0207700_10000624 Ga0207700_1000062423 249
926 3300025928 Ga0207700_10223904 Ga0207700_102239042 249
927 3300025929 Ga0207664_10141511 Ga0207664_101415112 249
928 3300025931 Ga0207644_10006733 Ga0207644_1000673310 249
929 3300025932 Ga0207690_10035634 Ga0207690_100356344 249
930 3300025932 Ga0207690_10244729 Ga0207690_102447292 249
931 3300025934 Ga0207686_10005492 Ga0207686_100054922 249
932 3300025934 Ga0207686_10028899 Ga0207686_100288992 249
933 3300025935 Ga0207709_10080410 Ga0207709_100804102 249
934 3300025936 Ga0207670_10021268 Ga0207670_100212684 249
935 3300025939 Ga0207665_10001758 Ga0207665_100017584 249
936 3300025939 Ga0207665_10045219 Ga0207665_100452193 249
937 3300025939 Ga0207665_10093758 Ga0207665_100937582 249
938 3300025940 Ga0207691_10110030 Ga0207691_101100302 249
939 3300025941 Ga0207711_10008985 Ga0207711_1000898510 249
940 3300025942 Ga0207689_10050098 Ga0207689_100500985 249
941 3300025949 Ga0207667_10440264 Ga0207667_104402641 249
942 3300025961 Ga0207712_10035776 Ga0207712_100357762 249
943 3300025981 Ga0207640_10107011 Ga0207640_101070112 249
944 3300025986 Ga0207658_10188011 Ga0207658_101880111 249
945 3300026023 Ga0207677_10047121 Ga0207677_100471212 249
946 3300026035 Ga0207703_10023508 Ga0207703_100235082 249
947 3300026067 Ga0207678_10015442 Ga0207678_100154422 249
948 3300026067 Ga0207678_10018849 Ga0207678_100188496 249
949 3300026075 Ga0207708_10054858 Ga0207708_100548583 249
950 3300026078 Ga0207702_10685683 Ga0207702_106856832 249
951 3300026089 Ga0207648_10002036 Ga0207648_1000203616 249
952 3300026095 Ga0207676_10009322 Ga0207676_100093229 249
953 3300026118 Ga0207675_100178387 Ga0207675_1001783872 249
954 3300026121 Ga0207683_10001099 Ga0207683_100010993 249
955 3300026121 Ga0207683_10032902 Ga0207683_100329028 249
956 3300027682 Ga0209971_1045187 Ga0209971_10451872 249
957 3300027907 Ga0207428_10000082 Ga0207428_1000008215 249
958 3300027907 Ga0207428_10175649 Ga0207428_101756491 249
959 3300028379 Ga0268266_10006793 Ga0268266_100067932 249
960 3300028379 Ga0268266_10536164 Ga0268266_105361642 249
961 3300028381 Ga0268264_10016466 Ga0268264_100164666 249
962 3300031241 Ga0265325_10000043 Ga0265325_1000004363 249
963 3300031241 Ga0265325_10047267 Ga0265325_100472672 249
964 3300031250 Ga0265331_10093489 Ga0265331_100934892 249
965 3300031712 Ga0265342_10256916 Ga0265342_102569161 249
966 3300034817 Ga0373948_0043525 Ga0373948_0043525_34_783 249
967 3300034818 Ga0373950_0008305 Ga0373950_0008305_774_1523 249
968 3300034819 Ga0373958_0010662 Ga0373958_0010662_387_1136 249
969 3300034957 Ga0373938_0005774 Ga0373938_0005774_551_1300 249
970 3300035083 Ga0373926_0006274 Ga0373926_0006274_1548_2297 249
971 3300035083 Ga0373926_0068555 Ga0373926_0068555_519_1274 249
972 3300035086 Ga0373934_0009209 Ga0373934_0009209_2830_3585 249
973 3300035086 Ga0373934_0074324 Ga0373934_0074324_447_1202 249
974 3300035089 Ga0373944_0003334 Ga0373944_0003334_2599_3354 249
975 3300035089 Ga0373944_0007277 Ga0373944_0007277_1818_2567 249
976 3300035089 Ga0373944_0009507 Ga0373944_0009507_1734_2483 249
977 3300035090 Ga0373949_0004216 Ga0373949_0004216_817_1566 249
