F492736
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1300 | 848 | 2600 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_100260722|Ga0070669_1002607223 |
| Length | 176 |
| Sequence | MSLSAIDFASDCNEAATALISHMTKTDVSNLTQLGHATALPANPDEAVLERVPNSQGKTIYLVRFVAPEFTSLCPMTGQPDFAHLVIDYVPGRWLVESKSLKLYLGSFRNHGSFHEDCTVGIGKRLVKELKPVWLRIGGYWYPRGGIPIDVFWQTAAPPKGLWLPDQGVPPYRGRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 20 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 69 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 85 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 89 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 102 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 103 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 104 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 108 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 109 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 110 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 165 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 169 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 171 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 187 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 188 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 203 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 204 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 205 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 206 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 207 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 208 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 212 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 213 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 214 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 215 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 216 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 217 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 218 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 219 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 220 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 221 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 222 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 223 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 224 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 225 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 229 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 287 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 288 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 289 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 290 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 293 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 294 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 295 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 296 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 297 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 330 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 344 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 345 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 347 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 348 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 349 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 350 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 351 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 352 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 355 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 358 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 361 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 362 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 363 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 364 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 365 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 366 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 367 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 368 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 369 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 371 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 372 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 380 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 381 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 382 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 383 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 384 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 385 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 386 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 387 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 388 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 389 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 390 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 391 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 392 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 393 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 394 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 395 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 396 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 397 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 398 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 399 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 400 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 401 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 402 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 403 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 404 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 405 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 406 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 407 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 408 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 409 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 410 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 411 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 412 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 413 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 414 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 415 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 416 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 417 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 418 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 419 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 420 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 421 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 422 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 423 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 424 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 425 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 426 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 427 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 428 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 429 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 430 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 431 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 432 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 433 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 434 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 435 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 436 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 437 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 438 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 439 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 440 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 441 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 442 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 443 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 444 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 445 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 446 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 447 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 448 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 449 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 450 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 451 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 452 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 453 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 454 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 455 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 456 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 457 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 458 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 459 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 460 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 461 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 462 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 463 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 464 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 465 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 466 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 467 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 468 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 469 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 470 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 471 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 472 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 473 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 474 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 475 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 476 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 477 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 478 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 479 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 480 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 481 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 482 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 483 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 484 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 485 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 486 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 487 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 488 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 489 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 490 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 491 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 492 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 493 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 494 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 495 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 496 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 497 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 498 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 499 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 500 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 501 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 502 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 503 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 504 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 505 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 506 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 507 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 508 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 509 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 510 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 511 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 512 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 513 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 514 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 515 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 516 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 517 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 518 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 519 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 520 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 521 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 522 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 523 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 524 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 525 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 526 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 527 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 528 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 529 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 530 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 531 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 532 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 533 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 534 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 535 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 536 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 537 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 538 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 539 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 540 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 541 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 542 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 543 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 544 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 545 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 546 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 547 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 548 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 549 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 550 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 551 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 552 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 553 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 554 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 555 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 556 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 557 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 558 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 559 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 560 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 561 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 562 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 563 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 564 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 565 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 566 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 567 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 568 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 569 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 570 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 571 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 572 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 573 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 574 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 575 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 576 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 577 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 578 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 579 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 580 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 581 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 582 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 583 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 584 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 585 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 586 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 587 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 588 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 589 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 590 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 591 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 592 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 593 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 594 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 595 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 596 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 597 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 598 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 599 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 600 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 601 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 602 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 603 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 604 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 605 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 606 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 607 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 608 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 609 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 610 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 611 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 612 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 613 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 614 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 615 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 616 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 617 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 618 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 619 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 620 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 621 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 622 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 623 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 624 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 625 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 626 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 627 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 