F492736

General Info

Members Datasets Scaffolds Average Seq Length
1300 848 2600 153

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100260722|Ga0070669_1002607223
Length 176
Sequence MSLSAIDFASDCNEAATALISHMTKTDVSNLTQLGHATALPANPDEAVLERVPNSQGKTIYLVRFVAPEFTSLCPMTGQPDFAHLVIDYVPGRWLVESKSLKLYLGSFRNHGSFHEDCTVGIGKRLVKELKPVWLRIGGYWYPRGGIPIDVFWQTAAPPKGLWLPDQGVPPYRGRG

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
69 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
85 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
89 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
102 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
103 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
109 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
110 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
111 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
163 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
170 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
187 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
205 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
206 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
209 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
210 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
211 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
212 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
213 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
214 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
215 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
216 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
217 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
218 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
219 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
222 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
223 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
238 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
241 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
242 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
243 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
246 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
293 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
298 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
337 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
338 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
341 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
342 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
343 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
344 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
345 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
346 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
347 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
348 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
351 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
352 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
353 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
354 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
355 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
356 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
357 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
358 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
359 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
361 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
362 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
363 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
364 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
365 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
366 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
367 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
368 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
369 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
370 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
371 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
380 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
381 2509276019 Ensifer aridi TW10 Isolate Nodule
382 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
383 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
384 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
385 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
386 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
387 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
388 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
389 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
390 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
391 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
392 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
393 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
394 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
395 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
396 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
397 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
398 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
399 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
400 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
401 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
402 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
403 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
404 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
405 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
406 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
407 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
408 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
409 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
410 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
411 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
412 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
413 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
414 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
415 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
416 2516143018 Ensifer sp. BR816 Isolate Nodule
417 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
418 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
419 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
420 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
421 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
422 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
423 2519899620 Rhizobium sp. Pop5 Isolate Nodule
424 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
425 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
426 2534681786 Brucella suis 92/29 Isolate Unclassified
427 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
428 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
429 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
430 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
431 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
432 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
433 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
434 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
435 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
436 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
437 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
438 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
439 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
440 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
441 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
442 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
443 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
444 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
445 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
446 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
447 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
448 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
449 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
450 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
451 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
452 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
453 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
454 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
455 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
456 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
457 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
458 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
459 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
460 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
461 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
462 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
463 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
464 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
465 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
466 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
467 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
468 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
469 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
470 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
471 2643221557 Ensifer sp. Root558 Isolate Unclassified
472 2643221558 Rhizobium sp. Root149 Isolate Unclassified
473 2643221568 Rhizobium sp. Root564 Isolate Unclassified
474 2643221582 Rhizobium sp. Root651 Isolate Unclassified
475 2643221591 Devosia sp. Root685 Isolate Unclassified
476 2643221599 Rhizobium sp. Root708 Isolate Unclassified
477 2643221607 Rhizobium sp. Root73 Isolate Unclassified
478 2643221610 Ensifer sp. Root74 Isolate Unclassified
479 2643221618 Ensifer sp. Root231 Isolate Unclassified
480 2643221626 Ensifer sp. Root31 Isolate Unclassified
481 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
482 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
483 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
484 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
485 2643221651 Afipia sp. Root123D2 Isolate Unclassified
486 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
487 2643221655 Ensifer sp. Root1252 Isolate Unclassified
488 2643221659 Ensifer sp. Root127 Isolate Unclassified
489 2643221668 Ensifer sp. Root423 Isolate Unclassified
490 2643221675 Ensifer sp. Root1298 Isolate Unclassified
491 2643221680 Ensifer sp. Root1312 Isolate Unclassified
492 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
493 2643221688 Rhizobium sp. Root482 Isolate Unclassified
494 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
495 2643221693 Rhizobium sp. Root491 Isolate Unclassified
496 2643221698 Ensifer sp. Root142 Isolate Unclassified
497 2643221712 Ensifer sp. Root258 Isolate Unclassified
498 2643221718 Rhizobium sp. Root268 Isolate Unclassified
499 2643221719 Rhizobium sp. Root274 Isolate Unclassified
500 2643221723 Ensifer sp. Root278 Isolate Unclassified
501 2643221726 Ensifer sp. Root954 Isolate Unclassified
502 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
503 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
504 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
505 2718217882 Rhizobium sp. N741 Isolate Nodule
506 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
507 2718218009 Rhizobium sp. N561 Isolate Nodule
508 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
509 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
510 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
511 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
512 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
513 2718218363 Rhizobium sp. N113 Isolate Nodule
514 2718218365 Rhizobium sp. N731 Isolate Nodule
515 2718218366 Rhizobium sp. N621 Isolate Nodule
516 2721755514 Rhizobium sp. N6212 Isolate Nodule
517 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
518 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
519 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
520 2721755810 Rhizobium sp. N871 Isolate Nodule
521 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
522 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
523 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
524 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
525 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
526 2728369365 Rhizobium sp. N1341 Isolate Nodule
527 2728369397 Rhizobium sp. N1314 Isolate Nodule
528 2738541293 Rhizobium sp. GV031 Isolate Unclassified
529 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
530 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
531 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
532 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
533 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
534 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
535 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
536 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
537 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
538 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
539 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
540 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
541 2791355256 Rhizobium sp. M10 Isolate Nodule
542 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
543 2791355260 Rhizobium sp. L9 Isolate Nodule
544 2791355261 Rhizobium sp. J15 Isolate Nodule
545 2791355262 Rhizobium sp. M1 Isolate Nodule
546 2791355263 Rhizobium chutanense C5 Isolate Nodule
547 2791355264 Rhizobium sp. S9 Isolate Nodule
548 2791355265 Rhizobium sp. H4 Isolate Nodule
549 2791355266 Rhizobium sp. L43 Isolate Nodule
550 2791355267 Rhizobium sp. L18 Isolate Nodule
551 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
552 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
553 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
554 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
555 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
556 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
557 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
558 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
559 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
560 2802429633 Rhizobium anhuiense J3 Isolate Nodule
561 2802429634 Rhizobium anhuiense S10 Isolate Nodule
562 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
563 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
564 2802429637 Rhizobium anhuiense C15 Isolate Nodule
565 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
566 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
567 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
568 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
569 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
570 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
571 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
572 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