978 3300035111 Ga0373923_0007076 Ga0373923_0007076_2002_2751 249
979 3300035112 Ga0373932_0007745 Ga0373932_0007745_162_911 249
980 3300035113 Ga0373936_0005552 Ga0373936_0005552_2378_3127 249
981 3300035113 Ga0373936_0045306 Ga0373936_0045306_65_820 249
982 3300035113 Ga0373936_0079399 Ga0373936_0079399_38_787 249
983 3300035115 Ga0373941_0004229 Ga0373941_0004229_1589_2338 249
984 3300035116 Ga0373945_0026010 Ga0373945_0026010_539_1288 249
985 3300035117 Ga0373953_0001186 Ga0373953_0001186_3887_4642 249
986 3300035117 Ga0373953_0125982 Ga0373953_0125982_195_950 249
987 3300035119 Ga0373956_0013246 Ga0373956_0013246_1015_1764 249
988 3300035119 Ga0373956_0027556 Ga0373956_0027556_826_1575 249
989 3300035119 Ga0373956_0046875 Ga0373956_0046875_1062_1817 249
990 3300035120 Ga0373957_0057040 Ga0373957_0057040_204_959 249
991 3300035121 Ga0373960_0005847 Ga0373960_0005847_1759_2508 249
992 3300035170 Ga0373943_0008559 Ga0373943_0008559_3364_4119 249
993 3300035170 Ga0373943_0021286 Ga0373943_0021286_790_1539 249
994 3300035170 Ga0373943_0051473 Ga0373943_0051473_740_1489 249
995 3300035172 Ga0373955_0008111 Ga0373955_0008111_821_1576 249
996 3300035207 Ga0373942_0012638 Ga0373942_0012638_637_1386 249
997 3300035241 Ga0373961_0003260 Ga0373961_0003260_1485_2234 249
998 3300035242 Ga0373962_0035508 Ga0373962_0035508_339_1088 249
999 3300035410 Ga0373924_0032147 Ga0373924_0032147_834_1589 249
1000 3300035691 Ga0373931_0023751 Ga0373931_0023751_2034_2783 249
1001 3300035692 Ga0373935_0006957 Ga0373935_0006957_5404_6153 249
1002 3300035692 Ga0373935_0131752 Ga0373935_0131752_602_1357 249
1003 3300035695 Ga0373927_0048608 Ga0373927_0048608_1310_2059 249
1004 3300035724 Ga0373933_0001224 Ga0373933_0001224_1379_2134 249
1005 3300035724 Ga0373933_0013762 Ga0373933_0013762_2181_2930 249
1006 3300035724 Ga0373933_0024904 Ga0373933_0024904_1832_2587 249
1007 3300035725 Ga0373947_0032762 Ga0373947_0032762_148_897 249
1008 3300035725 Ga0373947_0083977 Ga0373947_0083977_776_1531 249
1009 3300036401 Ga0373937_0000849 Ga0373937_0000849_10027_10782 249
1010 3300036401 Ga0373937_0034021 Ga0373937_0034021_1481_2230 249
1011 3300036401 Ga0373937_0047581 Ga0373937_0047581_1306_2061 249
1012 3300036401 Ga0373937_0138833 Ga0373937_0138833_943_1692 249
1013 3300037068 Ga0373925_0023317 Ga0373925_0023317_344_1099 249
1014 3300037068 Ga0373925_0042182 Ga0373925_0042182_1732_2487 249
1015 3300039437 Ga0436365_1174025 Ga0436365_1174025_1748_2497 249
1016 3300039453 Ga0436362_0096256 Ga0436362_0096256_3088_3837 249
1017 3300046452 Ga0495617_013564 Ga0495617_013564_305_1054 249
1018 3300046454 Ga0495592_0031170 Ga0495592_0031170_2270_3025 249
1019 3300046454 Ga0495592_0114759 Ga0495592_0114759_725_1474 249
1020 3300046454 Ga0495592_0124090 Ga0495592_0124090_726_1475 249
1021 3300046455 Ga0495603_0033576 Ga0495603_0033576_1604_2359 249
1022 3300046459 Ga0495629_0000062 Ga0495629_0000062_87879_88628 249
1023 3300046461 Ga0495641_0042022 Ga0495641_0042022_334_1089 249
1024 3300046461 Ga0495641_0072448 Ga0495641_0072448_18_767 249
1025 3300046462 Ga0495651_0020865 Ga0495651_0020865_1074_1829 249