628 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 629 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 630 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 631 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 632 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 633 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 634 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 635 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 636 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 637 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 638 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 639 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 640 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 641 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 642 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 643 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 644 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 645 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 646 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 647 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 648 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 649 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 650 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 651 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 652 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 653 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 654 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 655 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 656 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 657 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 658 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 659 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 660 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 661 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 662 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 663 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 664 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 665 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 666 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 667 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 668 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 669 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 670 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 671 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 672 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 673 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 674 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 675 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 676 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 677 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 678 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 679 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 680 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 681 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 682 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 683 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 684 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 685 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 686 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 687 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 688 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 689 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 690 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 691 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 692 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 693 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 694 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 695 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 696 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 697 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 698 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 699 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 700 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 701 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 702 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 703 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 704 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 705 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 706 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 707 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 708 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 709 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 710 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 711 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 712 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 713 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 714 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 715 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 716 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 717 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 718 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 719 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 720 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 721 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 722 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 723 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 724 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 725 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 726 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 727 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 728 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 729 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 730 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 731 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 732 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 733 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 734 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 735 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 736 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 737 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 738 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 739 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 740 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 741 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 742 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 743 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 744 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 745 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 746 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 747 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 748 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 749 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 750 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 751 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 752 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 753 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 754 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 755 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 756 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 757 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 758 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 759 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 760 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 761 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 762 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 763 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 764 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 765 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 766 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 767 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 768 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 769 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 770 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 771 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 772 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 773 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 774 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 775 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 776 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 777 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 778 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 779 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 780 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 781 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 782 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 783 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 784 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 785 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 786 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 787 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 788 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 789 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 790 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 791 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 792 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 793 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 794 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 795 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 796 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 797 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 798 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 799 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 800 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 801 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 802 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 803 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 804 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 805 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 806 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 807 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 808 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 809 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 810 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 811 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 812 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 813 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 814 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 815 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 816 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 817 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 818 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 819 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 820 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 821 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 822 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 823 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 824 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 825 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 826 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 827 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 828 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 829 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 830 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 831 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 832 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 833 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 834 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 835 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 836 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 837 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 838 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 839 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 840 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 841 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 842 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 843 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 844 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 845 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 846 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
| 847 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 848 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 63.08 |
| Metatranscriptomes | 0.77 |
| Isolates | 36.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.38 |
| Bulb | 0 |
| Endosphere | 22.54 |
| Nodule | 24.54 |
| Rhizoplane | 2 |
| Rhizosphere | 32.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070669_100260722 | 3300005353 | Bacteria | 1383 |
| 2 | JGI24740J21852_10003638 | 3300001979 | Bacteria | 6721 |
| 3 | JGI24739J22299_10033117 | 3300001989 | Bacteria | 1771 |
| 4 | JGI25155J39150_1000014 | 3300002704 | Bacteria | 196159 |
| 5 | JGI25156J39149_1000037 | 3300002705 | Bacteria | 109690 |
| 6 | JGI25156J39149_1000079 | 3300002705 | Bacteria | 73408 |
| 7 | JGI25162J39368_1000497 | 3300002737 | Bacteria | 29860 |
| 8 | JGI25162J39368_1000992 | 3300002737 | Bacteria | 17927 |
| 9 | JGI25154J39366_1000052 | 3300002738 | Bacteria | 120209 |
| 10 | JGI25158J39367_1000499 | 3300002739 | Bacteria | 7922 |
| 11 | JGI25157J39369_1000040 | 3300002741 | Bacteria | 126165 |
| 12 | JGI25152J39213_1001025 | 3300002773 | Bacteria | 13379 |
| 13 | JGI25152J39213_1002772 | 3300002773 | Bacteria | 6349 |
| 14 | JGI25152J39213_1004429 | 3300002773 | Bacteria | 4424 |
| 15 | JGI25152J39213_1020840 | 3300002773 | Bacteria | 1163 |
| 16 | JGI25152J39213_1029794 | 3300002773 | Bacteria | 854 |
| 17 | JGI25150J39212_1000088 | 3300002774 | Bacteria | 53538 |
| 18 | JGI25150J39212_1015270 | 3300002774 | Bacteria | 1285 |
| 19 | JGI25150J39212_1027871 | 3300002774 | Bacteria | 805 |
| 20 | JGI25159J45721_1000004 | 3300002987 | Bacteria | 215789 |
| 21 | JGI25159J45721_1001399 | 3300002987 | Bacteria | 10011 |
| 22 | JGI25159J45721_1006965 | 3300002987 | Bacteria | 3304 |
| 23 | JGI25151J46595_10000215 | 3300003187 | Bacteria | 69771 |
| 24 | JGI25151J46595_10000280 | 3300003187 | Bacteria | 58125 |
| 25 | JGI25151J46595_10005849 | 3300003187 | Bacteria | 6291 |
| 26 | JGI25151J46595_10006069 | 3300003187 | Bacteria | 6142 |
| 27 | JGI25151J46595_10024325 | 3300003187 | Bacteria | 2480 |
| 28 | JGI25151J46595_10024843 | 3300003187 | Bacteria | 2445 |
| 29 | JGI25151J46595_10038793 | 3300003187 | Bacteria | 1767 |
| 30 | JGI25151J46595_10052475 | 3300003187 | Bacteria | 1371 |
| 31 | JGI25151J46595_10065287 | 3300003187 | Bacteria | 1134 |
| 32 | JGI25151J46595_10129791 | 3300003187 | Bacteria | 629 |
| 33 | JGI25406J46586_10003554 | 3300003203 | Bacteria | 7306 |
| 34 | JGI25165J46597_1000371 | 3300003214 | Bacteria | 50062 |
| 35 | JGI25165J46597_1000462 | 3300003214 | Bacteria | 40205 |
| 36 | JGI25165J46597_1005670 | 3300003214 | Bacteria | 2358 |
| 37 | JGI25153J46596_10001244 | 3300003215 | Bacteria | 15371 |
| 38 | JGI25153J46596_10007382 | 3300003215 | Bacteria | 5419 |
| 39 | JGI25153J46596_10017172 | 3300003215 | Bacteria | 2862 |
| 40 | JGI25153J46596_10032466 | 3300003215 | Bacteria | 1741 |
| 41 | rootH1_10177570 | 3300003323 | Bacteria | 1729 |
| 42 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 43 | JGI25160J50197_1000021 | 3300003354 | Bacteria | 215789 |
| 44 | JGI25160J50197_1001207 | 3300003354 | Bacteria | 13131 |
| 45 | JGI25160J50197_1011565 | 3300003354 | Bacteria | 3120 |
| 46 | JGI25160J50197_1022474 | 3300003354 | Bacteria | 1848 |
| 47 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 48 | JGI25161J50226_1000283 | 3300003374 | Bacteria | 28981 |
| 49 | JGI25161J50226_1000307 | 3300003374 | Bacteria | 27289 |
| 50 | JGI25161J50226_1016692 | 3300003374 | Bacteria | 782 |
| 51 | Ga0006562J51391_1004630 | 3300003578 | Bacteria | 2770 |
| 52 | Ga0006562J51391_1004633 | 3300003578 | Bacteria | 940 |
| 53 | Ga0055525_1019223 | 3300003759 | Bacteria | 580 |
| 54 | Ga0055529_1005549 | 3300003763 | Bacteria | 1815 |
| 55 | Ga0055526_1001084 | 3300003771 | Bacteria | 19838 |
| 56 | Ga0055526_1002599 | 3300003771 | Bacteria | 12069 |
| 57 | Ga0055526_1004226 | 3300003771 | Bacteria | 8720 |
| 58 | Ga0055526_1013834 | 3300003771 | Bacteria | 3374 |
| 59 | Ga0055526_1042781 | 3300003771 | Bacteria | 1111 |
| 60 | Ga0055524_1002465 | 3300003775 | Bacteria | 9507 |
| 61 | Ga0055524_1004489 | 3300003775 | Bacteria | 6431 |
| 62 | Ga0055524_1004911 | 3300003775 | Bacteria | 6069 |
| 63 | Ga0055524_1009251 | 3300003775 | Bacteria | 4029 |
| 64 | Ga0055524_1011052 | 3300003775 | Bacteria | 3553 |
| 65 | Ga0055524_1021006 | 3300003775 | Bacteria | 2179 |
| 66 | Ga0055524_1025442 | 3300003775 | Bacteria | 1853 |
| 67 | Ga0055524_1074924 | 3300003775 | Bacteria | 637 |
| 68 | Ga0055536_1003481 | 3300003781 | Bacteria | 8439 |
| 69 | Ga0055536_1009272 | 3300003781 | Bacteria | 4098 |
| 70 | Ga0055528_1000549 | 3300003790 | Bacteria | 28640 |
| 71 | Ga0055528_1001077 | 3300003790 | Bacteria | 17996 |
| 72 | Ga0055528_1009596 | 3300003790 | Bacteria | 4028 |
| 73 | Ga0055528_1025209 | 3300003790 | Bacteria | 1755 |
| 74 | Ga0055528_1036530 | 3300003790 | Bacteria | 1172 |
| 75 | Ga0055530_10007952 | 3300003791 | Bacteria | 4340 |
| 76 | Ga0055540_1000766 | 3300003792 | Bacteria | 21853 |
| 77 | Ga0055540_1005952 | 3300003792 | Bacteria | 4961 |
| 78 | Ga0055540_1011443 | 3300003792 | Bacteria | 2859 |
| 79 | Ga0055540_1033758 | 3300003792 | Bacteria | 1157 |
| 80 | Ga0055540_1046310 | 3300003792 | Bacteria | 915 |
| 81 | Ga0055531_10002883 | 3300003794 | Bacteria | 11200 |
| 82 | Ga0055531_10028376 | 3300003794 | Bacteria | 1932 |
| 83 | Ga0058692_1010152 | 3300003856 | Bacteria | 2339 |
| 84 | Ga0058692_1010285 | 3300003856 | Bacteria | 2317 |
| 85 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 86 | Ga0055543_1000060 | 3300004625 | Bacteria | 98330 |
| 87 | Ga0055543_1000311 | 3300004625 | Bacteria | 33798 |
| 88 | Ga0055543_1000705 | 3300004625 | Bacteria | 17007 |
| 89 | Ga0065165_1000008 | 3300005262 | Bacteria | 334429 |
| 90 | Ga0065165_1000033 | 3300005262 | Bacteria | 215827 |
| 91 | Ga0065165_1007477 | 3300005262 | Bacteria | 5355 |