573 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
574 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
575 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
576 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
577 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
578 2838048938 Rhizobium pisi 27/80 Isolate Nodule
579 2838061910 Rhizobium phaseoli L15 Isolate Nodule
580 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
581 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
582 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
583 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
584 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
585 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
586 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
587 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
588 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
589 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
590 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
591 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
592 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
593 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
594 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
595 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
596 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
597 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
598 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
599 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
600 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
601 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
602 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
603 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
604 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
605 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
606 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
607 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
608 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
609 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
610 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
611 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
612 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
613 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
614 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
615 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
616 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
617 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
618 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
619 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
620 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
621 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
622 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
623 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
624 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
625 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
626 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
627 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
628 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
629 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
630 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
631 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
632 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
633 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
634 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
635 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
636 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
637 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
638 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
639 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
640 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
641 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
642 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
643 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
644 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
645 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
646 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
647 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
648 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
649 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
650 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
651 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
652 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
653 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
654 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
655 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
656 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
657 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
658 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
659 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
660 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
661 2844163670 Ensifer sp. 1H6 Isolate Unclassified
662 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
663 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
664 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
665 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
666 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
667 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
668 2854911287 Brucella lupini LUP21 Isolate Unclassified
669 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
670 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
671 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
672 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
673 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
674 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
675 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
676 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
677 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
678 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
679 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
680 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
681 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
682 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
683 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
684 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
685 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
686 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
687 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
688 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
689 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
690 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
691 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
692 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
693 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
694 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
695 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
696 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
697 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
698 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
699 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
700 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
701 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
702 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
703 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
704 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
705 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
706 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
707 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
708 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
709 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
710 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
711 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
712 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
713 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
714 2933599457 Rhizobium phaseoli M3 Isolate Nodule
715 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
716 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
717 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
718 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
719 2936381700 Rhizobium chutanense C16 Isolate Unclassified
720 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
721 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
722 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
723 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
724 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
725 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
726 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
727 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
728 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
729 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
730 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
731 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
732 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
733 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
734 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
735 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
736 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
737 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
738 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
739 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
740 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
741 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
742 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
743 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
744 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
745 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
746 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
747 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
748 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
749 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
750 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
751 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
752 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
753 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
754 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
755 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
756 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
757 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
758 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
759 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
760 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
761 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
762 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
763 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
764 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
765 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
766 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
767 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
768 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
769 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
770 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
771 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
772 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
773 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
774 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
775 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
776 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
777 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
778 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
779 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
780 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
781 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
782 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
783 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
784 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
785 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
786 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
787 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
788 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
789 2996887358 Rhizobium sp. R711 Isolate Nodule
790 2996893221 Rhizobium sp. R635 Isolate Nodule
791 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
792 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
793 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
794 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
795 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
796 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
797 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
798 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
799 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
800 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
801 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
802 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
803 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
804 8005258706 Rhizobium sp. R693 Isolate Nodule
805 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
806 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
807 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
808 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
809 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
810 8005321885 Rhizobium sp. R72 Isolate Nodule
811 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
812 8005382845 Rhizobium sp. R634 Isolate Nodule
813 8005395548 Rhizobium sp. R339 Isolate Nodule
814 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
815 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
816 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
817 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
818 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
819 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
820 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
821 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
822 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
823 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
824 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
825 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
826 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
827 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
828 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
829 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
830 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
831 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
832 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