1026 3300046462 Ga0495651_0022743 Ga0495651_0022743_840_1589 249
1027 3300046463 Ga0495653_0048987 Ga0495653_0048987_98_853 249
1028 3300046463 Ga0495653_0117336 Ga0495653_0117336_950_1705 249
1029 3300046472 Ga0495580_0092029 Ga0495580_0092029_1345_2094 249
1030 3300046475 Ga0495639_0008961 Ga0495639_0008961_848_1597 249
1031 3300046475 Ga0495639_0035781 Ga0495639_0035781_1335_2090 249
1032 3300046476 Ga0495662_0006739 Ga0495662_0006739_3182_3931 249
1033 3300046476 Ga0495662_0022613 Ga0495662_0022613_685_1440 249
1034 3300046477 Ga0495664_0020123 Ga0495664_0020123_1429_2178 249
1035 3300046477 Ga0495664_0078940 Ga0495664_0078940_1180_1935 249
1036 3300046477 Ga0495664_0170208 Ga0495664_0170208_451_1206 249
1037 3300046491 Ga0495584_0021105 Ga0495584_0021105_235_984 249
1038 3300046492 Ga0495585_0002429 Ga0495585_0002429_9679_10428 249
1039 3300046499 Ga0495594_0028654 Ga0495594_0028654_785_1534 249
1040 3300046499 Ga0495594_0174336 Ga0495594_0174336_347_1096 249
1041 3300046511 Ga0495608_0001948 Ga0495608_0001948_924_1679 249
1042 3300046511 Ga0495608_0055984 Ga0495608_0055984_1712_2461 249
1043 3300046511 Ga0495608_0197846 Ga0495608_0197846_206_961 249
1044 3300046514 Ga0495618_0025063 Ga0495618_0025063_1309_2064 249
1045 3300046514 Ga0495618_0050959 Ga0495618_0050959_696_1445 249
1046 3300046516 Ga0495628_0009783 Ga0495628_0009783_1765_2520 249
1047 3300046516 Ga0495628_0012772 Ga0495628_0012772_5364_6119 249
1048 3300046516 Ga0495628_0071647 Ga0495628_0071647_738_1487 249
1049 3300046523 Ga0495644_0004855 Ga0495644_0004855_2866_3615 249
1050 3300046526 Ga0495666_0030778 Ga0495666_0030778_1751_2500 249
1051 3300046529 Ga0495652_0023129 Ga0495652_0023129_1769_2524 249
1052 3300046529 Ga0495652_0093555 Ga0495652_0093555_1306_2061 249
1053 3300046529 Ga0495652_0352197 Ga0495652_0352197_175_924 249
1054 3300046531 Ga0495665_0034160 Ga0495665_0034160_106_861 249
1055 3300046531 Ga0495665_0140281 Ga0495665_0140281_340_1089 249
1056 3300046533 Ga0495640_0103700 Ga0495640_0103700_461_1210 249
1057 3300046533 Ga0495640_0105939 Ga0495640_0105939_135_890 249
1058 3300046533 Ga0495640_0136159 Ga0495640_0136159_760_1515 249
1059 3300046535 Ga0495586_0053241 Ga0495586_0053241_475_1230 249
1060 3300046536 Ga0495587_0030802 Ga0495587_0030802_956_1705 249
1061 3300046538 Ga0495609_0143510 Ga0495609_0143510_236_985 249
1062 3300046543 Ga0495645_0020277 Ga0495645_0020277_3064_3819 249
1063 3300046559 Ga0495667_0001067 Ga0495667_0001067_13064_13819 249
1064 3300046559 Ga0495667_0013909 Ga0495667_0013909_3656_4411 249
1065 3300046559 Ga0495667_0117677 Ga0495667_0117677_168_917 249
1066 3300046559 Ga0495667_0337744 Ga0495667_0337744_117_866 249
1067 3300046615 Ga0495656_0002593 Ga0495656_0002593_3226_3975 249
1068 3300046648 Ga0495611_0020648 Ga0495611_0020648_22_771 249
1069 3300046663 Ga0495635_0019587 Ga0495635_0019587_1320_2069 249
1070 3300046663 Ga0495635_0065327 Ga0495635_0065327_1287_2036 249
1071 3300046663 Ga0495635_0090619 Ga0495635_0090619_1296_2051 249
1072 3300046663 Ga0495635_0107543 Ga0495635_0107543_142_897 249
1073 3300046664 Ga0495659_0006541 Ga0495659_0006541_1817_2566 249