| 92 | Ga0065165_1012806 | 3300005262 | Bacteria | 3389 |
| 93 | Ga0065165_1033757 | 3300005262 | Bacteria | 1589 |
| 94 | Ga0065165_1081691 | 3300005262 | Bacteria | 838 |
| 95 | Ga0070682_100162700 | 3300005337 | Bacteria | 1543 |
| 96 | Ga0070689_101665527 | 3300005340 | Bacteria | 580 |
| 97 | Ga0070668_100310520 | 3300005347 | Bacteria | 1325 |
| 98 | Ga0070668_100394043 | 3300005347 | Bacteria | 1181 |
| 99 | Ga0070668_101312432 | 3300005347 | Bacteria | 658 |
| 100 | Ga0070669_100105433 | 3300005353 | Bacteria | 2132 |
| 101 | Ga0070669_100329913 | 3300005353 | Bacteria | 1234 |
| 102 | Ga0070671_100455684 | 3300005355 | Bacteria | 1097 |
| 103 | Ga0070674_100695063 | 3300005356 | Bacteria | 869 |
| 104 | Ga0070667_100031464 | 3300005367 | Bacteria | 4425 |
| 105 | Ga0070667_100781626 | 3300005367 | Bacteria | 886 |
| 106 | Ga0070708_100296775 | 3300005445 | Bacteria | 1522 |
| 107 | Ga0070663_100067010 | 3300005455 | Bacteria | 2603 |
| 108 | Ga0070706_100046586 | 3300005467 | Bacteria | 4002 |
| 109 | Ga0070698_100036273 | 3300005471 | Bacteria | 5095 |
| 110 | Ga0070699_100110489 | 3300005518 | Bacteria | 2413 |
| 111 | Ga0068853_100035919 | 3300005539 | Bacteria | 4212 |
| 112 | Ga0070672_101009375 | 3300005543 | Bacteria | 737 |
| 113 | Ga0070686_100138518 | 3300005544 | Bacteria | 1691 |
| 114 | Ga0070665_100002486 | 3300005548 | Bacteria | 20302 |
| 115 | Ga0070665_100070536 | 3300005548 | Bacteria | 3501 |
| 116 | Ga0070665_100172205 | 3300005548 | Bacteria | 2166 |
| 117 | Ga0070665_100582613 | 3300005548 | Bacteria | 1132 |
| 118 | Ga0070665_100693459 | 3300005548 | Bacteria | 1031 |
| 119 | Ga0070665_100800135 | 3300005548 | Bacteria | 956 |
| 120 | Ga0068855_100727602 | 3300005563 | Bacteria | 1060 |
| 121 | Ga0068854_100069462 | 3300005578 | Bacteria | 2572 |
| 122 | Ga0068856_100224261 | 3300005614 | Bacteria | 1895 |
| 123 | Ga0068856_100251105 | 3300005614 | Bacteria | 1784 |
| 124 | Ga0068851_10068800 | 3300005834 | Bacteria | 1828 |
| 125 | Ga0081455_10000538 | 3300005937 | Bacteria | 49235 |
| 126 | Ga0081455_10019611 | 3300005937 | Bacteria | 6389 |
| 127 | Ga0081539_10000572 | 3300005985 | Bacteria | 76133 |
| 128 | Ga0075365_10002452 | 3300006038 | Bacteria | 9106 |
| 129 | Ga0075365_10017736 | 3300006038 | Bacteria | 4364 |
| 130 | Ga0075365_10068903 | 3300006038 | Bacteria | 2377 |
| 131 | Ga0075365_10356132 | 3300006038 | Bacteria | 1032 |
| 132 | Ga0075368_10041228 | 3300006042 | Bacteria | 1813 |
| 133 | Ga0075363_100123831 | 3300006048 | Bacteria | 1446 |
| 134 | Ga0075363_100185340 | 3300006048 | Bacteria | 1185 |
| 135 | Ga0075363_100483201 | 3300006048 | Bacteria | 734 |
| 136 | Ga0075364_10002108 | 3300006051 | Bacteria | 11108 |
| 137 | Ga0075364_10024817 | 3300006051 | Bacteria | 3810 |
| 138 | Ga0075364_10030331 | 3300006051 | Bacteria | 3470 |
| 139 | Ga0075364_10099563 | 3300006051 | Bacteria | 1935 |
| 140 | Ga0075364_10466317 | 3300006051 | Bacteria | 863 |
| 141 | Ga0075364_10585114 | 3300006051 | Bacteria | 763 |
| 142 | Ga0075362_10000446 | 3300006177 | Bacteria | 11962 |
| 143 | Ga0075362_10050960 | 3300006177 | Bacteria | 1852 |
| 144 | Ga0075362_10383312 | 3300006177 | Bacteria | 707 |
| 145 | Ga0075367_10005571 | 3300006178 | Bacteria | 6272 |
| 146 | Ga0075367_10047982 | 3300006178 | Bacteria | 2514 |
| 147 | Ga0075367_10199637 | 3300006178 | Bacteria | 1250 |
| 148 | Ga0075367_10312320 | 3300006178 | Bacteria | 990 |
| 149 | Ga0075367_10334879 | 3300006178 | Bacteria | 954 |
| 150 | Ga0075367_10371372 | 3300006178 | Bacteria | 903 |
| 151 | Ga0075369_10010204 | 3300006186 | Bacteria | 3670 |
| 152 | Ga0075369_10021611 | 3300006186 | Bacteria | 2646 |
| 153 | Ga0075369_10035009 | 3300006186 | Bacteria | 2133 |
| 154 | Ga0075369_10060746 | 3300006186 | Bacteria | 1649 |
| 155 | Ga0075369_10061641 | 3300006186 | Bacteria | 1638 |
| 156 | Ga0075366_10003015 | 3300006195 | Bacteria | 8787 |
| 157 | Ga0075366_10122371 | 3300006195 | Bacteria | 1568 |
| 158 | Ga0075370_10045499 | 3300006353 | Bacteria | 2482 |
| 159 | Ga0075370_10243232 | 3300006353 | Bacteria | 1066 |
| 160 | Ga0075370_10272640 | 3300006353 | Bacteria | 1004 |
| 161 | Ga0075430_100226040 | 3300006846 | Bacteria | 1552 |
| 162 | Ga0075431_100006441 | 3300006847 | Bacteria | 11655 |
| 163 | Ga0075429_100055477 | 3300006880 | Bacteria | 3447 |
| 164 | Ga0068865_100639961 | 3300006881 | Bacteria | 903 |
| 165 | Ga0068865_100989888 | 3300006881 | Bacteria | 736 |
| 166 | Ga0075436_100176072 | 3300006914 | Bacteria | 1511 |
| 167 | Ga0079104_1000884 | 3300006946 | Bacteria | 24591 |
| 168 | Ga0079104_1002263 | 3300006946 | Bacteria | 10711 |
| 169 | Ga0099826_10010998 | 3300006948 | Bacteria | 6799 |
| 170 | Ga0099795_10351282 | 3300007788 | Bacteria | 660 |
| 171 | Ga0105251_10006266 | 3300009011 | Bacteria | 7622 |
| 172 | Ga0105244_10117156 | 3300009036 | Bacteria | 1292 |
| 173 | Ga0105244_10134460 | 3300009036 | Bacteria | 1192 |
| 174 | Ga0105250_10044154 | 3300009092 | Bacteria | 1787 |
| 175 | Ga0105240_10000014 | 3300009093 | Bacteria | 482033 |
| 176 | Ga0105240_10607559 | 3300009093 | Bacteria | 1203 |
| 177 | Ga0105240_10819328 | 3300009093 | Bacteria | 1007 |
| 178 | Ga0111539_10260506 | 3300009094 | Bacteria | 2019 |
| 179 | Ga0105247_10202228 | 3300009101 | Bacteria | 1335 |
| 180 | Ga0114129_10003089 | 3300009147 | Bacteria | 23361 |
| 181 | Ga0105243_10012270 | 3300009148 | Bacteria | 6481 |
| 182 | Ga0105243_11125546 | 3300009148 | Bacteria | 795 |
| 183 | Ga0105241_10668404 | 3300009174 | Bacteria | 945 |
| 184 | Ga0105248_10001790 | 3300009177 | Bacteria | 23884 |
| 185 | Ga0105248_10019194 | 3300009177 | Bacteria | 7563 |
| 186 | Ga0105237_10003542 | 3300009545 | Bacteria | 18502 |
| 187 | Ga0105237_10268463 | 3300009545 | Bacteria | 1709 |
| 188 | Ga0105238_10089717 | 3300009551 | Bacteria | 3061 |
| 189 | Ga0105238_10470719 | 3300009551 | Bacteria | 1255 |
| 190 | Ga0105238_10596547 | 3300009551 | Bacteria | 1112 |
| 191 | Ga0105238_12071368 | 3300009551 | Bacteria | 603 |
| 192 | Ga0105249_11610098 | 3300009553 | Bacteria | 722 |
| 193 | Ga0123341_1000112 | 3300009765 | Bacteria | 36073 |
| 194 | Ga0123341_1065565 | 3300009765 | Bacteria | 1684 |
| 195 | Ga0123342_1010951 | 3300009766 | Bacteria | 10166 |
| 196 | Ga0123342_1016639 | 3300009766 | Bacteria | 6342 |
| 197 | Ga0099796_10100096 | 3300010159 | Bacteria | 1089 |
| 198 | Ga0105239_10000973 | 3300010375 | Bacteria | 40196 |
| 199 | Ga0105239_11650850 | 3300010375 | Bacteria | 741 |
| 200 | Ga0157322_1002866 | 3300012490 | Bacteria | 1011 |
| 201 | Ga0157314_1015773 | 3300012500 | Bacteria | 718 |
| 202 | Ga0157373_10013476 | 3300013100 | Bacteria | 5998 |
| 203 | Ga0157373_10018335 | 3300013100 | Bacteria | 5098 |
| 204 | Ga0157373_10062061 | 3300013100 | Bacteria | 2647 |
| 205 | Ga0157371_10000017 | 3300013102 | Bacteria | 320830 |
| 206 | Ga0157371_10029204 | 3300013102 | Bacteria | 3991 |
| 207 | Ga0157370_10000327 | 3300013104 | Bacteria | 59705 |
| 208 | Ga0157370_10000616 | 3300013104 | Bacteria | 44220 |
| 209 | Ga0157370_10767920 | 3300013104 | Bacteria | 878 |
| 210 | Ga0157369_10221130 | 3300013105 | Bacteria | 1982 |
| 211 | Ga0157369_10223647 | 3300013105 | Bacteria | 1969 |
| 212 | Ga0157369_10432196 | 3300013105 | Bacteria | 1364 |
| 213 | Ga0157369_10661356 | 3300013105 | Bacteria | 1077 |
| 214 | Ga0157369_10718552 | 3300013105 | Bacteria | 1028 |
| 215 | Ga0171463_1007 | 3300013249 | Bacteria | 301198 |
| 216 | Ga0163162_10328425 | 3300013306 | Bacteria | 1662 |
| 217 | Ga0182008_10017060 | 3300014497 | Bacteria | 3768 |
| 218 | Ga0182007_10002083 | 3300015262 | Bacteria | 10267 |
| 219 | Ga0182005_1001327 | 3300015265 | Bacteria | 10109 |
| 220 | Ga0183363_1049 | 3300015690 | Bacteria | 38978 |
| 221 | Ga0163161_10941000 | 3300017792 | Bacteria | 734 |
| 222 | Ga0214544_1000110 | 3300021320 | Bacteria | 113143 |
| 223 | Ga0214542_1000268 | 3300021321 | Bacteria | 87082 |
| 224 | Ga0214542_1013594 | 3300021321 | Bacteria | 9673 |
| 225 | Ga0214543_1000022 | 3300021327 | Bacteria | 241930 |
| 226 | Ga0214543_1000219 | 3300021327 | Bacteria | 87102 |
| 227 | Ga0213872_10033273 | 3300021361 | Bacteria | 2362 |
| 228 | Ga0213876_10003111 | 3300021384 | Bacteria | 9596 |
| 229 | Ga0213876_10199775 | 3300021384 | Bacteria | 1063 |
| 230 | Ga0213875_10002041 | 3300021388 | Bacteria | 12410 |
| 231 | Ga0213871_10060080 | 3300021441 | Bacteria | 1057 |
| 232 | Ga0228711_1000026 | 3300022739 | Bacteria | 101497 |
| 233 | Ga0228710_1000005 | 3300022740 | Bacteria | 233531 |
| 234 | Ga0209435_100027 | 3300025206 | Bacteria | 196217 |
| 235 | Ga0209760_105271 | 3300025207 | Bacteria | 1072 |
| 236 | Ga0209436_100061 | 3300025208 | Bacteria | 58629 |
| 237 | Ga0209436_100422 | 3300025208 | Bacteria | 18988 |
| 238 | Ga0209436_109886 | 3300025208 | Bacteria | 1781 |
| 239 | Ga0209672_115973 | 3300025228 | Bacteria | 827 |
| 240 | Ga0209563_104435 | 3300025230 | Bacteria | 2684 |
| 241 | Ga0209437_100051 | 3300025233 | Bacteria | 392523 |
| 242 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 243 | Ga0207425_1000432 | 3300025245 | Bacteria | 27708 |
| 244 | Ga0207425_1004652 | 3300025245 | Bacteria | 4060 |
| 245 | Ga0207425_1004982 | 3300025245 | Bacteria | 3866 |
| 246 | Ga0207425_1017504 | 3300025245 | Bacteria | 1572 |
| 247 | Ga0209646_1000086 | 3300025246 | Bacteria | 196217 |
| 248 | Ga0209026_1000082 | 3300025250 | Bacteria | 196315 |
| 249 | Ga0209677_100273 | 3300025253 | Bacteria | 34599 |
| 250 | Ga0209148_1000588 | 3300025254 | Bacteria | 33100 |
| 251 | Ga0209148_1009991 | 3300025254 | Bacteria | 1820 |
| 252 | Ga0209759_1000063 | 3300025256 | Bacteria | 196315 |
| 253 | Ga0209129_1000029 | 3300025258 | Bacteria | 401149 |
| 254 | Ga0209129_1000307 | 3300025258 | Bacteria | 44447 |
| 255 | Ga0209129_1000433 | 3300025258 | Bacteria | 31302 |
| 256 | Ga0209129_1001238 | 3300025258 | Bacteria | 14649 |
| 257 | Ga0209129_1003217 | 3300025258 | Bacteria | 7286 |
| 258 | Ga0209129_1006305 | 3300025258 | Bacteria | 3884 |
| 259 | Ga0209129_1006840 | 3300025258 | Bacteria | 3560 |
| 260 | Ga0209129_1028875 | 3300025258 | Bacteria | 939 |
| 261 | Ga0209233_1000095 | 3300025261 | Bacteria | 303783 |
| 262 | Ga0209233_1000190 | 3300025261 | Bacteria | 130713 |
| 263 | Ga0209233_1000228 | 3300025261 | Bacteria | 100100 |
| 264 | Ga0209565_1023059 | 3300025263 | Bacteria | 1282 |
| 265 | Ga0209565_1024878 | 3300025263 | Bacteria | 1214 |
| 266 | Ga0209455_1000334 | 3300025272 | Bacteria | 45267 |
| 267 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 268 | Ga0209673_1000025 | 3300025273 | Bacteria | 404572 |
| 269 | Ga0209673_1000112 | 3300025273 | Bacteria | 179676 |
| 270 | Ga0209673_1000858 | 3300025273 | Bacteria | 39511 |
| 271 | Ga0209673_1003176 | 3300025273 | Bacteria | 10010 |
| 272 | Ga0209673_1003674 | 3300025273 | Bacteria | 8848 |
| 273 | Ga0209673_1006098 | 3300025273 | Bacteria | 5910 |
| 274 | Ga0209673_1013587 | 3300025273 | Bacteria | 3203 |
| 275 | Ga0209673_1030287 | 3300025273 | Bacteria | 1707 |
| 276 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 277 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 278 | Ga0209130_1000020 | 3300025284 | Bacteria | 379297 |
| 279 | Ga0209130_1042962 | 3300025284 | Bacteria | 862 |
| 280 | Ga0209675_1049955 | 3300025291 | Bacteria | 868 |
| 281 | Ga0209676_1000197 | 3300025292 | Bacteria | 135043 |
| 282 | Ga0209676_1005472 | 3300025292 | Bacteria | 6627 |
| 283 | Ga0209676_1009017 | 3300025292 | Bacteria | 4363 |
| 284 | Ga0209676_1034629 | 3300025292 | Bacteria | 1491 |
| 285 | Ga0209676_1066449 | 3300025292 | Bacteria | 874 |
| 286 | Ga0209025_1000070 | 3300025294 | Bacteria | 287776 |
| 287 | Ga0209025_1000091 | 3300025294 | Bacteria | 250401 |
| 288 | Ga0209025_1000154 | 3300025294 | Bacteria | 170288 |
| 289 | Ga0209025_1000161 | 3300025294 | Bacteria | 166506 |
| 290 | Ga0209025_1000171 | 3300025294 | Bacteria | 160478 |
| 291 | Ga0209025_1000927 | 3300025294 | Bacteria | 44856 |
| 292 | Ga0209025_1002842 | 3300025294 | Bacteria | 17370 |
| 293 | Ga0209025_1007846 | 3300025294 | Bacteria | 7836 |
| 294 | Ga0209025_1011929 | 3300025294 | Bacteria | 5650 |
| 295 | Ga0209025_1014918 | 3300025294 | Bacteria | 4733 |
| 296 | Ga0209025_1028907 | 3300025294 | Bacteria | 2699 |
| 297 | Ga0209025_1035289 | 3300025294 | Bacteria | 2263 |
| 298 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 299 | Ga0209564_1000265 | 3300025295 | Bacteria | 110606 |
| 300 | Ga0209564_1000607 | 3300025295 | Bacteria | 55712 |
| 301 | Ga0209564_1001968 | 3300025295 | Bacteria | 18089 |
| 302 | Ga0209564_1008091 | 3300025295 | Bacteria | 5262 |
| 303 | Ga0209564_1012456 | 3300025295 | Bacteria | 3708 |
| 304 | Ga0209564_1025637 | 3300025295 | Bacteria | 1975 |
| 305 | Ga0209758_1000058 | 3300025297 | Bacteria | 331603 |
| 306 | Ga0209758_1000094 | 3300025297 | Bacteria | 241068 |
| 307 | Ga0209758_1000671 | 3300025297 | Bacteria | 51169 |
| 308 | Ga0209758_1005284 | 3300025297 | Bacteria | 10089 |
| 309 | Ga0209758_1012944 | 3300025297 | Bacteria | 4607 |
| 310 | Ga0209758_1013086 | 3300025297 | Bacteria | 4562 |
| 311 | Ga0209758_1019706 | 3300025297 | Bacteria | 3237 |
| 312 | Ga0209758_1020944 | 3300025297 | Bacteria | 3068 |
| 313 | Ga0209758_1036138 | 3300025297 | Bacteria | 1934 |
| 314 | Ga0209758_1043460 | 3300025297 | Bacteria | 1655 |
| 315 | Ga0209050_1002996 | 3300025298 | Bacteria | 13124 |
| 316 | Ga0209050_1005559 | 3300025298 | Bacteria | 7851 |
| 317 | Ga0209050_1005667 | 3300025298 | Bacteria | 7728 |
| 318 | Ga0209256_1000153 | 3300025299 | Bacteria | 144736 |
| 319 | Ga0209256_1000381 | 3300025299 | Bacteria | 70973 |
| 320 | Ga0209256_1000655 | 3300025299 | Bacteria | 47114 |
| 321 | Ga0209256_1001163 | 3300025299 | Bacteria | 29718 |
| 322 | Ga0209256_1002016 | 3300025299 | Bacteria | 18118 |
| 323 | Ga0209256_1004610 | 3300025299 | Bacteria | 8514 |
| 324 | Ga0209256_1019160 | 3300025299 | Bacteria | 2191 |
| 325 | Ga0209256_1031417 | 3300025299 | Bacteria | 1452 |
| 326 | Ga0209256_1033906 | 3300025299 | Bacteria | 1366 |
| 327 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 328 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 329 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 330 | Ga0207426_1000344 | 3300025302 | Bacteria | 85912 |
| 331 | Ga0207426_1001833 | 3300025302 | Bacteria | 15687 |
| 332 | Ga0209051_1001157 | 3300025303 | Bacteria | 23986 |
| 333 | Ga0209051_1001614 | 3300025303 | Bacteria | 18391 |
| 334 | Ga0209051_1014703 | 3300025303 | Bacteria | 3637 |
| 335 | Ga0209051_1019573 | 3300025303 | Bacteria | 2947 |
| 336 | Ga0209051_1052327 | 3300025303 | Bacteria | 1350 |
| 337 | Ga0209051_1109753 | 3300025303 | Bacteria | 722 |
| 338 | Ga0209257_1002974 | 3300025304 | Bacteria | 15474 |
| 339 | Ga0209257_1008365 | 3300025304 | Bacteria | 5906 |
| 340 | Ga0209257_1013242 | 3300025304 | Bacteria | 3696 |
| 341 | Ga0209257_1015197 | 3300025304 | Bacteria | 3228 |
| 342 | Ga0207696_1096477 | 3300025711 | Bacteria | 808 |
| 343 | Ga0207655_1139394 | 3300025728 | Bacteria | 780 |
| 344 | Ga0207713_1047877 | 3300025735 | Bacteria | 1726 |
| 345 | Ga0207707_10502268 | 3300025912 | Bacteria | 1034 |
| 346 | Ga0207707_11428980 | 3300025912 | Bacteria | 551 |
| 347 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 348 | Ga0207695_10117657 | 3300025913 | Bacteria | 2630 |
| 349 | Ga0207695_10211115 | 3300025913 | Bacteria | 1852 |
| 350 | Ga0207695_10631791 | 3300025913 | Bacteria | 952 |
| 351 | Ga0207695_10920776 | 3300025913 | Bacteria | 754 |
| 352 | Ga0207671_10000271 | 3300025914 | Bacteria | 77228 |
| 353 | Ga0207671_10210143 | 3300025914 | Bacteria | 1522 |
| 354 | Ga0207649_11356407 | 3300025920 | Bacteria | 563 |
| 355 | Ga0207652_10291240 | 3300025921 | Bacteria | 1473 |
| 356 | Ga0207681_10683505 | 3300025923 | Bacteria | 852 |
| 357 | Ga0207694_10002909 | 3300025924 | Bacteria | 13780 |
| 358 | Ga0207694_10498678 | 3300025924 | Bacteria | 1019 |
| 359 | Ga0207694_10518221 | 3300025924 | Bacteria | 999 |
| 360 | Ga0207650_10000911 | 3300025925 | Bacteria | 22288 |
| 361 | Ga0207650_10078116 | 3300025925 | Bacteria | 2503 |
| 362 | Ga0207659_10146647 | 3300025926 | Bacteria | 1838 |
| 363 | Ga0207644_10071576 | 3300025931 | Bacteria | 2537 |
| 364 | Ga0207706_10231682 | 3300025933 | Bacteria | 1616 |
| 365 | Ga0207706_10439739 | 3300025933 | Bacteria | 1129 |
| 366 | Ga0207704_10550465 | 3300025938 | Bacteria | 937 |
| 367 | Ga0207691_10279013 | 3300025940 | Bacteria | 1438 |
| 368 | Ga0207711_10009012 | 3300025941 | Bacteria | 8340 |
| 369 | Ga0207711_10231808 | 3300025941 | Bacteria | 1691 |
| 370 | Ga0207668_10068654 | 3300025972 | Bacteria | 2521 |
| 371 | Ga0207668_10498133 | 3300025972 | Bacteria | 1047 |
| 372 | Ga0207668_11110420 | 3300025972 | Bacteria | 709 |
| 373 | Ga0207640_10052246 | 3300025981 | Bacteria | 2661 |
| 374 | Ga0207640_10198771 | 3300025981 | Bacteria | 1517 |
| 375 | Ga0207658_10627719 | 3300025986 | Bacteria | 967 |
| 376 | Ga0207639_10027841 | 3300026041 | Bacteria | 4121 |
| 377 | Ga0207678_10053726 | 3300026067 | Bacteria | 3471 |
| 378 | Ga0207702_10877792 | 3300026078 | Bacteria | 888 |
| 379 | Ga0207702_11820460 | 3300026078 | Bacteria | 601 |
| 380 | Ga0207698_10314980 | 3300026142 | Bacteria | 1463 |
| 381 | Ga0209281_1000034 | 3300027111 | Bacteria | 382562 |
| 382 | Ga0209281_1000082 | 3300027111 | Bacteria | 257684 |
| 383 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 384 | Ga0209371_1000892 | 3300027312 | Bacteria | 23789 |
| 385 | Ga0209371_1006087 | 3300027312 | Bacteria | 4582 |
| 386 | Ga0209282_1000006 | 3300027666 | Bacteria | 276998 |
| 387 | Ga0209282_1007756 | 3300027666 | Bacteria | 6737 |
| 388 | Ga0209282_1030375 | 3300027666 | Bacteria | 3327 |
| 389 | Ga0209588_1077228 | 3300027671 | Bacteria | 1076 |
| 390 | Ga0209813_10007851 | 3300027866 | Bacteria | 2672 |
| 391 | Ga0268266_10003490 | 3300028379 | Bacteria | 15653 |
| 392 | Ga0268266_10003866 | 3300028379 | Bacteria | 14604 |
| 393 | Ga0268266_10075098 | 3300028379 | Bacteria | 2936 |
| 394 | Ga0268266_10691014 | 3300028379 | Bacteria | 983 |
| 395 | Ga0268266_11364684 | 3300028379 | Bacteria | 684 |
| 396 | Ga0268266_11814705 | 3300028379 | Bacteria | 584 |
| 397 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 398 | Ga0307515_10046209 | 3300028794 | Bacteria | 6662 |
| 399 | Ga0307515_10069935 | 3300028794 | Bacteria | 4787 |
| 400 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 401 | Ga0268256_1006062 | 3300030500 | Bacteria | 4582 |
| 402 | Ga0268256_1026482 | 3300030500 | Bacteria | 1456 |
| 403 | Ga0316181_1138338 | 3300030744 | Bacteria | 916 |
| 404 | Ga0265328_10000189 | 3300031239 | Bacteria | 28650 |