833 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
834 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
835 8024501048 Rhizobium sp. H4 Isolate Nodule
836 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
837 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
838 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
839 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
840 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
841 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
842 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
843 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
844 8056382006 Rhizobium croatiense 13T Isolate Nodule
845 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
846 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
847 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
848 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.08
Metatranscriptomes 0.77
Isolates 36.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 22.54
Nodule 24.54
Rhizoplane 2
Rhizosphere 32.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100260722 3300005353 Bacteria 1383
2 JGI24740J21852_10003638 3300001979 Bacteria 6721
3 JGI24739J22299_10033117 3300001989 Bacteria 1771
4 JGI25155J39150_1000014 3300002704 Bacteria 196159
5 JGI25156J39149_1000037 3300002705 Bacteria 109690
6 JGI25156J39149_1000079 3300002705 Bacteria 73408
7 JGI25162J39368_1000497 3300002737 Bacteria 29860
8 JGI25162J39368_1000992 3300002737 Bacteria 17927
9 JGI25154J39366_1000052 3300002738 Bacteria 120209
10 JGI25158J39367_1000499 3300002739 Bacteria 7922
11 JGI25157J39369_1000040 3300002741 Bacteria 126165
12 JGI25152J39213_1001025 3300002773 Bacteria 13379
13 JGI25152J39213_1002772 3300002773 Bacteria 6349
14 JGI25152J39213_1004429 3300002773 Bacteria 4424
15 JGI25152J39213_1020840 3300002773 Bacteria 1163
16 JGI25152J39213_1029794 3300002773 Bacteria 854
17 JGI25150J39212_1000088 3300002774 Bacteria 53538
18 JGI25150J39212_1015270 3300002774 Bacteria 1285
19 JGI25150J39212_1027871 3300002774 Bacteria 805
20 JGI25159J45721_1000004 3300002987 Bacteria 215789
21 JGI25159J45721_1001399 3300002987 Bacteria 10011
22 JGI25159J45721_1006965 3300002987 Bacteria 3304
23 JGI25151J46595_10000215 3300003187 Bacteria 69771
24 JGI25151J46595_10000280 3300003187 Bacteria 58125
25 JGI25151J46595_10005849 3300003187 Bacteria 6291
26 JGI25151J46595_10006069 3300003187 Bacteria 6142
27 JGI25151J46595_10024325 3300003187 Bacteria 2480
28 JGI25151J46595_10024843 3300003187 Bacteria 2445
29 JGI25151J46595_10038793 3300003187 Bacteria 1767
30 JGI25151J46595_10052475 3300003187 Bacteria 1371
31 JGI25151J46595_10065287 3300003187 Bacteria 1134
32 JGI25151J46595_10129791 3300003187 Bacteria 629
33 JGI25406J46586_10003554 3300003203 Bacteria 7306
34 JGI25165J46597_1000371 3300003214 Bacteria 50062
35 JGI25165J46597_1000462 3300003214 Bacteria 40205
36 JGI25165J46597_1005670 3300003214 Bacteria 2358
37 JGI25153J46596_10001244 3300003215 Bacteria 15371
38 JGI25153J46596_10007382 3300003215 Bacteria 5419
39 JGI25153J46596_10017172 3300003215 Bacteria 2862
40 JGI25153J46596_10032466 3300003215 Bacteria 1741
41 rootH1_10177570 3300003323 Bacteria 1729
42 JGI25160J50197_1000001 3300003354 Bacteria 782301
43 JGI25160J50197_1000021 3300003354 Bacteria 215789
44 JGI25160J50197_1001207 3300003354 Bacteria 13131
45 JGI25160J50197_1011565 3300003354 Bacteria 3120
46 JGI25160J50197_1022474 3300003354 Bacteria 1848
47 JGI25161J50226_1000001 3300003374 Bacteria 655036
48 JGI25161J50226_1000283 3300003374 Bacteria 28981
49 JGI25161J50226_1000307 3300003374 Bacteria 27289
50 JGI25161J50226_1016692 3300003374 Bacteria 782
51 Ga0006562J51391_1004630 3300003578 Bacteria 2770
52 Ga0006562J51391_1004633 3300003578 Bacteria 940
53 Ga0055525_1019223 3300003759 Bacteria 580
54 Ga0055529_1005549 3300003763 Bacteria 1815
55 Ga0055526_1001084 3300003771 Bacteria 19838
56 Ga0055526_1002599 3300003771 Bacteria 12069
57 Ga0055526_1004226 3300003771 Bacteria 8720
58 Ga0055526_1013834 3300003771 Bacteria 3374
59 Ga0055526_1042781 3300003771 Bacteria 1111
60 Ga0055524_1002465 3300003775 Bacteria 9507
61 Ga0055524_1004489 3300003775 Bacteria 6431
62 Ga0055524_1004911 3300003775 Bacteria 6069
63 Ga0055524_1009251 3300003775 Bacteria 4029
64 Ga0055524_1011052 3300003775 Bacteria 3553
65 Ga0055524_1021006 3300003775 Bacteria 2179
66 Ga0055524_1025442 3300003775 Bacteria 1853
67 Ga0055524_1074924 3300003775 Bacteria 637
68 Ga0055536_1003481 3300003781 Bacteria 8439
69 Ga0055536_1009272 3300003781 Bacteria 4098
70 Ga0055528_1000549 3300003790 Bacteria 28640
71 Ga0055528_1001077 3300003790 Bacteria 17996
72 Ga0055528_1009596 3300003790 Bacteria 4028
73 Ga0055528_1025209 3300003790 Bacteria 1755
74 Ga0055528_1036530 3300003790 Bacteria 1172
75 Ga0055530_10007952 3300003791 Bacteria 4340
76 Ga0055540_1000766 3300003792 Bacteria 21853
77 Ga0055540_1005952 3300003792 Bacteria 4961
78 Ga0055540_1011443 3300003792 Bacteria 2859
79 Ga0055540_1033758 3300003792 Bacteria 1157
80 Ga0055540_1046310 3300003792 Bacteria 915
81 Ga0055531_10002883 3300003794 Bacteria 11200
82 Ga0055531_10028376 3300003794 Bacteria 1932
83 Ga0058692_1010152 3300003856 Bacteria 2339
84 Ga0058692_1010285 3300003856 Bacteria 2317
85 Ga0055543_1000003 3300004625 Bacteria 358656
86 Ga0055543_1000060 3300004625 Bacteria 98330
87 Ga0055543_1000311 3300004625 Bacteria 33798
88 Ga0055543_1000705 3300004625 Bacteria 17007
89 Ga0065165_1000008 3300005262 Bacteria 334429
90 Ga0065165_1000033 3300005262 Bacteria 215827
91 Ga0065165_1007477 3300005262 Bacteria 5355
92 Ga0065165_1012806 3300005262 Bacteria 3389
93 Ga0065165_1033757 3300005262 Bacteria 1589
94 Ga0065165_1081691 3300005262 Bacteria 838
95 Ga0070682_100162700 3300005337 Bacteria 1543
96 Ga0070689_101665527 3300005340 Bacteria 580
97 Ga0070668_100310520 3300005347 Bacteria 1325
98 Ga0070668_100394043 3300005347 Bacteria 1181
99 Ga0070668_101312432 3300005347 Bacteria 658
100 Ga0070669_100105433 3300005353 Bacteria 2132
101 Ga0070669_100329913 3300005353 Bacteria 1234
102 Ga0070671_100455684 3300005355 Bacteria 1097
103 Ga0070674_100695063 3300005356 Bacteria 869
104 Ga0070667_100031464 3300005367 Bacteria 4425
105 Ga0070667_100781626 3300005367 Bacteria 886
106 Ga0070708_100296775 3300005445 Bacteria 1522
107 Ga0070663_100067010 3300005455 Bacteria 2603
108 Ga0070706_100046586 3300005467 Bacteria 4002
109 Ga0070698_100036273 3300005471 Bacteria 5095
110 Ga0070699_100110489 3300005518 Bacteria 2413
111 Ga0068853_100035919 3300005539 Bacteria 4212
112 Ga0070672_101009375 3300005543 Bacteria 737
113 Ga0070686_100138518 3300005544 Bacteria 1691
114 Ga0070665_100002486 3300005548 Bacteria 20302
115 Ga0070665_100070536 3300005548 Bacteria 3501
116 Ga0070665_100172205 3300005548 Bacteria 2166
117 Ga0070665_100582613 3300005548 Bacteria 1132
118 Ga0070665_100693459 3300005548 Bacteria 1031
119 Ga0070665_100800135 3300005548 Bacteria 956
120 Ga0068855_100727602 3300005563 Bacteria 1060
121 Ga0068854_100069462 3300005578 Bacteria 2572
122 Ga0068856_100224261 3300005614 Bacteria 1895
123 Ga0068856_100251105 3300005614 Bacteria 1784
124 Ga0068851_10068800 3300005834 Bacteria 1828
125 Ga0081455_10000538 3300005937 Bacteria 49235
126 Ga0081455_10019611 3300005937 Bacteria 6389
127 Ga0081539_10000572 3300005985 Bacteria 76133
128 Ga0075365_10002452 3300006038 Bacteria 9106
129 Ga0075365_10017736 3300006038 Bacteria 4364
130 Ga0075365_10068903 3300006038 Bacteria 2377
131 Ga0075365_10356132 3300006038 Bacteria 1032
132 Ga0075368_10041228 3300006042 Bacteria 1813
133 Ga0075363_100123831 3300006048 Bacteria 1446
134 Ga0075363_100185340 3300006048 Bacteria 1185
135 Ga0075363_100483201 3300006048 Bacteria 734
136 Ga0075364_10002108 3300006051 Bacteria 11108
137 Ga0075364_10024817 3300006051 Bacteria 3810
138 Ga0075364_10030331 3300006051 Bacteria 3470
139 Ga0075364_10099563 3300006051 Bacteria 1935
140 Ga0075364_10466317 3300006051 Bacteria 863
141 Ga0075364_10585114 3300006051 Bacteria 763
142 Ga0075362_10000446 3300006177 Bacteria 11962
143 Ga0075362_10050960 3300006177 Bacteria 1852
144 Ga0075362_10383312 3300006177 Bacteria 707
145 Ga0075367_10005571 3300006178 Bacteria 6272
146 Ga0075367_10047982 3300006178 Bacteria 2514
147 Ga0075367_10199637 3300006178 Bacteria 1250
148 Ga0075367_10312320 3300006178 Bacteria 990
149 Ga0075367_10334879 3300006178 Bacteria 954
150 Ga0075367_10371372 3300006178 Bacteria 903
151 Ga0075369_10010204 3300006186 Bacteria 3670
152 Ga0075369_10021611 3300006186 Bacteria 2646
153 Ga0075369_10035009 3300006186 Bacteria 2133
154 Ga0075369_10060746 3300006186 Bacteria 1649
155 Ga0075369_10061641 3300006186 Bacteria 1638
156 Ga0075366_10003015 3300006195 Bacteria 8787
157 Ga0075366_10122371 3300006195 Bacteria 1568
158 Ga0075370_10045499 3300006353 Bacteria 2482
159 Ga0075370_10243232 3300006353 Bacteria 1066
160 Ga0075370_10272640 3300006353 Bacteria 1004
161 Ga0075430_100226040 3300006846 Bacteria 1552
162 Ga0075431_100006441 3300006847 Bacteria 11655
163 Ga0075429_100055477 3300006880 Bacteria 3447
164 Ga0068865_100639961 3300006881 Bacteria 903
165 Ga0068865_100989888 3300006881 Bacteria 736
166 Ga0075436_100176072 3300006914 Bacteria 1511
167 Ga0079104_1000884 3300006946 Bacteria 24591
168 Ga0079104_1002263 3300006946 Bacteria 10711
169 Ga0099826_10010998 3300006948 Bacteria 6799
170 Ga0099795_10351282 3300007788 Bacteria 660
171 Ga0105251_10006266 3300009011 Bacteria 7622
172 Ga0105244_10117156 3300009036 Bacteria 1292
173 Ga0105244_10134460 3300009036 Bacteria 1192
174 Ga0105250_10044154 3300009092 Bacteria 1787
175 Ga0105240_10000014 3300009093 Bacteria 482033
176 Ga0105240_10607559 3300009093 Bacteria 1203
177 Ga0105240_10819328 3300009093 Bacteria 1007
178 Ga0111539_10260506 3300009094 Bacteria 2019
179 Ga0105247_10202228 3300009101 Bacteria 1335
180 Ga0114129_10003089 3300009147 Bacteria 23361
181 Ga0105243_10012270 3300009148 Bacteria 6481
182 Ga0105243_11125546 3300009148 Bacteria 795
183 Ga0105241_10668404 3300009174 Bacteria 945
184 Ga0105248_10001790 3300009177 Bacteria 23884
185 Ga0105248_10019194 3300009177 Bacteria 7563
186 Ga0105237_10003542 3300009545 Bacteria 18502
187 Ga0105237_10268463 3300009545 Bacteria 1709
188 Ga0105238_10089717 3300009551 Bacteria 3061
189 Ga0105238_10470719 3300009551 Bacteria 1255
190 Ga0105238_10596547 3300009551 Bacteria 1112
191 Ga0105238_12071368 3300009551 Bacteria 603
192 Ga0105249_11610098 3300009553 Bacteria 722
193 Ga0123341_1000112 3300009765 Bacteria 36073
194 Ga0123341_1065565 3300009765 Bacteria 1684
195 Ga0123342_1010951 3300009766 Bacteria 10166
196 Ga0123342_1016639 3300009766 Bacteria 6342
197 Ga0099796_10100096 3300010159 Bacteria 1089
198 Ga0105239_10000973 3300010375 Bacteria 40196
199 Ga0105239_11650850 3300010375 Bacteria 741
200 Ga0157322_1002866 3300012490 Bacteria 1011
201 Ga0157314_1015773 3300012500 Bacteria 718
202 Ga0157373_10013476 3300013100 Bacteria 5998
203 Ga0157373_10018335 3300013100 Bacteria 5098
204 Ga0157373_10062061 3300013100 Bacteria 2647
205 Ga0157371_10000017 3300013102 Bacteria 320830
206 Ga0157371_10029204 3300013102 Bacteria 3991
207 Ga0157370_10000327 3300013104 Bacteria 59705
208 Ga0157370_10000616 3300013104 Bacteria 44220
209 Ga0157370_10767920 3300013104 Bacteria 878
210 Ga0157369_10221130 3300013105 Bacteria 1982
211 Ga0157369_10223647 3300013105 Bacteria 1969
212 Ga0157369_10432196 3300013105 Bacteria 1364
213 Ga0157369_10661356 3300013105 Bacteria 1077
214 Ga0157369_10718552 3300013105 Bacteria 1028
215 Ga0171463_1007 3300013249 Bacteria 301198
216 Ga0163162_10328425 3300013306 Bacteria 1662
217 Ga0182008_10017060 3300014497 Bacteria 3768
218 Ga0182007_10002083 3300015262 Bacteria 10267
219 Ga0182005_1001327 3300015265 Bacteria 10109
220 Ga0183363_1049 3300015690 Bacteria 38978
221 Ga0163161_10941000 3300017792 Bacteria 734
222 Ga0214544_1000110 3300021320 Bacteria 113143
223 Ga0214542_1000268 3300021321 Bacteria 87082
224 Ga0214542_1013594 3300021321 Bacteria 9673
225 Ga0214543_1000022 3300021327 Bacteria 241930
226 Ga0214543_1000219 3300021327 Bacteria 87102
227 Ga0213872_10033273 3300021361 Bacteria 2362
228 Ga0213876_10003111 3300021384 Bacteria 9596
229 Ga0213876_10199775 3300021384 Bacteria 1063
230 Ga0213875_10002041 3300021388 Bacteria 12410
231 Ga0213871_10060080 3300021441 Bacteria 1057
232 Ga0228711_1000026 3300022739 Bacteria 101497
233 Ga0228710_1000005 3300022740 Bacteria 233531
234 Ga0209435_100027 3300025206 Bacteria 196217
235 Ga0209760_105271 3300025207 Bacteria 1072
236 Ga0209436_100061 3300025208 Bacteria 58629
237 Ga0209436_100422 3300025208 Bacteria 18988
238 Ga0209436_109886 3300025208 Bacteria 1781
239 Ga0209672_115973 3300025228 Bacteria 827
240 Ga0209563_104435 3300025230 Bacteria 2684
241 Ga0209437_100051 3300025233 Bacteria 392523
242 Ga0209437_100060 3300025233 Bacteria 355034
243 Ga0207425_1000432 3300025245 Bacteria 27708
244 Ga0207425_1004652 3300025245 Bacteria 4060
245 Ga0207425_1004982 3300025245 Bacteria 3866
246 Ga0207425_1017504 3300025245 Bacteria 1572
247 Ga0209646_1000086 3300025246 Bacteria 196217
248 Ga0209026_1000082 3300025250 Bacteria 196315
249 Ga0209677_100273 3300025253 Bacteria 34599
250 Ga0209148_1000588 3300025254 Bacteria 33100
251 Ga0209148_1009991 3300025254 Bacteria 1820
252 Ga0209759_1000063 3300025256 Bacteria 196315
253 Ga0209129_1000029 3300025258 Bacteria 401149
254 Ga0209129_1000307 3300025258 Bacteria 44447
255 Ga0209129_1000433 3300025258 Bacteria 31302
256 Ga0209129_1001238 3300025258 Bacteria 14649
257 Ga0209129_1003217 3300025258 Bacteria 7286
258 Ga0209129_1006305 3300025258 Bacteria 3884
259 Ga0209129_1006840 3300025258 Bacteria 3560
260 Ga0209129_1028875 3300025258 Bacteria 939
261 Ga0209233_1000095 3300025261 Bacteria 303783
262 Ga0209233_1000190 3300025261 Bacteria 130713
263 Ga0209233_1000228 3300025261 Bacteria 100100
264 Ga0209565_1023059 3300025263 Bacteria 1282
265 Ga0209565_1024878 3300025263 Bacteria 1214
266 Ga0209455_1000334 3300025272 Bacteria 45267
267 Ga0209673_1000010 3300025273 Bacteria 596656
268 Ga0209673_1000025 3300025273 Bacteria 404572
269 Ga0209673_1000112 3300025273 Bacteria 179676
270 Ga0209673_1000858 3300025273 Bacteria 39511
271 Ga0209673_1003176 3300025273 Bacteria 10010
272 Ga0209673_1003674 3300025273 Bacteria 8848
273 Ga0209673_1006098 3300025273 Bacteria 5910
274 Ga0209673_1013587 3300025273 Bacteria 3203
275 Ga0209673_1030287 3300025273 Bacteria 1707
276 Ga0209130_1000003 3300025284 Bacteria 677988
277 Ga0209130_1000017 3300025284 Bacteria 388431
278 Ga0209130_1000020 3300025284 Bacteria 379297
279 Ga0209130_1042962 3300025284 Bacteria 862
280 Ga0209675_1049955 3300025291 Bacteria 868
281 Ga0209676_1000197 3300025292 Bacteria 135043
282 Ga0209676_1005472 3300025292 Bacteria 6627
283 Ga0209676_1009017 3300025292 Bacteria 4363
284 Ga0209676_1034629 3300025292 Bacteria 1491
285 Ga0209676_1066449 3300025292 Bacteria 874
286 Ga0209025_1000070 3300025294 Bacteria 287776
287 Ga0209025_1000091 3300025294 Bacteria 250401
288 Ga0209025_1000154 3300025294 Bacteria 170288