1074 3300046665 Ga0495661_0039661 Ga0495661_0039661_310_1059 249
1075 3300046674 Ga0495588_0019088 Ga0495588_0019088_694_1443 249
1076 3300046674 Ga0495588_0039698 Ga0495588_0039698_885_1640 249
1077 3300046675 Ga0495657_0016143 Ga0495657_0016143_2529_3284 249
1078 3300046675 Ga0495657_0033154 Ga0495657_0033154_1122_1877 249
1079 3300046675 Ga0495657_0339765 Ga0495657_0339765_89_844 249
1080 3300046678 Ga0495599_0002423 Ga0495599_0002423_5200_5955 249
1081 3300046678 Ga0495599_0002462 Ga0495599_0002462_1427_2182 249
1082 3300046678 Ga0495599_0027197 Ga0495599_0027197_1174_1923 249
1083 3300046679 Ga0495623_0003667 Ga0495623_0003667_2147_2902 249
1084 3300046679 Ga0495623_0039933 Ga0495623_0039933_317_1072 249
1085 3300046680 Ga0495646_0001912 Ga0495646_0001912_9059_9808 249
1086 3300046680 Ga0495646_0024134 Ga0495646_0024134_2279_3034 249
1087 3300046681 Ga0495647_0160541 Ga0495647_0160541_186_935 249
1088 3300046683 Ga0495658_0058438 Ga0495658_0058438_235_984 249
1089 3300046683 Ga0495658_0078615 Ga0495658_0078615_347_1096 249
1090 3300046689 Ga0495613_0030125 Ga0495613_0030125_1046_1795 249
1091 3300046689 Ga0495613_0081327 Ga0495613_0081327_938_1687 249
1092 3300046690 Ga0495624_0066588 Ga0495624_0066588_722_1477 249
1093 3300046690 Ga0495624_0231751 Ga0495624_0231751_352_1101 249
1094 3300046691 Ga0495670_0001352 Ga0495670_0001352_6519_7268 249
1095 3300046809 Ga0495600_0005044 Ga0495600_0005044_2689_3438 249
1096 3300046809 Ga0495600_0030328 Ga0495600_0030328_1044_1799 249
1097 3300046809 Ga0495600_0031854 Ga0495600_0031854_1886_2641 249
1098 3300047315 Ga0495581_0013989 Ga0495581_0013989_841_1590 249
1099 3300047315 Ga0495581_0062351 Ga0495581_0062351_117_866 249
1100 3300047317 Ga0495604_0004097 Ga0495604_0004097_9159_9908 249
1101 3300047317 Ga0495604_0009091 Ga0495604_0009091_848_1603 249
1102 3300047317 Ga0495604_0013822 Ga0495604_0013822_4887_5642 249
1103 3300047317 Ga0495604_0028326 Ga0495604_0028326_2319_3068 249
1104 3300047319 Ga0495674_0026001 Ga0495674_0026001_812_1561 249
1105 3300047319 Ga0495674_0084024 Ga0495674_0084024_1155_1910 249
1106 3300047322 Ga0495680_0014800 Ga0495680_0014800_5945_6694 249
1107 3300047322 Ga0495680_0055329 Ga0495680_0055329_1485_2234 249
1108 3300047322 Ga0495680_0180576 Ga0495680_0180576_477_1232 249
1109 3300047322 Ga0495680_0408230 Ga0495680_0408230_18_773 249
1110 3300047444 Ga0495675_0001338 Ga0495675_0001338_12856_13611 249
1111 3300047444 Ga0495675_0035048 Ga0495675_0035048_1207_1962 249
1112 3300047471 Ga0495684_0034589 Ga0495684_0034589_1842_2591 249
1113 3300047673 Ga0495593_0018657 Ga0495593_0018657_2337_3086 249
1114 3300047673 Ga0495593_0074108 Ga0495593_0074108_110_859 249
1115 3300048088 Ga0495602_0002392 Ga0495602_0002392_5433_6188 249
1116 3300048088 Ga0495602_0040040 Ga0495602_0040040_1797_2552 249
1117 3300048089 Ga0495614_0016010 Ga0495614_0016010_1792_2541 249
1118 3300048903 Ga0496100_0081168 Ga0496100_0081168_1248_2003 249
1119 3300048903 Ga0496100_0235230 Ga0496100_0235230_170_919 249
1120 3300048906 Ga0496103_0028858 Ga0496103_0028858_1456_2205 249
1121 3300048907 Ga0496104_0000528 Ga0496104_0000528_29834_30589 249