| 405 | Ga0265327_10002688 | 3300031251 | Bacteria | 18258 |
| 406 | Ga0265327_10049111 | 3300031251 | Bacteria | 2215 |
| 407 | Ga0307513_10015439 | 3300031456 | Bacteria | 9257 |
| 408 | Ga0307513_10057743 | 3300031456 | Bacteria | 4131 |
| 409 | Ga0307408_100259728 | 3300031548 | Bacteria | 1437 |
| 410 | Ga0307408_100551394 | 3300031548 | Bacteria | 1017 |
| 411 | Ga0265342_10295511 | 3300031712 | Bacteria | 854 |
| 412 | Ga0316576_10760265 | 3300031727 | Bacteria | 699 |
| 413 | Ga0307405_10002746 | 3300031731 | Bacteria | 7890 |
| 414 | Ga0307405_10103915 | 3300031731 | Bacteria | 1911 |
| 415 | Ga0307410_10192518 | 3300031852 | Bacteria | 1552 |
| 416 | Ga0307406_10740705 | 3300031901 | Bacteria | 824 |
| 417 | Ga0307412_10002363 | 3300031911 | Bacteria | 10464 |
| 418 | Ga0307412_10114024 | 3300031911 | Bacteria | 1935 |
| 419 | Ga0307412_10259515 | 3300031911 | Bacteria | 1354 |
| 420 | Ga0307412_10981645 | 3300031911 | Bacteria | 745 |
| 421 | Ga0315914_1000003 | 3300031967 | Bacteria | 314370 |
| 422 | Ga0307409_100821542 | 3300031995 | Bacteria | 938 |
| 423 | Ga0307416_100299293 | 3300032002 | Bacteria | 1598 |
| 424 | Ga0307416_100495718 | 3300032002 | Bacteria | 1285 |
| 425 | Ga0307414_10076304 | 3300032004 | Bacteria | 2435 |
| 426 | Ga0307414_10329742 | 3300032004 | Bacteria | 1302 |
| 427 | Ga0307414_10963431 | 3300032004 | Bacteria | 784 |
| 428 | Ga0307414_11179505 | 3300032004 | Bacteria | 709 |
| 429 | Ga0307411_10905437 | 3300032005 | Bacteria | 784 |
| 430 | Ga0315913_1000001 | 3300033430 | Bacteria | 284459 |
| 431 | Ga0315915_1000008 | 3300033464 | Bacteria | 258517 |
| 432 | Ga0373945_0483619 | 3300035116 | Bacteria | 550 |
| 433 | Ga0373943_0074066 | 3300035170 | Bacteria | 1731 |
| 434 | Ga0373943_0347105 | 3300035170 | Bacteria | 850 |
| 435 | Ga0373935_0010890 | 3300035692 | Bacteria | 5461 |
| 436 | Ga0373927_0000856 | 3300035695 | Bacteria | 23214 |
| 437 | Ga0373927_0849305 | 3300035695 | Bacteria | 603 |
| 438 | Ga0373925_0002516 | 3300037068 | Bacteria | 14642 |
| 439 | Ga0395899_0032746 | 3300037312 | Bacteria | 3907 |
| 440 | Ga0395899_0037181 | 3300037312 | Bacteria | 3650 |
| 441 | Ga0395899_0040984 | 3300037312 | Bacteria | 3461 |
| 442 | Ga0395899_0189558 | 3300037312 | Bacteria | 1439 |
| 443 | Ga0395900_0079907 | 3300037418 | Bacteria | 3360 |
| 444 | Ga0395900_0102233 | 3300037418 | Bacteria | 2944 |
| 445 | Ga0395898_0009045 | 3300037466 | Bacteria | 10487 |
| 446 | Ga0395898_0019247 | 3300037466 | Bacteria | 6950 |
| 447 | Ga0436364_1142809 | 3300037853 | Bacteria | 40161 |
| 448 | Ga0395901_0276823 | 3300038443 | Bacteria | 1744 |
| 449 | Ga0395901_0331860 | 3300038443 | Bacteria | 1572 |
| 450 | Ga0395901_0689569 | 3300038443 | Bacteria | 1020 |
| 451 | Ga0400483_144045 | 3300039062 | Bacteria | 3853 |
| 452 | Ga0400483_213761 | 3300039062 | Bacteria | 1346 |
| 453 | Ga0436365_0243032 | 3300039437 | Bacteria | 1622 |
| 454 | Ga0436365_0990465 | 3300039437 | Bacteria | 14414 |
| 455 | Ga0436360_1052595 | 3300039438 | Bacteria | 3124 |
| 456 | Ga0436361_0187853 | 3300039447 | Bacteria | 3059 |
| 457 | Ga0436361_0507050 | 3300039447 | Bacteria | 1270 |
| 458 | Ga0436361_0972763 | 3300039447 | Bacteria | 4532 |
| 459 | Ga0436361_1031687 | 3300039447 | Bacteria | 1418 |
| 460 | Ga0436363_1027101 | 3300039450 | Bacteria | 1261 |
| 461 | Ga0436363_1351969 | 3300039450 | Bacteria | 1170 |
| 462 | Ga0436362_0783924 | 3300039453 | Bacteria | 683 |
| 463 | Ga0439436_0019882 | 3300041404 | Bacteria | 2002 |
| 464 | Ga0439438_016435 | 3300041405 | Bacteria | 2151 |
| 465 | Ga0439438_017366 | 3300041405 | Bacteria | 2073 |
| 466 | Ga0439466_0070031 | 3300041411 | Bacteria | 1118 |
| 467 | Ga0439465_0008508 | 3300041413 | Bacteria | 3238 |
| 468 | Ga0439465_0165332 | 3300041413 | Bacteria | 795 |
| 469 | Ga0451787_502609 | 3300041441 | Bacteria | 1095 |
| 470 | Ga0451789_1281455 | 3300041443 | Bacteria | 897 |
| 471 | Ga0451795_0335541 | 3300041456 | Bacteria | 973 |
| 472 | Ga0451835_0255768 | 3300041492 | Bacteria | 1831 |
| 473 | Ga0451837_0676541 | 3300041494 | Bacteria | 1093 |
| 474 | Ga0451837_0772324 | 3300041494 | Bacteria | 1973 |
| 475 | Ga0451840_15734 | 3300041497 | Bacteria | 645 |
| 476 | Ga0451846_31201 | 3300041502 | Bacteria | 1028 |
| 477 | Ga0451847_0188909 | 3300041503 | Bacteria | 3856 |
| 478 | Ga0451851_0267608 | 3300041507 | Bacteria | 564 |
| 479 | Ga0451851_0872605 | 3300041507 | Bacteria | 1419 |
| 480 | Ga0451854_30980 | 3300041510 | Bacteria | 732 |
| 481 | Ga0451855_1076083 | 3300041511 | Bacteria | 982 |
| 482 | Ga0439433_0097097 | 3300041999 | Bacteria | 729 |
| 483 | Ga0439449_0004055 | 3300042007 | Bacteria | 5671 |
| 484 | Ga0439449_0017852 | 3300042007 | Bacteria | 2663 |
| 485 | Ga0439451_016516 | 3300042009 | Bacteria | 1487 |
| 486 | Ga0450920_010616 | 3300042122 | Bacteria | 1710 |
| 487 | Ga0450909_003686 | 3300042185 | Bacteria | 2175 |
| 488 | Ga0439434_0047458 | 3300042435 | Bacteria | 1327 |
| 489 | Ga0450918_010663 | 3300042531 | Bacteria | 1604 |
| 490 | Ga0466965_0694794 | 3300044683 | Bacteria | 583 |
| 491 | Ga0466966_0370726 | 3300044684 | Bacteria | 860 |
| 492 | Ga0466968_0015577 | 3300044735 | Bacteria | 3015 |
| 493 | Ga0466970_0218295 | 3300044765 | Bacteria | 1064 |
| 494 | Ga0466957_0017737 | 3300044842 | Bacteria | 4175 |
| 495 | Ga0466960_0232709 | 3300044901 | Bacteria | 1017 |
| 496 | Ga0451576_0002083 | 3300045051 | Bacteria | 31271 |
| 497 | Ga0451576_2052736 | 3300045051 | Bacteria | 588 |
| 498 | Ga0495627_051123 | 3300046453 | Bacteria | 1243 |
| 499 | Ga0495627_093648 | 3300046453 | Bacteria | 862 |
| 500 | Ga0495590_0016051 | 3300046457 | Bacteria | 2708 |
| 501 | Ga0495638_0001134 | 3300046460 | Bacteria | 25773 |
| 502 | Ga0495638_0080821 | 3300046460 | Bacteria | 1974 |
| 503 | Ga0495651_0140785 | 3300046462 | Bacteria | 1750 |
| 504 | Ga0495650_0045284 | 3300046471 | Bacteria | 1853 |
| 505 | Ga0495605_0099468 | 3300046474 | Bacteria | 1339 |
| 506 | Ga0495662_0009811 | 3300046476 | Bacteria | 4704 |
| 507 | Ga0495585_0060355 | 3300046492 | Bacteria | 2087 |
| 508 | Ga0495596_0027893 | 3300046500 | Bacteria | 2268 |
| 509 | Ga0495607_0010334 | 3300046501 | Bacteria | 6279 |
| 510 | Ga0495607_0046074 | 3300046501 | Bacteria | 2563 |
| 511 | Ga0495583_0035078 | 3300046506 | Bacteria | 2398 |
| 512 | Ga0495583_0053761 | 3300046506 | Bacteria | 1826 |
| 513 | Ga0495606_0004697 | 3300046507 | Bacteria | 13488 |
| 514 | Ga0495606_0007767 | 3300046507 | Bacteria | 9492 |
| 515 | Ga0495606_0039286 | 3300046507 | Bacteria | 3192 |
| 516 | Ga0495606_0112977 | 3300046507 | Bacteria | 1636 |
| 517 | Ga0495610_0003664 | 3300046512 | Bacteria | 11821 |
| 518 | Ga0495610_0031382 | 3300046512 | Bacteria | 2772 |
| 519 | Ga0495610_0139763 | 3300046512 | Bacteria | 1043 |
| 520 | Ga0495616_0022251 | 3300046513 | Bacteria | 3424 |
| 521 | Ga0495618_0210505 | 3300046514 | Bacteria | 1229 |
| 522 | Ga0495620_0026792 | 3300046515 | Bacteria | 2706 |
| 523 | Ga0495620_0359990 | 3300046515 | Bacteria | 551 |
| 524 | Ga0495630_0837281 | 3300046517 | Bacteria | 702 |
| 525 | Ga0495631_0001584 | 3300046518 | Bacteria | 13671 |
| 526 | Ga0495632_0003362 | 3300046519 | Bacteria | 11400 |
| 527 | Ga0495632_0009886 | 3300046519 | Bacteria | 5703 |
| 528 | Ga0495632_0041708 | 3300046519 | Bacteria | 2304 |
| 529 | Ga0495632_0081744 | 3300046519 | Bacteria | 1540 |
| 530 | Ga0495632_0108233 | 3300046519 | Bacteria | 1306 |
| 531 | Ga0495643_0031297 | 3300046522 | Bacteria | 2962 |
| 532 | Ga0495643_0066465 | 3300046522 | Bacteria | 1902 |
| 533 | Ga0495648_0029469 | 3300046524 | Bacteria | 3643 |
| 534 | Ga0495648_0161935 | 3300046524 | Bacteria | 1155 |
| 535 | Ga0495663_0018272 | 3300046525 | Bacteria | 1996 |
| 536 | Ga0495642_0201478 | 3300046528 | Bacteria | 868 |
| 537 | Ga0495654_0001572 | 3300046530 | Bacteria | 15496 |
| 538 | Ga0495654_0011933 | 3300046530 | Bacteria | 4685 |
| 539 | Ga0495654_0198712 | 3300046530 | Bacteria | 859 |
| 540 | Ga0495609_0026854 | 3300046538 | Bacteria | 2634 |
| 541 | Ga0495597_0029591 | 3300046542 | Bacteria | 2500 |
| 542 | Ga0495622_0042615 | 3300046557 | Bacteria | 2110 |
| 543 | Ga0495633_0041073 | 3300046558 | Bacteria | 2201 |
| 544 | Ga0495633_0048871 | 3300046558 | Bacteria | 1997 |
| 545 | Ga0495633_0265304 | 3300046558 | Bacteria | 782 |
| 546 | Ga0495656_0014314 | 3300046615 | Bacteria | 2972 |
| 547 | Ga0495668_0009467 | 3300046616 | Bacteria | 5984 |
| 548 | Ga0495668_0012948 | 3300046616 | Bacteria | 4937 |
| 549 | Ga0495668_0101874 | 3300046616 | Bacteria | 1571 |
| 550 | Ga0495611_0013882 | 3300046648 | Bacteria | 3436 |
| 551 | Ga0495611_0020130 | 3300046648 | Bacteria | 2870 |
| 552 | Ga0495625_0002255 | 3300046660 | Bacteria | 21195 |
| 553 | Ga0495625_0049809 | 3300046660 | Bacteria | 3009 |
| 554 | Ga0495625_0068316 | 3300046660 | Bacteria | 2498 |
| 555 | Ga0495625_0100585 | 3300046660 | Bacteria | 1987 |
| 556 | Ga0495625_0126598 | 3300046660 | Bacteria | 1734 |
| 557 | Ga0495588_0001571 | 3300046674 | Bacteria | 9773 |
| 558 | Ga0495588_0067742 | 3300046674 | Bacteria | 1853 |
| 559 | Ga0495670_0012039 | 3300046691 | Bacteria | 4258 |
| 560 | Ga0495671_0065310 | 3300046692 | Bacteria | 1791 |
| 561 | Ga0495600_0026201 | 3300046809 | Bacteria | 3761 |
| 562 | Ga0495660_0004669 | 3300046810 | Bacteria | 8269 |
| 563 | Ga0495604_0097972 | 3300047317 | Bacteria | 2161 |
| 564 | Ga0495636_0047809 | 3300047318 | Bacteria | 1787 |
| 565 | Ga0495672_0005525 | 3300047320 | Bacteria | 10005 |
| 566 | Ga0495683_0049570 | 3300047323 | Bacteria | 2103 |
| 567 | Ga0495681_0013102 | 3300047470 | Bacteria | 4834 |
| 568 | Ga0495681_0049184 | 3300047470 | Bacteria | 1994 |
| 569 | Ga0495681_0278580 | 3300047470 | Bacteria | 653 |
| 570 | Ga0495686_0001486 | 3300047472 | Bacteria | 25489 |
| 571 | Ga0495686_0010881 | 3300047472 | Bacteria | 6442 |
| 572 | Ga0495686_0011361 | 3300047472 | Bacteria | 6277 |
| 573 | Ga0495686_0021709 | 3300047472 | Bacteria | 4258 |
| 574 | Ga0495686_0200319 | 3300047472 | Bacteria | 1146 |
| 575 | Ga0495686_0213564 | 3300047472 | Bacteria | 1101 |
| 576 | Ga0495686_0322597 | 3300047472 | Bacteria | 846 |
| 577 | Ga0495626_0024583 | 3300048091 | Bacteria | 2952 |
| 578 | Ga0496100_1297634 | 3300048903 | Bacteria | 574 |
| 579 | Ga0496102_1292316 | 3300048905 | Bacteria | 649 |
| 580 | Ga0496105_0022766 | 3300048908 | Bacteria | 5077 |
| 581 | Ga0496105_0070505 | 3300048908 | Bacteria | 2889 |
| 582 | Ga0496105_0338339 | 3300048908 | Bacteria | 1204 |
| 583 | Ga0496106_0006078 | 3300048909 | Bacteria | 8935 |
| 584 | Ga0496106_0218120 | 3300048909 | Bacteria | 1521 |
| 585 | Ga0496110_0046395 | 3300048913 | Bacteria | 3801 |
| 586 | Ga0496110_0252786 | 3300048913 | Bacteria | 1604 |
| 587 | Ga0496111_0029761 | 3300048914 | Bacteria | 3879 |
| 588 | Ga0496112_0017743 | 3300048915 | Bacteria | 6698 |
| 589 | Ga0496112_0803831 | 3300048915 | Bacteria | 865 |
| 590 | Ga0496113_0040908 | 3300048916 | Bacteria | 3418 |
| 591 | Ga0496115_0695078 | 3300048918 | Bacteria | 800 |
| 592 | Ga0496116_0000105 | 3300048919 | Bacteria | 192704 |
| 593 | Ga0496116_0007168 | 3300048919 | Bacteria | 9963 |
| 594 | Ga0496116_0008842 | 3300048919 | Bacteria | 8671 |
| 595 | Ga0496116_0023634 | 3300048919 | Bacteria | 4572 |
| 596 | Ga0496116_0031594 | 3300048919 | Bacteria | 3787 |
| 597 | Ga0496116_0031701 | 3300048919 | Bacteria | 3778 |
| 598 | Ga0496116_0047753 | 3300048919 | Bacteria | 2879 |
| 599 | Ga0496116_0052894 | 3300048919 | Bacteria | 2686 |
| 600 | Ga0496116_0083429 | 3300048919 | Bacteria | 1973 |
| 601 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 602 | Ga0496117_0005967 | 3300048920 | Bacteria | 12557 |
| 603 | Ga0496117_0010221 | 3300048920 | Bacteria | 8599 |
| 604 | Ga0496117_0017552 | 3300048920 | Bacteria | 5971 |
| 605 | Ga0496117_0031122 | 3300048920 | Bacteria | 4080 |
| 606 | Ga0496117_0066513 | 3300048920 | Bacteria | 2444 |
| 607 | Ga0496117_0156739 | 3300048920 | Bacteria | 1339 |
| 608 | Ga0496118_0000566 | 3300048921 | Bacteria | 61208 |
| 609 | Ga0496118_0001151 | 3300048921 | Bacteria | 40832 |
| 610 | Ga0496118_0008628 | 3300048921 | Bacteria | 10486 |
| 611 | Ga0496118_0017174 | 3300048921 | Bacteria | 6601 |
| 612 | Ga0496118_0034028 | 3300048921 | Bacteria | 4168 |
| 613 | Ga0496118_0075392 | 3300048921 | Bacteria | 2406 |
| 614 | Ga0496118_0104617 | 3300048921 | Bacteria | 1899 |
| 615 | Ga0496118_0141386 | 3300048921 | Bacteria | 1525 |
| 616 | Ga0496119_0007422 | 3300048922 | Bacteria | 9879 |
| 617 | Ga0496119_0024620 | 3300048922 | Bacteria | 4229 |
| 618 | Ga0496119_0035300 | 3300048922 | Bacteria | 3278 |
| 619 | Ga0496119_0071800 | 3300048922 | Bacteria | 2025 |
| 620 | Ga0496119_0109266 | 3300048922 | Bacteria | 1538 |
| 621 | Ga0496119_0141554 | 3300048922 | Bacteria | 1298 |
| 622 | Ga0496120_0000309 | 3300048923 | Bacteria | 81375 |
| 623 | Ga0496120_0023586 | 3300048923 | Bacteria | 3849 |
| 624 | Ga0496120_0044995 | 3300048923 | Bacteria | 2560 |
| 625 | Ga0496120_0070685 | 3300048923 | Bacteria | 1919 |
| 626 | Ga0496120_0092898 | 3300048923 | Bacteria | 1608 |
| 627 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 628 | Ga0496121_0003780 | 3300048924 | Bacteria | 21134 |
| 629 | Ga0496121_0009804 | 3300048924 | Bacteria | 10942 |
| 630 | Ga0496121_0012638 | 3300048924 | Bacteria | 9172 |
| 631 | Ga0496121_0019047 | 3300048924 | Bacteria | 6886 |
| 632 | Ga0496121_0076734 | 3300048924 | Bacteria | 2663 |
| 633 | Ga0496121_0081685 | 3300048924 | Bacteria | 2557 |
| 634 | Ga0496121_0155671 | 3300048924 | Bacteria | 1677 |
| 635 | Ga0496121_0248290 | 3300048924 | Bacteria | 1235 |
| 636 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 637 | Ga0496122_0000157 | 3300048925 | Bacteria | 159733 |
| 638 | Ga0496122_0000464 | 3300048925 | Bacteria | 84473 |
| 639 | Ga0496122_0010069 | 3300048925 | Bacteria | 9817 |
| 640 | Ga0496122_0034634 | 3300048925 | Bacteria | 4128 |
| 641 | Ga0496122_0038124 | 3300048925 | Bacteria | 3856 |
| 642 | Ga0496122_0041265 | 3300048925 | Bacteria | 3651 |
| 643 | Ga0496122_0048776 | 3300048925 | Bacteria | 3251 |
| 644 | Ga0496122_0063672 | 3300048925 | Bacteria | 2689 |
| 645 | Ga0496122_0122766 | 3300048925 | Bacteria | 1670 |
| 646 | Ga0496122_0174327 | 3300048925 | Bacteria | 1291 |
| 647 | Ga0496122_0175306 | 3300048925 | Bacteria | 1286 |
| 648 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 649 | Ga0496123_0000048 | 3300048926 | Bacteria | 244152 |
| 650 | Ga0496123_0000147 | 3300048926 | Bacteria | 143834 |
| 651 | Ga0496123_0007075 | 3300048926 | Bacteria | 10666 |
| 652 | Ga0496123_0014048 | 3300048926 | Bacteria | 6663 |
| 653 | Ga0496123_0015923 | 3300048926 | Bacteria | 6135 |
| 654 | Ga0496123_0024343 | 3300048926 | Bacteria | 4604 |
| 655 | Ga0496123_0027255 | 3300048926 | Bacteria | 4259 |
| 656 | Ga0496123_0044556 | 3300048926 | Bacteria | 3032 |
| 657 | Ga0496123_0173840 | 3300048926 | Bacteria | 1133 |
| 658 | Ga0496123_0294082 | 3300048926 | Bacteria | 778 |
| 659 | Ga0496123_0311236 | 3300048926 | Bacteria | 747 |
| 660 | Ga0496124_0000067 | 3300048927 | Bacteria | 222576 |
| 661 | Ga0496124_0002089 | 3300048927 | Bacteria | 26962 |
| 662 | Ga0496124_0008090 | 3300048927 | Bacteria | 11052 |
| 663 | Ga0496124_0009653 | 3300048927 | Bacteria | 9884 |
| 664 | Ga0496124_0029277 | 3300048927 | Bacteria | 4910 |
| 665 | Ga0496124_0060523 | 3300048927 | Bacteria | 3176 |
| 666 | Ga0496124_0130083 | 3300048927 | Bacteria | 2001 |
| 667 | Ga0496124_0132515 | 3300048927 | Bacteria | 1978 |
| 668 | Ga0496124_0169676 | 3300048927 | Bacteria | 1692 |
| 669 | Ga0496124_0196392 | 3300048927 | Bacteria | 1539 |
| 670 | Ga0496124_0211242 | 3300048927 | Bacteria | 1468 |
| 671 | Ga0496124_0230418 | 3300048927 | Bacteria | 1385 |
| 672 | Ga0496124_0238957 | 3300048927 | Bacteria | 1352 |
| 673 | Ga0496124_0273913 | 3300048927 | Bacteria | 1234 |
| 674 | Ga0496124_0305280 | 3300048927 | Bacteria | 1147 |
| 675 | Ga0496125_0000441 | 3300048928 | Bacteria | 75923 |
| 676 | Ga0496125_0000786 | 3300048928 | Bacteria | 51737 |
| 677 | Ga0496125_0000848 | 3300048928 | Bacteria | 49020 |
| 678 | Ga0496125_0009794 | 3300048928 | Bacteria | 9769 |
| 679 | Ga0496125_0014106 | 3300048928 | Bacteria | 7803 |
| 680 | Ga0496125_0014581 | 3300048928 | Bacteria | 7646 |
| 681 | Ga0496125_0050143 | 3300048928 | Bacteria | 3459 |
| 682 | Ga0496125_0135179 | 3300048928 | Bacteria | 1726 |
| 683 | Ga0496125_0255670 | 3300048928 | Bacteria | 1102 |
| 684 | Ga0496125_0356085 | 3300048928 | Bacteria | 872 |
| 685 | Ga0496125_0491740 | 3300048928 | Bacteria | 693 |
| 686 | Ga0496126_0000188 | 3300048929 | Bacteria | 139625 |
| 687 | Ga0496126_0060889 | 3300048929 | Bacteria | 3393 |
| 688 | Ga0496126_0302042 | 3300048929 | Bacteria | 1320 |
| 689 | Ga0496126_0526382 | 3300048929 | Bacteria | 941 |
| 690 | Ga0496126_0531684 | 3300048929 | Bacteria | 935 |
| 691 | Ga0496126_0852853 | 3300048929 | Bacteria | 694 |
| 692 | Ga0495678_066512 | 3300049459 | Bacteria | 1334 |
| 693 | Ga0495682_0011491 | 3300049460 | Bacteria | 3407 |
| 694 | Ga0501031_0099971 | 3300049568 | Bacteria | 1893 |
| 695 | Ga0501032_0187945 | 3300049569 | Bacteria | 1351 |
| 696 | Ga0501033_0000365 | 3300049570 | Bacteria | 43281 |
| 697 | Ga0501033_0150020 | 3300049570 | Bacteria | 1682 |
| 698 | Ga0501033_0183076 | 3300049570 | Bacteria | 1501 |
| 699 | Ga0501034_0001020 | 3300049571 | Bacteria | 40131 |
| 700 | Ga0501034_0191769 | 3300049571 | Bacteria | 2005 |
| 701 | Ga0501034_0327128 | 3300049571 | Bacteria | 1465 |
| 702 | Ga0501034_0648779 | 3300049571 | Bacteria | 957 |
| 703 | Ga0501036_0031089 | 3300049572 | Bacteria | 4512 |
| 704 | Ga0501036_1004531 | 3300049572 | Bacteria | 683 |
| 705 | Ga0501037_0066214 | 3300049573 | Bacteria | 2632 |
| 706 | Ga0501037_0515409 | 3300049573 | Bacteria | 810 |
| 707 | Ga0501038_0020981 | 3300049574 | Bacteria | 5869 |
| 708 | Ga0501040_0034092 | 3300049576 | Bacteria | 3449 |
| 709 | Ga0501041_0162692 | 3300049577 | Bacteria | 1395 |
| 710 | Ga0501042_0162443 | 3300049578 | Bacteria | 1611 |
| 711 | Ga0501043_0216218 | 3300049579 | Bacteria | 1484 |
| 712 | Ga0501043_0419576 | 3300049579 | Bacteria | 1009 |
| 713 | Ga0501046_0028941 | 3300049580 | Bacteria | 4508 |
| 714 | Ga0501047_0221955 | 3300049581 | Bacteria | 1746 |
| 715 | Ga0501047_0255272 | 3300049581 | Bacteria | 1602 |
| 716 | Ga0501048_0025595 | 3300049582 | Bacteria | 4301 |
| 717 | Ga0501067_0065314 | 3300049583 | Bacteria | 2014 |
| 718 | Ga0501068_0288358 | 3300049584 | Bacteria | 1050 |
| 719 | Ga0501068_0309858 | 3300049584 | Bacteria | 1011 |
| 720 | Ga0501070_1196288 | 3300049586 | Bacteria | 583 |