289 Ga0209025_1000161 3300025294 Bacteria 166506
290 Ga0209025_1000171 3300025294 Bacteria 160478
291 Ga0209025_1000927 3300025294 Bacteria 44856
292 Ga0209025_1002842 3300025294 Bacteria 17370
293 Ga0209025_1007846 3300025294 Bacteria 7836
294 Ga0209025_1011929 3300025294 Bacteria 5650
295 Ga0209025_1014918 3300025294 Bacteria 4733
296 Ga0209025_1028907 3300025294 Bacteria 2699
297 Ga0209025_1035289 3300025294 Bacteria 2263
298 Ga0209564_1000013 3300025295 Bacteria 775755
299 Ga0209564_1000265 3300025295 Bacteria 110606
300 Ga0209564_1000607 3300025295 Bacteria 55712
301 Ga0209564_1001968 3300025295 Bacteria 18089
302 Ga0209564_1008091 3300025295 Bacteria 5262
303 Ga0209564_1012456 3300025295 Bacteria 3708
304 Ga0209564_1025637 3300025295 Bacteria 1975
305 Ga0209758_1000058 3300025297 Bacteria 331603
306 Ga0209758_1000094 3300025297 Bacteria 241068
307 Ga0209758_1000671 3300025297 Bacteria 51169
308 Ga0209758_1005284 3300025297 Bacteria 10089
309 Ga0209758_1012944 3300025297 Bacteria 4607
310 Ga0209758_1013086 3300025297 Bacteria 4562
311 Ga0209758_1019706 3300025297 Bacteria 3237
312 Ga0209758_1020944 3300025297 Bacteria 3068
313 Ga0209758_1036138 3300025297 Bacteria 1934
314 Ga0209758_1043460 3300025297 Bacteria 1655
315 Ga0209050_1002996 3300025298 Bacteria 13124
316 Ga0209050_1005559 3300025298 Bacteria 7851
317 Ga0209050_1005667 3300025298 Bacteria 7728
318 Ga0209256_1000153 3300025299 Bacteria 144736
319 Ga0209256_1000381 3300025299 Bacteria 70973
320 Ga0209256_1000655 3300025299 Bacteria 47114
321 Ga0209256_1001163 3300025299 Bacteria 29718
322 Ga0209256_1002016 3300025299 Bacteria 18118
323 Ga0209256_1004610 3300025299 Bacteria 8514
324 Ga0209256_1019160 3300025299 Bacteria 2191
325 Ga0209256_1031417 3300025299 Bacteria 1452
326 Ga0209256_1033906 3300025299 Bacteria 1366
327 Ga0207426_1000006 3300025302 Bacteria 1025969
328 Ga0207426_1000008 3300025302 Bacteria 848730
329 Ga0207426_1000011 3300025302 Bacteria 791203
330 Ga0207426_1000344 3300025302 Bacteria 85912
331 Ga0207426_1001833 3300025302 Bacteria 15687
332 Ga0209051_1001157 3300025303 Bacteria 23986
333 Ga0209051_1001614 3300025303 Bacteria 18391
334 Ga0209051_1014703 3300025303 Bacteria 3637
335 Ga0209051_1019573 3300025303 Bacteria 2947
336 Ga0209051_1052327 3300025303 Bacteria 1350
337 Ga0209051_1109753 3300025303 Bacteria 722
338 Ga0209257_1002974 3300025304 Bacteria 15474
339 Ga0209257_1008365 3300025304 Bacteria 5906
340 Ga0209257_1013242 3300025304 Bacteria 3696
341 Ga0209257_1015197 3300025304 Bacteria 3228
342 Ga0207696_1096477 3300025711 Bacteria 808
343 Ga0207655_1139394 3300025728 Bacteria 780
344 Ga0207713_1047877 3300025735 Bacteria 1726
345 Ga0207707_10502268 3300025912 Bacteria 1034
346 Ga0207707_11428980 3300025912 Bacteria 551
347 Ga0207695_10000037 3300025913 Bacteria 476303
348 Ga0207695_10117657 3300025913 Bacteria 2630
349 Ga0207695_10211115 3300025913 Bacteria 1852
350 Ga0207695_10631791 3300025913 Bacteria 952
351 Ga0207695_10920776 3300025913 Bacteria 754
352 Ga0207671_10000271 3300025914 Bacteria 77228
353 Ga0207671_10210143 3300025914 Bacteria 1522
354 Ga0207649_11356407 3300025920 Bacteria 563
355 Ga0207652_10291240 3300025921 Bacteria 1473
356 Ga0207681_10683505 3300025923 Bacteria 852
357 Ga0207694_10002909 3300025924 Bacteria 13780
358 Ga0207694_10498678 3300025924 Bacteria 1019
359 Ga0207694_10518221 3300025924 Bacteria 999
360 Ga0207650_10000911 3300025925 Bacteria 22288
361 Ga0207650_10078116 3300025925 Bacteria 2503
362 Ga0207659_10146647 3300025926 Bacteria 1838
363 Ga0207644_10071576 3300025931 Bacteria 2537
364 Ga0207706_10231682 3300025933 Bacteria 1616
365 Ga0207706_10439739 3300025933 Bacteria 1129
366 Ga0207704_10550465 3300025938 Bacteria 937
367 Ga0207691_10279013 3300025940 Bacteria 1438
368 Ga0207711_10009012 3300025941 Bacteria 8340
369 Ga0207711_10231808 3300025941 Bacteria 1691
370 Ga0207668_10068654 3300025972 Bacteria 2521
371 Ga0207668_10498133 3300025972 Bacteria 1047
372 Ga0207668_11110420 3300025972 Bacteria 709
373 Ga0207640_10052246 3300025981 Bacteria 2661
374 Ga0207640_10198771 3300025981 Bacteria 1517
375 Ga0207658_10627719 3300025986 Bacteria 967
376 Ga0207639_10027841 3300026041 Bacteria 4121
377 Ga0207678_10053726 3300026067 Bacteria 3471
378 Ga0207702_10877792 3300026078 Bacteria 888
379 Ga0207702_11820460 3300026078 Bacteria 601
380 Ga0207698_10314980 3300026142 Bacteria 1463
381 Ga0209281_1000034 3300027111 Bacteria 382562
382 Ga0209281_1000082 3300027111 Bacteria 257684
383 Ga0209371_1000022 3300027312 Bacteria 536342
384 Ga0209371_1000892 3300027312 Bacteria 23789
385 Ga0209371_1006087 3300027312 Bacteria 4582
386 Ga0209282_1000006 3300027666 Bacteria 276998
387 Ga0209282_1007756 3300027666 Bacteria 6737
388 Ga0209282_1030375 3300027666 Bacteria 3327
389 Ga0209588_1077228 3300027671 Bacteria 1076
390 Ga0209813_10007851 3300027866 Bacteria 2672
391 Ga0268266_10003490 3300028379 Bacteria 15653
392 Ga0268266_10003866 3300028379 Bacteria 14604
393 Ga0268266_10075098 3300028379 Bacteria 2936
394 Ga0268266_10691014 3300028379 Bacteria 983
395 Ga0268266_11364684 3300028379 Bacteria 684
396 Ga0268266_11814705 3300028379 Bacteria 584
397 Ga0307515_10000017 3300028794 Bacteria 550465
398 Ga0307515_10046209 3300028794 Bacteria 6662
399 Ga0307515_10069935 3300028794 Bacteria 4787
400 Ga0268256_1000019 3300030500 Bacteria 587949
401 Ga0268256_1006062 3300030500 Bacteria 4582
402 Ga0268256_1026482 3300030500 Bacteria 1456
403 Ga0316181_1138338 3300030744 Bacteria 916
404 Ga0265328_10000189 3300031239 Bacteria 28650
405 Ga0265327_10002688 3300031251 Bacteria 18258
406 Ga0265327_10049111 3300031251 Bacteria 2215
407 Ga0307513_10015439 3300031456 Bacteria 9257
408 Ga0307513_10057743 3300031456 Bacteria 4131
409 Ga0307408_100259728 3300031548 Bacteria 1437
410 Ga0307408_100551394 3300031548 Bacteria 1017
411 Ga0265342_10295511 3300031712 Bacteria 854
412 Ga0316576_10760265 3300031727 Bacteria 699
413 Ga0307405_10002746 3300031731 Bacteria 7890
414 Ga0307405_10103915 3300031731 Bacteria 1911
415 Ga0307410_10192518 3300031852 Bacteria 1552
416 Ga0307406_10740705 3300031901 Bacteria 824
417 Ga0307412_10002363 3300031911 Bacteria 10464
418 Ga0307412_10114024 3300031911 Bacteria 1935
419 Ga0307412_10259515 3300031911 Bacteria 1354
420 Ga0307412_10981645 3300031911 Bacteria 745
421 Ga0315914_1000003 3300031967 Bacteria 314370
422 Ga0307409_100821542 3300031995 Bacteria 938
423 Ga0307416_100299293 3300032002 Bacteria 1598
424 Ga0307416_100495718 3300032002 Bacteria 1285
425 Ga0307414_10076304 3300032004 Bacteria 2435
426 Ga0307414_10329742 3300032004 Bacteria 1302
427 Ga0307414_10963431 3300032004 Bacteria 784
428 Ga0307414_11179505 3300032004 Bacteria 709
429 Ga0307411_10905437 3300032005 Bacteria 784
430 Ga0315913_1000001 3300033430 Bacteria 284459
431 Ga0315915_1000008 3300033464 Bacteria 258517
432 Ga0373945_0483619 3300035116 Bacteria 550
433 Ga0373943_0074066 3300035170 Bacteria 1731
434 Ga0373943_0347105 3300035170 Bacteria 850
435 Ga0373935_0010890 3300035692 Bacteria 5461
436 Ga0373927_0000856 3300035695 Bacteria 23214
437 Ga0373927_0849305 3300035695 Bacteria 603
438 Ga0373925_0002516 3300037068 Bacteria 14642
439 Ga0395899_0032746 3300037312 Bacteria 3907
440 Ga0395899_0037181 3300037312 Bacteria 3650
441 Ga0395899_0040984 3300037312 Bacteria 3461
442 Ga0395899_0189558 3300037312 Bacteria 1439
443 Ga0395900_0079907 3300037418 Bacteria 3360
444 Ga0395900_0102233 3300037418 Bacteria 2944
445 Ga0395898_0009045 3300037466 Bacteria 10487
446 Ga0395898_0019247 3300037466 Bacteria 6950
447 Ga0436364_1142809 3300037853 Bacteria 40161
448 Ga0395901_0276823 3300038443 Bacteria 1744
449 Ga0395901_0331860 3300038443 Bacteria 1572
450 Ga0395901_0689569 3300038443 Bacteria 1020
451 Ga0400483_144045 3300039062 Bacteria 3853
452 Ga0400483_213761 3300039062 Bacteria 1346
453 Ga0436365_0243032 3300039437 Bacteria 1622
454 Ga0436365_0990465 3300039437 Bacteria 14414
455 Ga0436360_1052595 3300039438 Bacteria 3124
456 Ga0436361_0187853 3300039447 Bacteria 3059
457 Ga0436361_0507050 3300039447 Bacteria 1270
458 Ga0436361_0972763 3300039447 Bacteria 4532
459 Ga0436361_1031687 3300039447 Bacteria 1418
460 Ga0436363_1027101 3300039450 Bacteria 1261
461 Ga0436363_1351969 3300039450 Bacteria 1170
462 Ga0436362_0783924 3300039453 Bacteria 683
463 Ga0439436_0019882 3300041404 Bacteria 2002
464 Ga0439438_016435 3300041405 Bacteria 2151
465 Ga0439438_017366 3300041405 Bacteria 2073
466 Ga0439466_0070031 3300041411 Bacteria 1118
467 Ga0439465_0008508 3300041413 Bacteria 3238
468 Ga0439465_0165332 3300041413 Bacteria 795
469 Ga0451787_502609 3300041441 Bacteria 1095
470 Ga0451789_1281455 3300041443 Bacteria 897
471 Ga0451795_0335541 3300041456 Bacteria 973
472 Ga0451835_0255768 3300041492 Bacteria 1831
473 Ga0451837_0676541 3300041494 Bacteria 1093
474 Ga0451837_0772324 3300041494 Bacteria 1973
475 Ga0451840_15734 3300041497 Bacteria 645
476 Ga0451846_31201 3300041502 Bacteria 1028
477 Ga0451847_0188909 3300041503 Bacteria 3856
478 Ga0451851_0267608 3300041507 Bacteria 564
479 Ga0451851_0872605 3300041507 Bacteria 1419
480 Ga0451854_30980 3300041510 Bacteria 732
481 Ga0451855_1076083 3300041511 Bacteria 982
482 Ga0439433_0097097 3300041999 Bacteria 729
483 Ga0439449_0004055 3300042007 Bacteria 5671
484 Ga0439449_0017852 3300042007 Bacteria 2663
485 Ga0439451_016516 3300042009 Bacteria 1487
486 Ga0450920_010616 3300042122 Bacteria 1710
487 Ga0450909_003686 3300042185 Bacteria 2175
488 Ga0439434_0047458 3300042435 Bacteria 1327
489 Ga0450918_010663 3300042531 Bacteria 1604
490 Ga0466965_0694794 3300044683 Bacteria 583
491 Ga0466966_0370726 3300044684 Bacteria 860
492 Ga0466968_0015577 3300044735 Bacteria 3015
493 Ga0466970_0218295 3300044765 Bacteria 1064
494 Ga0466957_0017737 3300044842 Bacteria 4175
495 Ga0466960_0232709 3300044901 Bacteria 1017
496 Ga0451576_0002083 3300045051 Bacteria 31271
497 Ga0451576_2052736 3300045051 Bacteria 588
498 Ga0495627_051123 3300046453 Bacteria 1243
499 Ga0495627_093648 3300046453 Bacteria 862
500 Ga0495590_0016051 3300046457 Bacteria 2708
501 Ga0495638_0001134 3300046460 Bacteria 25773
502 Ga0495638_0080821 3300046460 Bacteria 1974
503 Ga0495651_0140785 3300046462 Bacteria 1750
504 Ga0495650_0045284 3300046471 Bacteria 1853
505 Ga0495605_0099468 3300046474 Bacteria 1339
506 Ga0495662_0009811 3300046476 Bacteria 4704
507 Ga0495585_0060355 3300046492 Bacteria 2087
508 Ga0495596_0027893 3300046500 Bacteria 2268
509 Ga0495607_0010334 3300046501 Bacteria 6279
510 Ga0495607_0046074 3300046501 Bacteria 2563
511 Ga0495583_0035078 3300046506 Bacteria 2398
512 Ga0495583_0053761 3300046506 Bacteria 1826
513 Ga0495606_0004697 3300046507 Bacteria 13488
514 Ga0495606_0007767 3300046507 Bacteria 9492
515 Ga0495606_0039286 3300046507 Bacteria 3192
516 Ga0495606_0112977 3300046507 Bacteria 1636
517 Ga0495610_0003664 3300046512 Bacteria 11821
518 Ga0495610_0031382 3300046512 Bacteria 2772
519 Ga0495610_0139763 3300046512 Bacteria 1043
520 Ga0495616_0022251 3300046513 Bacteria 3424
521 Ga0495618_0210505 3300046514 Bacteria 1229
522 Ga0495620_0026792 3300046515 Bacteria 2706
523 Ga0495620_0359990 3300046515 Bacteria 551
524 Ga0495630_0837281 3300046517 Bacteria 702
525 Ga0495631_0001584 3300046518 Bacteria 13671
526 Ga0495632_0003362 3300046519 Bacteria 11400
527 Ga0495632_0009886 3300046519 Bacteria 5703
528 Ga0495632_0041708 3300046519 Bacteria 2304
529 Ga0495632_0081744 3300046519 Bacteria 1540
530 Ga0495632_0108233 3300046519 Bacteria 1306
531 Ga0495643_0031297 3300046522 Bacteria 2962
532 Ga0495643_0066465 3300046522 Bacteria 1902
533 Ga0495648_0029469 3300046524 Bacteria 3643
534 Ga0495648_0161935 3300046524 Bacteria 1155
535 Ga0495663_0018272 3300046525 Bacteria 1996
536 Ga0495642_0201478 3300046528 Bacteria 868
537 Ga0495654_0001572 3300046530 Bacteria 15496
538 Ga0495654_0011933 3300046530 Bacteria 4685
539 Ga0495654_0198712 3300046530 Bacteria 859
540 Ga0495609_0026854 3300046538 Bacteria 2634
541 Ga0495597_0029591 3300046542 Bacteria 2500
542 Ga0495622_0042615 3300046557 Bacteria 2110
543 Ga0495633_0041073 3300046558 Bacteria 2201
544 Ga0495633_0048871 3300046558 Bacteria 1997
545 Ga0495633_0265304 3300046558 Bacteria 782
546 Ga0495656_0014314 3300046615 Bacteria 2972
547 Ga0495668_0009467 3300046616 Bacteria 5984
548 Ga0495668_0012948 3300046616 Bacteria 4937
549 Ga0495668_0101874 3300046616 Bacteria 1571
550 Ga0495611_0013882 3300046648 Bacteria 3436
551 Ga0495611_0020130 3300046648 Bacteria 2870
552 Ga0495625_0002255 3300046660 Bacteria 21195
553 Ga0495625_0049809 3300046660 Bacteria 3009
554 Ga0495625_0068316 3300046660 Bacteria 2498
555 Ga0495625_0100585 3300046660 Bacteria 1987
556 Ga0495625_0126598 3300046660 Bacteria 1734
557 Ga0495588_0001571 3300046674 Bacteria 9773
558 Ga0495588_0067742 3300046674 Bacteria 1853
559 Ga0495670_0012039 3300046691 Bacteria 4258
560 Ga0495671_0065310 3300046692 Bacteria 1791
561 Ga0495600_0026201 3300046809 Bacteria 3761
562 Ga0495660_0004669 3300046810 Bacteria 8269
563 Ga0495604_0097972 3300047317 Bacteria 2161
564 Ga0495636_0047809 3300047318 Bacteria 1787
565 Ga0495672_0005525 3300047320 Bacteria 10005
566 Ga0495683_0049570 3300047323 Bacteria 2103
567 Ga0495681_0013102 3300047470 Bacteria 4834
568 Ga0495681_0049184 3300047470 Bacteria 1994
569 Ga0495681_0278580 3300047470 Bacteria 653
570 Ga0495686_0001486 3300047472 Bacteria 25489
571 Ga0495686_0010881 3300047472 Bacteria 6442
572 Ga0495686_0011361 3300047472 Bacteria 6277
573 Ga0495686_0021709 3300047472 Bacteria 4258
574 Ga0495686_0200319 3300047472 Bacteria 1146
575 Ga0495686_0213564 3300047472 Bacteria 1101
576 Ga0495686_0322597 3300047472 Bacteria 846
577 Ga0495626_0024583 3300048091 Bacteria 2952
578 Ga0496100_1297634 3300048903 Bacteria 574
579 Ga0496102_1292316 3300048905 Bacteria 649
580 Ga0496105_0022766 3300048908 Bacteria 5077
581 Ga0496105_0070505 3300048908 Bacteria 2889
582 Ga0496105_0338339 3300048908 Bacteria 1204
583 Ga0496106_0006078 3300048909 Bacteria 8935
584 Ga0496106_0218120 3300048909 Bacteria 1521
585 Ga0496110_0046395 3300048913 Bacteria 3801
586 Ga0496110_0252786 3300048913 Bacteria 1604
587 Ga0496111_0029761 3300048914 Bacteria 3879
588 Ga0496112_0017743 3300048915 Bacteria 6698
589 Ga0496112_0803831 3300048915 Bacteria 865
590 Ga0496113_0040908 3300048916 Bacteria 3418
591 Ga0496115_0695078 3300048918 Bacteria 800
592 Ga0496116_0000105 3300048919 Bacteria 192704
593 Ga0496116_0007168 3300048919 Bacteria 9963
594 Ga0496116_0008842 3300048919 Bacteria 8671
595 Ga0496116_0023634 3300048919 Bacteria 4572
596 Ga0496116_0031594 3300048919 Bacteria 3787
597 Ga0496116_0031701 3300048919 Bacteria 3778
598 Ga0496116_0047753 3300048919 Bacteria 2879
599 Ga0496116_0052894 3300048919 Bacteria 2686
600 Ga0496116_0083429 3300048919 Bacteria 1973
601 Ga0496117_0000002 3300048920 Bacteria 2483758
602 Ga0496117_0005967 3300048920 Bacteria 12557
603 Ga0496117_0010221 3300048920 Bacteria 8599
604 Ga0496117_0017552 3300048920 Bacteria 5971
605 Ga0496117_0031122 3300048920 Bacteria 4080
606 Ga0496117_0066513 3300048920 Bacteria 2444
607 Ga0496117_0156739 3300048920 Bacteria 1339
608 Ga0496118_0000566 3300048921 Bacteria 61208
609 Ga0496118_0001151 3300048921 Bacteria 40832
610 Ga0496118_0008628 3300048921 Bacteria 10486
611 Ga0496118_0017174 3300048921 Bacteria 6601
612 Ga0496118_0034028 3300048921 Bacteria 4168
613 Ga0496118_0075392 3300048921 Bacteria 2406
614 Ga0496118_0104617 3300048921 Bacteria 1899
615 Ga0496118_0141386 3300048921 Bacteria 1525
616 Ga0496119_0007422 3300048922 Bacteria 9879
617 Ga0496119_0024620 3300048922 Bacteria 4229
618 Ga0496119_0035300 3300048922 Bacteria 3278
619 Ga0496119_0071800 3300048922 Bacteria 2025
620 Ga0496119_0109266 3300048922 Bacteria 1538
621 Ga0496119_0141554 3300048922 Bacteria 1298
622 Ga0496120_0000309 3300048923 Bacteria 81375
623 Ga0496120_0023586 3300048923 Bacteria 3849
624 Ga0496120_0044995 3300048923 Bacteria 2560
625 Ga0496120_0070685 3300048923 Bacteria 1919
626 Ga0496120_0092898 3300048923 Bacteria 1608
627 Ga0496121_0000003 3300048924 Bacteria 1191431
628 Ga0496121_0003780 3300048924 Bacteria 21134
629 Ga0496121_0009804 3300048924 Bacteria 10942
630 Ga0496121_0012638 3300048924 Bacteria 9172
631 Ga0496121_0019047 3300048924 Bacteria 6886
632 Ga0496121_0076734 3300048924 Bacteria 2663
633 Ga0496121_0081685 3300048924 Bacteria 2557
634 Ga0496121_0155671 3300048924 Bacteria 1677
635 Ga0496121_0248290 3300048924 Bacteria 1235
636 Ga0496122_0000004 3300048925 Bacteria 645283
637 Ga0496122_0000157 3300048925 Bacteria 159733
638 Ga0496122_0000464 3300048925 Bacteria 84473
639 Ga0496122_0010069 3300048925 Bacteria 9817
640 Ga0496122_0034634 3300048925 Bacteria 4128
641 Ga0496122_0038124 3300048925 Bacteria 3856
642 Ga0496122_0041265 3300048925 Bacteria 3651
643 Ga0496122_0048776 3300048925 Bacteria 3251
644 Ga0496122_0063672 3300048925 Bacteria 2689
645 Ga0496122_0122766 3300048925 Bacteria 1670
646 Ga0496122_0174327 3300048925 Bacteria 1291
647 Ga0496122_0175306 3300048925 Bacteria 1286
648 Ga0496123_0000007 3300048926 Bacteria 645283
649 Ga0496123_0000048 3300048926 Bacteria 244152
650 Ga0496123_0000147 3300048926 Bacteria 143834
651 Ga0496123_0007075 3300048926 Bacteria 10666
652 Ga0496123_0014048 3300048926 Bacteria 6663
653 Ga0496123_0015923 3300048926 Bacteria 6135
654 Ga0496123_0024343 3300048926 Bacteria 4604
655 Ga0496123_0027255 3300048926 Bacteria 4259
656 Ga0496123_0044556 3300048926 Bacteria 3032
657 Ga0496123_0173840 3300048926 Bacteria 1133
658 Ga0496123_0294082 3300048926 Bacteria 778
659 Ga0496123_0311236 3300048926 Bacteria 747
660 Ga0496124_0000067 3300048927 Bacteria 222576
661 Ga0496124_0002089 3300048927 Bacteria 26962
662 Ga0496124_0008090 3300048927 Bacteria 11052
663 Ga0496124_0009653 3300048927 Bacteria 9884
664 Ga0496124_0029277 3300048927 Bacteria 4910
665 Ga0496124_0060523 3300048927 Bacteria 3176
666 Ga0496124_0130083 3300048927 Bacteria 2001
667 Ga0496124_0132515 3300048927 Bacteria 1978
668 Ga0496124_0169676 3300048927 Bacteria 1692
669 Ga0496124_0196392 3300048927 Bacteria 1539
670 Ga0496124_0211242 3300048927 Bacteria 1468
671 Ga0496124_0230418 3300048927 Bacteria 1385
672 Ga0496124_0238957 3300048927 Bacteria 1352
673 Ga0496124_0273913 3300048927 Bacteria 1234
674 Ga0496124_0305280 3300048927 Bacteria 1147
675 Ga0496125_0000441 3300048928 Bacteria 75923
676 Ga0496125_0000786 3300048928 Bacteria 51737
677 Ga0496125_0000848 3300048928 Bacteria 49020
678 Ga0496125_0009794 3300048928 Bacteria 9769
679 Ga0496125_0014106 3300048928 Bacteria 7803
680 Ga0496125_0014581 3300048928 Bacteria 7646
681 Ga0496125_0050143 3300048928 Bacteria 3459
682 Ga0496125_0135179 3300048928 Bacteria 1726
683 Ga0496125_0255670 3300048928 Bacteria 1102
684 Ga0496125_0356085 3300048928 Bacteria 872
685 Ga0496125_0491740 3300048928 Bacteria 693
686 Ga0496126_0000188 3300048929 Bacteria 139625
687 Ga0496126_0060889 3300048929 Bacteria 3393
688 Ga0496126_0302042 3300048929 Bacteria 1320
689 Ga0496126_0526382 3300048929 Bacteria 941
690 Ga0496126_0531684 3300048929 Bacteria 935
691 Ga0496126_0852853 3300048929 Bacteria 694
692 Ga0495678_066512 3300049459 Bacteria 1334
693 Ga0495682_0011491 3300049460 Bacteria 3407
694 Ga0501031_0099971 3300049568 Bacteria 1893
695 Ga0501032_0187945 3300049569 Bacteria 1351
696 Ga0501033_0000365 3300049570 Bacteria 43281
697 Ga0501033_0150020 3300049570 Bacteria 1682
698 Ga0501033_0183076 3300049570 Bacteria 1501
699 Ga0501034_0001020 3300049571 Bacteria 40131
700 Ga0501034_0191769 3300049571 Bacteria 2005
701 Ga0501034_0327128 3300049571 Bacteria 1465
702 Ga0501034_0648779 3300049571 Bacteria 957
703 Ga0501036_0031089 3300049572 Bacteria 4512
704 Ga0501036_1004531 3300049572 Bacteria 683
705 Ga0501037_0066214 3300049573 Bacteria 2632
706 Ga0501037_0515409 3300049573 Bacteria 810
707 Ga0501038_0020981 3300049574 Bacteria 5869
708 Ga0501040_0034092 3300049576 Bacteria 3449
709 Ga0501041_0162692 3300049577 Bacteria 1395
710 Ga0501042_0162443 3300049578 Bacteria 1611
711 Ga0501043_0216218 3300049579 Bacteria 1484
712 Ga0501043_0419576 3300049579 Bacteria 1009
713 Ga0501046_0028941 3300049580 Bacteria 4508
714 Ga0501047_0221955 3300049581 Bacteria 1746
715 Ga0501047_0255272 3300049581 Bacteria 1602
716 Ga0501048_0025595 3300049582 Bacteria 4301
717 Ga0501067_0065314 3300049583 Bacteria 2014
718 Ga0501068_0288358 3300049584 Bacteria 1050
719 Ga0501068_0309858 3300049584 Bacteria 1011
720 Ga0501070_1196288 3300049586 Bacteria 583
721 Ga0501071_0046594 3300049587 Bacteria 3114
722 Ga0501074_0005267 3300049590 Bacteria 9310
723 Ga0501075_0195777 3300049591 Bacteria 1541
724 Ga0501076_0056877 3300049592 Bacteria 3105
725 Ga0501077_0084373 3300049593 Bacteria 2014
726 Ga0501079_0057880 3300049741 Bacteria 2990
727 Ga0501080_0232366 3300049742 Bacteria 1685
728 Ga0501080_0310242 3300049742 Bacteria 1430
729 Ga0501080_0426430 3300049742 Bacteria 1191
730 Ga0501080_0460058 3300049742 Bacteria 1140
731 Ga0501081_0001100 3300049743 Bacteria 16217
732 Ga0501280_001764 3300049776 Bacteria 3799
733 Ga0501280_052361 3300049776 Bacteria 690
734 Ga0501280_053158 3300049776 Bacteria 686
735 Ga0501035_0001622 3300049822 Bacteria 22762
736 Ga0501044_0109786 3300049823 Bacteria 2767
737 Ga0501044_0590104 3300049823 Bacteria 1005
738 Ga0501044_1392044 3300049823 Bacteria 567
739 Ga0501045_0045776 3300049824 Bacteria 3185
740 nmdc:mga03683_106140_c1 3300050489 Bacteria 1238
741 nmdc:mga03683_240320_c1 3300050489 Bacteria 839
742 nmdc:mga03683_53915_c1 3300050489 Bacteria 1685
743 nmdc:mga03683_858_c1 3300050489 Bacteria 8750
744 nmdc:mga03683_8607_c2 3300050489 Bacteria 3247
745 nmdc:mga03n38_376232_c1 3300050490 Bacteria 777
746 nmdc:mga03n38_48518_c1 3300050490 Bacteria 1884
747 nmdc:mga03n38_582808_c1 3300050490 Bacteria 636
748 nmdc:mga00v17_180_c1 3300050491 Bacteria 37485
749 nmdc:mga00v17_209459_c1 3300050491 Bacteria 1261
750 nmdc:mga00v17_414573_c1 3300050491 Bacteria 875
751 nmdc:mga00v17_443299_c1 3300050491 Bacteria 843
752 nmdc:mga00v17_824_c1 3300050491 Bacteria 16830
753 nmdc:mga00v17_983886_c1 3300050491 Bacteria 531
754 nmdc:mga0yw44_1405_c1 3300050492 Bacteria 9539
755 nmdc:mga0yw44_192004_c1 3300050492 Bacteria 1347
756 nmdc:mga0yw44_31619_c1 3300050492 Bacteria 3079
757 nmdc:mga0yw44_865_c1 3300050492 Bacteria 5959
758 nmdc:mga0k408_21083_c1 3300050493 Bacteria 3657
759 nmdc:mga0k408_63710_c1 3300050493 Bacteria 2145
760 nmdc:mga06z11_196570_c1 3300050494 Bacteria 1169
761 nmdc:mga06z11_285710_c1 3300050494 Bacteria 978
762 nmdc:mga06z11_424021_c1 3300050494 Bacteria 802
763 nmdc:mga07m45_40428_c1 3300050496 Bacteria 2609
764 nmdc:mga05p37_169637_c1 3300050507 Bacteria 2662
765 nmdc:mga05p37_181727_c1 3300050507 Bacteria 2558
766 nmdc:mga0qj67_357762_c1 3300050509 Bacteria 1180
767 nmdc:mga06r32_179582_c1 3300050510 Bacteria 2102
768 nmdc:mga06r32_954463_c1 3300050510 Bacteria 812
769 nmdc:mga08y16_453561_c1 3300050511 Bacteria 1307
770 nmdc:mga08x19_237661_c1 3300050514 Bacteria 1255
771 nmdc:mga0sz30_235323_c1 3300050516 Bacteria 815
772 nmdc:mga0sz30_260587_c1 3300050516 Bacteria 772
773 nmdc:mga0sz30_4354_c1 3300050516 Bacteria 5112
774 nmdc:mga0sz30_7993_c1 3300050516 Bacteria 2987
775 nmdc:mga0sz30_802_c1 3300050516 Bacteria 11359
776 nmdc:mga0sz30_84103_c1 3300050516 Bacteria 1379
777 Ga0500610_0022183 3300053079 Bacteria 3127
778 Ga0495619_0039700 3300053085 Bacteria 3074
779 Ga0500578_0448500 3300053086 Bacteria 735
780 Ga0500578_0459078 3300053086 Bacteria 723
781 Ga0500643_006663 3300053087 Bacteria 4789
782 Ga0500644_0011388 3300053088 Bacteria 2430
783 Ga0500644_0157381 3300053088 Bacteria 916
784 Ga0500646_0268453 3300053090 Bacteria 605
785 Ga0500647_0108906 3300053091 Bacteria 1318
786 Ga0500583_0343685 3300053092 Bacteria 724
787 Ga0500651_0345810 3300053093 Bacteria 845
788 Ga0500557_000501 3300053105 Bacteria 5231
789 Ga0500569_002896 3300053109 Bacteria 3438
790 Ga0500569_008858 3300053109 Bacteria 2316
791 Ga0500569_155755 3300053109 Bacteria 772
792 Ga0500572_003731 3300053111 Bacteria 3457
793 Ga0500594_0003894 3300053118 Bacteria 3288
794 Ga0500607_180670 3300053121 Bacteria 936
795 Ga0500608_052883 3300053122 Bacteria 1950
796 Ga0500618_000849 3300053125 Bacteria 16428
797 Ga0500618_015687 3300053125 Bacteria 1909
798 Ga0500618_041237 3300053125 Bacteria 1059
799 Ga0500642_0256169 3300053130 Bacteria 802
800 Ga0500658_0000206 3300053134 Bacteria 27878
801 Ga0500658_0011557 3300053134 Bacteria 3254
802 Ga0500561_0002494 3300053137 Bacteria 3106
803 Ga0500568_0001714 3300053139 Bacteria 13653
804 Ga0500568_0003195 3300053139 Bacteria 9316
805 Ga0500573_0018797 3300053140 Bacteria 3946
806 Ga0500588_0000807 3300053146 Bacteria 5419
807 Ga0500590_002837 3300053148 Bacteria 7835
808 Ga0500616_0000309 3300053153 Bacteria 70113
809 Ga0500616_0000576 3300053153 Bacteria 44650
810 Ga0500616_0002766 3300053153 Bacteria 14162
811 Ga0500616_0267263 3300053153 Bacteria 723
812 Ga0500616_0294343 3300053153 Bacteria 676
813 Ga0500620_007914 3300053155 Bacteria 2654
814 Ga0500622_0003878 3300053156 Bacteria 9707
815 Ga0500624_000308 3300053157 Bacteria 16712
816 Ga0500624_087080 3300053157 Bacteria 629
817 Ga0500634_0013063 3300053161 Bacteria 4344
818 Ga0500634_0181681 3300053161 Bacteria 946
819 Ga0500636_0000003 3300053177 Bacteria 240189
820 Ga0500636_0000840 3300053177 Bacteria 16525
821 Ga0500637_0093605 3300053178 Bacteria 1741
822 Ga0500609_029468 3300053731 Bacteria 753
823 Ga0501084_0009756 3300054114 Bacteria 7940
824 Ga0587080_061273 3300059503 Bacteria 733
825 Ga0587090_011104 3300059510 Bacteria 1261
826 Ga0587068_011069 3300059641 Bacteria 1355
827 Ga0587069_012415 3300059642 Bacteria 1155
828 Ga0587072_018780 3300059643 Bacteria 1204
829 Ga0501082_0017190 3300060353 Bacteria 6231
830 Ga0530510_0034914 3300061734 Bacteria 3623
831 2509108157 2508501122 Bacteria 6292184
832 2509376667 2509276019 Bacteria 6802256
833 2509391816 2509276021 Bacteria 7634384
834 2509447329 2509276033 Bacteria 7180565
835 2510134167 2510065019 Bacteria 6903379
836 2510305320 2510065057 Bacteria 6649661
837 2510841357 2510461069 Bacteria 5505000
838 2510895604 2510461076 Bacteria 8618824
839 2511133230 2510917022 Bacteria 6504556
840 2511172874 2510917026 Bacteria 7046020
841 2511182484 2510917028 Bacteria 6185411
842 2511199240 2510917030 Bacteria 7460662
843 2511502456 2511231052 Bacteria 6974333
844 2512533834 2512047086 Bacteria 6850303
845 2512970417 2512875026 Bacteria 6861065
846 2513567753 2513237084 Bacteria 7231967
847 2513577164 2513237085 Bacteria 7695351
848 2513597682 2513237088 Bacteria 6927906
849 2513601481 2513237089 Bacteria 6553624
850 2513618150 2513237091 Bacteria 6900273
851 2513633165 2513237093 Bacteria 7545552
852 2513707838 2513237103 Bacteria 7647401
853 2513865913 2513237138 Bacteria 7368160
854 2513884475 2513237140 Bacteria 7076289
855 2513904483 2513237143 Bacteria 6664116
856 2513908555 2513237144 Bacteria 7530820
857 2513925193 2513237146 Bacteria 7166346
858 2513983678 2513237156 Bacteria 6402557
859 2513997692 2513237159 Bacteria 6810126
860 2514003073 2513237160 Bacteria 6650282
861 2514018084 2513237162 Bacteria 7468464
862 2515609251 2515154107 Bacteria 6795637
863 2515636775 2515154113 Bacteria 7807172
864 2515646359 2515154114 Bacteria 7848616
865 2515655125 2515154116 Bacteria 7552979
866 2515739698 2515154134 Bacteria 7220242
867 2516206197 2516143018 Bacteria 6951533
868 2516893832 2516653046 Bacteria 6989037
869 2517036937 2516653077 Bacteria 7555578
870 2517077294 2516653085 Bacteria 7346596
871 2517096052 2517093000 Bacteria 7412387
872 2517407672 2517287029 Bacteria 6905599
873 2517570545 2517487022 Bacteria 7227575
874 2520377042 2519899620 Bacteria 6499161
875 2524448346 2524023207 Bacteria 6813453
876 2524458843 2524023209 Bacteria 6679728
877 2535484901 2534681786 Bacteria 3308809
878 2535517092 2534681796 Bacteria 7146037
879 2537876325 2537561587 Bacteria 5425293
880 2554248393 2554235003 Bacteria 5877155
881 2558863971 2558860100 Bacteria 8458965
882 2559295509 2558860242 Bacteria 5568029
883 2561469275 2558860983 Bacteria 4133860
884 2585147455 2582581279 Bacteria 4980720
885 2585167432 2582581283 Bacteria 6030556
886 2585202005 2582581294 Bacteria 6626667
887 2585223070 2582581298 Bacteria 7315509
888 2585228507 2582581299 Bacteria 6518058
889 2585258284 2582581304 Bacteria 5831370
890 2585265657 2582581306 Bacteria 6450535
891 2585271339 2582581307 Bacteria 6597605
892 2585279278 2582581308 Bacteria 7413247
893 2585323117 2582581315 Bacteria 7318924
894 2585331229 2582581316 Bacteria 7774528
895 2585388862 2582581865 Bacteria 6644329
896 2585395439 2582581866 Bacteria 6859583
897 2585400945 2582581867 Bacteria 7184437
898 2585524722 2585427526 Bacteria 7258840
899 2585531237 2585427527 Bacteria 7273426
900 2585538409 2585427528 Bacteria 6842387
901 2585545653 2585427529 Bacteria 7395659
902 2585552840 2585427530 Bacteria 7383882
903 2585559082 2585427531 Bacteria 6992870
904 2585822152 2585427590 Bacteria 6824633
905 2585836362 2585427593 Bacteria 7141551
906 2585843454 2585427594 Bacteria 6180594
907 2585898463 2585427608 Bacteria 6544331
908 2585903972 2585427609 Bacteria 6667127
909 2587980910 2585428125 Bacteria 6662905
910 2599332003 2599185156 Bacteria 5403036
911 2599417100 2599185170 Bacteria 7295545
912 2599601826 2599185210 Bacteria 5624189
913 2599721594 2599185236 Bacteria 6875203
914 2600194838 2599185352 Bacteria 7228948
915 2600374119 2600254933 Bacteria 4750527
916 2601609918 2600255279 Bacteria 5605316
917 2601746693 2600255308 Bacteria 5611129
918 2616293149 2615840624 Bacteria 6557588
919 2616311445 2615840626 Bacteria 7921970
920 2616554456 2615840698 Bacteria 7319877
921 2617384820 2617270742 Bacteria 6808054
922 2643804208 2643221557 Bacteria 7184309
923 2643811320 2643221558 Bacteria 5460675
924 2643856585 2643221568 Bacteria 5187270
925 2643920175 2643221582 Bacteria 5804683
926 2643962815 2643221591 Bacteria 4397626
927 2644007051 2643221599 Bacteria 6292121
928 2644050245 2643221607 Bacteria 6314006
929 2644065018 2643221610 Bacteria 7480339
930 2644105271 2643221618 Bacteria 7717186
931 2644145653 2643221626 Bacteria 8069654
932 2644191830 2643221634 Bacteria 6705461
933 2644204693 2643221636 Bacteria 6583769
934 2644208797 2643221637 Bacteria 5345260
935 2644242553 2643221643 Bacteria 5749658
936 2644288418 2643221651 Bacteria 4798932
937 2644298895 2643221653 Bacteria 4569637
938 2644309684 2643221655 Bacteria 7722067
939 2644331148 2643221659 Bacteria 7890716
940 2644376573 2643221668 Bacteria 7306521
941 2644416691 2643221675 Bacteria 7473456
942 2644449731 2643221680 Bacteria 7473610
943 2644483165 2643221686 Bacteria 6310811
944 2644494319 2643221688 Bacteria 5260751
945 2644497812 2643221689 Bacteria 6042950
946 2644521796 2643221693 Bacteria 5513853
947 2644543413 2643221698 Bacteria 7756764
948 2644616208 2643221712 Bacteria 7729434
949 2644652327 2643221718 Bacteria 5345506
950 2644657124 2643221719 Bacteria 4568197
951 2644675831 2643221723 Bacteria 7095460
952 2644689863 2643221726 Bacteria 7455827
953 2657681722 2657244999 Bacteria 5946535
954 2671111224 2667528174 Bacteria 6435400
955 2692315293 2690316117 Bacteria 6800650
956 2719182008 2718217882 Bacteria 6556348
957 2719666368 2718217997 Bacteria 6740740
958 2719732725 2718218009 Bacteria 6478651
959 2720492788 2718218199 Bacteria 6740745
960 2720614256 2718218232 Bacteria 6720332
961 2720621024 2718218233 Bacteria 6662049
962 2720632348 2718218235 Bacteria 6630699
963 2720776076 2718218269 Bacteria 6906114
964 2721148099 2718218363 Bacteria 6524337
965 2721159550 2718218365 Bacteria 6274507
966 2721164935 2718218366 Bacteria 6425255
967 2722841105 2721755514 Bacteria 6424414
968 2723027675 2721755556 Bacteria 6745503
969 2723561303 2721755684 Bacteria 6859907
970 2723567926 2721755685 Bacteria 6704835
971 2724045481 2721755810 Bacteria 6479005
972 2724090683 2721755819 Bacteria 6906405
973 2724105191 2721755822 Bacteria 6726041
974 2724111018 2721755823 Bacteria 6752556
975 2725951385 2724679232 Bacteria 7646494
976 2730108611 2728369352 Bacteria 6745171
977 2730165243 2728369365 Bacteria 6555560
978 2730299182 2728369397 Bacteria 6274511
979 2738800309 2738541293 Bacteria 7065685
980 2738944060 2738541317 Bacteria 5340176
981 2739033050 2738541333 Bacteria 7106503
982 2753462350 2751185821 Bacteria 6189929
983 2758641785 2758568016 Bacteria 5645291
984 2766066093 2765235942 Bacteria 7445910
985 2776914177 2775507049 Bacteria 6284736
986 2778175639 2775507266 Bacteria 7392367
987 2792581434 2791355082 Bacteria 5973319
988 2792620588 2791355091 Bacteria 6135441
989 2792625947 2791355092 Bacteria 6248105
990 2792638886 2791355094 Bacteria 7011481
991 2793280117 2791355253 Bacteria 5171699
992 2793294223 2791355256 Bacteria 6798008
993 2793315878 2791355259 Bacteria 7254731
994 2793319389 2791355260 Bacteria 6598818
995 2793328475 2791355261 Bacteria 6661293
996 2793335433 2791355262 Bacteria 6774204
997 2793339485 2791355263 Bacteria 6872478
998 2793347038 2791355264 Bacteria 6429314
999 2793351630 2791355265 Bacteria 6539969
1000 2793361926 2791355266 Bacteria 7116587
1001 2793367683 2791355267 Bacteria 7222458
1002 2802716773 2802428858 Bacteria 6636079
1003 2802725585 2802428859 Bacteria 6667919
1004 2802730324 2802428860 Bacteria 6525526
1005 2802737705 2802428861 Bacteria 6534206
1006 2802742906 2802428862 Bacteria 6633353
1007 2802750330 2802428863 Bacteria 6410669
1008 2804752909 2802429268 Bacteria 6094027
1009 2805926861 2802429605 Bacteria 6875453
1010 2805932776 2802429606 Bacteria 6346811
1011 2806045189 2802429633 Bacteria 7341974
1012 2806050016 2802429634 Bacteria 7083200
1013 2806056854 2802429635 Bacteria 7650140
1014 2806064235 2802429636 Bacteria 7597525
1015 2806071503 2802429637 Bacteria 7067217
1016 2808987756 2808606387 Bacteria 5697198
1017 2819241098 2818991272 Bacteria 4622173
1018 2819559224 2818991439 Bacteria 6907412
1019 2819609347 2818991448 Bacteria 6772224
1020 2819641341 2818991453 Bacteria 7181617
1021 2819685145 2818991461 Bacteria 7026071
1022 2821125722 2821123053 Bacteria 7836056
1023 2821447862 2821443989 Bacteria 7658172
1024 2838021666 2838016132 Bacteria 6577831
1025 2838023641 2838022645 Bacteria 6494267
1026 2838033396 2838029111 Bacteria 6603031
1027 2838038693 2838035591 Bacteria 7166484
1028 2838045179 2838042994 Bacteria 6046894
1029 2838053340 2838048938 Bacteria 6044578
1030 2838065460 2838061910 Bacteria 6794874
1031 2838069939 2838068647 Bacteria 6208656
1032 2838079797 2838074704 Bacteria 6785777
1033 2838661385 2838661181 Bacteria 7385261
1034 2838670571 2838668709 Bacteria 6671819
1035 2838675605 2838675328 Bacteria 4909118
1036 2838683238 2838680041 Bacteria 6545511
1037 2838686833 2838686498 Bacteria 7807632
1038 2838697818 2838694306 Bacteria 6853137
1039 2838702942 2838701080 Bacteria 6669771
1040 2838710933 2838707686 Bacteria 6619912
1041 2838714487 2838714209 Bacteria 5525906
1042 2838721712 2838719591 Bacteria 5523910
1043 2838725247 2838724970 Bacteria 4908691
1044 2838730209 2838729681 Bacteria 7400765
1045 2838737827 2838736955 Bacteria 5760694
1046 2838742776 2838742623 Bacteria 7396178
1047 2841841804 2841840854 Bacteria 5761912
1048 2841848696 2841846520 Bacteria 5345850
1049 2841852279 2841851746 Bacteria 7532261
1050 2841862294 2841859092 Bacteria 5436171
1051 2841867168 2841864319 Bacteria 6742987
1052 2842079107 2842077413 Bacteria 6508645
1053 2842113045 2842110456 Bacteria 7656360
1054 2842118383 2842118031 Bacteria 7033875
1055 2842125273 2842124991 Bacteria 5346824
1056 2842130500 2842130223 Bacteria 4909145
1057 2842141582 2842140634 Bacteria 5759631
1058 2842147800 2842146304 Bacteria 5957337
1059 2842154330 2842152218 Bacteria 4908957
1060 2842158319 2842156927 Bacteria 6894975
1061 2842168578 2842163707 Bacteria 6916235
1062 2842170729 2842170452 Bacteria 5525737
1063 2842177950 2842175837 Bacteria 4908771
1064 2842181939 2842180545 Bacteria 6888678
1065 2842187596 2842187318 Bacteria 5524014
1066 2842195848 2842192696 Bacteria 6147454
1067 2842199155 2842198810 Bacteria 6608673
1068 2842209605 2842205361 Bacteria 6340321
1069 2842211907 2842211629 Bacteria 5523832
1070 2842218162 2842217011 Bacteria 7497767
1071 2842226474 2842224351 Bacteria 5524473
1072 2842230066 2842229732 Bacteria 7475766
1073 2842240295 2842237096 Bacteria 6620661
1074 2842243955 2842243621 Bacteria 7421798
1075 2842252866 2842250916 Bacteria 6579627
1076 2842257960 2842257432 Bacteria 7401195
1077 2842269496 2842264693 Bacteria 6472963
1078 2842271629 2842271015 Bacteria 7807131
1079 2842283059 2842278818 Bacteria 6340002
1080 2842285393 2842285085 Bacteria 6011953
1081 2842292769 2842291075 Bacteria 7076806
1082 2842298192 2842298080 Bacteria 6123127
1083 2842305260 2842304105 Bacteria 7023636
1084 2842314010 2842311132 Bacteria 6616990
1085 2842319749 2842317721 Bacteria 6793725
1086 2842348473 2842341865 Bacteria 7003929
1087 2842360208 2842357229 Bacteria 6485165
1088 2842370250 2842363717 Bacteria 6844742
1089 2842373869 2842370503 Bacteria 7038661
1090 2842379166 2842377471 Bacteria 7140707
1091 2842384893 2842384541 Bacteria 7057858
1092 2842402753 2842402390 Bacteria 6681310
1093 2842409876 2842409023 Bacteria 6687331
1094 2842416524 2842415677 Bacteria 6596907
1095 2842423553 2842422224 Bacteria 6239196
1096 2842430502 2842428310 Bacteria 6767288
1097 2842436686 2842434925 Bacteria 6502746
1098 2842443472 2842441272 Bacteria 6769273
1099 2842449342 2842447887 Bacteria 6754142
1100 2842466756 2842462802 Bacteria 6588055
1101 2842471444 2842469257 Bacteria 6752936
1102 2842479938 2842475841 Bacteria 6603183
1103 2842483860 2842482326 Bacteria 7212537
1104 2842492279 2842489311 Bacteria 6620893
1105 2842497861 2842495871 Bacteria 6820686
1106 2842505277 2842502639 Bacteria 6604161
1107 2842514284 2842509118 Bacteria 6850950
1108 2842519078 2842515876 Bacteria 5436280
1109 2842522062 2842521101 Bacteria 6569494
1110 2842777676 2842775625 Bacteria 5587290
1111 2842924338 2842922631 Bacteria 5824079
1112 2844164033 2844163670 Bacteria 7266046
1113 2844458130 2844454524 Bacteria 7952546
1114 2847419648 2847417321 Bacteria 6913799
1115 2848994650 2848992105 Bacteria 6810864
1116 2850081667 2850079185 Bacteria 6848280
1117 2852390469 2852387548 Bacteria 8025568
1118 2854901335 2854896431 Bacteria 5869725
1119 2854912118 2854911287 Bacteria 5582813
1120 2855826557 2855825444 Bacteria 6785811
1121 2855877165 2855872281 Bacteria 6964271
1122 2857517205 2857516855 Bacteria 7787325
1123 2857532283 2857531043 Bacteria 6754041
1124 2858803750 2858800743 Bacteria 6603254
1125 2891089979 2891088606 Bacteria 4762464
1126 2891373572 2891373044 Bacteria 5202277
1127 2894776970 2894772417 Bacteria 5305674
1128 2894817751 2894817345 Bacteria 4892941
1129 2896392101 2896384573 Bacteria 7700774
1130 2899794101 2899792073 Bacteria 4926588
1131 2899806799 2899803654 Bacteria 5577784
1132 2899847747 2899845264 Bacteria 5672268
1133 2913296101 2913295892 Bacteria 6333755
1134 2913313570 2913308742 Bacteria 5350706
1135 2915654079 2915650412 Bacteria 4288180
1136 2915982886 2915980308 Bacteria 6624279
1137 2915989485 2915986958 Bacteria 6739310
1138 2916009195 2916007675 Bacteria 6898660
1139 2916044326 2916041962 Bacteria 6820487
1140 2916050375 2916048683 Bacteria 6543552
1141 2916065458 2916061851 Bacteria 6737736
1142 2916074655 2916068649 Bacteria 6943657
1143 2916078318 2916076590 Bacteria 6596108
1144 2919106244 2919100787 Bacteria 7710546
1145 2919114523 2919114240 Bacteria 5700270
1146 2919169492 2919166419 Bacteria 4952238
1147 2919410207 2919408235 Bacteria 6149349
1148 2920761319 2920760137 Bacteria 7427611
1149 2920762659 2920760137 Bacteria 7427611
1150 2920825475 2920822456 Bacteria 6897201
1151 2921253734 2921250672 Bacteria 6677771
1152 2921261941 2921257292 Bacteria 6808382
1153 2923561083 2923556063 Bacteria 6793593
1154 2924156775 2924150972 Bacteria 7169444
1155 2924196976 2924193448 Bacteria 6955718
1156 2926755538 2926754445 Bacteria 5964435
1157 2926762666 2926760298 Bacteria 5505990
1158 2929141018 2929138655 Bacteria 5810547
1159 2929203319 2929199973 Bacteria 7260745
1160 2933008975 2933006813 Bacteria 4912075
1161 2933014749 2933011516 Bacteria 5439334
1162 2933018204 2933016740 Bacteria 6355406
1163 2933571067 2933570622 Bacteria 7023390
1164 2933588898 2933586486 Bacteria 7667493
1165 2933596430 2933594066 Bacteria 5594265
1166 2933600745 2933599457 Bacteria 5858799
1167 2935896797 2935894831 Bacteria 6620579
1168 2935901739 2935901341 Bacteria 7341747
1169 2936371825 2936367885 Bacteria 7324495
1170 2936379659 2936375103 Bacteria 6652732
1171 2936387829 2936381700 Bacteria 7006523
1172 2937002713 2936996657 Bacteria 6298727
1173 2937027285 2937023124 Bacteria 6815156
1174 2937033392 2937029754 Bacteria 6424026
1175 2937038430 2937036028 Bacteria 6846469
1176 2937057920 2937056579 Bacteria 7107896
1177 2937065268 2937063883 Bacteria 7199456
1178 2937080638 2937078374 Bacteria 6610289
1179 2937091302 2937084907 Bacteria 6618516
1180 2937107810 2937106411 Bacteria 6947143
1181 2937117732 2937113482 Bacteria 6505872
1182 2941504743 2941499720 Bacteria 7599444
1183 2957380749 2957375807 Bacteria 6425588
1184 2957388538 2957382221 Bacteria 6737050
1185 2957394719 2957388812 Bacteria 6778072
1186 2957397202 2957395598 Bacteria 6822399
1187 2957419003 2957415311 Bacteria 6991633
1188 2957439498 2957437181 Bacteria 6568994
1189 2957445568 2957443900 Bacteria 6869977
1190 2957458737 2957457609 Bacteria 6967680
1191 2957493014 2957491536 Bacteria 6695180
1192 2960594073 2960591022 Bacteria 6622873
1193 2960613155 2960610863 Bacteria 6691244
1194 2960619824 2960617483 Bacteria 6727748
1195 2960625678 2960624210 Bacteria 6875384
1196 2960635574 2960631154 Bacteria 6732508
1197 2960656473 2960652885 Bacteria 7083688
1198 2960663037 2960660292 Bacteria 7041660
1199 2960668053 2960667422 Bacteria 6763020
1200 2960680865 2960680706 Bacteria 6624464
1201 2960688149 2960687367 Bacteria 6535474
1202 2960697323 2960693952 Bacteria 6749742
1203 2964608786 2964607997 Bacteria 7101408
1204 2964618122 2964615318 Bacteria 6809089
1205 2964700139 2964698721 Bacteria 6765331
1206 2964717665 2964712639 Bacteria 6695970
1207 2967689272 2967686174 Bacteria 6678622
1208 2967699529 2967693043 Bacteria 6804451
1209 2967729439 2967728569 Bacteria 6641507
1210 2967759706 2967755722 Bacteria 6814706
1211 2970028070 2970026789 Bacteria 6785236
1212 2970036924 2970033650 Bacteria 7118744
1213 2970042119 2970040964 Bacteria 6731123
1214 2970053661 2970047711 Bacteria 7088379
1215 2970073586 2970068827 Bacteria 7123112
1216 2970078523 2970076120 Bacteria 6697332
1217 2970087450 2970082768 Bacteria 6183754
1218 2970104023 2970102677 Bacteria 6812532
1219 2970126101 2970122695 Bacteria 6625855
1220 2970132045 2970129317 Bacteria 6806560
1221 2970147266 2970143518 Bacteria 6446480
1222 2970181162 2970177841 Bacteria 6768001
1223 2977523195 2977516862 Bacteria 6940108
1224 2977524746 2977523885 Bacteria 6960446
1225 2977536454 2977530762 Bacteria 6951399
1226 2977550416 2977544691 Bacteria 6875412
1227 2977572717 2977565890 Bacteria 6901543
1228 2978971891 2978969890 Bacteria 5400756
1229 2979092021 2979089926 Bacteria 5670289
1230 2979100590 2979095461 Bacteria 5669583
1231 2979104078 2979100975 Bacteria 5423623
1232 2984511351 2984509177 Bacteria 5274802
1233 2984522288 2984518228 Bacteria 5277463
1234 2984541590 2984537506 Bacteria 5277481
1235 2984590176 2984587000 Bacteria 5263363
1236 2984603863 2984601300 Bacteria 5455244
1237 2989350047 2989349275 Bacteria 6349068
1238 2989776011 2989771324 Bacteria 5605128
1239 2989779454 2989776772 Bacteria 4843317
1240 2995396008 2995392953 Bacteria 4539380
1241 2996892826 2996887358 Bacteria 5795980
1242 2996894929 2996893221 Bacteria 5823108
1243 3000018609 3000017691 Bacteria 3772574
1244 3003934460 3003930520 Bacteria 5667563
1245 3005414349 3005409236 Bacteria 7188837
1246 3005418973 3005416602 Bacteria 7064308
1247 3005448663 3005445848 Bacteria 6906074
1248 3005454901 3005452660 Bacteria 5889319
1249 639649392 639633055 Bacteria 7751309
1250 643826545 643692032 Bacteria 6891900
1251 650740719 650716007 Bacteria 5573770
1252 8003571793 8003570095 Bacteria 5747666
1253 8003994383 8003992118 Bacteria 7266902
1254 8004002081 8003999396 Bacteria 7063185
1255 8005249937 8005246636 Bacteria 4933972
1256 8005259407 8005258706 Bacteria 6184835
1257 8005284604 8005282627 Bacteria 6675747
1258 8005295727 8005289223 Bacteria 6634003
1259 8005303339 8005301065 Bacteria 6614431
1260 8005309608 8005307578 Bacteria 7395396
1261 8005318135 8005314921 Bacteria 7072929
1262 8005327353 8005321885 Bacteria 5795980
1263 8005381143 8005376324 Bacteria 6590079
1264 8005388903 8005382845 Bacteria 6732062
1265 8005395887 8005395548 Bacteria 6806915
1266 8005437494 8005430974 Bacteria 6689030
1267 8005488988 8005484373 Bacteria 6297373
1268 8005501108 8005497431 Bacteria 6477605
1269 8005545906 8005542996 Bacteria 7077758
1270 8005561435 8005556819 Bacteria 6908598
1271 8005568213 8005563573 Bacteria 7153261
1272 8005573247 8005570704 Bacteria 6957481
1273 8005622475 8005619151 Bacteria 7030230
1274 8005629977 8005626139 Bacteria 6534237
1275 8005646067 8005645114 Bacteria 6950293
1276 8005658852 8005658619 Bacteria 4500593
1277 8005672526 8005668836 Bacteria 6953162
1278 8005682681 8005682033 Bacteria 6726518
1279 8005691889 8005688590 Bacteria 6610080
1280 8005697623 8005695170 Bacteria 6912330
1281 8018127990 8018127388 Bacteria 7351159
1282 8018151344 8018150411 Bacteria 5549903
1283 8018164355 8018163183 Bacteria 7277977
1284 8023682952 8023680758 Bacteria 7729763
1285 8024482647 8024479707 Bacteria 6954785
1286 8024488252 8024486573 Bacteria 6540512
1287 8024504646 8024501048 Bacteria 6427847
1288 8045865571 8045864390 Bacteria 5043873
1289 8046771734 8046767195 Bacteria 7547379
1290 8049295515 8049293176 Bacteria 6128433
1291 8054463141 8054460903 Bacteria 4872905
1292 8054562192 8054558443 Bacteria 5204801
1293 8055432393 8055431914 Bacteria 4551896
1294 8055910564 8055909800 Bacteria 7278581
1295 8056378352 8056375014 Bacteria 7006639
1296 8056384206 8056382006 Bacteria 6408074
1297 8056875761 8056875544 Bacteria 4355797
1298 8057103362 8057101203 Bacteria 5034064
1299 8057575488 8057575449 Bacteria 7367519
1300 8057879873 8057874678 Bacteria 7494653
1301 Ga0070669_100260722
1302 JGI24740J21852_10003638
1303 JGI24739J22299_10033117
1304 JGI25155J39150_1000014
1305 JGI25156J39149_1000037
1306 JGI25156J39149_1000079
1307 JGI25162J39368_1000497
1308 JGI25162J39368_1000992
1309 JGI25154J39366_1000052
1310 JGI25158J39367_1000499
1311 JGI25157J39369_1000040
1312 JGI25152J39213_1001025
1313 JGI25152J39213_1002772
1314 JGI25152J39213_1004429
1315 JGI25152J39213_1020840
1316 JGI25152J39213_1029794
1317 JGI25150J39212_1000088
1318 JGI25150J39212_1015270
1319 JGI25150J39212_1027871
1320 JGI25159J45721_1000004
1321 JGI25159J45721_1001399
1322 JGI25159J45721_1006965
1323 JGI25151J46595_10000215
1324 JGI25151J46595_10000280
1325 JGI25151J46595_10005849
1326 JGI25151J46595_10006069
1327 JGI25151J46595_10024325
1328 JGI25151J46595_10024843
1329 JGI25151J46595_10038793
1330 JGI25151J46595_10052475
1331 JGI25151J46595_10065287
1332 JGI25151J46595_10129791
1333 JGI25406J46586_10003554
1334 JGI25165J46597_1000371
1335 JGI25165J46597_1000462
1336 JGI25165J46597_1005670
1337 JGI25153J46596_10001244
1338 JGI25153J46596_10007382
1339 JGI25153J46596_10017172
1340 JGI25153J46596_10032466
1341 rootH1_10177570
1342 JGI25160J50197_1000001
1343 JGI25160J50197_1000021
1344 JGI25160J50197_1001207
1345 JGI25160J50197_1011565
1346 JGI25160J50197_1022474
1347 JGI25161J50226_1000001
1348 JGI25161J50226_1000283
1349 JGI25161J50226_1000307
1350 JGI25161J50226_1016692
1351 Ga0006562J51391_1004630
1352 Ga0006562J51391_1004633
1353 Ga0055525_1019223
1354 Ga0055529_1005549
1355 Ga0055526_1001084
1356 Ga0055526_1002599
1357 Ga0055526_1004226
1358 Ga0055526_1013834
1359 Ga0055526_1042781
1360 Ga0055524_1002465
1361 Ga0055524_1004489
1362 Ga0055524_1004911
1363 Ga0055524_1009251
1364 Ga0055524_1011052
1365 Ga0055524_1021006
1366 Ga0055524_1025442
1367 Ga0055524_1074924
1368 Ga0055536_1003481
1369 Ga0055536_1009272
1370 Ga0055528_1000549
1371 Ga0055528_1001077
1372 Ga0055528_1009596
1373 Ga0055528_1025209
1374 Ga0055528_1036530
1375 Ga0055530_10007952
1376 Ga0055540_1000766
1377 Ga0055540_1005952
1378 Ga0055540_1011443
1379 Ga0055540_1033758
1380 Ga0055540_1046310
1381 Ga0055531_10002883
1382 Ga0055531_10028376
1383 Ga0058692_1010152
1384 Ga0058692_1010285
1385 Ga0055543_1000003
1386 Ga0055543_1000060
1387 Ga0055543_1000311
1388 Ga0055543_1000705
1389 Ga0065165_1000008
1390 Ga0065165_1000033
1391 Ga0065165_1007477
1392 Ga0065165_1012806
1393 Ga0065165_1033757
1394 Ga0065165_1081691
1395 Ga0070682_100162700
1396 Ga0070689_101665527
1397 Ga0070668_100310520
1398 Ga0070668_100394043
1399 Ga0070668_101312432
1400 Ga0070669_100105433
1401 Ga0070669_100329913
1402 Ga0070671_100455684
1403 Ga0070674_100695063
1404 Ga0070667_100031464
1405 Ga0070667_100781626
1406 Ga0070708_100296775
1407 Ga0070663_100067010
1408 Ga0070706_100046586
1409 Ga0070698_100036273
1410 Ga0070699_100110489
1411 Ga0068853_100035919
1412 Ga0070672_101009375
1413 Ga0070686_100138518
1414 Ga0070665_100002486
1415 Ga0070665_100070536
1416 Ga0070665_100172205
1417 Ga0070665_100582613
1418 Ga0070665_100693459
1419 Ga0070665_100800135
1420 Ga0068855_100727602
1421 Ga0068854_100069462
1422 Ga0068856_100224261
1423 Ga0068856_100251105
1424 Ga0068851_10068800
1425 Ga0081455_10000538
1426 Ga0081455_10019611
1427 Ga0081539_10000572
1428 Ga0075365_10002452
1429 Ga0075365_10017736
1430 Ga0075365_10068903
1431 Ga0075365_10356132
1432 Ga0075368_10041228
1433 Ga0075363_100123831
1434 Ga0075363_100185340
1435 Ga0075363_100483201
1436 Ga0075364_10002108
1437 Ga0075364_10024817
1438 Ga0075364_10030331
1439 Ga0075364_10099563
1440 Ga0075364_10466317
1441 Ga0075364_10585114
1442 Ga0075362_10000446
1443 Ga0075362_10050960
1444 Ga0075362_10383312
1445 Ga0075367_10005571
1446 Ga0075367_10047982
1447 Ga0075367_10199637
1448 Ga0075367_10312320
1449 Ga0075367_10334879
1450 Ga0075367_10371372
1451 Ga0075369_10010204
1452 Ga0075369_10021611
1453 Ga0075369_10035009
1454 Ga0075369_10060746
1455 Ga0075369_10061641
1456 Ga0075366_10003015
1457 Ga0075366_10122371
1458 Ga0075370_10045499
1459 Ga0075370_10243232
1460 Ga0075370_10272640
1461 Ga0075430_100226040
1462 Ga0075431_100006441
1463 Ga0075429_100055477
1464 Ga0068865_100639961
1465 Ga0068865_100989888
1466 Ga0075436_100176072
1467 Ga0079104_1000884
1468 Ga0079104_1002263
1469 Ga0099826_10010998
1470 Ga0099795_10351282
1471 Ga0105251_10006266
1472 Ga0105244_10117156
1473 Ga0105244_10134460
1474 Ga0105250_10044154
1475 Ga0105240_10000014
1476 Ga0105240_10607559
1477 Ga0105240_10819328
1478 Ga0111539_10260506
1479 Ga0105247_10202228
1480 Ga0114129_10003089
1481 Ga0105243_10012270
1482 Ga0105243_11125546
1483 Ga0105241_10668404
1484 Ga0105248_10001790
1485 Ga0105248_10019194
1486 Ga0105237_10003542
1487 Ga0105237_10268463
1488 Ga0105238_10089717
1489 Ga0105238_10470719
1490 Ga0105238_10596547
1491 Ga0105238_12071368
1492 Ga0105249_11610098
1493 Ga0123341_1000112
1494 Ga0123341_1065565
1495 Ga0123342_1010951
1496 Ga0123342_1016639
1497 Ga0099796_10100096
1498 Ga0105239_10000973
1499 Ga0105239_11650850
1500 Ga0157322_1002866
1501 Ga0157314_1015773
1502 Ga0157373_10013476
1503 Ga0157373_10018335
1504 Ga0157373_10062061
1505 Ga0157371_10000017
1506 Ga0157371_10029204
1507 Ga0157370_10000327
1508 Ga0157370_10000616
1509 Ga0157370_10767920
1510 Ga0157369_10221130
1511 Ga0157369_10223647
1512 Ga0157369_10432196
1513 Ga0157369_10661356
1514 Ga0157369_10718552
1515 Ga0171463_1007
1516 Ga0163162_10328425
1517 Ga0182008_10017060
1518 Ga0182007_10002083
1519 Ga0182005_1001327
1520 Ga0183363_1049
1521 Ga0163161_10941000
1522 Ga0214544_1000110
1523 Ga0214542_1000268
1524 Ga0214542_1013594
1525 Ga0214543_1000022
1526 Ga0214543_1000219
1527 Ga0213872_10033273
1528 Ga0213876_10003111
1529 Ga0213876_10199775
1530 Ga0213875_10002041
1531 Ga0213871_10060080
1532 Ga0228711_1000026
1533 Ga0228710_1000005
1534 Ga0209435_100027
1535 Ga0209760_105271
1536 Ga0209436_100061
1537 Ga0209436_100422
1538 Ga0209436_109886
1539 Ga0209672_115973
1540 Ga0209563_104435
1541 Ga0209437_100051
1542 Ga0209437_100060
1543 Ga0207425_1000432
1544 Ga0207425_1004652
1545 Ga0207425_1004982
1546 Ga0207425_1017504
1547 Ga0209646_1000086
1548 Ga0209026_1000082
1549 Ga0209677_100273
1550 Ga0209148_1000588
1551 Ga0209148_1009991
1552 Ga0209759_1000063
1553 Ga0209129_1000029
1554 Ga0209129_1000307
1555 Ga0209129_1000433
1556 Ga0209129_1001238
1557 Ga0209129_1003217
1558 Ga0209129_1006305
1559 Ga0209129_1006840
1560 Ga0209129_1028875
1561 Ga0209233_1000095
1562 Ga0209233_1000190
1563 Ga0209233_1000228
1564 Ga0209565_1023059
1565 Ga0209565_1024878
1566 Ga0209455_1000334
1567 Ga0209673_1000010
1568 Ga0209673_1000025
1569 Ga0209673_1000112
1570 Ga0209673_1000858
1571 Ga0209673_1003176
1572 Ga0209673_1003674
1573 Ga0209673_1006098
1574 Ga0209673_1013587
1575 Ga0209673_1030287
1576 Ga0209130_1000003
1577 Ga0209130_1000017
1578 Ga0209130_1000020
1579 Ga0209130_1042962
1580 Ga0209675_1049955
1581 Ga0209676_1000197
1582 Ga0209676_1005472
1583 Ga0209676_1009017
1584 Ga0209676_1034629
1585 Ga0209676_1066449
1586 Ga0209025_1000070
1587 Ga0209025_1000091
1588 Ga0209025_1000154
1589 Ga0209025_1000161
1590 Ga0209025_1000171
1591 Ga0209025_1000927
1592 Ga0209025_1002842
1593 Ga0209025_1007846
1594 Ga0209025_1011929
1595 Ga0209025_1014918
1596 Ga0209025_1028907
1597 Ga0209025_1035289
1598 Ga0209564_1000013
1599 Ga0209564_1000265
1600 Ga0209564_1000607
1601 Ga0209564_1001968
1602 Ga0209564_1008091
1603 Ga0209564_1012456
1604 Ga0209564_1025637
1605 Ga0209758_1000058
1606 Ga0209758_1000094
1607 Ga0209758_1000671
1608 Ga0209758_1005284
1609 Ga0209758_1012944
1610 Ga0209758_1013086
1611 Ga0209758_1019706
1612 Ga0209758_1020944
1613 Ga0209758_1036138
1614 Ga0209758_1043460
1615 Ga0209050_1002996
1616 Ga0209050_1005559
1617 Ga0209050_1005667
1618 Ga0209256_1000153
1619 Ga0209256_1000381
1620 Ga0209256_1000655
1621 Ga0209256_1001163
1622 Ga0209256_1002016
1623 Ga0209256_1004610
1624 Ga0209256_1019160
1625 Ga0209256_1031417
1626 Ga0209256_1033906
1627 Ga0207426_1000006
1628 Ga0207426_1000008
1629 Ga0207426_1000011
1630 Ga0207426_1000344
1631 Ga0207426_1001833
1632 Ga0209051_1001157
1633 Ga0209051_1001614
1634 Ga0209051_1014703
1635 Ga0209051_1019573
1636 Ga0209051_1052327
1637 Ga0209051_1109753
1638 Ga0209257_1002974
1639 Ga0209257_1008365
1640 Ga0209257_1013242
1641 Ga0209257_1015197
1642 Ga0207696_1096477
1643 Ga0207655_1139394
1644 Ga0207713_1047877
1645 Ga0207707_10502268
1646 Ga0207707_11428980
1647 Ga0207695_10000037
1648 Ga0207695_10117657
1649 Ga0207695_10211115
1650 Ga0207695_10631791
1651 Ga0207695_10920776
1652 Ga0207671_10000271
1653 Ga0207671_10210143
1654 Ga0207649_11356407
1655 Ga0207652_10291240
1656 Ga0207681_10683505
1657 Ga0207694_10002909
1658 Ga0207694_10498678
1659 Ga0207694_10518221
1660 Ga0207650_10000911
1661 Ga0207650_10078116
1662 Ga0207659_10146647
1663 Ga0207644_10071576
1664 Ga0207706_10231682
1665 Ga0207706_10439739
1666 Ga0207704_10550465
1667 Ga0207691_10279013
1668 Ga0207711_10009012
1669 Ga0207711_10231808
1670 Ga0207668_10068654
1671 Ga0207668_10498133
1672 Ga0207668_11110420
1673 Ga0207640_10052246
1674 Ga0207640_10198771
1675 Ga0207658_10627719
1676 Ga0207639_10027841
1677 Ga0207678_10053726
1678 Ga0207702_10877792
1679 Ga0207702_11820460
1680 Ga0207698_10314980
1681 Ga0209281_1000034
1682 Ga0209281_1000082
1683 Ga0209371_1000022
1684 Ga0209371_1000892
1685 Ga0209371_1006087
1686 Ga0209282_1000006
1687 Ga0209282_1007756
1688 Ga0209282_1030375
1689 Ga0209588_1077228
1690 Ga0209813_10007851
1691 Ga0268266_10003490
1692 Ga0268266_10003866
1693 Ga0268266_10075098
1694 Ga0268266_10691014
1695 Ga0268266_11364684
1696 Ga0268266_11814705
1697 Ga0307515_10000017
1698 Ga0307515_10046209
1699 Ga0307515_10069935
1700 Ga0268256_1000019
1701 Ga0268256_1006062
1702 Ga0268256_1026482
1703 Ga0316181_1138338
1704 Ga0265328_10000189
1705 Ga0265327_10002688
1706 Ga0265327_10049111
1707 Ga0307513_10015439
1708 Ga0307513_10057743
1709 Ga0307408_100259728
1710 Ga0307408_100551394
1711 Ga0265342_10295511
1712 Ga0316576_10760265
1713 Ga0307405_10002746
1714 Ga0307405_10103915
1715 Ga0307410_10192518
1716 Ga0307406_10740705
1717 Ga0307412_10002363
1718 Ga0307412_10114024
1719 Ga0307412_10259515
1720 Ga0307412_10981645
1721 Ga0315914_1000003
1722 Ga0307409_100821542
1723 Ga0307416_100299293
1724 Ga0307416_100495718
1725 Ga0307414_10076304
1726 Ga0307414_10329742
1727 Ga0307414_10963431
1728 Ga0307414_11179505
1729 Ga0307411_10905437
1730 Ga0315913_1000001
1731 Ga0315915_1000008
1732 Ga0373945_0483619
1733 Ga0373943_0074066
1734 Ga0373943_0347105
1735 Ga0373935_0010890
1736 Ga0373927_0000856
1737 Ga0373927_0849305
1738 Ga0373925_0002516
1739 Ga0395899_0032746
1740 Ga0395899_0037181
1741 Ga0395899_0040984
1742 Ga0395899_0189558
1743 Ga0395900_0079907
1744 Ga0395900_0102233
1745 Ga0395898_0009045
1746 Ga0395898_0019247
1747 Ga0436364_1142809
1748 Ga0395901_0276823
1749 Ga0395901_0331860
1750 Ga0395901_0689569
1751 Ga0400483_144045
1752 Ga0400483_213761
1753 Ga0436365_0243032
1754 Ga0436365_0990465
1755 Ga0436360_1052595
1756 Ga0436361_0187853
1757 Ga0436361_0507050
1758 Ga0436361_0972763
1759 Ga0436361_1031687
1760 Ga0436363_1027101
1761 Ga0436363_1351969
1762 Ga0436362_0783924
1763 Ga0439436_0019882
1764 Ga0439438_016435
1765 Ga0439438_017366
1766 Ga0439466_0070031
1767 Ga0439465_0008508
1768 Ga0439465_0165332
1769 Ga0451787_502609
1770 Ga0451789_1281455
1771 Ga0451795_0335541
1772 Ga0451835_0255768
1773 Ga0451837_0676541
1774 Ga0451837_0772324
1775 Ga0451840_15734
1776 Ga0451846_31201
1777 Ga0451847_0188909
1778 Ga0451851_0267608
1779 Ga0451851_0872605
1780 Ga0451854_30980
1781 Ga0451855_1076083
1782 Ga0439433_0097097
1783 Ga0439449_0004055
1784 Ga0439449_0017852
1785 Ga0439451_016516
1786 Ga0450920_010616
1787 Ga0450909_003686
1788 Ga0439434_0047458
1789 Ga0450918_010663
1790 Ga0466965_0694794
1791 Ga0466966_0370726
1792 Ga0466968_0015577
1793 Ga0466970_0218295
1794 Ga0466957_0017737
1795 Ga0466960_0232709
1796 Ga0451576_0002083
1797 Ga0451576_2052736
1798 Ga0495627_051123
1799 Ga0495627_093648
1800 Ga0495590_0016051
1801 Ga0495638_0001134
1802 Ga0495638_0080821
1803 Ga0495651_0140785
1804 Ga0495650_0045284
1805 Ga0495605_0099468
1806 Ga0495662_0009811
1807 Ga0495585_0060355
1808 Ga0495596_0027893
1809 Ga0495607_0010334
1810 Ga0495607_0046074
1811 Ga0495583_0035078
1812 Ga0495583_0053761
1813 Ga0495606_0004697
1814 Ga0495606_0007767
1815 Ga0495606_0039286
1816 Ga0495606_0112977
1817 Ga0495610_0003664
1818 Ga0495610_0031382
1819 Ga0495610_0139763
1820 Ga0495616_0022251
1821 Ga0495618_0210505
1822 Ga0495620_0026792
1823 Ga0495620_0359990
1824 Ga0495630_0837281
1825 Ga0495631_0001584
1826 Ga0495632_0003362
1827 Ga0495632_0009886
1828 Ga0495632_0041708
1829 Ga0495632_0081744
1830 Ga0495632_0108233
1831 Ga0495643_0031297
1832 Ga0495643_0066465
1833 Ga0495648_0029469
1834 Ga0495648_0161935
1835 Ga0495663_0018272
1836 Ga0495642_0201478
1837 Ga0495654_0001572
1838 Ga0495654_0011933
1839 Ga0495654_0198712
1840 Ga0495609_0026854
1841 Ga0495597_0029591
1842 Ga0495622_0042615
1843 Ga0495633_0041073
1844 Ga0495633_0048871
1845 Ga0495633_0265304
1846 Ga0495656_0014314
1847 Ga0495668_0009467
1848 Ga0495668_0012948
1849 Ga0495668_0101874
1850 Ga0495611_0013882
1851 Ga0495611_0020130
1852 Ga0495625_0002255
1853 Ga0495625_0049809
1854 Ga0495625_0068316
1855 Ga0495625_0100585
1856 Ga0495625_0126598
1857 Ga0495588_0001571
1858 Ga0495588_0067742
1859 Ga0495670_0012039
1860 Ga0495671_0065310
1861 Ga0495600_0026201
1862 Ga0495660_0004669
1863 Ga0495604_0097972
1864 Ga0495636_0047809
1865 Ga0495672_0005525
1866 Ga0495683_0049570
1867 Ga0495681_0013102
1868 Ga0495681_0049184
1869 Ga0495681_0278580
1870 Ga0495686_0001486
1871 Ga0495686_0010881
1872 Ga0495686_0011361
1873 Ga0495686_0021709
1874 Ga0495686_0200319
1875 Ga0495686_0213564
1876 Ga0495686_0322597
1877 Ga0495626_0024583
1878 Ga0496100_1297634
1879 Ga0496102_1292316
1880 Ga0496105_0022766
1881 Ga0496105_0070505
1882 Ga0496105_0338339
1883 Ga0496106_0006078
1884 Ga0496106_0218120
1885 Ga0496110_0046395
1886 Ga0496110_0252786
1887 Ga0496111_0029761
1888 Ga0496112_0017743
1889 Ga0496112_0803831
1890 Ga0496113_0040908
1891 Ga0496115_0695078
1892 Ga0496116_0000105
1893 Ga0496116_0007168
1894 Ga0496116_0008842
1895 Ga0496116_0023634
1896 Ga0496116_0031594
1897 Ga0496116_0031701
1898 Ga0496116_0047753
1899 Ga0496116_0052894
1900 Ga0496116_0083429
1901 Ga0496117_0000002
1902 Ga0496117_0005967
1903 Ga0496117_0010221
1904 Ga0496117_0017552
1905 Ga0496117_0031122
1906 Ga0496117_0066513
1907 Ga0496117_0156739
1908 Ga0496118_0000566
1909 Ga0496118_0001151
1910 Ga0496118_0008628
1911 Ga0496118_0017174
1912 Ga0496118_0034028
1913 Ga0496118_0075392
1914 Ga0496118_0104617
1915 Ga0496118_0141386
1916 Ga0496119_0007422
1917 Ga0496119_0024620
1918 Ga0496119_0035300
1919 Ga0496119_0071800
1920 Ga0496119_0109266
1921 Ga0496119_0141554
1922 Ga0496120_0000309
1923 Ga0496120_0023586
1924 Ga0496120_0044995
1925 Ga0496120_0070685
1926 Ga0496120_0092898
1927 Ga0496121_0000003
1928 Ga0496121_0003780
1929 Ga0496121_0009804
1930 Ga0496121_0012638
1931 Ga0496121_0019047
1932 Ga0496121_0076734
1933 Ga0496121_0081685
1934 Ga0496121_0155671
1935 Ga0496121_0248290
1936 Ga0496122_0000004
1937 Ga0496122_0000157
1938 Ga0496122_0000464
1939 Ga0496122_0010069
1940 Ga0496122_0034634
1941 Ga0496122_0038124
1942 Ga0496122_0041265
1943 Ga0496122_0048776
1944 Ga0496122_0063672
1945 Ga0496122_0122766
1946 Ga0496122_0174327
1947 Ga0496122_0175306
1948 Ga0496123_0000007
1949 Ga0496123_0000048
1950 Ga0496123_0000147
1951 Ga0496123_0007075
1952 Ga0496123_0014048
1953 Ga0496123_0015923
1954 Ga0496123_0024343
1955 Ga0496123_0027255
1956 Ga0496123_0044556
1957 Ga0496123_0173840
1958 Ga0496123_0294082
1959 Ga0496123_0311236
1960 Ga0496124_0000067
1961 Ga0496124_0002089
1962 Ga0496124_0008090
1963 Ga0496124_0009653
1964 Ga0496124_0029277
1965 Ga0496124_0060523
1966 Ga0496124_0130083
1967 Ga0496124_0132515
1968 Ga0496124_0169676
1969 Ga0496124_0196392
1970 Ga0496124_0211242
1971 Ga0496124_0230418
1972 Ga0496124_0238957
1973 Ga0496124_0273913
1974 Ga0496124_0305280
1975 Ga0496125_0000441
1976 Ga0496125_0000786
1977 Ga0496125_0000848
1978 Ga0496125_0009794
1979 Ga0496125_0014106
1980 Ga0496125_0014581
1981 Ga0496125_0050143
1982 Ga0496125_0135179
1983 Ga0496125_0255670
1984 Ga0496125_0356085
1985 Ga0496125_0491740
1986 Ga0496126_0000188
1987 Ga0496126_0060889
1988 Ga0496126_0302042
1989 Ga0496126_0526382
1990 Ga0496126_0531684
1991 Ga0496126_0852853
1992 Ga0495678_066512
1993 Ga0495682_0011491
1994 Ga0501031_0099971
1995 Ga0501032_0187945
1996 Ga0501033_0000365
1997 Ga0501033_0150020
1998 Ga0501033_0183076
1999 Ga0501034_0001020
2000 Ga0501034_0191769
2001 Ga0501034_0327128
2002 Ga0501034_0648779
2003 Ga0501036_0031089
2004 Ga0501036_1004531
2005 Ga0501037_0066214
2006 Ga0501037_0515409
2007 Ga0501038_0020981
2008 Ga0501040_0034092
2009 Ga0501041_0162692
2010 Ga0501042_0162443
2011 Ga0501043_0216218
2012 Ga0501043_0419576
2013 Ga0501046_0028941
2014 Ga0501047_0221955
2015 Ga0501047_0255272
2016 Ga0501048_0025595
2017 Ga0501067_0065314
2018 Ga0501068_0288358
2019 Ga0501068_0309858
2020 Ga0501070_1196288
2021 Ga0501071_0046594
2022 Ga0501074_0005267
2023 Ga0501075_0195777
2024 Ga0501076_0056877
2025 Ga0501077_0084373
2026 Ga0501079_0057880
2027 Ga0501080_0232366
2028 Ga0501080_0310242
2029 Ga0501080_0426430
2030 Ga0501080_0460058
2031 Ga0501081_0001100
2032 Ga0501280_001764
2033 Ga0501280_052361
2034 Ga0501280_053158
2035 Ga0501035_0001622
2036 Ga0501044_0109786
2037 Ga0501044_0590104
2038 Ga0501044_1392044
2039 Ga0501045_0045776
2040 nmdc:mga03683_106140_c1
2041 nmdc:mga03683_240320_c1
2042 nmdc:mga03683_53915_c1
2043 nmdc:mga03683_858_c1
2044 nmdc:mga03683_8607_c2
2045 nmdc:mga03n38_376232_c1
2046 nmdc:mga03n38_48518_c1
2047 nmdc:mga03n38_582808_c1
2048 nmdc:mga00v17_180_c1
2049 nmdc:mga00v17_209459_c1
2050 nmdc:mga00v17_414573_c1
2051 nmdc:mga00v17_443299_c1
2052 nmdc:mga00v17_824_c1
2053 nmdc:mga00v17_983886_c1
2054 nmdc:mga0yw44_1405_c1
2055 nmdc:mga0yw44_192004_c1
2056 nmdc:mga0yw44_31619_c1
2057 nmdc:mga0yw44_865_c1
2058 nmdc:mga0k408_21083_c1
2059 nmdc:mga0k408_63710_c1
2060 nmdc:mga06z11_196570_c1
2061 nmdc:mga06z11_285710_c1
2062 nmdc:mga06z11_424021_c1
2063 nmdc:mga07m45_40428_c1
2064 nmdc:mga05p37_169637_c1
2065 nmdc:mga05p37_181727_c1
2066 nmdc:mga0qj67_357762_c1
2067 nmdc:mga06r32_179582_c1
2068 nmdc:mga06r32_954463_c1
2069 nmdc:mga08y16_453561_c1
2070 nmdc:mga08x19_237661_c1
2071 nmdc:mga0sz30_235323_c1
2072 nmdc:mga0sz30_260587_c1
2073 nmdc:mga0sz30_4354_c1
2074 nmdc:mga0sz30_7993_c1
2075 nmdc:mga0sz30_802_c1
2076 nmdc:mga0sz30_84103_c1
2077 Ga0500610_0022183
2078 Ga0495619_0039700
2079 Ga0500578_0448500
2080 Ga0500578_0459078
2081 Ga0500643_006663
2082 Ga0500644_0011388
2083 Ga0500644_0157381
2084 Ga0500646_0268453
2085 Ga0500647_0108906
2086 Ga0500583_0343685
2087 Ga0500651_0345810
2088 Ga0500557_000501
2089 Ga0500569_002896
2090 Ga0500569_008858
2091 Ga0500569_155755
2092 Ga0500572_003731
2093 Ga0500594_0003894
2094 Ga0500607_180670
2095 Ga0500608_052883
2096 Ga0500618_000849
2097 Ga0500618_015687
2098 Ga0500618_041237
2099 Ga0500642_0256169
2100 Ga0500658_0000206
2101 Ga0500658_0011557
2102 Ga0500561_0002494
2103 Ga0500568_0001714
2104 Ga0500568_0003195
2105 Ga0500573_0018797
2106 Ga0500588_0000807
2107 Ga0500590_002837
2108 Ga0500616_0000309
2109 Ga0500616_0000576
2110 Ga0500616_0002766
2111 Ga0500616_0267263
2112 Ga0500616_0294343
2113 Ga0500620_007914
2114 Ga0500622_0003878
2115 Ga0500624_000308
2116 Ga0500624_087080
2117 Ga0500634_0013063
2118 Ga0500634_0181681
2119 Ga0500636_0000003
2120 Ga0500636_0000840
2121 Ga0500637_0093605
2122 Ga0500609_029468
2123 Ga0501084_0009756
2124 Ga0587080_061273
2125 Ga0587090_011104
2126 Ga0587068_011069
2127 Ga0587069_012415
2128 Ga0587072_018780
2129 Ga0501082_0017190
2130 Ga0530510_0034914
2131 2509108157
2132 2509376667
2133 2509391816
2134 2509447329
2135 2510134167
2136 2510305320
2137 2510841357
2138 2510895604
2139 2511133230
2140 2511172874
2141 2511182484
2142 2511199240
2143 2511502456
2144 2512533834
2145 2512970417
2146 2513567753
2147 2513577164
2148 2513597682
2149 2513601481
2150 2513618150
2151 2513633165
2152 2513707838
2153 2513865913
2154 2513884475
2155 2513904483
2156 2513908555
2157 2513925193
2158 2513983678
2159 2513997692
2160 2514003073
2161 2514018084
2162 2515609251
2163 2515636775
2164 2515646359
2165 2515655125
2166 2515739698
2167 2516206197
2168 2516893832
2169 2517036937
2170 2517077294
2171 2517096052
2172 2517407672
2173 2517570545
2174 2520377042
2175 2524448346
2176 2524458843
2177 2535484901
2178 2535517092
2179 2537876325
2180 2554248393
2181 2558863971
2182 2559295509
2183 2561469275
2184 2585147455
2185 2585167432
2186 2585202005
2187 2585223070
2188 2585228507
2189 2585258284
2190 2585265657
2191 2585271339
2192 2585279278
2193 2585323117
2194 2585331229
2195 2585388862
2196 2585395439
2197 2585400945
2198 2585524722
2199 2585531237
2200 2585538409
2201 2585545653
2202 2585552840
2203 2585559082
2204 2585822152
2205 2585836362
2206 2585843454
2207 2585898463
2208 2585903972
2209 2587980910
2210 2599332003
2211 2599417100
2212 2599601826
2213 2599721594
2214 2600194838
2215 2600374119
2216 2601609918
2217 2601746693
2218 2616293149
2219 2616311445
2220 2616554456
2221 2617384820
2222 2643804208
2223 2643811320
2224 2643856585
2225 2643920175
2226 2643962815
2227 2644007051
2228 2644050245
2229 2644065018
2230 2644105271
2231 2644145653
2232 2644191830
2233 2644204693
2234 2644208797
2235 2644242553
2236 2644288418
2237 2644298895
2238 2644309684
2239 2644331148
2240 2644376573
2241 2644416691
2242 2644449731
2243 2644483165
2244 2644494319
2245 2644497812
2246 2644521796
2247 2644543413
2248 2644616208
2249 2644652327
2250 2644657124
2251 2644675831
2252 2644689863
2253 2657681722
2254 2671111224
2255 2692315293
2256 2719182008
2257 2719666368
2258 2719732725
2259 2720492788
2260 2720614256
2261 2720621024
2262 2720632348
2263 2720776076
2264 2721148099
2265 2721159550
2266 2721164935
2267 2722841105
2268 2723027675
2269 2723561303
2270 2723567926
2271 2724045481
2272 2724090683
2273 2724105191
2274 2724111018
2275 2725951385
2276 2730108611
2277 2730165243
2278 2730299182
2279 2738800309
2280 2738944060
2281 2739033050
2282 2753462350
2283 2758641785
2284 2766066093
2285 2776914177
2286 2778175639
2287 2792581434
2288 2792620588
2289 2792625947
2290 2792638886
2291 2793280117
2292 2793294223
2293 2793315878
2294 2793319389
2295 2793328475
2296 2793335433
2297 2793339485
2298 2793347038
2299 2793351630
2300 2793361926
2301 2793367683
2302 2802716773
2303 2802725585
2304 2802730324
2305 2802737705
2306 2802742906
2307 2802750330
2308 2804752909
2309 2805926861
2310 2805932776
2311 2806045189
2312 2806050016
2313 2806056854
2314 2806064235
2315 2806071503
2316 2808987756
2317 2819241098
2318 2819559224
2319 2819609347
2320 2819641341
2321 2819685145
2322 2821125722
2323 2821447862
2324 2838021666
2325 2838023641
2326 2838033396
2327 2838038693
2328 2838045179
2329 2838053340
2330 2838065460
2331 2838069939
2332 2838079797
2333 2838661385
2334 2838670571
2335 2838675605
2336 2838683238
2337 2838686833
2338 2838697818
2339 2838702942
2340 2838710933
2341 2838714487
2342 2838721712
2343 2838725247
2344 2838730209
2345 2838737827
2346 2838742776
2347 2841841804
2348 2841848696
2349 2841852279
2350 2841862294
2351 2841867168
2352 2842079107
2353 2842113045
2354 2842118383
2355 2842125273
2356 2842130500
2357 2842141582
2358 2842147800
2359 2842154330
2360 2842158319
2361 2842168578
2362 2842170729
2363 2842177950
2364 2842181939
2365 2842187596
2366 2842195848
2367 2842199155
2368 2842209605
2369 2842211907
2370 2842218162
2371 2842226474
2372 2842230066
2373 2842240295
2374 2842243955
2375 2842252866
2376 2842257960
2377 2842269496
2378 2842271629
2379 2842283059
2380 2842285393
2381 2842292769
2382 2842298192
2383 2842305260
2384 2842314010
2385 2842319749
2386 2842348473
2387 2842360208
2388 2842370250
2389 2842373869
2390 2842379166
2391 2842384893
2392 2842402753
2393 2842409876
2394 2842416524
2395 2842423553
2396 2842430502
2397 2842436686
2398 2842443472
2399 2842449342
2400 2842466756
2401 2842471444
2402 2842479938
2403 2842483860
2404 2842492279
2405 2842497861
2406 2842505277
2407 2842514284
2408 2842519078
2409 2842522062
2410 2842777676
2411 2842924338
2412 2844164033
2413 2844458130
2414 2847419648
2415 2848994650
2416 2850081667
2417 2852390469
2418 2854901335
2419 2854912118
2420 2855826557
2421 2855877165
2422 2857517205
2423 2857532283
2424 2858803750
2425 2891089979
2426 2891373572
2427 2894776970
2428 2894817751
2429 2896392101
2430 2899794101
2431 2899806799
2432 2899847747
2433 2913296101
2434 2913313570
2435 2915654079
2436 2915982886
2437 2915989485
2438 2916009195
2439 2916044326
2440 2916050375
2441 2916065458
2442 2916074655
2443 2916078318
2444 2919106244
2445 2919114523
2446 2919169492
2447 2919410207
2448 2920761319
2449 2920762659
2450 2920825475
2451 2921253734
2452 2921261941
2453 2923561083
2454 2924156775
2455 2924196976
2456 2926755538
2457 2926762666
2458 2929141018
2459 2929203319
2460 2933008975
2461 2933014749
2462 2933018204
2463 2933571067
2464 2933588898
2465 2933596430
2466 2933600745
2467 2935896797
2468 2935901739
2469 2936371825
2470 2936379659
2471 2936387829
2472 2937002713
2473 2937027285
2474 2937033392
2475 2937038430
2476 2937057920
2477 2937065268
2478 2937080638
2479 2937091302
2480 2937107810
2481 2937117732
2482 2941504743
2483 2957380749
2484 2957388538
2485 2957394719
2486 2957397202
2487 2957419003
2488 2957439498
2489 2957445568
2490 2957458737
2491 2957493014
2492 2960594073
2493 2960613155
2494 2960619824
2495 2960625678
2496 2960635574
2497 2960656473
2498 2960663037
2499 2960668053
2500 2960680865
2501 2960688149
2502 2960697323
2503 2964608786
2504 2964618122
2505 2964700139
2506 2964717665
2507 2967689272
2508 2967699529
2509 2967729439
2510 2967759706
2511 2970028070
2512 2970036924
2513 2970042119
2514 2970053661
2515 2970073586
2516 2970078523
2517 2970087450
2518 2970104023
2519 2970126101
2520 2970132045
2521 2970147266
2522 2970181162
2523 2977523195
2524 2977524746
2525 2977536454
2526 2977550416
2527 2977572717
2528 2978971891
2529 2979092021
2530 2979100590
2531 2979104078
2532 2984511351
2533 2984522288
2534 2984541590
2535 2984590176
2536 2984603863
2537 2989350047
2538 2989776011
2539 2989779454
2540 2995396008
2541 2996892826
2542 2996894929
2543 3000018609
2544 3003934460
2545 3005414349
2546 3005418973
2547 3005448663
2548 3005454901
2549 639649392
2550 643826545
2551 650740719
2552 8003571793
2553 8003994383
2554 8004002081
2555 8005249937
2556 8005259407
2557 8005284604
2558 8005295727
2559 8005303339
2560 8005309608
2561 8005318135
2562 8005327353
2563 8005381143
2564 8005388903
2565 8005395887
2566 8005437494
2567 8005488988
2568 8005501108
2569 8005545906
2570 8005561435
2571 8005568213
2572 8005573247
2573 8005622475
2574 8005629977
2575 8005646067
2576 8005658852
2577 8005672526
2578 8005682681
2579 8005691889
2580 8005697623
2581 8018127990
2582 8018151344
2583 8018164355
2584 8023682952
2585 8024482647
2586 8024488252
2587 8024504646
2588 8045865571
2589 8046771734
2590 8049295515
2591 8054463141
2592 8054562192
2593 8055432393
2594 8055910564
2595 8056378352
2596 8056384206
2597 8056875761
2598 8057103362
2599 8057575488
2600 8057879873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14489

QueF

QueF-like protein

80

160

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7alc-assembly1.cif.gz_E-2 human gch-gfrp stimulatory complex 0.9161 38 134
5k0p-assembly1.cif.gz_B crystal structure of the archaeosine synthase quef-like in the apo form 0.913 37 137
7alc-assembly1.cif.gz_B-2 human gch-gfrp stimulatory complex 0.9123 40 134
6z88-assembly1.cif.gz_H human gtp cyclohydrolase i in complex with allosteric inhibitor 0.911 38 134
7alc-assembly1.cif.gz_C-2 human gch-gfrp stimulatory complex 0.9103 40 134
ID Description Score Start End Superfamily
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9186 15 136 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8747 36 130 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8552 34 134 3.30.1130.10
af_A0A1D6DUT0_342_468_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8391 40 135 3.30.1130.10
3rzpD02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8291 31 139 3.30.1130.10
ID Description Score Start End GO Terms
AF-Q9RNJ7-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9892 10 119 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A520IJI0-F1-model_v4 PreQ(1) synthase (EC 1.7.1.13) 0.9872 10 116 GO:0005737
GO:0008616
GO:0033739
AF-A0A7U8JXT8-F1-model_v4 deleted 0.9846 7 137
AF-A0A6L7ZVT3-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (EC 1.7.1.13) 0.9839 8 129 GO:0005737
GO:0008616
GO:0033739
AF-A0A5B8XE36-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9837 1 145 GO:0005737
GO:0006400
GO:0008616
GO:0033739

Map