1122 3300048907 Ga0496104_0053102 Ga0496104_0053102_1699_2454 249
1123 3300048907 Ga0496104_0695566 Ga0496104_0695566_43_792 249
1124 3300048908 Ga0496105_0001587 Ga0496105_0001587_10556_11311 249
1125 3300048908 Ga0496105_0043589 Ga0496105_0043589_2759_3514 249
1126 3300048908 Ga0496105_0101523 Ga0496105_0101523_172_921 249
1127 3300048908 Ga0496105_0231257 Ga0496105_0231257_170_919 249
1128 3300048909 Ga0496106_0010684 Ga0496106_0010684_16_771 249
1129 3300048909 Ga0496106_0187467 Ga0496106_0187467_268_1017 249
1130 3300048909 Ga0496106_0285497 Ga0496106_0285497_559_1308 249
1131 3300048910 Ga0496107_0021482 Ga0496107_0021482_1919_2668 249
1132 3300048910 Ga0496107_0034610 Ga0496107_0034610_2533_3288 249
1133 3300048911 Ga0496108_0246053 Ga0496108_0246053_635_1384 249
1134 3300048912 Ga0496109_0375200 Ga0496109_0375200_164_913 249
1135 3300048913 Ga0496110_0524359 Ga0496110_0524359_32_781 249
1136 3300048914 Ga0496111_0108616 Ga0496111_0108616_308_1057 249
1137 3300048915 Ga0496112_0264067 Ga0496112_0264067_105_854 249
1138 3300048916 Ga0496113_0102944 Ga0496113_0102944_592_1341 249
1139 3300048917 Ga0496114_0035315 Ga0496114_0035315_718_1473 249
1140 3300048917 Ga0496114_0056359 Ga0496114_0056359_1097_1846 249
1141 3300049571 Ga0501034_0141364 Ga0501034_0141364_1220_1972 249
1142 3300049572 Ga0501036_0029281 Ga0501036_0029281_2364_3116 249
1143 3300049581 Ga0501047_0547731 Ga0501047_0547731_82_834 249
1144 3300049823 Ga0501044_0422212 Ga0501044_0422212_271_1023 249
1145 3300050507 nmdc:mga05p37_19_c3 nmdc:mga05p37_19_c3_19255_20004 249
1146 3300050508 nmdc:mga09592_758_c1 nmdc:mga09592_758_c1_18010_18759 249
1147 3300050509 nmdc:mga0qj67_1779_c1 nmdc:mga0qj67_1779_c1_9339_10088 249
1148 3300050510 nmdc:mga06r32_4145_c1 nmdc:mga06r32_4145_c1_6154_6903 249
1149 3300050511 nmdc:mga08y16_238686_c1 nmdc:mga08y16_238686_c1_367_1116 249
1150 3300050511 nmdc:mga08y16_46719_c1 nmdc:mga08y16_46719_c1_725_1474 249
1151 3300050512 nmdc:mga0n895_1573_c1 nmdc:mga0n895_1573_c1_3059_3808 249
1152 3300050512 nmdc:mga0n895_375865_c1 nmdc:mga0n895_375865_c1_436_1185 249
1153 3300050513 nmdc:mga0rr50_32274_c1 nmdc:mga0rr50_32274_c1_431_1180 249
1154 3300050513 nmdc:mga0rr50_390_c1 nmdc:mga0rr50_390_c1_17320_18069 249
1155 3300050514 nmdc:mga08x19_42973_c1 nmdc:mga08x19_42973_c1_353_1102 249
1156 3300050514 nmdc:mga08x19_85416_c1 nmdc:mga08x19_85416_c1_52_801 249
1157 3300050515 nmdc:mga0a205_681_c1 nmdc:mga0a205_681_c1_21310_22059 249
1158 3300050515 nmdc:mga0a205_79345_c1 nmdc:mga0a205_79345_c1_2161_2910 249
1159 3300053077 Ga0495601_0000680 Ga0495601_0000680_13624_14379 249
1160 3300053077 Ga0495601_0003107 Ga0495601_0003107_2221_2970 249
1161 3300053077 Ga0495601_0068588 Ga0495601_0068588_1189_1944 249
1162 3300053078 Ga0495612_0004246 Ga0495612_0004246_3605_4360 249
1163 3300053078 Ga0495612_0040633 Ga0495612_0040633_917_1666 249
1164 3300053078 Ga0495612_0044087 Ga0495612_0044087_18_767 249
1165 3300053084 Ga0495595_0000365 Ga0495595_0000365_14799_15548 249
1166 3300053084 Ga0495595_0003679 Ga0495595_0003679_1722_2477 249
1167 3300053084 Ga0495595_0023228 Ga0495595_0023228_1550_2299 249
1168 3300053085 Ga0495619_0000378 Ga0495619_0000378_13377_14126 249
1169 3300053085 Ga0495619_0000897 Ga0495619_0000897_13746_14495 249
1170 3300053085 Ga0495619_0024786 Ga0495619_0024786_2561_3310 249
1171 3300053085 Ga0495619_0085476 Ga0495619_0085476_30_785 249
1172 3300053085 Ga0495619_0291015 Ga0495619_0291015_59_814 249
1173 2209111006 2214683824 2213702577 250
1174 3300000041 ARcpr5oldR_c000960 ARcpr5oldR_0009602 250
1175 3300000042 ARSoilYngRDRAFT_c00484 ARSoilYngRDRAFT_004847 250
1176 3300000043 ARcpr5yngRDRAFT_c000683 ARcpr5yngRDRAFT_0006836 250
1177 3300000044 ARSoilOldRDRAFT_c000056 ARSoilOldRDRAFT_00005623 250
1178 3300000045 ARCol0oldRDRAFT_c00385 ARCol0oldRDRAFT_003851 250
1179 3300000652 ARCol0yngRDRAFT_1000069 ARCol0yngRDRAFT_10000691 250
1180 3300001990 JGI24737J22298_10020399 JGI24737J22298_100203993 250
1181 3300005277 Ga0065716_1001578 Ga0065716_10015789 250
1182 3300005289 Ga0065704_10020946 Ga0065704_100209462 250
1183 3300005290 Ga0065712_10006735 Ga0065712_100067352 250
1184 3300005293 Ga0065715_10002029 Ga0065715_100020292 250
1185 3300005295 Ga0065707_10122926 Ga0065707_101229261 250
1186 3300005330 Ga0070690_100012134 Ga0070690_1000121341 250
1187 3300005331 Ga0070670_100022469 Ga0070670_1000224698 250
1188 3300005336 Ga0070680_100024207 Ga0070680_1000242075 250
1189 3300005340 Ga0070689_100069420 Ga0070689_1000694203 250
1190 3300005340 Ga0070689_100131877 Ga0070689_1001318771 250
1191 3300005341 Ga0070691_10025483 Ga0070691_100254831 250
1192 3300005345 Ga0070692_10018948 Ga0070692_100189482 250
1193 3300005353 Ga0070669_100062339 Ga0070669_1000623393 250
1194 3300005354 Ga0070675_100220573 Ga0070675_1002205732 250
1195 3300005356 Ga0070674_100035549 Ga0070674_1000355491 250
1196 3300005365 Ga0070688_100068213 Ga0070688_1000682131 250
1197 3300005366 Ga0070659_100149522 Ga0070659_1001495222 250
1198 3300005367 Ga0070667_100042342 Ga0070667_1000423426 250
1199 3300005367 Ga0070667_100218666 Ga0070667_1002186661 250
1200 3300005438 Ga0070701_10028731 Ga0070701_100287311 250
1201 3300005440 Ga0070705_100404685 Ga0070705_1004046852 250
1202 3300005441 Ga0070700_100014797 Ga0070700_1000147971 250
1203 3300005444 Ga0070694_100019456 Ga0070694_1000194565 250
1204 3300005455 Ga0070663_100012921 Ga0070663_1000129219 250
1205 3300005457 Ga0070662_100203962 Ga0070662_1002039622 250
1206 3300005458 Ga0070681_10281525 Ga0070681_102815251 250
1207 3300005459 Ga0068867_100135265 Ga0068867_1001352651 250
1208 3300005466 Ga0070685_10232234 Ga0070685_102322342 250
1209 3300005544 Ga0070686_100013596 Ga0070686_1000135962 250
1210 3300005546 Ga0070696_100140069 Ga0070696_1001400692 250
1211 3300005549 Ga0070704_100111030 Ga0070704_1001110302 250
1212 3300005617 Ga0068859_100060567 Ga0068859_1000605674 250
1213 3300005617 Ga0068859_100358863 Ga0068859_1003588632 250
1214 3300005719 Ga0068861_100067567 Ga0068861_1000675674 250
1215 3300005842 Ga0068858_100238575 Ga0068858_1002385752 250
1216 3300005844 Ga0068862_100030660 Ga0068862_1000306601 250
1217 3300006881 Ga0068865_100112839 Ga0068865_1001128392 250
1218 3300006931 Ga0097620_100060567 Ga0097620_1000605674 250
1219 3300006931 Ga0097620_100358823 Ga0097620_1003588231 250
1220 3300009094 Ga0111539_10094883 Ga0111539_100948833 250
1221 3300009094 Ga0111539_10318811 Ga0111539_103188112 250
1222 3300009101 Ga0105247_10083629 Ga0105247_100836292 250
1223 3300009148 Ga0105243_10114907 Ga0105243_101149072 250
1224 3300009177 Ga0105248_10460221 Ga0105248_104602211 250
1225 3300009545 Ga0105237_10039367 Ga0105237_100393675 250
1226 3300010375 Ga0105239_10197284 Ga0105239_101972841 250
1227 3300011119 Ga0105246_10483828 Ga0105246_104838282 250
1228 3300012492 Ga0157335_1001212 Ga0157335_10012122 250
1229 3300013308 Ga0157375_10413884 Ga0157375_104138841 250
1230 3300014325 Ga0163163_10003323 Ga0163163_100033231 250
1231 3300014326 Ga0157380_10564885 Ga0157380_105648852 250
1232 3300014968 Ga0157379_10089280 Ga0157379_100892801 250
1233 3300025271 Ga0207666_1003558 Ga0207666_10035581 250
1234 3300025900 Ga0207710_10046923 Ga0207710_100469231 250
1235 3300025904 Ga0207647_10027189 Ga0207647_100271893 250
1236 3300025912 Ga0207707_10376174 Ga0207707_103761741 250
1237 3300025917 Ga0207660_10126548 Ga0207660_101265481 250
1238 3300025919 Ga0207657_10080547 Ga0207657_100805471 250
1239 3300025923 Ga0207681_10393816 Ga0207681_103938161 250
1240 3300025925 Ga0207650_10044066 Ga0207650_100440662 250
1241 3300025926 Ga0207659_10058879 Ga0207659_100588793 250
1242 3300025931 Ga0207644_10155311 Ga0207644_101553111 250
1243 3300025932 Ga0207690_10239543 Ga0207690_102395431 250
1244 3300025933 Ga0207706_10016238 Ga0207706_1001623810 250
1245 3300025936 Ga0207670_10170803 Ga0207670_101708031 250
1246 3300025937 Ga0207669_10008197 Ga0207669_100081976 250
1247 3300025938 Ga0207704_10125902 Ga0207704_101259022 250
1248 3300025941 Ga0207711_10343123 Ga0207711_103431232 250
1249 3300025945 Ga0207679_10528986 Ga0207679_105289861 250
1250 3300025961 Ga0207712_10228959 Ga0207712_102289592 250
1251 3300025986 Ga0207658_10018395 Ga0207658_100183957 250
1252 3300026035 Ga0207703_10243501 Ga0207703_102435012 250
1253 3300026041 Ga0207639_10188342 Ga0207639_101883422 250
1254 3300026075 Ga0207708_10027504 Ga0207708_100275041 250
1255 3300026089 Ga0207648_10157247 Ga0207648_101572472 250
1256 3300026142 Ga0207698_10143522 Ga0207698_101435221 250
1257 3300027471 Ga0209995_1016685 Ga0209995_10166852 250
1258 3300027695 Ga0209966_1003556 Ga0209966_10035563 250
1259 3300027717 Ga0209998_10006389 Ga0209998_100063892 250
1260 3300028381 Ga0268264_10539477 Ga0268264_105394771 250
1261 3300031344 Ga0265316_10093930 Ga0265316_100939302 250
1262 3300034816 Ga0373930_0001507 Ga0373930_0001507_259_1011 250
1263 3300034817 Ga0373948_0000117 Ga0373948_0000117_5802_6554 250
1264 3300034818 Ga0373950_0000396 Ga0373950_0000396_3734_4486 250
1265 3300035084 Ga0373928_0006026 Ga0373928_0006026_697_1449 250
1266 3300035085 Ga0373929_0000961 Ga0373929_0000961_2893_3645 250
1267 3300035088 Ga0373940_0001118 Ga0373940_0001118_3566_4318 250
1268 3300035091 Ga0373951_0013415 Ga0373951_0013415_939_1691 250
1269 3300035112 Ga0373932_0000255 Ga0373932_0000255_864_1616 250
1270 3300035114 Ga0373939_0021302 Ga0373939_0021302_223_975 250
1271 3300035121 Ga0373960_0007815 Ga0373960_0007815_894_1646 250
1272 3300035241 Ga0373961_0025734 Ga0373961_0025734_619_1371 250
1273 3300042008 Ga0439450_003393 Ga0439450_003393_1813_2565 250
1274 3300042461 Ga0439460_0058776 Ga0439460_0058776_31_789 250
1275 3300042876 Ga0451577_0052576 Ga0451577_0052576_1735_2487 250
1276 3300045051 Ga0451576_0040952 Ga0451576_0040952_942_1694 250
1277 3300048905 Ga0496102_0009899 Ga0496102_0009899_1296_2048 250
1278 3300048906 Ga0496103_0052832 Ga0496103_0052832_223_975 250
1279 3300048907 Ga0496104_0150963 Ga0496104_0150963_998_1750 250
1280 3300048909 Ga0496106_0061507 Ga0496106_0061507_1736_2488 250
1281 3300048910 Ga0496107_0096950 Ga0496107_0096950_480_1232 250
1282 3300048910 Ga0496107_0129718 Ga0496107_0129718_903_1655 250
1283 3300048911 Ga0496108_0002310 Ga0496108_0002310_8128_8880 250
1284 3300048912 Ga0496109_0012832 Ga0496109_0012832_3512_4264 250
1285 3300048912 Ga0496109_0291611 Ga0496109_0291611_554_1306 250
1286 3300048913 Ga0496110_0180951 Ga0496110_0180951_419_1171 250
1287 3300048914 Ga0496111_0115205 Ga0496111_0115205_208_960 250
1288 3300048915 Ga0496112_0238505 Ga0496112_0238505_609_1361 250
1289 3300048916 Ga0496113_0066487 Ga0496113_0066487_981_1733 250
1290 3300048916 Ga0496113_0068360 Ga0496113_0068360_1534_2286 250
1291 3300049591 Ga0501075_0079925 Ga0501075_0079925_1562_2314 250
1292 3300049593 Ga0501077_0023267 Ga0501077_0023267_1732_2484 250
1293 3300049742 Ga0501080_0195503 Ga0501080_0195503_358_1110 250
1294 3300050490 nmdc:mga03n38_151130_c1 nmdc:mga03n38_151130_c1_159_911 250
1295 3300050511 nmdc:mga08y16_253307_c1 nmdc:mga08y16_253307_c1_838_1590 250
1296 3300053085 Ga0495619_0121249 Ga0495619_0121249_473_1225 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

14

123

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

157

233

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9842 7 122
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9809 6 124
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9803 7 122
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9789 7 122
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9775 5 123
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9933 7 84 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9874 6 84 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9785 6 84 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9784 6 84 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9782 7 84 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3C0Z4C2-F1-model_v4 DNA-binding response regulator 0.981 7 124 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A522UKK1-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9778 3 128 GO:0000155
AF-A0A0G1YX15-F1-model_v4 PAS domain S-box 0.9767 5 125 GO:0000160
AF-A0A7C1ETQ0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9747 5 128 GO:0000155
AF-A0A1F9VDU4-F1-model_v4 Response regulatory domain-containing protein 0.9744 1 121 GO:0000160
GO:0003677

Feature Viewer

pLDDT pTM Quality
88.02 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map