| 721 | Ga0501071_0046594 | 3300049587 | Bacteria | 3114 |
| 722 | Ga0501074_0005267 | 3300049590 | Bacteria | 9310 |
| 723 | Ga0501075_0195777 | 3300049591 | Bacteria | 1541 |
| 724 | Ga0501076_0056877 | 3300049592 | Bacteria | 3105 |
| 725 | Ga0501077_0084373 | 3300049593 | Bacteria | 2014 |
| 726 | Ga0501079_0057880 | 3300049741 | Bacteria | 2990 |
| 727 | Ga0501080_0232366 | 3300049742 | Bacteria | 1685 |
| 728 | Ga0501080_0310242 | 3300049742 | Bacteria | 1430 |
| 729 | Ga0501080_0426430 | 3300049742 | Bacteria | 1191 |
| 730 | Ga0501080_0460058 | 3300049742 | Bacteria | 1140 |
| 731 | Ga0501081_0001100 | 3300049743 | Bacteria | 16217 |
| 732 | Ga0501280_001764 | 3300049776 | Bacteria | 3799 |
| 733 | Ga0501280_052361 | 3300049776 | Bacteria | 690 |
| 734 | Ga0501280_053158 | 3300049776 | Bacteria | 686 |
| 735 | Ga0501035_0001622 | 3300049822 | Bacteria | 22762 |
| 736 | Ga0501044_0109786 | 3300049823 | Bacteria | 2767 |
| 737 | Ga0501044_0590104 | 3300049823 | Bacteria | 1005 |
| 738 | Ga0501044_1392044 | 3300049823 | Bacteria | 567 |
| 739 | Ga0501045_0045776 | 3300049824 | Bacteria | 3185 |
| 740 | nmdc:mga03683_106140_c1 | 3300050489 | Bacteria | 1238 |
| 741 | nmdc:mga03683_240320_c1 | 3300050489 | Bacteria | 839 |
| 742 | nmdc:mga03683_53915_c1 | 3300050489 | Bacteria | 1685 |
| 743 | nmdc:mga03683_858_c1 | 3300050489 | Bacteria | 8750 |
| 744 | nmdc:mga03683_8607_c2 | 3300050489 | Bacteria | 3247 |
| 745 | nmdc:mga03n38_376232_c1 | 3300050490 | Bacteria | 777 |
| 746 | nmdc:mga03n38_48518_c1 | 3300050490 | Bacteria | 1884 |
| 747 | nmdc:mga03n38_582808_c1 | 3300050490 | Bacteria | 636 |
| 748 | nmdc:mga00v17_180_c1 | 3300050491 | Bacteria | 37485 |
| 749 | nmdc:mga00v17_209459_c1 | 3300050491 | Bacteria | 1261 |
| 750 | nmdc:mga00v17_414573_c1 | 3300050491 | Bacteria | 875 |
| 751 | nmdc:mga00v17_443299_c1 | 3300050491 | Bacteria | 843 |
| 752 | nmdc:mga00v17_824_c1 | 3300050491 | Bacteria | 16830 |
| 753 | nmdc:mga00v17_983886_c1 | 3300050491 | Bacteria | 531 |
| 754 | nmdc:mga0yw44_1405_c1 | 3300050492 | Bacteria | 9539 |
| 755 | nmdc:mga0yw44_192004_c1 | 3300050492 | Bacteria | 1347 |
| 756 | nmdc:mga0yw44_31619_c1 | 3300050492 | Bacteria | 3079 |
| 757 | nmdc:mga0yw44_865_c1 | 3300050492 | Bacteria | 5959 |
| 758 | nmdc:mga0k408_21083_c1 | 3300050493 | Bacteria | 3657 |
| 759 | nmdc:mga0k408_63710_c1 | 3300050493 | Bacteria | 2145 |
| 760 | nmdc:mga06z11_196570_c1 | 3300050494 | Bacteria | 1169 |
| 761 | nmdc:mga06z11_285710_c1 | 3300050494 | Bacteria | 978 |
| 762 | nmdc:mga06z11_424021_c1 | 3300050494 | Bacteria | 802 |
| 763 | nmdc:mga07m45_40428_c1 | 3300050496 | Bacteria | 2609 |
| 764 | nmdc:mga05p37_169637_c1 | 3300050507 | Bacteria | 2662 |
| 765 | nmdc:mga05p37_181727_c1 | 3300050507 | Bacteria | 2558 |
| 766 | nmdc:mga0qj67_357762_c1 | 3300050509 | Bacteria | 1180 |
| 767 | nmdc:mga06r32_179582_c1 | 3300050510 | Bacteria | 2102 |
| 768 | nmdc:mga06r32_954463_c1 | 3300050510 | Bacteria | 812 |
| 769 | nmdc:mga08y16_453561_c1 | 3300050511 | Bacteria | 1307 |
| 770 | nmdc:mga08x19_237661_c1 | 3300050514 | Bacteria | 1255 |
| 771 | nmdc:mga0sz30_235323_c1 | 3300050516 | Bacteria | 815 |
| 772 | nmdc:mga0sz30_260587_c1 | 3300050516 | Bacteria | 772 |
| 773 | nmdc:mga0sz30_4354_c1 | 3300050516 | Bacteria | 5112 |
| 774 | nmdc:mga0sz30_7993_c1 | 3300050516 | Bacteria | 2987 |
| 775 | nmdc:mga0sz30_802_c1 | 3300050516 | Bacteria | 11359 |
| 776 | nmdc:mga0sz30_84103_c1 | 3300050516 | Bacteria | 1379 |
| 777 | Ga0500610_0022183 | 3300053079 | Bacteria | 3127 |
| 778 | Ga0495619_0039700 | 3300053085 | Bacteria | 3074 |
| 779 | Ga0500578_0448500 | 3300053086 | Bacteria | 735 |
| 780 | Ga0500578_0459078 | 3300053086 | Bacteria | 723 |
| 781 | Ga0500643_006663 | 3300053087 | Bacteria | 4789 |
| 782 | Ga0500644_0011388 | 3300053088 | Bacteria | 2430 |
| 783 | Ga0500644_0157381 | 3300053088 | Bacteria | 916 |
| 784 | Ga0500646_0268453 | 3300053090 | Bacteria | 605 |
| 785 | Ga0500647_0108906 | 3300053091 | Bacteria | 1318 |
| 786 | Ga0500583_0343685 | 3300053092 | Bacteria | 724 |
| 787 | Ga0500651_0345810 | 3300053093 | Bacteria | 845 |
| 788 | Ga0500557_000501 | 3300053105 | Bacteria | 5231 |
| 789 | Ga0500569_002896 | 3300053109 | Bacteria | 3438 |
| 790 | Ga0500569_008858 | 3300053109 | Bacteria | 2316 |
| 791 | Ga0500569_155755 | 3300053109 | Bacteria | 772 |
| 792 | Ga0500572_003731 | 3300053111 | Bacteria | 3457 |
| 793 | Ga0500594_0003894 | 3300053118 | Bacteria | 3288 |
| 794 | Ga0500607_180670 | 3300053121 | Bacteria | 936 |
| 795 | Ga0500608_052883 | 3300053122 | Bacteria | 1950 |
| 796 | Ga0500618_000849 | 3300053125 | Bacteria | 16428 |
| 797 | Ga0500618_015687 | 3300053125 | Bacteria | 1909 |
| 798 | Ga0500618_041237 | 3300053125 | Bacteria | 1059 |
| 799 | Ga0500642_0256169 | 3300053130 | Bacteria | 802 |
| 800 | Ga0500658_0000206 | 3300053134 | Bacteria | 27878 |
| 801 | Ga0500658_0011557 | 3300053134 | Bacteria | 3254 |
| 802 | Ga0500561_0002494 | 3300053137 | Bacteria | 3106 |
| 803 | Ga0500568_0001714 | 3300053139 | Bacteria | 13653 |
| 804 | Ga0500568_0003195 | 3300053139 | Bacteria | 9316 |
| 805 | Ga0500573_0018797 | 3300053140 | Bacteria | 3946 |
| 806 | Ga0500588_0000807 | 3300053146 | Bacteria | 5419 |
| 807 | Ga0500590_002837 | 3300053148 | Bacteria | 7835 |
| 808 | Ga0500616_0000309 | 3300053153 | Bacteria | 70113 |
| 809 | Ga0500616_0000576 | 3300053153 | Bacteria | 44650 |
| 810 | Ga0500616_0002766 | 3300053153 | Bacteria | 14162 |
| 811 | Ga0500616_0267263 | 3300053153 | Bacteria | 723 |
| 812 | Ga0500616_0294343 | 3300053153 | Bacteria | 676 |
| 813 | Ga0500620_007914 | 3300053155 | Bacteria | 2654 |
| 814 | Ga0500622_0003878 | 3300053156 | Bacteria | 9707 |
| 815 | Ga0500624_000308 | 3300053157 | Bacteria | 16712 |
| 816 | Ga0500624_087080 | 3300053157 | Bacteria | 629 |
| 817 | Ga0500634_0013063 | 3300053161 | Bacteria | 4344 |
| 818 | Ga0500634_0181681 | 3300053161 | Bacteria | 946 |
| 819 | Ga0500636_0000003 | 3300053177 | Bacteria | 240189 |
| 820 | Ga0500636_0000840 | 3300053177 | Bacteria | 16525 |
| 821 | Ga0500637_0093605 | 3300053178 | Bacteria | 1741 |
| 822 | Ga0500609_029468 | 3300053731 | Bacteria | 753 |
| 823 | Ga0501084_0009756 | 3300054114 | Bacteria | 7940 |
| 824 | Ga0587080_061273 | 3300059503 | Bacteria | 733 |
| 825 | Ga0587090_011104 | 3300059510 | Bacteria | 1261 |
| 826 | Ga0587068_011069 | 3300059641 | Bacteria | 1355 |
| 827 | Ga0587069_012415 | 3300059642 | Bacteria | 1155 |
| 828 | Ga0587072_018780 | 3300059643 | Bacteria | 1204 |
| 829 | Ga0501082_0017190 | 3300060353 | Bacteria | 6231 |
| 830 | Ga0530510_0034914 | 3300061734 | Bacteria | 3623 |
| 831 | 2509108157 | 2508501122 | Bacteria | 6292184 |
| 832 | 2509376667 | 2509276019 | Bacteria | 6802256 |
| 833 | 2509391816 | 2509276021 | Bacteria | 7634384 |
| 834 | 2509447329 | 2509276033 | Bacteria | 7180565 |
| 835 | 2510134167 | 2510065019 | Bacteria | 6903379 |
| 836 | 2510305320 | 2510065057 | Bacteria | 6649661 |
| 837 | 2510841357 | 2510461069 | Bacteria | 5505000 |
| 838 | 2510895604 | 2510461076 | Bacteria | 8618824 |
| 839 | 2511133230 | 2510917022 | Bacteria | 6504556 |
| 840 | 2511172874 | 2510917026 | Bacteria | 7046020 |
| 841 | 2511182484 | 2510917028 | Bacteria | 6185411 |
| 842 | 2511199240 | 2510917030 | Bacteria | 7460662 |
| 843 | 2511502456 | 2511231052 | Bacteria | 6974333 |
| 844 | 2512533834 | 2512047086 | Bacteria | 6850303 |
| 845 | 2512970417 | 2512875026 | Bacteria | 6861065 |
| 846 | 2513567753 | 2513237084 | Bacteria | 7231967 |
| 847 | 2513577164 | 2513237085 | Bacteria | 7695351 |
| 848 | 2513597682 | 2513237088 | Bacteria | 6927906 |
| 849 | 2513601481 | 2513237089 | Bacteria | 6553624 |
| 850 | 2513618150 | 2513237091 | Bacteria | 6900273 |
| 851 | 2513633165 | 2513237093 | Bacteria | 7545552 |
| 852 | 2513707838 | 2513237103 | Bacteria | 7647401 |
| 853 | 2513865913 | 2513237138 | Bacteria | 7368160 |
| 854 | 2513884475 | 2513237140 | Bacteria | 7076289 |
| 855 | 2513904483 | 2513237143 | Bacteria | 6664116 |
| 856 | 2513908555 | 2513237144 | Bacteria | 7530820 |
| 857 | 2513925193 | 2513237146 | Bacteria | 7166346 |
| 858 | 2513983678 | 2513237156 | Bacteria | 6402557 |
| 859 | 2513997692 | 2513237159 | Bacteria | 6810126 |
| 860 | 2514003073 | 2513237160 | Bacteria | 6650282 |
| 861 | 2514018084 | 2513237162 | Bacteria | 7468464 |
| 862 | 2515609251 | 2515154107 | Bacteria | 6795637 |
| 863 | 2515636775 | 2515154113 | Bacteria | 7807172 |
| 864 | 2515646359 | 2515154114 | Bacteria | 7848616 |
| 865 | 2515655125 | 2515154116 | Bacteria | 7552979 |
| 866 | 2515739698 | 2515154134 | Bacteria | 7220242 |
| 867 | 2516206197 | 2516143018 | Bacteria | 6951533 |
| 868 | 2516893832 | 2516653046 | Bacteria | 6989037 |
| 869 | 2517036937 | 2516653077 | Bacteria | 7555578 |
| 870 | 2517077294 | 2516653085 | Bacteria | 7346596 |
| 871 | 2517096052 | 2517093000 | Bacteria | 7412387 |
| 872 | 2517407672 | 2517287029 | Bacteria | 6905599 |
| 873 | 2517570545 | 2517487022 | Bacteria | 7227575 |
| 874 | 2520377042 | 2519899620 | Bacteria | 6499161 |
| 875 | 2524448346 | 2524023207 | Bacteria | 6813453 |
| 876 | 2524458843 | 2524023209 | Bacteria | 6679728 |
| 877 | 2535484901 | 2534681786 | Bacteria | 3308809 |
| 878 | 2535517092 | 2534681796 | Bacteria | 7146037 |
| 879 | 2537876325 | 2537561587 | Bacteria | 5425293 |
| 880 | 2554248393 | 2554235003 | Bacteria | 5877155 |
| 881 | 2558863971 | 2558860100 | Bacteria | 8458965 |
| 882 | 2559295509 | 2558860242 | Bacteria | 5568029 |
| 883 | 2561469275 | 2558860983 | Bacteria | 4133860 |
| 884 | 2585147455 | 2582581279 | Bacteria | 4980720 |
| 885 | 2585167432 | 2582581283 | Bacteria | 6030556 |
| 886 | 2585202005 | 2582581294 | Bacteria | 6626667 |
| 887 | 2585223070 | 2582581298 | Bacteria | 7315509 |
| 888 | 2585228507 | 2582581299 | Bacteria | 6518058 |
| 889 | 2585258284 | 2582581304 | Bacteria | 5831370 |
| 890 | 2585265657 | 2582581306 | Bacteria | 6450535 |
| 891 | 2585271339 | 2582581307 | Bacteria | 6597605 |
| 892 | 2585279278 | 2582581308 | Bacteria | 7413247 |
| 893 | 2585323117 | 2582581315 | Bacteria | 7318924 |
| 894 | 2585331229 | 2582581316 | Bacteria | 7774528 |
| 895 | 2585388862 | 2582581865 | Bacteria | 6644329 |
| 896 | 2585395439 | 2582581866 | Bacteria | 6859583 |
| 897 | 2585400945 | 2582581867 | Bacteria | 7184437 |
| 898 | 2585524722 | 2585427526 | Bacteria | 7258840 |
| 899 | 2585531237 | 2585427527 | Bacteria | 7273426 |
| 900 | 2585538409 | 2585427528 | Bacteria | 6842387 |
| 901 | 2585545653 | 2585427529 | Bacteria | 7395659 |
| 902 | 2585552840 | 2585427530 | Bacteria | 7383882 |
| 903 | 2585559082 | 2585427531 | Bacteria | 6992870 |
| 904 | 2585822152 | 2585427590 | Bacteria | 6824633 |
| 905 | 2585836362 | 2585427593 | Bacteria | 7141551 |
| 906 | 2585843454 | 2585427594 | Bacteria | 6180594 |
| 907 | 2585898463 | 2585427608 | Bacteria | 6544331 |
| 908 | 2585903972 | 2585427609 | Bacteria | 6667127 |
| 909 | 2587980910 | 2585428125 | Bacteria | 6662905 |
| 910 | 2599332003 | 2599185156 | Bacteria | 5403036 |
| 911 | 2599417100 | 2599185170 | Bacteria | 7295545 |
| 912 | 2599601826 | 2599185210 | Bacteria | 5624189 |
| 913 | 2599721594 | 2599185236 | Bacteria | 6875203 |
| 914 | 2600194838 | 2599185352 | Bacteria | 7228948 |
| 915 | 2600374119 | 2600254933 | Bacteria | 4750527 |
| 916 | 2601609918 | 2600255279 | Bacteria | 5605316 |
| 917 | 2601746693 | 2600255308 | Bacteria | 5611129 |
| 918 | 2616293149 | 2615840624 | Bacteria | 6557588 |
| 919 | 2616311445 | 2615840626 | Bacteria | 7921970 |
| 920 | 2616554456 | 2615840698 | Bacteria | 7319877 |
| 921 | 2617384820 | 2617270742 | Bacteria | 6808054 |
| 922 | 2643804208 | 2643221557 | Bacteria | 7184309 |
| 923 | 2643811320 | 2643221558 | Bacteria | 5460675 |
| 924 | 2643856585 | 2643221568 | Bacteria | 5187270 |
| 925 | 2643920175 | 2643221582 | Bacteria | 5804683 |
| 926 | 2643962815 | 2643221591 | Bacteria | 4397626 |
| 927 | 2644007051 | 2643221599 | Bacteria | 6292121 |
| 928 | 2644050245 | 2643221607 | Bacteria | 6314006 |
| 929 | 2644065018 | 2643221610 | Bacteria | 7480339 |
| 930 | 2644105271 | 2643221618 | Bacteria | 7717186 |
| 931 | 2644145653 | 2643221626 | Bacteria | 8069654 |
| 932 | 2644191830 | 2643221634 | Bacteria | 6705461 |
| 933 | 2644204693 | 2643221636 | Bacteria | 6583769 |
| 934 | 2644208797 | 2643221637 | Bacteria | 5345260 |
| 935 | 2644242553 | 2643221643 | Bacteria | 5749658 |
| 936 | 2644288418 | 2643221651 | Bacteria | 4798932 |
| 937 | 2644298895 | 2643221653 | Bacteria | 4569637 |
| 938 | 2644309684 | 2643221655 | Bacteria | 7722067 |
| 939 | 2644331148 | 2643221659 | Bacteria | 7890716 |
| 940 | 2644376573 | 2643221668 | Bacteria | 7306521 |
| 941 | 2644416691 | 2643221675 | Bacteria | 7473456 |
| 942 | 2644449731 | 2643221680 | Bacteria | 7473610 |
| 943 | 2644483165 | 2643221686 | Bacteria | 6310811 |
| 944 | 2644494319 | 2643221688 | Bacteria | 5260751 |
| 945 | 2644497812 | 2643221689 | Bacteria | 6042950 |
| 946 | 2644521796 | 2643221693 | Bacteria | 5513853 |
| 947 | 2644543413 | 2643221698 | Bacteria | 7756764 |
| 948 | 2644616208 | 2643221712 | Bacteria | 7729434 |
| 949 | 2644652327 | 2643221718 | Bacteria | 5345506 |
| 950 | 2644657124 | 2643221719 | Bacteria | 4568197 |
| 951 | 2644675831 | 2643221723 | Bacteria | 7095460 |
| 952 | 2644689863 | 2643221726 | Bacteria | 7455827 |
| 953 | 2657681722 | 2657244999 | Bacteria | 5946535 |
| 954 | 2671111224 | 2667528174 | Bacteria | 6435400 |
| 955 | 2692315293 | 2690316117 | Bacteria | 6800650 |
| 956 | 2719182008 | 2718217882 | Bacteria | 6556348 |
| 957 | 2719666368 | 2718217997 | Bacteria | 6740740 |
| 958 | 2719732725 | 2718218009 | Bacteria | 6478651 |
| 959 | 2720492788 | 2718218199 | Bacteria | 6740745 |
| 960 | 2720614256 | 2718218232 | Bacteria | 6720332 |
| 961 | 2720621024 | 2718218233 | Bacteria | 6662049 |
| 962 | 2720632348 | 2718218235 | Bacteria | 6630699 |
| 963 | 2720776076 | 2718218269 | Bacteria | 6906114 |
| 964 | 2721148099 | 2718218363 | Bacteria | 6524337 |
| 965 | 2721159550 | 2718218365 | Bacteria | 6274507 |
| 966 | 2721164935 | 2718218366 | Bacteria | 6425255 |
| 967 | 2722841105 | 2721755514 | Bacteria | 6424414 |
| 968 | 2723027675 | 2721755556 | Bacteria | 6745503 |
| 969 | 2723561303 | 2721755684 | Bacteria | 6859907 |
| 970 | 2723567926 | 2721755685 | Bacteria | 6704835 |
| 971 | 2724045481 | 2721755810 | Bacteria | 6479005 |
| 972 | 2724090683 | 2721755819 | Bacteria | 6906405 |
| 973 | 2724105191 | 2721755822 | Bacteria | 6726041 |
| 974 | 2724111018 | 2721755823 | Bacteria | 6752556 |
| 975 | 2725951385 | 2724679232 | Bacteria | 7646494 |
| 976 | 2730108611 | 2728369352 | Bacteria | 6745171 |
| 977 | 2730165243 | 2728369365 | Bacteria | 6555560 |
| 978 | 2730299182 | 2728369397 | Bacteria | 6274511 |
| 979 | 2738800309 | 2738541293 | Bacteria | 7065685 |
| 980 | 2738944060 | 2738541317 | Bacteria | 5340176 |
| 981 | 2739033050 | 2738541333 | Bacteria | 7106503 |
| 982 | 2753462350 | 2751185821 | Bacteria | 6189929 |
| 983 | 2758641785 | 2758568016 | Bacteria | 5645291 |
| 984 | 2766066093 | 2765235942 | Bacteria | 7445910 |
| 985 | 2776914177 | 2775507049 | Bacteria | 6284736 |
| 986 | 2778175639 | 2775507266 | Bacteria | 7392367 |
| 987 | 2792581434 | 2791355082 | Bacteria | 5973319 |
| 988 | 2792620588 | 2791355091 | Bacteria | 6135441 |
| 989 | 2792625947 | 2791355092 | Bacteria | 6248105 |
| 990 | 2792638886 | 2791355094 | Bacteria | 7011481 |
| 991 | 2793280117 | 2791355253 | Bacteria | 5171699 |
| 992 | 2793294223 | 2791355256 | Bacteria | 6798008 |
| 993 | 2793315878 | 2791355259 | Bacteria | 7254731 |
| 994 | 2793319389 | 2791355260 | Bacteria | 6598818 |
| 995 | 2793328475 | 2791355261 | Bacteria | 6661293 |
| 996 | 2793335433 | 2791355262 | Bacteria | 6774204 |
| 997 | 2793339485 | 2791355263 | Bacteria | 6872478 |
| 998 | 2793347038 | 2791355264 | Bacteria | 6429314 |
| 999 | 2793351630 | 2791355265 | Bacteria | 6539969 |
| 1000 | 2793361926 | 2791355266 | Bacteria | 7116587 |
| 1001 | 2793367683 | 2791355267 | Bacteria | 7222458 |
| 1002 | 2802716773 | 2802428858 | Bacteria | 6636079 |
| 1003 | 2802725585 | 2802428859 | Bacteria | 6667919 |
| 1004 | 2802730324 | 2802428860 | Bacteria | 6525526 |
| 1005 | 2802737705 | 2802428861 | Bacteria | 6534206 |
| 1006 | 2802742906 | 2802428862 | Bacteria | 6633353 |
| 1007 | 2802750330 | 2802428863 | Bacteria | 6410669 |
| 1008 | 2804752909 | 2802429268 | Bacteria | 6094027 |
| 1009 | 2805926861 | 2802429605 | Bacteria | 6875453 |
| 1010 | 2805932776 | 2802429606 | Bacteria | 6346811 |
| 1011 | 2806045189 | 2802429633 | Bacteria | 7341974 |
| 1012 | 2806050016 | 2802429634 | Bacteria | 7083200 |
| 1013 | 2806056854 | 2802429635 | Bacteria | 7650140 |
| 1014 | 2806064235 | 2802429636 | Bacteria | 7597525 |
| 1015 | 2806071503 | 2802429637 | Bacteria | 7067217 |
| 1016 | 2808987756 | 2808606387 | Bacteria | 5697198 |
| 1017 | 2819241098 | 2818991272 | Bacteria | 4622173 |
| 1018 | 2819559224 | 2818991439 | Bacteria | 6907412 |
| 1019 | 2819609347 | 2818991448 | Bacteria | 6772224 |
| 1020 | 2819641341 | 2818991453 | Bacteria | 7181617 |
| 1021 | 2819685145 | 2818991461 | Bacteria | 7026071 |
| 1022 | 2821125722 | 2821123053 | Bacteria | 7836056 |
| 1023 | 2821447862 | 2821443989 | Bacteria | 7658172 |
| 1024 | 2838021666 | 2838016132 | Bacteria | 6577831 |
| 1025 | 2838023641 | 2838022645 | Bacteria | 6494267 |
| 1026 | 2838033396 | 2838029111 | Bacteria | 6603031 |
| 1027 | 2838038693 | 2838035591 | Bacteria | 7166484 |
| 1028 | 2838045179 | 2838042994 | Bacteria | 6046894 |
| 1029 | 2838053340 | 2838048938 | Bacteria | 6044578 |
| 1030 | 2838065460 | 2838061910 | Bacteria | 6794874 |
| 1031 | 2838069939 | 2838068647 | Bacteria | 6208656 |
| 1032 | 2838079797 | 2838074704 | Bacteria | 6785777 |
| 1033 | 2838661385 | 2838661181 | Bacteria | 7385261 |
| 1034 | 2838670571 | 2838668709 | Bacteria | 6671819 |
| 1035 | 2838675605 | 2838675328 | Bacteria | 4909118 |
| 1036 | 2838683238 | 2838680041 | Bacteria | 6545511 |
| 1037 | 2838686833 | 2838686498 | Bacteria | 7807632 |
| 1038 | 2838697818 | 2838694306 | Bacteria | 6853137 |
| 1039 | 2838702942 | 2838701080 | Bacteria | 6669771 |
| 1040 | 2838710933 | 2838707686 | Bacteria | 6619912 |
| 1041 | 2838714487 | 2838714209 | Bacteria | 5525906 |
| 1042 | 2838721712 | 2838719591 | Bacteria | 5523910 |
| 1043 | 2838725247 | 2838724970 | Bacteria | 4908691 |
| 1044 | 2838730209 | 2838729681 | Bacteria | 7400765 |
| 1045 | 2838737827 | 2838736955 | Bacteria | 5760694 |
| 1046 | 2838742776 | 2838742623 | Bacteria | 7396178 |
| 1047 | 2841841804 | 2841840854 | Bacteria | 5761912 |
| 1048 | 2841848696 | 2841846520 | Bacteria | 5345850 |
| 1049 | 2841852279 | 2841851746 | Bacteria | 7532261 |
| 1050 | 2841862294 | 2841859092 | Bacteria | 5436171 |
| 1051 | 2841867168 | 2841864319 | Bacteria | 6742987 |
| 1052 | 2842079107 | 2842077413 | Bacteria | 6508645 |
| 1053 | 2842113045 | 2842110456 | Bacteria | 7656360 |
| 1054 | 2842118383 | 2842118031 | Bacteria | 7033875 |
| 1055 | 2842125273 | 2842124991 | Bacteria | 5346824 |
| 1056 | 2842130500 | 2842130223 | Bacteria | 4909145 |
| 1057 | 2842141582 | 2842140634 | Bacteria | 5759631 |
| 1058 | 2842147800 | 2842146304 | Bacteria | 5957337 |
| 1059 | 2842154330 | 2842152218 | Bacteria | 4908957 |
| 1060 | 2842158319 | 2842156927 | Bacteria | 6894975 |
| 1061 | 2842168578 | 2842163707 | Bacteria | 6916235 |
| 1062 | 2842170729 | 2842170452 | Bacteria | 5525737 |
| 1063 | 2842177950 | 2842175837 | Bacteria | 4908771 |
| 1064 | 2842181939 | 2842180545 | Bacteria | 6888678 |
| 1065 | 2842187596 | 2842187318 | Bacteria | 5524014 |
| 1066 | 2842195848 | 2842192696 | Bacteria | 6147454 |
| 1067 | 2842199155 | 2842198810 | Bacteria | 6608673 |
| 1068 | 2842209605 | 2842205361 | Bacteria | 6340321 |
| 1069 | 2842211907 | 2842211629 | Bacteria | 5523832 |
| 1070 | 2842218162 | 2842217011 | Bacteria | 7497767 |
| 1071 | 2842226474 | 2842224351 | Bacteria | 5524473 |
| 1072 | 2842230066 | 2842229732 | Bacteria | 7475766 |
| 1073 | 2842240295 | 2842237096 | Bacteria | 6620661 |
| 1074 | 2842243955 | 2842243621 | Bacteria | 7421798 |
| 1075 | 2842252866 | 2842250916 | Bacteria | 6579627 |
| 1076 | 2842257960 | 2842257432 | Bacteria | 7401195 |
| 1077 | 2842269496 | 2842264693 | Bacteria | 6472963 |
| 1078 | 2842271629 | 2842271015 | Bacteria | 7807131 |
| 1079 | 2842283059 | 2842278818 | Bacteria | 6340002 |
| 1080 | 2842285393 | 2842285085 | Bacteria | 6011953 |
| 1081 | 2842292769 | 2842291075 | Bacteria | 7076806 |
| 1082 | 2842298192 | 2842298080 | Bacteria | 6123127 |
| 1083 | 2842305260 | 2842304105 | Bacteria | 7023636 |
| 1084 | 2842314010 | 2842311132 | Bacteria | 6616990 |
| 1085 | 2842319749 | 2842317721 | Bacteria | 6793725 |
| 1086 | 2842348473 | 2842341865 | Bacteria | 7003929 |
| 1087 | 2842360208 | 2842357229 | Bacteria | 6485165 |
| 1088 | 2842370250 | 2842363717 | Bacteria | 6844742 |
| 1089 | 2842373869 | 2842370503 | Bacteria | 7038661 |
| 1090 | 2842379166 | 2842377471 | Bacteria | 7140707 |
| 1091 | 2842384893 | 2842384541 | Bacteria | 7057858 |
| 1092 | 2842402753 | 2842402390 | Bacteria | 6681310 |
| 1093 | 2842409876 | 2842409023 | Bacteria | 6687331 |
| 1094 | 2842416524 | 2842415677 | Bacteria | 6596907 |
| 1095 | 2842423553 | 2842422224 | Bacteria | 6239196 |
| 1096 | 2842430502 | 2842428310 | Bacteria | 6767288 |
| 1097 | 2842436686 | 2842434925 | Bacteria | 6502746 |
| 1098 | 2842443472 | 2842441272 | Bacteria | 6769273 |
| 1099 | 2842449342 | 2842447887 | Bacteria | 6754142 |
| 1100 | 2842466756 | 2842462802 | Bacteria | 6588055 |
| 1101 | 2842471444 | 2842469257 | Bacteria | 6752936 |
| 1102 | 2842479938 | 2842475841 | Bacteria | 6603183 |
| 1103 | 2842483860 | 2842482326 | Bacteria | 7212537 |
| 1104 | 2842492279 | 2842489311 | Bacteria | 6620893 |
| 1105 | 2842497861 | 2842495871 | Bacteria | 6820686 |
| 1106 | 2842505277 | 2842502639 | Bacteria | 6604161 |
| 1107 | 2842514284 | 2842509118 | Bacteria | 6850950 |
| 1108 | 2842519078 | 2842515876 | Bacteria | 5436280 |
| 1109 | 2842522062 | 2842521101 | Bacteria | 6569494 |
| 1110 | 2842777676 | 2842775625 | Bacteria | 5587290 |
| 1111 | 2842924338 | 2842922631 | Bacteria | 5824079 |
| 1112 | 2844164033 | 2844163670 | Bacteria | 7266046 |
| 1113 | 2844458130 | 2844454524 | Bacteria | 7952546 |
| 1114 | 2847419648 | 2847417321 | Bacteria | 6913799 |
| 1115 | 2848994650 | 2848992105 | Bacteria | 6810864 |
| 1116 | 2850081667 | 2850079185 | Bacteria | 6848280 |
| 1117 | 2852390469 | 2852387548 | Bacteria | 8025568 |
| 1118 | 2854901335 | 2854896431 | Bacteria | 5869725 |
| 1119 | 2854912118 | 2854911287 | Bacteria | 5582813 |
| 1120 | 2855826557 | 2855825444 | Bacteria | 6785811 |
| 1121 | 2855877165 | 2855872281 | Bacteria | 6964271 |
| 1122 | 2857517205 | 2857516855 | Bacteria | 7787325 |
| 1123 | 2857532283 | 2857531043 | Bacteria | 6754041 |
| 1124 | 2858803750 | 2858800743 | Bacteria | 6603254 |
| 1125 | 2891089979 | 2891088606 | Bacteria | 4762464 |
| 1126 | 2891373572 | 2891373044 | Bacteria | 5202277 |
| 1127 | 2894776970 | 2894772417 | Bacteria | 5305674 |
| 1128 | 2894817751 | 2894817345 | Bacteria | 4892941 |
| 1129 | 2896392101 | 2896384573 | Bacteria | 7700774 |
| 1130 | 2899794101 | 2899792073 | Bacteria | 4926588 |
| 1131 | 2899806799 | 2899803654 | Bacteria | 5577784 |
| 1132 | 2899847747 | 2899845264 | Bacteria | 5672268 |
| 1133 | 2913296101 | 2913295892 | Bacteria | 6333755 |
| 1134 | 2913313570 | 2913308742 | Bacteria | 5350706 |
| 1135 | 2915654079 | 2915650412 | Bacteria | 4288180 |
| 1136 | 2915982886 | 2915980308 | Bacteria | 6624279 |
| 1137 | 2915989485 | 2915986958 | Bacteria | 6739310 |
| 1138 | 2916009195 | 2916007675 | Bacteria | 6898660 |
| 1139 | 2916044326 | 2916041962 | Bacteria | 6820487 |
| 1140 | 2916050375 | 2916048683 | Bacteria | 6543552 |
| 1141 | 2916065458 | 2916061851 | Bacteria | 6737736 |
| 1142 | 2916074655 | 2916068649 | Bacteria | 6943657 |
| 1143 | 2916078318 | 2916076590 | Bacteria | 6596108 |
| 1144 | 2919106244 | 2919100787 | Bacteria | 7710546 |
| 1145 | 2919114523 | 2919114240 | Bacteria | 5700270 |
| 1146 | 2919169492 | 2919166419 | Bacteria | 4952238 |
| 1147 | 2919410207 | 2919408235 | Bacteria | 6149349 |
| 1148 | 2920761319 | 2920760137 | Bacteria | 7427611 |
| 1149 | 2920762659 | 2920760137 | Bacteria | 7427611 |
| 1150 | 2920825475 | 2920822456 | Bacteria | 6897201 |
| 1151 | 2921253734 | 2921250672 | Bacteria | 6677771 |
| 1152 | 2921261941 | 2921257292 | Bacteria | 6808382 |
| 1153 | 2923561083 | 2923556063 | Bacteria | 6793593 |
| 1154 | 2924156775 | 2924150972 | Bacteria | 7169444 |
| 1155 | 2924196976 | 2924193448 | Bacteria | 6955718 |
| 1156 | 2926755538 | 2926754445 | Bacteria | 5964435 |
| 1157 | 2926762666 | 2926760298 | Bacteria | 5505990 |
| 1158 | 2929141018 | 2929138655 | Bacteria | 5810547 |
| 1159 | 2929203319 | 2929199973 | Bacteria | 7260745 |
| 1160 | 2933008975 | 2933006813 | Bacteria | 4912075 |
| 1161 | 2933014749 | 2933011516 | Bacteria | 5439334 |
| 1162 | 2933018204 | 2933016740 | Bacteria | 6355406 |
| 1163 | 2933571067 | 2933570622 | Bacteria | 7023390 |
| 1164 | 2933588898 | 2933586486 | Bacteria | 7667493 |
| 1165 | 2933596430 | 2933594066 | Bacteria | 5594265 |
| 1166 | 2933600745 | 2933599457 | Bacteria | 5858799 |
| 1167 | 2935896797 | 2935894831 | Bacteria | 6620579 |
| 1168 | 2935901739 | 2935901341 | Bacteria | 7341747 |
| 1169 | 2936371825 | 2936367885 | Bacteria | 7324495 |
| 1170 | 2936379659 | 2936375103 | Bacteria | 6652732 |
| 1171 | 2936387829 | 2936381700 | Bacteria | 7006523 |
| 1172 | 2937002713 | 2936996657 | Bacteria | 6298727 |
| 1173 | 2937027285 | 2937023124 | Bacteria | 6815156 |
| 1174 | 2937033392 | 2937029754 | Bacteria | 6424026 |
| 1175 | 2937038430 | 2937036028 | Bacteria | 6846469 |
| 1176 | 2937057920 | 2937056579 | Bacteria | 7107896 |
| 1177 | 2937065268 | 2937063883 | Bacteria | 7199456 |
| 1178 | 2937080638 | 2937078374 | Bacteria | 6610289 |
| 1179 | 2937091302 | 2937084907 | Bacteria | 6618516 |
| 1180 | 2937107810 | 2937106411 | Bacteria | 6947143 |
| 1181 | 2937117732 | 2937113482 | Bacteria | 6505872 |
| 1182 | 2941504743 | 2941499720 | Bacteria | 7599444 |
| 1183 | 2957380749 | 2957375807 | Bacteria | 6425588 |
| 1184 | 2957388538 | 2957382221 | Bacteria | 6737050 |
| 1185 | 2957394719 | 2957388812 | Bacteria | 6778072 |
| 1186 | 2957397202 | 2957395598 | Bacteria | 6822399 |
| 1187 | 2957419003 | 2957415311 | Bacteria | 6991633 |
| 1188 | 2957439498 | 2957437181 | Bacteria | 6568994 |
| 1189 | 2957445568 | 2957443900 | Bacteria | 6869977 |
| 1190 | 2957458737 | 2957457609 | Bacteria | 6967680 |
| 1191 | 2957493014 | 2957491536 | Bacteria | 6695180 |
| 1192 | 2960594073 | 2960591022 | Bacteria | 6622873 |
| 1193 | 2960613155 | 2960610863 | Bacteria | 6691244 |
| 1194 | 2960619824 | 2960617483 | Bacteria | 6727748 |
| 1195 | 2960625678 | 2960624210 | Bacteria | 6875384 |
| 1196 | 2960635574 | 2960631154 | Bacteria | 6732508 |
| 1197 | 2960656473 | 2960652885 | Bacteria | 7083688 |
| 1198 | 2960663037 | 2960660292 | Bacteria | 7041660 |
| 1199 | 2960668053 | 2960667422 | Bacteria | 6763020 |
| 1200 | 2960680865 | 2960680706 | Bacteria | 6624464 |
| 1201 | 2960688149 | 2960687367 | Bacteria | 6535474 |
| 1202 | 2960697323 | 2960693952 | Bacteria | 6749742 |
| 1203 | 2964608786 | 2964607997 | Bacteria | 7101408 |
| 1204 | 2964618122 | 2964615318 | Bacteria | 6809089 |
| 1205 | 2964700139 | 2964698721 | Bacteria | 6765331 |
| 1206 | 2964717665 | 2964712639 | Bacteria | 6695970 |
| 1207 | 2967689272 | 2967686174 | Bacteria | 6678622 |
| 1208 | 2967699529 | 2967693043 | Bacteria | 6804451 |
| 1209 | 2967729439 | 2967728569 | Bacteria | 6641507 |
| 1210 | 2967759706 | 2967755722 | Bacteria | 6814706 |
| 1211 | 2970028070 | 2970026789 | Bacteria | 6785236 |
| 1212 | 2970036924 | 2970033650 | Bacteria | 7118744 |
| 1213 | 2970042119 | 2970040964 | Bacteria | 6731123 |
| 1214 | 2970053661 | 2970047711 | Bacteria | 7088379 |
| 1215 | 2970073586 | 2970068827 | Bacteria | 7123112 |
| 1216 | 2970078523 | 2970076120 | Bacteria | 6697332 |
| 1217 | 2970087450 | 2970082768 | Bacteria | 6183754 |
| 1218 | 2970104023 | 2970102677 | Bacteria | 6812532 |
| 1219 | 2970126101 | 2970122695 | Bacteria | 6625855 |
| 1220 | 2970132045 | 2970129317 | Bacteria | 6806560 |
| 1221 | 2970147266 | 2970143518 | Bacteria | 6446480 |
| 1222 | 2970181162 | 2970177841 | Bacteria | 6768001 |
| 1223 | 2977523195 | 2977516862 | Bacteria | 6940108 |
| 1224 | 2977524746 | 2977523885 | Bacteria | 6960446 |
| 1225 | 2977536454 | 2977530762 | Bacteria | 6951399 |
| 1226 | 2977550416 | 2977544691 | Bacteria | 6875412 |
| 1227 | 2977572717 | 2977565890 | Bacteria | 6901543 |
| 1228 | 2978971891 | 2978969890 | Bacteria | 5400756 |
| 1229 | 2979092021 | 2979089926 | Bacteria | 5670289 |
| 1230 | 2979100590 | 2979095461 | Bacteria | 5669583 |
| 1231 | 2979104078 | 2979100975 | Bacteria | 5423623 |
| 1232 | 2984511351 | 2984509177 | Bacteria | 5274802 |
| 1233 | 2984522288 | 2984518228 | Bacteria | 5277463 |
| 1234 | 2984541590 | 2984537506 | Bacteria | 5277481 |
| 1235 | 2984590176 | 2984587000 | Bacteria | 5263363 |
| 1236 | 2984603863 | 2984601300 | Bacteria | 5455244 |
| 1237 | 2989350047 | 2989349275 | Bacteria | 6349068 |
| 1238 | 2989776011 | 2989771324 | Bacteria | 5605128 |
| 1239 | 2989779454 | 2989776772 | Bacteria | 4843317 |
| 1240 | 2995396008 | 2995392953 | Bacteria | 4539380 |
| 1241 | 2996892826 | 2996887358 | Bacteria | 5795980 |
| 1242 | 2996894929 | 2996893221 | Bacteria | 5823108 |
| 1243 | 3000018609 | 3000017691 | Bacteria | 3772574 |
| 1244 | 3003934460 | 3003930520 | Bacteria | 5667563 |
| 1245 | 3005414349 | 3005409236 | Bacteria | 7188837 |
| 1246 | 3005418973 | 3005416602 | Bacteria | 7064308 |
| 1247 | 3005448663 | 3005445848 | Bacteria | 6906074 |
| 1248 | 3005454901 | 3005452660 | Bacteria | 5889319 |
| 1249 | 639649392 | 639633055 | Bacteria | 7751309 |
| 1250 | 643826545 | 643692032 | Bacteria | 6891900 |
| 1251 | 650740719 | 650716007 | Bacteria | 5573770 |
| 1252 | 8003571793 | 8003570095 | Bacteria | 5747666 |
| 1253 | 8003994383 | 8003992118 | Bacteria | 7266902 |
| 1254 | 8004002081 | 8003999396 | Bacteria | 7063185 |
| 1255 | 8005249937 | 8005246636 | Bacteria | 4933972 |
| 1256 | 8005259407 | 8005258706 | Bacteria | 6184835 |
| 1257 | 8005284604 | 8005282627 | Bacteria | 6675747 |
| 1258 | 8005295727 | 8005289223 | Bacteria | 6634003 |
| 1259 | 8005303339 | 8005301065 | Bacteria | 6614431 |
| 1260 | 8005309608 | 8005307578 | Bacteria | 7395396 |
| 1261 | 8005318135 | 8005314921 | Bacteria | 7072929 |
| 1262 | 8005327353 | 8005321885 | Bacteria | 5795980 |
| 1263 | 8005381143 | 8005376324 | Bacteria | 6590079 |
| 1264 | 8005388903 | 8005382845 | Bacteria | 6732062 |
| 1265 | 8005395887 | 8005395548 | Bacteria | 6806915 |
| 1266 | 8005437494 | 8005430974 | Bacteria | 6689030 |
| 1267 | 8005488988 | 8005484373 | Bacteria | 6297373 |
| 1268 | 8005501108 | 8005497431 | Bacteria | 6477605 |
| 1269 | 8005545906 | 8005542996 | Bacteria | 7077758 |
| 1270 | 8005561435 | 8005556819 | Bacteria | 6908598 |
| 1271 | 8005568213 | 8005563573 | Bacteria | 7153261 |
| 1272 | 8005573247 | 8005570704 | Bacteria | 6957481 |
| 1273 | 8005622475 | 8005619151 | Bacteria | 7030230 |
| 1274 | 8005629977 | 8005626139 | Bacteria | 6534237 |
| 1275 | 8005646067 | 8005645114 | Bacteria | 6950293 |
| 1276 | 8005658852 | 8005658619 | Bacteria | 4500593 |
| 1277 | 8005672526 | 8005668836 | Bacteria | 6953162 |
| 1278 | 8005682681 | 8005682033 | Bacteria | 6726518 |
| 1279 | 8005691889 | 8005688590 | Bacteria | 6610080 |
| 1280 | 8005697623 | 8005695170 | Bacteria | 6912330 |
| 1281 | 8018127990 | 8018127388 | Bacteria | 7351159 |
| 1282 | 8018151344 | 8018150411 | Bacteria | 5549903 |
| 1283 | 8018164355 | 8018163183 | Bacteria | 7277977 |
| 1284 | 8023682952 | 8023680758 | Bacteria | 7729763 |
| 1285 | 8024482647 | 8024479707 | Bacteria | 6954785 |
| 1286 | 8024488252 | 8024486573 | Bacteria | 6540512 |
| 1287 | 8024504646 | 8024501048 | Bacteria | 6427847 |
| 1288 | 8045865571 | 8045864390 | Bacteria | 5043873 |
| 1289 | 8046771734 | 8046767195 | Bacteria | 7547379 |
| 1290 | 8049295515 | 8049293176 | Bacteria | 6128433 |
| 1291 | 8054463141 | 8054460903 | Bacteria | 4872905 |
| 1292 | 8054562192 | 8054558443 | Bacteria | 5204801 |
| 1293 | 8055432393 | 8055431914 | Bacteria | 4551896 |
| 1294 | 8055910564 | 8055909800 | Bacteria | 7278581 |
| 1295 | 8056378352 | 8056375014 | Bacteria | 7006639 |
| 1296 | 8056384206 | 8056382006 | Bacteria | 6408074 |
| 1297 | 8056875761 | 8056875544 | Bacteria | 4355797 |
| 1298 | 8057103362 | 8057101203 | Bacteria | 5034064 |
| 1299 | 8057575488 | 8057575449 | Bacteria | 7367519 |
| 1300 | 8057879873 | 8057874678 | Bacteria | 7494653 |
| 1301 | Ga0070669_100260722 | |||
| 1302 | JGI24740J21852_10003638 | |||
| 1303 | JGI24739J22299_10033117 | |||
| 1304 | JGI25155J39150_1000014 | |||
| 1305 | JGI25156J39149_1000037 | |||
| 1306 | JGI25156J39149_1000079 | |||
| 1307 | JGI25162J39368_1000497 | |||
| 1308 | JGI25162J39368_1000992 | |||
| 1309 | JGI25154J39366_1000052 | |||
| 1310 | JGI25158J39367_1000499 | |||
| 1311 | JGI25157J39369_1000040 | |||
| 1312 | JGI25152J39213_1001025 | |||
| 1313 | JGI25152J39213_1002772 | |||
| 1314 | JGI25152J39213_1004429 | |||
| 1315 | JGI25152J39213_1020840 | |||
| 1316 | JGI25152J39213_1029794 | |||
| 1317 | JGI25150J39212_1000088 | |||
| 1318 | JGI25150J39212_1015270 | |||
| 1319 | JGI25150J39212_1027871 | |||
| 1320 | JGI25159J45721_1000004 | |||
| 1321 | JGI25159J45721_1001399 | |||
| 1322 | JGI25159J45721_1006965 | |||
| 1323 | JGI25151J46595_10000215 | |||
| 1324 | JGI25151J46595_10000280 | |||
| 1325 | JGI25151J46595_10005849 | |||
| 1326 | JGI25151J46595_10006069 | |||
| 1327 | JGI25151J46595_10024325 | |||
| 1328 | JGI25151J46595_10024843 | |||
| 1329 | JGI25151J46595_10038793 | |||
| 1330 | JGI25151J46595_10052475 | |||
| 1331 | JGI25151J46595_10065287 | |||
| 1332 | JGI25151J46595_10129791 | |||
| 1333 | JGI25406J46586_10003554 | |||
| 1334 | JGI25165J46597_1000371 | |||
| 1335 | JGI25165J46597_1000462 | |||
| 1336 | JGI25165J46597_1005670 | |||
| 1337 | JGI25153J46596_10001244 | |||
| 1338 | JGI25153J46596_10007382 | |||
| 1339 | JGI25153J46596_10017172 | |||
| 1340 | JGI25153J46596_10032466 | |||
| 1341 | rootH1_10177570 | |||
| 1342 | JGI25160J50197_1000001 | |||
| 1343 | JGI25160J50197_1000021 | |||
| 1344 | JGI25160J50197_1001207 | |||
| 1345 | JGI25160J50197_1011565 | |||
| 1346 | JGI25160J50197_1022474 | |||
| 1347 | JGI25161J50226_1000001 | |||
| 1348 | JGI25161J50226_1000283 | |||
| 1349 | JGI25161J50226_1000307 | |||
| 1350 | JGI25161J50226_1016692 | |||
| 1351 | Ga0006562J51391_1004630 | |||
| 1352 | Ga0006562J51391_1004633 | |||
| 1353 | Ga0055525_1019223 | |||
| 1354 | Ga0055529_1005549 | |||
| 1355 | Ga0055526_1001084 | |||
| 1356 | Ga0055526_1002599 | |||
| 1357 | Ga0055526_1004226 | |||
| 1358 | Ga0055526_1013834 | |||
| 1359 | Ga0055526_1042781 | |||
| 1360 | Ga0055524_1002465 | |||
| 1361 | Ga0055524_1004489 | |||
| 1362 | Ga0055524_1004911 | |||
| 1363 | Ga0055524_1009251 | |||
| 1364 | Ga0055524_1011052 | |||
| 1365 | Ga0055524_1021006 | |||
| 1366 | Ga0055524_1025442 | |||
| 1367 | Ga0055524_1074924 | |||
| 1368 | Ga0055536_1003481 | |||
| 1369 | Ga0055536_1009272 | |||
| 1370 | Ga0055528_1000549 | |||
| 1371 | Ga0055528_1001077 | |||
| 1372 | Ga0055528_1009596 | |||
| 1373 | Ga0055528_1025209 | |||
| 1374 | Ga0055528_1036530 | |||
| 1375 | Ga0055530_10007952 | |||
| 1376 | Ga0055540_1000766 | |||
| 1377 | Ga0055540_1005952 | |||
| 1378 | Ga0055540_1011443 | |||
| 1379 | Ga0055540_1033758 | |||
| 1380 | Ga0055540_1046310 | |||
| 1381 | Ga0055531_10002883 | |||
| 1382 | Ga0055531_10028376 | |||
| 1383 | Ga0058692_1010152 | |||
| 1384 | Ga0058692_1010285 | |||
| 1385 | Ga0055543_1000003 | |||
| 1386 | Ga0055543_1000060 | |||
| 1387 | Ga0055543_1000311 | |||
| 1388 | Ga0055543_1000705 | |||
| 1389 | Ga0065165_1000008 | |||
| 1390 | Ga0065165_1000033 | |||
| 1391 | Ga0065165_1007477 | |||
| 1392 | Ga0065165_1012806 | |||
| 1393 | Ga0065165_1033757 | |||
| 1394 | Ga0065165_1081691 | |||
| 1395 | Ga0070682_100162700 | |||
| 1396 | Ga0070689_101665527 | |||
| 1397 | Ga0070668_100310520 | |||
| 1398 | Ga0070668_100394043 | |||
| 1399 | Ga0070668_101312432 | |||
| 1400 | Ga0070669_100105433 | |||
| 1401 | Ga0070669_100329913 | |||
| 1402 | Ga0070671_100455684 | |||
| 1403 | Ga0070674_100695063 | |||
| 1404 | Ga0070667_100031464 | |||
| 1405 | Ga0070667_100781626 | |||
| 1406 | Ga0070708_100296775 | |||
| 1407 | Ga0070663_100067010 | |||
| 1408 | Ga0070706_100046586 | |||
| 1409 | Ga0070698_100036273 | |||
| 1410 | Ga0070699_100110489 | |||
| 1411 | Ga0068853_100035919 | |||
| 1412 | Ga0070672_101009375 | |||
| 1413 | Ga0070686_100138518 | |||
| 1414 | Ga0070665_100002486 | |||
| 1415 | Ga0070665_100070536 | |||
| 1416 | Ga0070665_100172205 | |||
| 1417 | Ga0070665_100582613 | |||
| 1418 | Ga0070665_100693459 | |||
| 1419 | Ga0070665_100800135 | |||
| 1420 | Ga0068855_100727602 | |||
| 1421 | Ga0068854_100069462 | |||
| 1422 | Ga0068856_100224261 | |||
| 1423 | Ga0068856_100251105 | |||
| 1424 | Ga0068851_10068800 | |||
| 1425 | Ga0081455_10000538 | |||
| 1426 | Ga0081455_10019611 | |||
| 1427 | Ga0081539_10000572 | |||
| 1428 | Ga0075365_10002452 | |||
| 1429 | Ga0075365_10017736 | |||
| 1430 | Ga0075365_10068903 | |||
| 1431 | Ga0075365_10356132 | |||
| 1432 | Ga0075368_10041228 | |||
| 1433 | Ga0075363_100123831 | |||
| 1434 | Ga0075363_100185340 | |||
| 1435 | Ga0075363_100483201 | |||
| 1436 | Ga0075364_10002108 | |||
| 1437 | Ga0075364_10024817 | |||
| 1438 | Ga0075364_10030331 | |||
| 1439 | Ga0075364_10099563 | |||
| 1440 | Ga0075364_10466317 | |||
| 1441 | Ga0075364_10585114 | |||
| 1442 | Ga0075362_10000446 | |||
| 1443 | Ga0075362_10050960 | |||
| 1444 | Ga0075362_10383312 | |||
| 1445 | Ga0075367_10005571 | |||
| 1446 | Ga0075367_10047982 | |||
| 1447 | Ga0075367_10199637 | |||
| 1448 | Ga0075367_10312320 | |||
| 1449 | Ga0075367_10334879 | |||
| 1450 | Ga0075367_10371372 | |||
| 1451 | Ga0075369_10010204 | |||
| 1452 | Ga0075369_10021611 | |||
| 1453 | Ga0075369_10035009 | |||
| 1454 | Ga0075369_10060746 | |||
| 1455 | Ga0075369_10061641 | |||
| 1456 | Ga0075366_10003015 | |||
| 1457 | Ga0075366_10122371 | |||
| 1458 | Ga0075370_10045499 | |||
| 1459 | Ga0075370_10243232 | |||
| 1460 | Ga0075370_10272640 | |||
| 1461 | Ga0075430_100226040 | |||
| 1462 | Ga0075431_100006441 | |||
| 1463 | Ga0075429_100055477 | |||
| 1464 | Ga0068865_100639961 | |||
| 1465 | Ga0068865_100989888 | |||
| 1466 | Ga0075436_100176072 | |||
| 1467 | Ga0079104_1000884 | |||
| 1468 | Ga0079104_1002263 | |||
| 1469 | Ga0099826_10010998 | |||
| 1470 | Ga0099795_10351282 | |||
| 1471 | Ga0105251_10006266 | |||
| 1472 | Ga0105244_10117156 | |||
| 1473 | Ga0105244_10134460 | |||
| 1474 | Ga0105250_10044154 | |||
| 1475 | Ga0105240_10000014 | |||
| 1476 | Ga0105240_10607559 | |||
| 1477 | Ga0105240_10819328 | |||
| 1478 | Ga0111539_10260506 | |||
| 1479 | Ga0105247_10202228 | |||
| 1480 | Ga0114129_10003089 | |||
| 1481 | Ga0105243_10012270 | |||
| 1482 | Ga0105243_11125546 | |||
| 1483 | Ga0105241_10668404 | |||
| 1484 | Ga0105248_10001790 | |||
| 1485 | Ga0105248_10019194 | |||
| 1486 | Ga0105237_10003542 | |||
| 1487 | Ga0105237_10268463 | |||
| 1488 | Ga0105238_10089717 | |||
| 1489 | Ga0105238_10470719 | |||
| 1490 | Ga0105238_10596547 | |||
| 1491 | Ga0105238_12071368 | |||
| 1492 | Ga0105249_11610098 | |||
| 1493 | Ga0123341_1000112 | |||
| 1494 | Ga0123341_1065565 | |||
| 1495 | Ga0123342_1010951 | |||
| 1496 | Ga0123342_1016639 | |||
| 1497 | Ga0099796_10100096 | |||
| 1498 | Ga0105239_10000973 | |||
| 1499 | Ga0105239_11650850 | |||
| 1500 | Ga0157322_1002866 | |||
| 1501 | Ga0157314_1015773 | |||
| 1502 | Ga0157373_10013476 | |||
| 1503 | Ga0157373_10018335 | |||
| 1504 | Ga0157373_10062061 | |||
| 1505 | Ga0157371_10000017 | |||
| 1506 | Ga0157371_10029204 | |||
| 1507 | Ga0157370_10000327 | |||
| 1508 | Ga0157370_10000616 | |||
| 1509 | Ga0157370_10767920 | |||
| 1510 | Ga0157369_10221130 | |||
| 1511 | Ga0157369_10223647 | |||
| 1512 | Ga0157369_10432196 | |||
| 1513 | Ga0157369_10661356 | |||
| 1514 | Ga0157369_10718552 | |||
| 1515 | Ga0171463_1007 | |||
| 1516 | Ga0163162_10328425 | |||
| 1517 | Ga0182008_10017060 | |||
| 1518 | Ga0182007_10002083 | |||
| 1519 | Ga0182005_1001327 | |||
| 1520 | Ga0183363_1049 | |||
| 1521 | Ga0163161_10941000 | |||
| 1522 | Ga0214544_1000110 | |||
| 1523 | Ga0214542_1000268 | |||
| 1524 | Ga0214542_1013594 | |||
| 1525 | Ga0214543_1000022 | |||
| 1526 | Ga0214543_1000219 | |||
| 1527 | Ga0213872_10033273 | |||
| 1528 | Ga0213876_10003111 | |||
| 1529 | Ga0213876_10199775 | |||
| 1530 | Ga0213875_10002041 | |||
| 1531 | Ga0213871_10060080 | |||
| 1532 | Ga0228711_1000026 | |||
| 1533 | Ga0228710_1000005 | |||
| 1534 | Ga0209435_100027 | |||
| 1535 | Ga0209760_105271 | |||
| 1536 | Ga0209436_100061 | |||
| 1537 | Ga0209436_100422 | |||
| 1538 | Ga0209436_109886 | |||
| 1539 | Ga0209672_115973 | |||
| 1540 | Ga0209563_104435 | |||
| 1541 | Ga0209437_100051 | |||
| 1542 | Ga0209437_100060 | |||
| 1543 | Ga0207425_1000432 | |||
| 1544 | Ga0207425_1004652 | |||
| 1545 | Ga0207425_1004982 | |||
| 1546 | Ga0207425_1017504 | |||
| 1547 | Ga0209646_1000086 | |||
| 1548 | Ga0209026_1000082 | |||
| 1549 | Ga0209677_100273 | |||
| 1550 | Ga0209148_1000588 | |||
| 1551 | Ga0209148_1009991 | |||
| 1552 | Ga0209759_1000063 | |||
| 1553 | Ga0209129_1000029 | |||
| 1554 | Ga0209129_1000307 | |||
| 1555 | Ga0209129_1000433 | |||
| 1556 | Ga0209129_1001238 | |||
| 1557 | Ga0209129_1003217 | |||
| 1558 | Ga0209129_1006305 | |||
| 1559 | Ga0209129_1006840 | |||
| 1560 | Ga0209129_1028875 | |||
| 1561 | Ga0209233_1000095 | |||
| 1562 | Ga0209233_1000190 | |||
| 1563 | Ga0209233_1000228 | |||
| 1564 | Ga0209565_1023059 | |||
| 1565 | Ga0209565_1024878 | |||
| 1566 | Ga0209455_1000334 | |||
| 1567 | Ga0209673_1000010 | |||
| 1568 | Ga0209673_1000025 | |||
| 1569 | Ga0209673_1000112 | |||
| 1570 | Ga0209673_1000858 | |||
| 1571 | Ga0209673_1003176 | |||
| 1572 | Ga0209673_1003674 | |||
| 1573 | Ga0209673_1006098 | |||
| 1574 | Ga0209673_1013587 | |||
| 1575 | Ga0209673_1030287 | |||
| 1576 | Ga0209130_1000003 | |||
| 1577 | Ga0209130_1000017 | |||
| 1578 | Ga0209130_1000020 | |||
| 1579 | Ga0209130_1042962 | |||
| 1580 | Ga0209675_1049955 | |||
| 1581 | Ga0209676_1000197 | |||
| 1582 | Ga0209676_1005472 | |||
| 1583 | Ga0209676_1009017 | |||
| 1584 | Ga0209676_1034629 | |||
| 1585 | Ga0209676_1066449 | |||
| 1586 | Ga0209025_1000070 | |||
| 1587 | Ga0209025_1000091 | |||
| 1588 | Ga0209025_1000154 | |||
| 1589 | Ga0209025_1000161 | |||
| 1590 | Ga0209025_1000171 | |||
| 1591 | Ga0209025_1000927 | |||
| 1592 | Ga0209025_1002842 | |||
| 1593 | Ga0209025_1007846 | |||
| 1594 | Ga0209025_1011929 | |||
| 1595 | Ga0209025_1014918 | |||
| 1596 | Ga0209025_1028907 | |||
| 1597 | Ga0209025_1035289 | |||
| 1598 | Ga0209564_1000013 | |||
| 1599 | Ga0209564_1000265 | |||
| 1600 | Ga0209564_1000607 | |||
| 1601 | Ga0209564_1001968 | |||
| 1602 | Ga0209564_1008091 | |||
| 1603 | Ga0209564_1012456 | |||
| 1604 | Ga0209564_1025637 | |||
| 1605 | Ga0209758_1000058 | |||
| 1606 | Ga0209758_1000094 | |||
| 1607 | Ga0209758_1000671 | |||
| 1608 | Ga0209758_1005284 | |||
| 1609 | Ga0209758_1012944 | |||
| 1610 | Ga0209758_1013086 | |||
| 1611 | Ga0209758_1019706 | |||
| 1612 | Ga0209758_1020944 | |||
| 1613 | Ga0209758_1036138 | |||
| 1614 | Ga0209758_1043460 | |||
| 1615 | Ga0209050_1002996 | |||
| 1616 | Ga0209050_1005559 | |||
| 1617 | Ga0209050_1005667 | |||
| 1618 | Ga0209256_1000153 | |||
| 1619 | Ga0209256_1000381 | |||
| 1620 | Ga0209256_1000655 | |||
| 1621 | Ga0209256_1001163 | |||
| 1622 | Ga0209256_1002016 | |||
| 1623 | Ga0209256_1004610 | |||
| 1624 | Ga0209256_1019160 | |||
| 1625 | Ga0209256_1031417 | |||
| 1626 | Ga0209256_1033906 | |||
| 1627 | Ga0207426_1000006 | |||
| 1628 | Ga0207426_1000008 | |||
| 1629 | Ga0207426_1000011 | |||
| 1630 | Ga0207426_1000344 | |||
| 1631 | Ga0207426_1001833 | |||
| 1632 | Ga0209051_1001157 | |||
| 1633 | Ga0209051_1001614 | |||
| 1634 | Ga0209051_1014703 | |||
| 1635 | Ga0209051_1019573 | |||
| 1636 | Ga0209051_1052327 | |||
| 1637 | Ga0209051_1109753 | |||
| 1638 | Ga0209257_1002974 | |||
| 1639 | Ga0209257_1008365 | |||
| 1640 | Ga0209257_1013242 | |||
| 1641 | Ga0209257_1015197 | |||
| 1642 | Ga0207696_1096477 | |||
| 1643 | Ga0207655_1139394 | |||
| 1644 | Ga0207713_1047877 | |||
| 1645 | Ga0207707_10502268 | |||
| 1646 | Ga0207707_11428980 | |||
| 1647 | Ga0207695_10000037 | |||
| 1648 | Ga0207695_10117657 | |||
| 1649 | Ga0207695_10211115 | |||
| 1650 | Ga0207695_10631791 | |||
| 1651 | Ga0207695_10920776 | |||
| 1652 | Ga0207671_10000271 | |||
| 1653 | Ga0207671_10210143 | |||
| 1654 | Ga0207649_11356407 | |||
| 1655 | Ga0207652_10291240 | |||
| 1656 | Ga0207681_10683505 | |||
| 1657 | Ga0207694_10002909 | |||
| 1658 | Ga0207694_10498678 | |||
| 1659 | Ga0207694_10518221 | |||
| 1660 | Ga0207650_10000911 | |||
| 1661 | Ga0207650_10078116 | |||
| 1662 | Ga0207659_10146647 | |||
| 1663 | Ga0207644_10071576 | |||
| 1664 | Ga0207706_10231682 | |||
| 1665 | Ga0207706_10439739 | |||
| 1666 | Ga0207704_10550465 | |||
| 1667 | Ga0207691_10279013 | |||
| 1668 | Ga0207711_10009012 | |||
| 1669 | Ga0207711_10231808 | |||
| 1670 | Ga0207668_10068654 | |||
| 1671 | Ga0207668_10498133 | |||
| 1672 | Ga0207668_11110420 | |||
| 1673 | Ga0207640_10052246 | |||
| 1674 | Ga0207640_10198771 | |||
| 1675 | Ga0207658_10627719 | |||
| 1676 | Ga0207639_10027841 | |||
| 1677 | Ga0207678_10053726 | |||
| 1678 | Ga0207702_10877792 | |||
| 1679 | Ga0207702_11820460 | |||
| 1680 | Ga0207698_10314980 | |||
| 1681 | Ga0209281_1000034 | |||
| 1682 | Ga0209281_1000082 | |||
| 1683 | Ga0209371_1000022 | |||
| 1684 | Ga0209371_1000892 | |||
| 1685 | Ga0209371_1006087 | |||
| 1686 | Ga0209282_1000006 | |||
| 1687 | Ga0209282_1007756 | |||
| 1688 | Ga0209282_1030375 | |||
| 1689 | Ga0209588_1077228 | |||
| 1690 | Ga0209813_10007851 | |||
| 1691 | Ga0268266_10003490 | |||
| 1692 | Ga0268266_10003866 | |||
| 1693 | Ga0268266_10075098 | |||
| 1694 | Ga0268266_10691014 | |||
| 1695 | Ga0268266_11364684 | |||
| 1696 | Ga0268266_11814705 | |||
| 1697 | Ga0307515_10000017 | |||
| 1698 | Ga0307515_10046209 | |||
| 1699 | Ga0307515_10069935 | |||
| 1700 | Ga0268256_1000019 | |||
| 1701 | Ga0268256_1006062 | |||
| 1702 | Ga0268256_1026482 | |||
| 1703 | Ga0316181_1138338 | |||
| 1704 | Ga0265328_10000189 | |||
| 1705 | Ga0265327_10002688 | |||
| 1706 | Ga0265327_10049111 | |||
| 1707 | Ga0307513_10015439 | |||
| 1708 | Ga0307513_10057743 | |||
| 1709 | Ga0307408_100259728 | |||
| 1710 | Ga0307408_100551394 | |||
| 1711 | Ga0265342_10295511 | |||
| 1712 | Ga0316576_10760265 | |||
| 1713 | Ga0307405_10002746 | |||
| 1714 | Ga0307405_10103915 | |||
| 1715 | Ga0307410_10192518 | |||
| 1716 | Ga0307406_10740705 | |||
| 1717 | Ga0307412_10002363 | |||
| 1718 | Ga0307412_10114024 | |||
| 1719 | Ga0307412_10259515 | |||
| 1720 | Ga0307412_10981645 | |||
| 1721 | Ga0315914_1000003 | |||
| 1722 | Ga0307409_100821542 | |||
| 1723 | Ga0307416_100299293 | |||
| 1724 | Ga0307416_100495718 | |||
| 1725 | Ga0307414_10076304 | |||
| 1726 | Ga0307414_10329742 | |||
| 1727 | Ga0307414_10963431 | |||
| 1728 | Ga0307414_11179505 | |||
| 1729 | Ga0307411_10905437 | |||
| 1730 | Ga0315913_1000001 | |||
| 1731 | Ga0315915_1000008 | |||
| 1732 | Ga0373945_0483619 | |||
| 1733 | Ga0373943_0074066 | |||
| 1734 | Ga0373943_0347105 | |||
| 1735 | Ga0373935_0010890 | |||
| 1736 | Ga0373927_0000856 | |||
| 1737 | Ga0373927_0849305 | |||
| 1738 | Ga0373925_0002516 | |||
| 1739 | Ga0395899_0032746 | |||
| 1740 | Ga0395899_0037181 | |||
| 1741 | Ga0395899_0040984 | |||
| 1742 | Ga0395899_0189558 | |||
| 1743 | Ga0395900_0079907 | |||
| 1744 | Ga0395900_0102233 | |||
| 1745 | Ga0395898_0009045 | |||
| 1746 | Ga0395898_0019247 | |||
| 1747 | Ga0436364_1142809 | |||
| 1748 | Ga0395901_0276823 | |||
| 1749 | Ga0395901_0331860 | |||
| 1750 | Ga0395901_0689569 | |||
| 1751 | Ga0400483_144045 | |||
| 1752 | Ga0400483_213761 | |||
| 1753 | Ga0436365_0243032 | |||
| 1754 | Ga0436365_0990465 | |||
| 1755 | Ga0436360_1052595 | |||
| 1756 | Ga0436361_0187853 | |||
| 1757 | Ga0436361_0507050 | |||
| 1758 | Ga0436361_0972763 | |||
| 1759 | Ga0436361_1031687 | |||
| 1760 | Ga0436363_1027101 | |||
| 1761 | Ga0436363_1351969 | |||
| 1762 | Ga0436362_0783924 | |||
| 1763 | Ga0439436_0019882 | |||
| 1764 | Ga0439438_016435 | |||
| 1765 | Ga0439438_017366 | |||
| 1766 | Ga0439466_0070031 | |||
| 1767 | Ga0439465_0008508 | |||
| 1768 | Ga0439465_0165332 | |||
| 1769 | Ga0451787_502609 | |||
| 1770 | Ga0451789_1281455 | |||
| 1771 | Ga0451795_0335541 | |||
| 1772 | Ga0451835_0255768 | |||
| 1773 | Ga0451837_0676541 | |||
| 1774 | Ga0451837_0772324 | |||
| 1775 | Ga0451840_15734 | |||
| 1776 | Ga0451846_31201 | |||
| 1777 | Ga0451847_0188909 | |||
| 1778 | Ga0451851_0267608 | |||
| 1779 | Ga0451851_0872605 | |||
| 1780 | Ga0451854_30980 | |||
| 1781 | Ga0451855_1076083 | |||
| 1782 | Ga0439433_0097097 | |||
| 1783 | Ga0439449_0004055 | |||
| 1784 | Ga0439449_0017852 | |||
| 1785 | Ga0439451_016516 | |||
| 1786 | Ga0450920_010616 | |||
| 1787 | Ga0450909_003686 | |||
| 1788 | Ga0439434_0047458 | |||
| 1789 | Ga0450918_010663 | |||
| 1790 | Ga0466965_0694794 | |||
| 1791 | Ga0466966_0370726 | |||
| 1792 | Ga0466968_0015577 | |||
| 1793 | Ga0466970_0218295 | |||
| 1794 | Ga0466957_0017737 | |||
| 1795 | Ga0466960_0232709 | |||
| 1796 | Ga0451576_0002083 | |||
| 1797 | Ga0451576_2052736 | |||
| 1798 | Ga0495627_051123 | |||
| 1799 | Ga0495627_093648 | |||
| 1800 | Ga0495590_0016051 | |||
| 1801 | Ga0495638_0001134 | |||
| 1802 | Ga0495638_0080821 | |||
| 1803 | Ga0495651_0140785 | |||
| 1804 | Ga0495650_0045284 | |||
| 1805 | Ga0495605_0099468 | |||
| 1806 | Ga0495662_0009811 | |||
| 1807 | Ga0495585_0060355 | |||
| 1808 | Ga0495596_0027893 | |||
| 1809 | Ga0495607_0010334 | |||
| 1810 | Ga0495607_0046074 | |||
| 1811 | Ga0495583_0035078 | |||
| 1812 | Ga0495583_0053761 | |||
| 1813 | Ga0495606_0004697 | |||
| 1814 | Ga0495606_0007767 | |||
| 1815 | Ga0495606_0039286 | |||
| 1816 | Ga0495606_0112977 | |||
| 1817 | Ga0495610_0003664 | |||
| 1818 | Ga0495610_0031382 | |||
| 1819 | Ga0495610_0139763 | |||
| 1820 | Ga0495616_0022251 | |||
| 1821 | Ga0495618_0210505 | |||
| 1822 | Ga0495620_0026792 | |||
| 1823 | Ga0495620_0359990 | |||
| 1824 | Ga0495630_0837281 | |||
| 1825 | Ga0495631_0001584 | |||
| 1826 | Ga0495632_0003362 | |||
| 1827 | Ga0495632_0009886 | |||
| 1828 | Ga0495632_0041708 | |||
| 1829 | Ga0495632_0081744 | |||
| 1830 | Ga0495632_0108233 | |||
| 1831 | Ga0495643_0031297 | |||
| 1832 | Ga0495643_0066465 | |||
| 1833 | Ga0495648_0029469 | |||
| 1834 | Ga0495648_0161935 | |||
| 1835 | Ga0495663_0018272 | |||
| 1836 | Ga0495642_0201478 | |||
| 1837 | Ga0495654_0001572 | |||
| 1838 | Ga0495654_0011933 | |||
| 1839 | Ga0495654_0198712 | |||
| 1840 | Ga0495609_0026854 | |||
| 1841 | Ga0495597_0029591 | |||
| 1842 | Ga0495622_0042615 | |||
| 1843 | Ga0495633_0041073 | |||
| 1844 | Ga0495633_0048871 | |||
| 1845 | Ga0495633_0265304 | |||
| 1846 | Ga0495656_0014314 | |||
| 1847 | Ga0495668_0009467 | |||
| 1848 | Ga0495668_0012948 | |||
| 1849 | Ga0495668_0101874 | |||
| 1850 | Ga0495611_0013882 | |||
| 1851 | Ga0495611_0020130 | |||
| 1852 | Ga0495625_0002255 | |||
| 1853 | Ga0495625_0049809 | |||
| 1854 | Ga0495625_0068316 | |||
| 1855 | Ga0495625_0100585 | |||
| 1856 | Ga0495625_0126598 | |||
| 1857 | Ga0495588_0001571 | |||
| 1858 | Ga0495588_0067742 | |||
| 1859 | Ga0495670_0012039 | |||
| 1860 | Ga0495671_0065310 | |||
| 1861 | Ga0495600_0026201 | |||
| 1862 | Ga0495660_0004669 | |||
| 1863 | Ga0495604_0097972 | |||
| 1864 | Ga0495636_0047809 | |||
| 1865 | Ga0495672_0005525 | |||
| 1866 | Ga0495683_0049570 | |||
| 1867 | Ga0495681_0013102 | |||
| 1868 | Ga0495681_0049184 | |||
| 1869 | Ga0495681_0278580 | |||
| 1870 | Ga0495686_0001486 | |||
| 1871 | Ga0495686_0010881 | |||
| 1872 | Ga0495686_0011361 | |||
| 1873 | Ga0495686_0021709 | |||
| 1874 | Ga0495686_0200319 | |||
| 1875 | Ga0495686_0213564 | |||
| 1876 | Ga0495686_0322597 | |||
| 1877 | Ga0495626_0024583 | |||
| 1878 | Ga0496100_1297634 | |||
| 1879 | Ga0496102_1292316 | |||
| 1880 | Ga0496105_0022766 | |||
| 1881 | Ga0496105_0070505 | |||
| 1882 | Ga0496105_0338339 | |||
| 1883 | Ga0496106_0006078 | |||
| 1884 | Ga0496106_0218120 | |||
| 1885 | Ga0496110_0046395 | |||
| 1886 | Ga0496110_0252786 | |||
| 1887 | Ga0496111_0029761 | |||
| 1888 | Ga0496112_0017743 | |||
| 1889 | Ga0496112_0803831 | |||
| 1890 | Ga0496113_0040908 | |||
| 1891 | Ga0496115_0695078 | |||
| 1892 | Ga0496116_0000105 | |||
| 1893 | Ga0496116_0007168 | |||
| 1894 | Ga0496116_0008842 | |||
| 1895 | Ga0496116_0023634 | |||
| 1896 | Ga0496116_0031594 | |||
| 1897 | Ga0496116_0031701 | |||
| 1898 | Ga0496116_0047753 | |||
| 1899 | Ga0496116_0052894 | |||
| 1900 | Ga0496116_0083429 | |||
| 1901 | Ga0496117_0000002 | |||
| 1902 | Ga0496117_0005967 | |||
| 1903 | Ga0496117_0010221 | |||
| 1904 | Ga0496117_0017552 | |||
| 1905 | Ga0496117_0031122 | |||
| 1906 | Ga0496117_0066513 | |||
| 1907 | Ga0496117_0156739 | |||
| 1908 | Ga0496118_0000566 | |||
| 1909 | Ga0496118_0001151 | |||
| 1910 | Ga0496118_0008628 | |||
| 1911 | Ga0496118_0017174 | |||
| 1912 | Ga0496118_0034028 | |||
| 1913 | Ga0496118_0075392 | |||
| 1914 | Ga0496118_0104617 | |||
| 1915 | Ga0496118_0141386 | |||
| 1916 | Ga0496119_0007422 | |||
| 1917 | Ga0496119_0024620 | |||
| 1918 | Ga0496119_0035300 | |||
| 1919 | Ga0496119_0071800 | |||
| 1920 | Ga0496119_0109266 | |||
| 1921 | Ga0496119_0141554 | |||
| 1922 | Ga0496120_0000309 | |||
| 1923 | Ga0496120_0023586 | |||
| 1924 | Ga0496120_0044995 | |||
| 1925 | Ga0496120_0070685 | |||
| 1926 | Ga0496120_0092898 | |||
| 1927 | Ga0496121_0000003 | |||
| 1928 | Ga0496121_0003780 | |||
| 1929 | Ga0496121_0009804 | |||
| 1930 | Ga0496121_0012638 | |||
| 1931 | Ga0496121_0019047 | |||
| 1932 | Ga0496121_0076734 | |||
| 1933 | Ga0496121_0081685 | |||
| 1934 | Ga0496121_0155671 | |||
| 1935 | Ga0496121_0248290 | |||
| 1936 | Ga0496122_0000004 | |||
| 1937 | Ga0496122_0000157 | |||
| 1938 | Ga0496122_0000464 | |||
| 1939 | Ga0496122_0010069 | |||
| 1940 | Ga0496122_0034634 | |||
| 1941 | Ga0496122_0038124 | |||
| 1942 | Ga0496122_0041265 | |||
| 1943 | Ga0496122_0048776 | |||
| 1944 | Ga0496122_0063672 | |||
| 1945 | Ga0496122_0122766 | |||
| 1946 | Ga0496122_0174327 | |||
| 1947 | Ga0496122_0175306 | |||
| 1948 | Ga0496123_0000007 | |||
| 1949 | Ga0496123_0000048 | |||
| 1950 | Ga0496123_0000147 | |||
| 1951 | Ga0496123_0007075 | |||
| 1952 | Ga0496123_0014048 | |||
| 1953 | Ga0496123_0015923 | |||
| 1954 | Ga0496123_0024343 | |||
| 1955 | Ga0496123_0027255 | |||
| 1956 | Ga0496123_0044556 | |||
| 1957 | Ga0496123_0173840 | |||
| 1958 | Ga0496123_0294082 | |||
| 1959 | Ga0496123_0311236 | |||
| 1960 | Ga0496124_0000067 | |||
| 1961 | Ga0496124_0002089 | |||
| 1962 | Ga0496124_0008090 | |||
| 1963 | Ga0496124_0009653 | |||
| 1964 | Ga0496124_0029277 | |||
| 1965 | Ga0496124_0060523 | |||
| 1966 | Ga0496124_0130083 | |||
| 1967 | Ga0496124_0132515 | |||
| 1968 | Ga0496124_0169676 | |||
| 1969 | Ga0496124_0196392 | |||
| 1970 | Ga0496124_0211242 | |||
| 1971 | Ga0496124_0230418 | |||
| 1972 | Ga0496124_0238957 | |||
| 1973 | Ga0496124_0273913 | |||
| 1974 | Ga0496124_0305280 | |||
| 1975 | Ga0496125_0000441 | |||
| 1976 | Ga0496125_0000786 | |||
| 1977 | Ga0496125_0000848 | |||
| 1978 | Ga0496125_0009794 | |||
| 1979 | Ga0496125_0014106 | |||
| 1980 | Ga0496125_0014581 | |||
| 1981 | Ga0496125_0050143 | |||
| 1982 | Ga0496125_0135179 | |||
| 1983 | Ga0496125_0255670 | |||
| 1984 | Ga0496125_0356085 | |||
| 1985 | Ga0496125_0491740 | |||
| 1986 | Ga0496126_0000188 | |||
| 1987 | Ga0496126_0060889 | |||
| 1988 | Ga0496126_0302042 | |||
| 1989 | Ga0496126_0526382 | |||
| 1990 | Ga0496126_0531684 | |||
| 1991 | Ga0496126_0852853 | |||
| 1992 | Ga0495678_066512 | |||
| 1993 | Ga0495682_0011491 | |||
| 1994 | Ga0501031_0099971 | |||
| 1995 | Ga0501032_0187945 | |||
| 1996 | Ga0501033_0000365 | |||
| 1997 | Ga0501033_0150020 | |||
| 1998 | Ga0501033_0183076 | |||
| 1999 | Ga0501034_0001020 | |||
| 2000 | Ga0501034_0191769 | |||
| 2001 | Ga0501034_0327128 | |||
| 2002 | Ga0501034_0648779 | |||
| 2003 | Ga0501036_0031089 | |||
| 2004 | Ga0501036_1004531 | |||
| 2005 | Ga0501037_0066214 | |||
| 2006 | Ga0501037_0515409 | |||
| 2007 | Ga0501038_0020981 | |||
| 2008 | Ga0501040_0034092 | |||
| 2009 | Ga0501041_0162692 | |||
| 2010 | Ga0501042_0162443 | |||
| 2011 | Ga0501043_0216218 | |||
| 2012 | Ga0501043_0419576 | |||
| 2013 | Ga0501046_0028941 | |||
| 2014 | Ga0501047_0221955 | |||
| 2015 | Ga0501047_0255272 | |||
| 2016 | Ga0501048_0025595 | |||
| 2017 | Ga0501067_0065314 | |||
| 2018 | Ga0501068_0288358 | |||
| 2019 | Ga0501068_0309858 | |||
| 2020 | Ga0501070_1196288 | |||
| 2021 | Ga0501071_0046594 | |||
| 2022 | Ga0501074_0005267 | |||
| 2023 | Ga0501075_0195777 | |||
| 2024 | Ga0501076_0056877 | |||
| 2025 | Ga0501077_0084373 | |||
| 2026 | Ga0501079_0057880 | |||
| 2027 | Ga0501080_0232366 | |||
| 2028 | Ga0501080_0310242 | |||
| 2029 | Ga0501080_0426430 | |||
| 2030 | Ga0501080_0460058 | |||
| 2031 | Ga0501081_0001100 | |||
| 2032 | Ga0501280_001764 | |||
| 2033 | Ga0501280_052361 | |||
| 2034 | Ga0501280_053158 | |||
| 2035 | Ga0501035_0001622 | |||
| 2036 | Ga0501044_0109786 | |||
| 2037 | Ga0501044_0590104 | |||
| 2038 | Ga0501044_1392044 | |||
| 2039 | Ga0501045_0045776 | |||
| 2040 | nmdc:mga03683_106140_c1 | |||
| 2041 | nmdc:mga03683_240320_c1 | |||
| 2042 | nmdc:mga03683_53915_c1 | |||
| 2043 | nmdc:mga03683_858_c1 | |||
| 2044 | nmdc:mga03683_8607_c2 | |||
| 2045 | nmdc:mga03n38_376232_c1 | |||
| 2046 | nmdc:mga03n38_48518_c1 | |||
| 2047 | nmdc:mga03n38_582808_c1 | |||
| 2048 | nmdc:mga00v17_180_c1 | |||
| 2049 | nmdc:mga00v17_209459_c1 | |||
| 2050 | nmdc:mga00v17_414573_c1 | |||
| 2051 | nmdc:mga00v17_443299_c1 | |||
| 2052 | nmdc:mga00v17_824_c1 | |||
| 2053 | nmdc:mga00v17_983886_c1 | |||
| 2054 | nmdc:mga0yw44_1405_c1 | |||
| 2055 | nmdc:mga0yw44_192004_c1 | |||
| 2056 | nmdc:mga0yw44_31619_c1 | |||
| 2057 | nmdc:mga0yw44_865_c1 | |||
| 2058 | nmdc:mga0k408_21083_c1 | |||
| 2059 | nmdc:mga0k408_63710_c1 | |||
| 2060 | nmdc:mga06z11_196570_c1 | |||
| 2061 | nmdc:mga06z11_285710_c1 | |||
| 2062 | nmdc:mga06z11_424021_c1 | |||
| 2063 | nmdc:mga07m45_40428_c1 | |||
| 2064 | nmdc:mga05p37_169637_c1 | |||
| 2065 | nmdc:mga05p37_181727_c1 | |||
| 2066 | nmdc:mga0qj67_357762_c1 | |||
| 2067 | nmdc:mga06r32_179582_c1 | |||
| 2068 | nmdc:mga06r32_954463_c1 | |||
| 2069 | nmdc:mga08y16_453561_c1 | |||
| 2070 | nmdc:mga08x19_237661_c1 | |||
| 2071 | nmdc:mga0sz30_235323_c1 | |||
| 2072 | nmdc:mga0sz30_260587_c1 | |||
| 2073 | nmdc:mga0sz30_4354_c1 | |||
| 2074 | nmdc:mga0sz30_7993_c1 | |||
| 2075 | nmdc:mga0sz30_802_c1 | |||
| 2076 | nmdc:mga0sz30_84103_c1 | |||
| 2077 | Ga0500610_0022183 | |||
| 2078 | Ga0495619_0039700 | |||
| 2079 | Ga0500578_0448500 | |||
| 2080 | Ga0500578_0459078 | |||
| 2081 | Ga0500643_006663 | |||
| 2082 | Ga0500644_0011388 | |||
| 2083 | Ga0500644_0157381 | |||
| 2084 | Ga0500646_0268453 | |||
| 2085 | Ga0500647_0108906 | |||
| 2086 | Ga0500583_0343685 | |||
| 2087 | Ga0500651_0345810 | |||
| 2088 | Ga0500557_000501 | |||
| 2089 | Ga0500569_002896 | |||
| 2090 | Ga0500569_008858 | |||
| 2091 | Ga0500569_155755 | |||
| 2092 | Ga0500572_003731 | |||
| 2093 | Ga0500594_0003894 | |||
| 2094 | Ga0500607_180670 | |||
| 2095 | Ga0500608_052883 | |||
| 2096 | Ga0500618_000849 | |||
| 2097 | Ga0500618_015687 | |||
| 2098 | Ga0500618_041237 | |||
| 2099 | Ga0500642_0256169 | |||
| 2100 | Ga0500658_0000206 | |||
| 2101 | Ga0500658_0011557 | |||
| 2102 | Ga0500561_0002494 | |||
| 2103 | Ga0500568_0001714 | |||
| 2104 | Ga0500568_0003195 | |||
| 2105 | Ga0500573_0018797 | |||
| 2106 | Ga0500588_0000807 | |||
| 2107 | Ga0500590_002837 | |||
| 2108 | Ga0500616_0000309 | |||
| 2109 | Ga0500616_0000576 | |||
| 2110 | Ga0500616_0002766 | |||
| 2111 | Ga0500616_0267263 | |||
| 2112 | Ga0500616_0294343 | |||
| 2113 | Ga0500620_007914 | |||
| 2114 | Ga0500622_0003878 | |||
| 2115 | Ga0500624_000308 | |||
| 2116 | Ga0500624_087080 | |||
| 2117 | Ga0500634_0013063 | |||
| 2118 | Ga0500634_0181681 | |||
| 2119 | Ga0500636_0000003 | |||
| 2120 | Ga0500636_0000840 | |||
| 2121 | Ga0500637_0093605 | |||
| 2122 | Ga0500609_029468 | |||
| 2123 | Ga0501084_0009756 | |||
| 2124 | Ga0587080_061273 | |||
| 2125 | Ga0587090_011104 | |||
| 2126 | Ga0587068_011069 | |||
| 2127 | Ga0587069_012415 | |||
| 2128 | Ga0587072_018780 | |||
| 2129 | Ga0501082_0017190 | |||
| 2130 | Ga0530510_0034914 | |||
| 2131 | 2509108157 | |||
| 2132 | 2509376667 | |||
| 2133 | 2509391816 | |||
| 2134 | 2509447329 | |||
| 2135 | 2510134167 | |||
| 2136 | 2510305320 | |||
| 2137 | 2510841357 | |||
| 2138 | 2510895604 | |||
| 2139 | 2511133230 | |||
| 2140 | 2511172874 | |||
| 2141 | 2511182484 | |||
| 2142 | 2511199240 | |||
| 2143 | 2511502456 | |||
| 2144 | 2512533834 | |||
| 2145 | 2512970417 | |||
| 2146 | 2513567753 | |||
| 2147 | 2513577164 | |||
| 2148 | 2513597682 | |||
| 2149 | 2513601481 | |||
| 2150 | 2513618150 | |||
| 2151 | 2513633165 | |||
| 2152 | 2513707838 | |||
| 2153 | 2513865913 | |||
| 2154 | 2513884475 | |||
| 2155 | 2513904483 | |||
| 2156 | 2513908555 | |||
| 2157 | 2513925193 | |||
| 2158 | 2513983678 | |||
| 2159 | 2513997692 | |||
| 2160 | 2514003073 | |||
| 2161 | 2514018084 | |||
| 2162 | 2515609251 | |||
| 2163 | 2515636775 | |||
| 2164 | 2515646359 | |||
| 2165 | 2515655125 | |||
| 2166 | 2515739698 | |||
| 2167 | 2516206197 | |||
| 2168 | 2516893832 | |||
| 2169 | 2517036937 | |||
| 2170 | 2517077294 | |||
| 2171 | 2517096052 | |||
| 2172 | 2517407672 | |||
| 2173 | 2517570545 | |||
| 2174 | 2520377042 | |||
| 2175 | 2524448346 | |||
| 2176 | 2524458843 | |||
| 2177 | 2535484901 | |||
| 2178 | 2535517092 | |||
| 2179 | 2537876325 | |||
| 2180 | 2554248393 | |||
| 2181 | 2558863971 | |||
| 2182 | 2559295509 | |||
| 2183 | 2561469275 | |||
| 2184 | 2585147455 | |||
| 2185 | 2585167432 | |||
| 2186 | 2585202005 | |||
| 2187 | 2585223070 | |||
| 2188 | 2585228507 | |||
| 2189 | 2585258284 | |||
| 2190 | 2585265657 | |||
| 2191 | 2585271339 | |||
| 2192 | 2585279278 | |||
| 2193 | 2585323117 | |||
| 2194 | 2585331229 | |||
| 2195 | 2585388862 | |||
| 2196 | 2585395439 | |||
| 2197 | 2585400945 | |||
| 2198 | 2585524722 | |||
| 2199 | 2585531237 | |||
| 2200 | 2585538409 | |||
| 2201 | 2585545653 | |||
| 2202 | 2585552840 | |||
| 2203 | 2585559082 | |||
| 2204 | 2585822152 | |||
| 2205 | 2585836362 | |||
| 2206 | 2585843454 | |||
| 2207 | 2585898463 | |||
| 2208 | 2585903972 | |||
| 2209 | 2587980910 | |||
| 2210 | 2599332003 | |||
| 2211 | 2599417100 | |||
| 2212 | 2599601826 | |||
| 2213 | 2599721594 | |||
| 2214 | 2600194838 | |||
| 2215 | 2600374119 | |||
| 2216 | 2601609918 | |||
| 2217 | 2601746693 | |||
| 2218 | 2616293149 | |||
| 2219 | 2616311445 | |||
| 2220 | 2616554456 | |||
| 2221 | 2617384820 | |||
| 2222 | 2643804208 | |||
| 2223 | 2643811320 | |||
| 2224 | 2643856585 | |||
| 2225 | 2643920175 | |||
| 2226 | 2643962815 | |||
| 2227 | 2644007051 | |||
| 2228 | 2644050245 | |||
| 2229 | 2644065018 | |||
| 2230 | 2644105271 | |||
| 2231 | 2644145653 | |||
| 2232 | 2644191830 | |||
| 2233 | 2644204693 | |||
| 2234 | 2644208797 | |||
| 2235 | 2644242553 | |||
| 2236 | 2644288418 | |||
| 2237 | 2644298895 | |||
| 2238 | 2644309684 | |||
| 2239 | 2644331148 | |||
| 2240 | 2644376573 | |||
| 2241 | 2644416691 | |||
| 2242 | 2644449731 | |||
| 2243 | 2644483165 | |||
| 2244 | 2644494319 | |||
| 2245 | 2644497812 | |||
| 2246 | 2644521796 | |||
| 2247 | 2644543413 | |||
| 2248 | 2644616208 | |||
| 2249 | 2644652327 | |||
| 2250 | 2644657124 | |||
| 2251 | 2644675831 | |||
| 2252 | 2644689863 | |||
| 2253 | 2657681722 | |||
| 2254 | 2671111224 | |||
| 2255 | 2692315293 | |||
| 2256 | 2719182008 | |||
| 2257 | 2719666368 | |||
| 2258 | 2719732725 | |||
| 2259 | 2720492788 | |||
| 2260 | 2720614256 | |||
| 2261 | 2720621024 | |||
| 2262 | 2720632348 | |||
| 2263 | 2720776076 | |||
| 2264 | 2721148099 | |||
| 2265 | 2721159550 | |||
| 2266 | 2721164935 | |||
| 2267 | 2722841105 | |||
| 2268 | 2723027675 | |||
| 2269 | 2723561303 | |||
| 2270 | 2723567926 | |||
| 2271 | 2724045481 | |||
| 2272 | 2724090683 | |||
| 2273 | 2724105191 | |||
| 2274 | 2724111018 | |||
| 2275 | 2725951385 | |||
| 2276 | 2730108611 | |||
| 2277 | 2730165243 | |||
| 2278 | 2730299182 | |||
| 2279 | 2738800309 | |||
| 2280 | 2738944060 | |||
| 2281 | 2739033050 | |||
| 2282 | 2753462350 | |||
| 2283 | 2758641785 | |||
| 2284 | 2766066093 | |||
| 2285 | 2776914177 | |||
| 2286 | 2778175639 | |||
| 2287 | 2792581434 | |||
| 2288 | 2792620588 | |||
| 2289 | 2792625947 | |||
| 2290 | 2792638886 | |||
| 2291 | 2793280117 | |||
| 2292 | 2793294223 | |||
| 2293 | 2793315878 | |||
| 2294 | 2793319389 | |||
| 2295 | 2793328475 | |||
| 2296 | 2793335433 | |||
| 2297 | 2793339485 | |||
| 2298 | 2793347038 | |||
| 2299 | 2793351630 | |||
| 2300 | 2793361926 | |||
| 2301 | 2793367683 | |||
| 2302 | 2802716773 | |||
| 2303 | 2802725585 | |||
| 2304 | 2802730324 | |||
| 2305 | 2802737705 | |||
| 2306 | 2802742906 | |||
| 2307 | 2802750330 | |||
| 2308 | 2804752909 | |||
| 2309 | 2805926861 | |||
| 2310 | 2805932776 | |||
| 2311 | 2806045189 | |||
| 2312 | 2806050016 | |||
| 2313 | 2806056854 | |||
| 2314 | 2806064235 | |||
| 2315 | 2806071503 | |||
| 2316 | 2808987756 | |||
| 2317 | 2819241098 | |||
| 2318 | 2819559224 | |||
| 2319 | 2819609347 | |||
| 2320 | 2819641341 | |||
| 2321 | 2819685145 | |||
| 2322 | 2821125722 | |||
| 2323 | 2821447862 | |||
| 2324 | 2838021666 | |||
| 2325 | 2838023641 | |||
| 2326 | 2838033396 | |||
| 2327 | 2838038693 | |||
| 2328 | 2838045179 | |||
| 2329 | 2838053340 | |||
| 2330 | 2838065460 | |||
| 2331 | 2838069939 | |||
| 2332 | 2838079797 | |||
| 2333 | 2838661385 | |||
| 2334 | 2838670571 | |||
| 2335 | 2838675605 | |||
| 2336 | 2838683238 | |||
| 2337 | 2838686833 | |||
| 2338 | 2838697818 | |||
| 2339 | 2838702942 | |||
| 2340 | 2838710933 | |||
| 2341 | 2838714487 | |||
| 2342 | 2838721712 | |||
| 2343 | 2838725247 | |||
| 2344 | 2838730209 | |||
| 2345 | 2838737827 | |||
| 2346 | 2838742776 | |||
| 2347 | 2841841804 | |||
| 2348 | 2841848696 | |||
| 2349 | 2841852279 | |||
| 2350 | 2841862294 | |||
| 2351 | 2841867168 | |||
| 2352 | 2842079107 | |||
| 2353 | 2842113045 | |||
| 2354 | 2842118383 | |||
| 2355 | 2842125273 | |||
| 2356 | 2842130500 | |||
| 2357 | 2842141582 | |||
| 2358 | 2842147800 | |||
| 2359 | 2842154330 | |||
| 2360 | 2842158319 | |||
| 2361 | 2842168578 | |||
| 2362 | 2842170729 | |||
| 2363 | 2842177950 | |||
| 2364 | 2842181939 | |||
| 2365 | 2842187596 | |||
| 2366 | 2842195848 | |||
| 2367 | 2842199155 | |||
| 2368 | 2842209605 | |||
| 2369 | 2842211907 | |||
| 2370 | 2842218162 | |||
| 2371 | 2842226474 | |||
| 2372 | 2842230066 | |||
| 2373 | 2842240295 | |||
| 2374 | 2842243955 | |||
| 2375 | 2842252866 | |||
| 2376 | 2842257960 | |||
| 2377 | 2842269496 | |||
| 2378 | 2842271629 | |||
| 2379 | 2842283059 | |||
| 2380 | 2842285393 | |||
| 2381 | 2842292769 | |||
| 2382 | 2842298192 | |||
| 2383 | 2842305260 | |||
| 2384 | 2842314010 | |||
| 2385 | 2842319749 | |||
| 2386 | 2842348473 | |||
| 2387 | 2842360208 | |||
| 2388 | 2842370250 | |||
| 2389 | 2842373869 | |||
| 2390 | 2842379166 | |||
| 2391 | 2842384893 | |||
| 2392 | 2842402753 | |||
| 2393 | 2842409876 | |||
| 2394 | 2842416524 | |||
| 2395 | 2842423553 | |||
| 2396 | 2842430502 | |||
| 2397 | 2842436686 | |||
| 2398 | 2842443472 | |||
| 2399 | 2842449342 | |||
| 2400 | 2842466756 | |||
| 2401 | 2842471444 | |||
| 2402 | 2842479938 | |||
| 2403 | 2842483860 | |||
| 2404 | 2842492279 | |||
| 2405 | 2842497861 | |||
| 2406 | 2842505277 | |||
| 2407 | 2842514284 | |||
| 2408 | 2842519078 | |||
| 2409 | 2842522062 | |||
| 2410 | 2842777676 | |||
| 2411 | 2842924338 | |||
| 2412 | 2844164033 | |||
| 2413 | 2844458130 | |||
| 2414 | 2847419648 | |||
| 2415 | 2848994650 | |||
| 2416 | 2850081667 | |||
| 2417 | 2852390469 | |||
| 2418 | 2854901335 | |||
| 2419 | 2854912118 | |||
| 2420 | 2855826557 | |||
| 2421 | 2855877165 | |||
| 2422 | 2857517205 | |||
| 2423 | 2857532283 | |||
| 2424 | 2858803750 | |||
| 2425 | 2891089979 | |||
| 2426 | 2891373572 | |||
| 2427 | 2894776970 | |||
| 2428 | 2894817751 | |||
| 2429 | 2896392101 | |||
| 2430 | 2899794101 | |||
| 2431 | 2899806799 | |||
| 2432 | 2899847747 | |||
| 2433 | 2913296101 | |||
| 2434 | 2913313570 | |||
| 2435 | 2915654079 | |||
| 2436 | 2915982886 | |||
| 2437 | 2915989485 | |||
| 2438 | 2916009195 | |||
| 2439 | 2916044326 | |||
| 2440 | 2916050375 | |||
| 2441 | 2916065458 | |||
| 2442 | 2916074655 | |||
| 2443 | 2916078318 | |||
| 2444 | 2919106244 | |||
| 2445 | 2919114523 | |||
| 2446 | 2919169492 | |||
| 2447 | 2919410207 | |||
| 2448 | 2920761319 | |||
| 2449 | 2920762659 | |||
| 2450 | 2920825475 | |||
| 2451 | 2921253734 | |||
| 2452 | 2921261941 | |||
| 2453 | 2923561083 | |||
| 2454 | 2924156775 | |||
| 2455 | 2924196976 | |||
| 2456 | 2926755538 | |||
| 2457 | 2926762666 | |||
| 2458 | 2929141018 | |||
| 2459 | 2929203319 | |||
| 2460 | 2933008975 | |||
| 2461 | 2933014749 | |||
| 2462 | 2933018204 | |||
| 2463 | 2933571067 | |||
| 2464 | 2933588898 | |||
| 2465 | 2933596430 | |||
| 2466 | 2933600745 | |||
| 2467 | 2935896797 | |||
| 2468 | 2935901739 | |||
| 2469 | 2936371825 | |||
| 2470 | 2936379659 | |||
| 2471 | 2936387829 | |||
| 2472 | 2937002713 | |||
| 2473 | 2937027285 | |||
| 2474 | 2937033392 | |||
| 2475 | 2937038430 | |||
| 2476 | 2937057920 | |||
| 2477 | 2937065268 | |||
| 2478 | 2937080638 | |||
| 2479 | 2937091302 | |||
| 2480 | 2937107810 | |||
| 2481 | 2937117732 | |||
| 2482 | 2941504743 | |||
| 2483 | 2957380749 | |||
| 2484 | 2957388538 | |||
| 2485 | 2957394719 | |||
| 2486 | 2957397202 | |||
| 2487 | 2957419003 | |||
| 2488 | 2957439498 | |||
| 2489 | 2957445568 | |||
| 2490 | 2957458737 | |||
| 2491 | 2957493014 | |||
| 2492 | 2960594073 | |||
| 2493 | 2960613155 | |||
| 2494 | 2960619824 | |||
| 2495 | 2960625678 | |||
| 2496 | 2960635574 | |||
| 2497 | 2960656473 | |||
| 2498 | 2960663037 | |||
| 2499 | 2960668053 | |||
| 2500 | 2960680865 | |||
| 2501 | 2960688149 | |||
| 2502 | 2960697323 | |||
| 2503 | 2964608786 | |||
| 2504 | 2964618122 | |||
| 2505 | 2964700139 | |||
| 2506 | 2964717665 | |||
| 2507 | 2967689272 | |||
| 2508 | 2967699529 | |||
| 2509 | 2967729439 | |||
| 2510 | 2967759706 | |||
| 2511 | 2970028070 | |||
| 2512 | 2970036924 | |||
| 2513 | 2970042119 | |||
| 2514 | 2970053661 | |||
| 2515 | 2970073586 | |||
| 2516 | 2970078523 | |||
| 2517 | 2970087450 | |||
| 2518 | 2970104023 | |||
| 2519 | 2970126101 | |||
| 2520 | 2970132045 | |||
| 2521 | 2970147266 | |||
| 2522 | 2970181162 | |||
| 2523 | 2977523195 | |||
| 2524 | 2977524746 | |||
| 2525 | 2977536454 | |||
| 2526 | 2977550416 | |||
| 2527 | 2977572717 | |||
| 2528 | 2978971891 | |||
| 2529 | 2979092021 | |||
| 2530 | 2979100590 | |||
| 2531 | 2979104078 | |||
| 2532 | 2984511351 | |||
| 2533 | 2984522288 | |||
| 2534 | 2984541590 | |||
| 2535 | 2984590176 | |||
| 2536 | 2984603863 | |||
| 2537 | 2989350047 | |||
| 2538 | 2989776011 | |||
| 2539 | 2989779454 | |||
| 2540 | 2995396008 | |||
| 2541 | 2996892826 | |||
| 2542 | 2996894929 | |||
| 2543 | 3000018609 | |||
| 2544 | 3003934460 | |||
| 2545 | 3005414349 | |||
| 2546 | 3005418973 | |||
| 2547 | 3005448663 | |||
| 2548 | 3005454901 | |||
| 2549 | 639649392 | |||
| 2550 | 643826545 | |||
| 2551 | 650740719 | |||
| 2552 | 8003571793 | |||
| 2553 | 8003994383 | |||
| 2554 | 8004002081 | |||
| 2555 | 8005249937 | |||
| 2556 | 8005259407 | |||
| 2557 | 8005284604 | |||
| 2558 | 8005295727 | |||
| 2559 | 8005303339 | |||
| 2560 | 8005309608 | |||
| 2561 | 8005318135 | |||
| 2562 | 8005327353 | |||
| 2563 | 8005381143 | |||
| 2564 | 8005388903 | |||
| 2565 | 8005395887 | |||
| 2566 | 8005437494 | |||
| 2567 | 8005488988 | |||
| 2568 | 8005501108 | |||
| 2569 | 8005545906 | |||
| 2570 | 8005561435 | |||
| 2571 | 8005568213 | |||
| 2572 | 8005573247 | |||
| 2573 | 8005622475 | |||
| 2574 | 8005629977 | |||
| 2575 | 8005646067 | |||
| 2576 | 8005658852 | |||
| 2577 | 8005672526 | |||
| 2578 | 8005682681 | |||
| 2579 | 8005691889 | |||
| 2580 | 8005697623 | |||
| 2581 | 8018127990 | |||
| 2582 | 8018151344 | |||
| 2583 | 8018164355 | |||
| 2584 | 8023682952 | |||
| 2585 | 8024482647 | |||
| 2586 | 8024488252 | |||
| 2587 | 8024504646 | |||
| 2588 | 8045865571 | |||
| 2589 | 8046771734 | |||
| 2590 | 8049295515 | |||
| 2591 | 8054463141 | |||
| 2592 | 8054562192 | |||
| 2593 | 8055432393 | |||
| 2594 | 8055910564 | |||
| 2595 | 8056378352 | |||
| 2596 | 8056384206 | |||
| 2597 | 8056875761 | |||
| 2598 | 8057103362 | |||
| 2599 | 8057575488 | |||
| 2600 | 8057879873 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7alc-assembly1.cif.gz_E-2 | human gch-gfrp stimulatory complex | 0.9161 | 38 | 134 |
| 5k0p-assembly1.cif.gz_B | crystal structure of the archaeosine synthase quef-like in the apo form | 0.913 | 37 | 137 |
| 7alc-assembly1.cif.gz_B-2 | human gch-gfrp stimulatory complex | 0.9123 | 40 | 134 |
| 6z88-assembly1.cif.gz_H | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.911 | 38 | 134 |
| 7alc-assembly1.cif.gz_C-2 | human gch-gfrp stimulatory complex | 0.9103 | 40 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G081_22_166_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9186 | 15 | 136 | 3.30.1130.10 |
| 1a8rA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8747 | 36 | 130 | 3.30.1130.10 |
| 4uqfA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8552 | 34 | 134 | 3.30.1130.10 |
| af_A0A1D6DUT0_342_468_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8391 | 40 | 135 | 3.30.1130.10 |
| 3rzpD02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8291 | 31 | 139 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q9RNJ7-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9892 | 10 | 119 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A520IJI0-F1-model_v4 | PreQ(1) synthase (EC 1.7.1.13) | 0.9872 | 10 | 116 |
GO:0005737
GO:0008616 GO:0033739 |
| AF-A0A7U8JXT8-F1-model_v4 | deleted | 0.9846 | 7 | 137 |
|
| AF-A0A6L7ZVT3-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (EC 1.7.1.13) | 0.9839 | 8 | 129 |
GO:0005737
GO:0008616 GO:0033739 |
| AF-A0A5B8XE36-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9837 | 1 | 145 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |