F492804
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1305 | 541 | 2610 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10065248|Ga0070717_100652483 |
| Length | 219 |
| Sequence | VDASDVGADLKDVLIPEERLRARVTELAAQIDADYAGRELLLVGVLKGAVMVMADLARAMHMPVQMDWMAVSSYGSGTRSSGVVRILKDLDTDITGKDVLVIEDIVDSGLTLSWLVGNLRSRGPASVQVCVMLRKPAAIRMDVDVAYTGFDIENEFVVGYGLDYAEKYRNLPFIGTLAPHVYKGEESAETDAEPRTEESAEAPPGRQADPGNRISDEER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 88 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 90 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 93 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 94 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 95 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 137 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 138 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 141 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 142 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 143 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 144 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 146 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 147 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 148 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 149 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 150 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 151 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 152 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 162 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 163 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 164 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 165 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 166 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 167 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 168 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 170 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 176 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 180 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 186 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 193 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 211 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 212 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 213 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 217 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 218 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 219 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 220 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 221 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 222 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 223 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 224 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 225 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 226 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 227 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 228 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 229 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 230 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 231 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 232 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 233 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 334 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 335 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 336 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 337 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 341 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 342 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 345 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 346 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 347 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 348 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 349 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 350 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 389 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 411 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 413 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 414 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 417 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 418 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 419 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 420 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 421 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 422 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 425 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 426 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 427 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 428 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 429 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 430 | 3300053152 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere | Metagenome | Endosphere |
| 431 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 432 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 433 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 434 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 435 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 436 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 437 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 440 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 441 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 442 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 443 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 444 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 445 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 446 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 447 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 448 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 449 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 450 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 451 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 452 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 453 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 454 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 455 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 456 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 457 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 458 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 459 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 460 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 461 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 462 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 463 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 464 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 465 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 466 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 467 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 468 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 469 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 470 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 471 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 472 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 473 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 474 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 475 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 476 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 477 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 478 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 479 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 480 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 481 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 482 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 483 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 484 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 485 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 486 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 487 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 488 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 489 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 490 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 491 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 492 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 493 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 494 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 495 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 496 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 497 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 498 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 499 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 500 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 501 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 502 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 503 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 504 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 505 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 506 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 507 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 508 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 509 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 510 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 511 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 512 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 513 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 514 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 515 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 516 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 517 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 518 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 519 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 520 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 521 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 522 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 523 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 524 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 525 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 526 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 527 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 528 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 529 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 530 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 531 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 532 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 533 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 534 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 535 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 536 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 537 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 538 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 539 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 540 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 541 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.96 |
| Metatranscriptomes | 1.23 |
| Isolates | 7.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.22 |
| Nodule | 0.23 |
| Rhizoplane | 3.45 |
| Rhizosphere | 85.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070717_10065248 | 3300006028 | Bacteria | 3026 |
| 2 | JGI24739J22299_10010829 | 3300001989 | Bacteria | 3377 |
| 3 | JGI24739J22299_10054830 | 3300001989 | Bacteria | 1276 |
| 4 | JGI24735J21928_10082150 | 3300002067 | Bacteria | 923 |
| 5 | JGI24735J21928_10108197 | 3300002067 | Bacteria | 799 |
| 6 | JGI25153J46596_10033766 | 3300003215 | Bacteria | 1683 |
| 7 | rootL2_10055055 | 3300003322 | Bacteria | 1462 |
| 8 | JGI25160J50197_1018765 | 3300003354 | Bacteria | 2143 |
| 9 | Ga0070658_10095112 | 3300005327 | Bacteria | 2459 |
| 10 | Ga0070683_100135277 | 3300005329 | Bacteria | 2333 |
| 11 | Ga0070683_100448463 | 3300005329 | Bacteria | 1231 |
| 12 | Ga0070680_100237792 | 3300005336 | Bacteria | 1539 |
| 13 | Ga0070691_10026742 | 3300005341 | Bacteria | 2690 |
| 14 | Ga0070671_100378328 | 3300005355 | Bacteria | 1210 |
| 15 | Ga0070667_100122393 | 3300005367 | Bacteria | 2264 |
| 16 | Ga0070709_10000303 | 3300005434 | Bacteria | 31301 |
| 17 | Ga0070709_10000658 | 3300005434 | Bacteria | 19667 |
| 18 | Ga0070709_10063183 | 3300005434 | Bacteria | 2364 |
| 19 | Ga0070714_100001285 | 3300005435 | Bacteria | 18158 |
| 20 | Ga0070714_100007011 | 3300005435 | Bacteria | 8736 |
| 21 | Ga0070714_100017017 | 3300005435 | Bacteria | 5883 |
| 22 | Ga0070714_100042447 | 3300005435 | Bacteria | 3843 |
| 23 | Ga0070714_100082975 | 3300005435 | Bacteria | 2793 |
| 24 | Ga0070714_100084104 | 3300005435 | Bacteria | 2776 |
| 25 | Ga0070714_100126586 | 3300005435 | Bacteria | 2278 |
| 26 | Ga0070714_100254436 | 3300005435 | Bacteria | 1625 |
| 27 | Ga0070714_100710830 | 3300005435 | Bacteria | 970 |
| 28 | Ga0070713_100000735 | 3300005436 | Bacteria | 20988 |
| 29 | Ga0070713_100083338 | 3300005436 | Bacteria | 2733 |
| 30 | Ga0070713_100084766 | 3300005436 | Bacteria | 2712 |
| 31 | Ga0070713_100096675 | 3300005436 | Bacteria | 2550 |
| 32 | Ga0070713_100107677 | 3300005436 | Bacteria | 2425 |
| 33 | Ga0070713_101711383 | 3300005436 | Bacteria | 610 |
| 34 | Ga0070710_10002868 | 3300005437 | Bacteria | 8210 |
| 35 | Ga0070711_100001622 | 3300005439 | Bacteria | 12424 |
| 36 | Ga0070711_100002814 | 3300005439 | Bacteria | 9988 |
| 37 | Ga0070711_100042489 | 3300005439 | Bacteria | 3073 |
| 38 | Ga0070711_100104285 | 3300005439 | Bacteria | 2068 |
| 39 | Ga0070711_100270564 | 3300005439 | Bacteria | 1340 |
| 40 | Ga0070711_100493291 | 3300005439 | Bacteria | 1009 |
| 41 | Ga0070708_100254009 | 3300005445 | Bacteria | 1652 |
| 42 | Ga0070663_100207088 | 3300005455 | Bacteria | 1534 |
| 43 | Ga0070663_100474322 | 3300005455 | Bacteria | 1035 |
| 44 | Ga0070678_100236706 | 3300005456 | Bacteria | 1525 |
| 45 | Ga0070681_10115673 | 3300005458 | Bacteria | 2620 |
| 46 | Ga0070681_10182789 | 3300005458 | Bacteria | 2018 |
| 47 | Ga0070706_100001435 | 3300005467 | Bacteria | 25160 |
| 48 | Ga0070706_100005954 | 3300005467 | Bacteria | 11534 |
| 49 | Ga0070706_100038357 | 3300005467 | Bacteria | 4421 |
| 50 | Ga0070706_100291256 | 3300005467 | Bacteria | 1523 |
| 51 | Ga0070706_100409956 | 3300005467 | Bacteria | 1262 |
| 52 | Ga0070707_100000833 | 3300005468 | Bacteria | 30514 |
| 53 | Ga0070707_100019207 | 3300005468 | Bacteria | 6439 |
| 54 | Ga0070707_100023123 | 3300005468 | Bacteria | 5880 |
| 55 | Ga0070707_100398034 | 3300005468 | Bacteria | 1337 |
| 56 | Ga0070698_100000680 | 3300005471 | Bacteria | 36332 |
| 57 | Ga0070698_100001044 | 3300005471 | Bacteria | 30485 |
| 58 | Ga0070698_100041951 | 3300005471 | Bacteria | 4695 |
| 59 | Ga0070698_100051264 | 3300005471 | Bacteria | 4204 |
| 60 | Ga0070699_100044519 | 3300005518 | Bacteria | 3842 |
| 61 | Ga0070699_100359689 | 3300005518 | Bacteria | 1312 |
| 62 | Ga0070699_100667491 | 3300005518 | Bacteria | 949 |
| 63 | Ga0070697_100073899 | 3300005536 | Bacteria | 2800 |
| 64 | Ga0070697_100168505 | 3300005536 | Bacteria | 1853 |
| 65 | Ga0068853_100042399 | 3300005539 | Bacteria | 3891 |
| 66 | Ga0068853_100168810 | 3300005539 | Bacteria | 1978 |
| 67 | Ga0070695_100668750 | 3300005545 | Bacteria | 821 |
| 68 | Ga0070696_100511849 | 3300005546 | Bacteria | 956 |
| 69 | Ga0070665_100073321 | 3300005548 | Bacteria | 3430 |
| 70 | Ga0070665_100093875 | 3300005548 | Bacteria | 3005 |
| 71 | Ga0070665_100172659 | 3300005548 | Bacteria | 2163 |
| 72 | Ga0068855_100110791 | 3300005563 | Bacteria | 3151 |
| 73 | Ga0068855_100207190 | 3300005563 | Bacteria | 2205 |
| 74 | Ga0070664_100358433 | 3300005564 | Bacteria | 1328 |
| 75 | Ga0070664_100893661 | 3300005564 | Bacteria | 833 |
| 76 | Ga0068854_100788008 | 3300005578 | Bacteria | 827 |
| 77 | Ga0068852_100007469 | 3300005616 | Bacteria | 7976 |
| 78 | Ga0068859_100737826 | 3300005617 | Bacteria | 1074 |
| 79 | Ga0068863_100121156 | 3300005841 | Bacteria | 2494 |
| 80 | Ga0068860_100126846 | 3300005843 | Bacteria | 2446 |
| 81 | Ga0081455_10309069 | 3300005937 | Bacteria | 1131 |
| 82 | Ga0081540_1003225 | 3300005983 | Bacteria | 12999 |
| 83 | Ga0081540_1155036 | 3300005983 | Bacteria | 897 |
| 84 | Ga0081539_10066960 | 3300005985 | Bacteria | 1944 |
| 85 | Ga0070717_10004476 | 3300006028 | Bacteria | 10099 |
| 86 | Ga0070717_10114967 | 3300006028 | Bacteria | 2299 |
| 87 | Ga0070717_10123979 | 3300006028 | Bacteria | 2216 |
| 88 | Ga0075365_10230197 | 3300006038 | Bacteria | 1301 |
| 89 | Ga0075363_100066381 | 3300006048 | Bacteria | 1953 |
| 90 | Ga0070715_10038014 | 3300006163 | Bacteria | 1996 |
| 91 | Ga0070715_10071889 | 3300006163 | Bacteria | 1547 |
| 92 | Ga0070716_100000094 | 3300006173 | Bacteria | 34515 |
| 93 | Ga0070716_100004007 | 3300006173 | Bacteria | 6992 |
| 94 | Ga0070716_100222343 | 3300006173 | Bacteria | 1269 |
| 95 | Ga0070712_100224202 | 3300006175 | Bacteria | 1489 |
| 96 | Ga0070712_100235700 | 3300006175 | Bacteria | 1455 |
| 97 | Ga0070712_100562509 | 3300006175 | Bacteria | 962 |
| 98 | Ga0075367_10120663 | 3300006178 | Bacteria | 1615 |
| 99 | Ga0097621_100031362 | 3300006237 | Bacteria | 4217 |
| 100 | Ga0097621_100105362 | 3300006237 | Bacteria | 2377 |
| 101 | Ga0075370_10271902 | 3300006353 | Bacteria | 1006 |
| 102 | Ga0075428_100013717 | 3300006844 | Bacteria | 9023 |
| 103 | Ga0075428_100223572 | 3300006844 | Bacteria | 2033 |
| 104 | Ga0075433_10011945 | 3300006852 | Bacteria | 7000 |
| 105 | Ga0075433_10027801 | 3300006852 | Bacteria | 4802 |
| 106 | Ga0075433_11107116 | 3300006852 | Bacteria | 689 |
| 107 | Ga0075434_100017170 | 3300006871 | Bacteria | 6967 |
| 108 | Ga0075434_100141004 | 3300006871 | Bacteria | 2430 |
| 109 | Ga0075434_100848954 | 3300006871 | Bacteria | 929 |
| 110 | Ga0075429_100184222 | 3300006880 | Bacteria | 1830 |
| 111 | Ga0068865_100312719 | 3300006881 | Bacteria | 1261 |
| 112 | Ga0075436_100002907 | 3300006914 | Bacteria | 11750 |
| 113 | Ga0075436_100026649 | 3300006914 | Bacteria | 3980 |
| 114 | Ga0097620_100737656 | 3300006931 | Bacteria | 1074 |
| 115 | Ga0075435_100038265 | 3300007076 | Bacteria | 3824 |
| 116 | Ga0075435_100128010 | 3300007076 | Bacteria | 2123 |
| 117 | Ga0105251_10042952 | 3300009011 | Bacteria | 2191 |
| 118 | Ga0105244_10138189 | 3300009036 | Bacteria | 1173 |
| 119 | Ga0105240_10002593 | 3300009093 | Bacteria | 28927 |
| 120 | Ga0111539_10217332 | 3300009094 | Bacteria | 2226 |
| 121 | Ga0105245_10022695 | 3300009098 | Bacteria | 5508 |
| 122 | Ga0105247_10097872 | 3300009101 | Bacteria | 1872 |
| 123 | Ga0105247_10140142 | 3300009101 | Bacteria | 1584 |
| 124 | Ga0114129_10008421 | 3300009147 | Bacteria | 14692 |
| 125 | Ga0114129_10068964 | 3300009147 | Bacteria | 4929 |
| 126 | Ga0105243_10364898 | 3300009148 | Bacteria | 1330 |
| 127 | Ga0105243_10501073 | 3300009148 | Bacteria | 1151 |
| 128 | Ga0105243_10534848 | 3300009148 | Bacteria | 1117 |
| 129 | Ga0105241_10001133 | 3300009174 | Bacteria | 20315 |
| 130 | Ga0105241_10054363 | 3300009174 | Bacteria | 3065 |
| 131 | Ga0105241_10197349 | 3300009174 | Bacteria | 1679 |
| 132 | Ga0105248_10112199 | 3300009177 | Bacteria | 3075 |
| 133 | Ga0105248_10301486 | 3300009177 | Bacteria | 1804 |
| 134 | Ga0105237_10033948 | 3300009545 | Bacteria | 5168 |
| 135 | Ga0105237_10525944 | 3300009545 | Bacteria | 1189 |
| 136 | Ga0105237_10587634 | 3300009545 | Bacteria | 1120 |
| 137 | Ga0105238_10019076 | 3300009551 | Bacteria | 6987 |
| 138 | Ga0105249_10574137 | 3300009553 | Bacteria | 1180 |
| 139 | Ga0105239_10080227 | 3300010375 | Bacteria | 3590 |
| 140 | Ga0105246_10012385 | 3300011119 | Bacteria | 5320 |
| 141 | Ga0105246_10157689 | 3300011119 | Bacteria | 1726 |
| 142 | Ga0105246_10173966 | 3300011119 | Bacteria | 1651 |
| 143 | Ga0105246_10655340 | 3300011119 | Bacteria | 914 |
| 144 | Ga0157370_10024372 | 3300013104 | Bacteria | 5992 |
| 145 | Ga0157369_10231037 | 3300013105 | Bacteria | 1934 |
| 146 | Ga0157374_10009898 | 3300013296 | Bacteria | 8182 |
| 147 | Ga0157374_10028904 | 3300013296 | Bacteria | 5012 |
| 148 | Ga0157378_10174862 | 3300013297 | Bacteria | 2016 |
| 149 | Ga0163162_10391453 | 3300013306 | Bacteria | 1522 |
| 150 | Ga0163162_10490143 | 3300013306 | Bacteria | 1360 |
| 151 | Ga0157372_10062057 | 3300013307 | Bacteria | 4186 |
| 152 | Ga0157372_10188025 | 3300013307 | Bacteria | 2391 |
| 153 | Ga0157372_10281353 | 3300013307 | Bacteria | 1934 |
| 154 | Ga0157372_10457540 | 3300013307 | Bacteria | 1487 |
| 155 | Ga0157375_10277578 | 3300013308 | Bacteria | 1838 |
| 156 | Ga0163163_10003442 | 3300014325 | Bacteria | 13446 |
| 157 | Ga0157380_10255069 | 3300014326 | Bacteria | 1590 |
| 158 | Ga0157377_10155670 | 3300014745 | Bacteria | 1417 |
| 159 | Ga0157377_10852080 | 3300014745 | Bacteria | 677 |
| 160 | Ga0157379_10002390 | 3300014968 | Bacteria | 15680 |
| 161 | Ga0157376_10007343 | 3300014969 | Bacteria | 7856 |
| 162 | Ga0157376_10102298 | 3300014969 | Bacteria | 2506 |
| 163 | Ga0157376_10520189 | 3300014969 | Bacteria | 1173 |
| 164 | Ga0182006_1047820 | 3300015261 | Bacteria | 1656 |
| 165 | Ga0182007_10000948 | 3300015262 | Bacteria | 15950 |
| 166 | Ga0182005_1024865 | 3300015265 | Bacteria | 1635 |
| 167 | Ga0183367_1015 | 3300015688 | Bacteria | 298435 |
| 168 | Ga0206356_10039005 | 3300020070 | Bacteria | 735 |
| 169 | Ga0206355_1518046 | 3300020076 | Bacteria | 1732 |
| 170 | Ga0206350_10371078 | 3300020080 | Bacteria | 1192 |
| 171 | Ga0206353_10318742 | 3300020082 | Bacteria | 4638 |
| 172 | Ga0213875_10016990 | 3300021388 | Bacteria | 3523 |
| 173 | Ga0213875_10042697 | 3300021388 | Bacteria | 2130 |
| 174 | Ga0224572_1002611 | 3300024225 | Bacteria | 2944 |
| 175 | Ga0228598_1030632 | 3300024227 | Bacteria | 1059 |
| 176 | Ga0209758_1020439 | 3300025297 | Bacteria | 3132 |
| 177 | Ga0207426_1003984 | 3300025302 | Bacteria | 7520 |
| 178 | Ga0207426_1072135 | 3300025302 | Bacteria | 959 |
| 179 | Ga0209051_1112049 | 3300025303 | Bacteria | 709 |
| 180 | Ga0207696_1038217 | 3300025711 | Bacteria | 1418 |
| 181 | Ga0207692_10000198 | 3300025898 | Bacteria | 20008 |
| 182 | Ga0207692_10005056 | 3300025898 | Bacteria | 5254 |
| 183 | Ga0207692_10007347 | 3300025898 | Bacteria | 4515 |
| 184 | Ga0207692_10026163 | 3300025898 | Bacteria | 2735 |
| 185 | Ga0207692_10039943 | 3300025898 | Bacteria | 2312 |
| 186 | Ga0207710_10263081 | 3300025900 | Bacteria | 865 |
| 187 | Ga0207647_10007289 | 3300025904 | Bacteria | 8006 |
| 188 | Ga0207647_10044080 | 3300025904 | Bacteria | 2788 |
| 189 | Ga0207685_10007645 | 3300025905 | Bacteria | 3026 |
| 190 | Ga0207685_10028498 | 3300025905 | Bacteria | 1967 |
| 191 | Ga0207685_10048016 | 3300025905 | Bacteria | 1633 |
| 192 | Ga0207699_10000355 | 3300025906 | Bacteria | 24243 |
| 193 | Ga0207699_10008211 | 3300025906 | Bacteria | 5140 |
| 194 | Ga0207699_10013730 | 3300025906 | Bacteria | 4154 |
| 195 | Ga0207699_10014905 | 3300025906 | Bacteria | 4024 |
| 196 | Ga0207699_10069936 | 3300025906 | Bacteria | 2142 |
| 197 | Ga0207684_10000549 | 3300025910 | Bacteria | 46187 |
| 198 | Ga0207684_10001867 | 3300025910 | Bacteria | 21943 |
| 199 | Ga0207684_10023269 | 3300025910 | Bacteria | 5290 |
| 200 | Ga0207684_10304429 | 3300025910 | Bacteria | 1374 |
| 201 | Ga0207654_10002025 | 3300025911 | Bacteria | 10420 |
| 202 | Ga0207707_10214262 | 3300025912 | Bacteria | 1677 |
| 203 | Ga0207695_10001075 | 3300025913 | Bacteria | 47773 |
| 204 | Ga0207671_10000122 | 3300025914 | Bacteria | 119512 |
| 205 | Ga0207671_10858263 | 3300025914 | Bacteria | 719 |
| 206 | Ga0207693_10012402 | 3300025915 | Bacteria | 6885 |
| 207 | Ga0207693_10018785 | 3300025915 | Bacteria | 5501 |
| 208 | Ga0207693_10056204 | 3300025915 | Bacteria | 3086 |
| 209 | Ga0207693_10088416 | 3300025915 | Bacteria | 2428 |
| 210 | Ga0207693_10166610 | 3300025915 | Bacteria | 1734 |
| 211 | Ga0207663_10057034 | 3300025916 | Bacteria | 2459 |
| 212 | Ga0207663_10647442 | 3300025916 | Bacteria | 834 |
| 213 | Ga0207663_10990230 | 3300025916 | Bacteria | 674 |
| 214 | Ga0207660_10372919 | 3300025917 | Bacteria | 1146 |
| 215 | Ga0207646_10000577 | 3300025922 | Bacteria | 48073 |
| 216 | Ga0207646_10017839 | 3300025922 | Bacteria | 6629 |
| 217 | Ga0207646_10077134 | 3300025922 | Bacteria | 2978 |
| 218 | Ga0207646_10104929 | 3300025922 | Bacteria | 2534 |
| 219 | Ga0207646_10314217 | 3300025922 | Bacteria | 1416 |
| 220 | Ga0207694_10000829 | 3300025924 | Bacteria | 27496 |
| 221 | Ga0207700_10000427 | 3300025928 | Bacteria | 24804 |
| 222 | Ga0207700_10008608 | 3300025928 | Bacteria | 6333 |
| 223 | Ga0207700_10008868 | 3300025928 | Bacteria | 6254 |
| 224 | Ga0207700_10037684 | 3300025928 | Bacteria | 3504 |
| 225 | Ga0207700_10081039 | 3300025928 | Bacteria | 2533 |
| 226 | Ga0207700_10111952 | 3300025928 | Bacteria | 2198 |
| 227 | Ga0207700_10111987 | 3300025928 | Bacteria | 2198 |
| 228 | Ga0207700_10293449 | 3300025928 | Bacteria | 1402 |
| 229 | Ga0207664_10006111 | 3300025929 | Bacteria | 8246 |
| 230 | Ga0207664_10010058 | 3300025929 | Bacteria | 6666 |
| 231 | Ga0207664_10029954 | 3300025929 | Bacteria | 4152 |
| 232 | Ga0207664_10039826 | 3300025929 | Bacteria | 3649 |
| 233 | Ga0207664_10056279 | 3300025929 | Bacteria | 3123 |
| 234 | Ga0207664_10075145 | 3300025929 | Bacteria | 2731 |
| 235 | Ga0207664_10172013 | 3300025929 | Bacteria | 1854 |
| 236 | Ga0207664_10409254 | 3300025929 | Bacteria | 1207 |
| 237 | Ga0207664_10768876 | 3300025929 | Bacteria | 866 |
| 238 | Ga0207686_10347464 | 3300025934 | Bacteria | 1116 |
| 239 | Ga0207709_10238836 | 3300025935 | Bacteria | 1321 |
| 240 | Ga0207665_10001080 | 3300025939 | Bacteria | 18366 |
| 241 | Ga0207665_10003971 | 3300025939 | Bacteria | 9884 |
| 242 | Ga0207665_10007451 | 3300025939 | Bacteria | 7235 |
| 243 | Ga0207691_10137592 | 3300025940 | Bacteria | 2154 |
| 244 | Ga0207691_10930167 | 3300025940 | Bacteria | 727 |
| 245 | Ga0207691_11020483 | 3300025940 | Bacteria | 690 |
| 246 | Ga0207711_10115701 | 3300025941 | Bacteria | 2390 |
| 247 | Ga0207661_10138298 | 3300025944 | Bacteria | 2094 |
| 248 | Ga0207667_10006929 | 3300025949 | Bacteria | 13696 |
| 249 | Ga0207667_10094891 | 3300025949 | Bacteria | 3080 |
| 250 | Ga0207667_10287468 | 3300025949 | Bacteria | 1680 |
| 251 | Ga0207640_10006140 | 3300025981 | Bacteria | 6574 |
| 252 | Ga0207658_10386164 | 3300025986 | Bacteria | 1227 |
| 253 | Ga0207703_10146273 | 3300026035 | Bacteria | 2056 |
| 254 | Ga0207639_10023348 | 3300026041 | Bacteria | 4466 |
| 255 | Ga0207639_10048788 | 3300026041 | Bacteria | 3206 |
| 256 | Ga0207678_10084430 | 3300026067 | Bacteria | 2716 |
| 257 | Ga0207678_10486158 | 3300026067 | Bacteria | 1075 |
| 258 | Ga0207702_10019973 | 3300026078 | Bacteria | 5550 |
| 259 | Ga0207641_10059677 | 3300026088 | Bacteria | 3249 |
| 260 | Ga0207674_10214750 | 3300026116 | Bacteria | 1872 |
| 261 | Ga0207683_10188808 | 3300026121 | Bacteria | 1870 |
| 262 | Ga0207698_10035262 | 3300026142 | Bacteria | 3658 |
| 263 | Ga0209371_1008032 | 3300027312 | Bacteria | 3569 |
| 264 | Ga0209371_1018659 | 3300027312 | Bacteria | 1754 |
| 265 | Ga0207428_10053288 | 3300027907 | Bacteria | 3226 |
| 266 | Ga0268266_10042600 | 3300028379 | Bacteria | 3878 |
| 267 | Ga0307517_10008770 | 3300028786 | Bacteria | 14457 |
| 268 | Ga0307517_10012587 | 3300028786 | Bacteria | 11590 |
| 269 | Ga0307515_10001114 | 3300028794 | Bacteria | 61489 |
| 270 | Ga0307515_10101266 | 3300028794 | Bacteria | 3479 |
| 271 | Ga0265338_10000718 | 3300028800 | Bacteria | 56666 |
| 272 | Ga0268256_1005719 | 3300030500 | Bacteria | 4800 |
| 273 | Ga0268256_1015837 | 3300030500 | Bacteria | 2184 |
| 274 | Ga0307511_10003592 | 3300030521 | Bacteria | 15888 |
| 275 | Ga0307511_10089148 | 3300030521 | Bacteria | 2104 |
| 276 | Ga0307511_10145549 | 3300030521 | Bacteria | 1378 |
| 277 | Ga0307512_10006056 | 3300030522 | Bacteria | 12386 |
| 278 | Ga0307513_10015029 | 3300031456 | Bacteria | 9397 |
| 279 | Ga0307513_10036984 | 3300031456 | Bacteria | 5437 |
| 280 | Ga0307509_10030305 | 3300031507 | Bacteria | 5987 |
| 281 | Ga0307509_10166488 | 3300031507 | Bacteria | 2091 |
| 282 | Ga0307509_10174524 | 3300031507 | Bacteria | 2023 |
| 283 | Ga0265313_10125733 | 3300031595 | Bacteria | 1115 |
| 284 | Ga0307508_10019325 | 3300031616 | Bacteria | 6193 |
| 285 | Ga0307508_10105662 | 3300031616 | Bacteria | 2413 |
| 286 | Ga0307508_10191297 | 3300031616 | Bacteria | 1647 |
| 287 | Ga0307514_10001631 | 3300031649 | Bacteria | 26246 |
| 288 | Ga0307514_10022169 | 3300031649 | Bacteria | 5166 |
| 289 | Ga0307514_10303992 | 3300031649 | Bacteria | 891 |
| 290 | Ga0316575_10000002 | 3300031665 | Bacteria | 148142 |
| 291 | Ga0316575_10000356 | 3300031665 | Bacteria | 12976 |
| 292 | Ga0316579_10011102 | 3300031691 | Bacteria | 3822 |
| 293 | Ga0316576_10000206 | 3300031727 | Bacteria | 24729 |
| 294 | Ga0316576_10001306 | 3300031727 | Bacteria | 13232 |
| 295 | Ga0316576_10257292 | 3300031727 | Bacteria | 1310 |
| 296 | Ga0316576_10353518 | 3300031727 | Bacteria | 1093 |
| 297 | Ga0307516_10010607 | 3300031730 | Bacteria | 10108 |
| 298 | Ga0307516_10051538 | 3300031730 | Bacteria | 4033 |
| 299 | Ga0307516_10503110 | 3300031730 | Bacteria | 866 |
| 300 | Ga0316577_10020948 | 3300031733 | Bacteria | 3623 |
| 301 | Ga0307518_10039052 | 3300031838 | Bacteria | 3451 |
| 302 | Ga0307518_10169360 | 3300031838 | Bacteria | 1490 |
| 303 | Ga0307410_10078913 | 3300031852 | Bacteria | 2305 |
| 304 | Ga0307406_10521558 | 3300031901 | Bacteria | 967 |
| 305 | Ga0307412_10168871 | 3300031911 | Bacteria | 1634 |
| 306 | Ga0307409_100100195 | 3300031995 | Bacteria | 2401 |
| 307 | Ga0307409_100192306 | 3300031995 | Bacteria | 1817 |
| 308 | Ga0307416_100148139 | 3300032002 | Bacteria | 2147 |
| 309 | Ga0307416_100759353 | 3300032002 | Bacteria | 1063 |
| 310 | Ga0307416_100990072 | 3300032002 | Bacteria | 943 |
| 311 | Ga0307414_10112584 | 3300032004 | Bacteria | 2075 |
| 312 | Ga0307414_10405169 | 3300032004 | Bacteria | 1186 |
| 313 | Ga0307414_10867056 | 3300032004 | Bacteria | 826 |
| 314 | Ga0307411_10117908 | 3300032005 | Bacteria | 1914 |
| 315 | Ga0307411_10592719 | 3300032005 | Bacteria | 952 |
| 316 | Ga0307415_100561399 | 3300032126 | Bacteria | 1009 |
| 317 | Ga0307415_100829103 | 3300032126 | Bacteria | 847 |
| 318 | Ga0316583_10037055 | 3300032133 | Bacteria | 1728 |
| 319 | Ga0316580_10013909 | 3300032139 | Bacteria | 2453 |
| 320 | Ga0307507_10000013 | 3300033179 | Bacteria | 242708 |
| 321 | Ga0307507_10057967 | 3300033179 | Bacteria | 3641 |
| 322 | Ga0307507_10097415 | 3300033179 | Bacteria | 2481 |
| 323 | Ga0307507_10136125 | 3300033179 | Bacteria | 1902 |
| 324 | Ga0307507_10140857 | 3300033179 | Bacteria | 1850 |
| 325 | Ga0307510_10045037 | 3300033180 | Bacteria | 4770 |
| 326 | Ga0307510_10152409 | 3300033180 | Bacteria | 1927 |
| 327 | Ga0307510_10245106 | 3300033180 | Bacteria | 1283 |
| 328 | Ga0307510_10287941 | 3300033180 | Bacteria | 1110 |
| 329 | Ga0373930_0019205 | 3300034816 | Bacteria | 1321 |
| 330 | Ga0373948_0006582 | 3300034817 | Bacteria | 1927 |
| 331 | Ga0373958_0106638 | 3300034819 | Bacteria | 663 |
| 332 | Ga0373938_0006469 | 3300034957 | Bacteria | 2025 |
| 333 | Ga0373926_0040258 | 3300035083 | Bacteria | 1667 |
| 334 | Ga0373926_0139670 | 3300035083 | Bacteria | 920 |
| 335 | Ga0373929_0037106 | 3300035085 | Bacteria | 1067 |
| 336 | Ga0373934_0000184 | 3300035086 | Bacteria | 22845 |
| 337 | Ga0373934_0002392 | 3300035086 | Bacteria | 6905 |
| 338 | Ga0373934_0018608 | 3300035086 | Bacteria | 2659 |
| 339 | Ga0373934_0019406 | 3300035086 | Bacteria | 2609 |
| 340 | Ga0373940_0048960 | 3300035088 | Bacteria | 1182 |
| 341 | Ga0373949_0038148 | 3300035090 | Bacteria | 1171 |
| 342 | Ga0373951_0030281 | 3300035091 | Bacteria | 1273 |
| 343 | Ga0373952_0048375 | 3300035092 | Bacteria | 1006 |
| 344 | Ga0373923_0006465 | 3300035111 | Bacteria | 4055 |
| 345 | Ga0373923_0030219 | 3300035111 | Bacteria | 2177 |
| 346 | Ga0373923_0048861 | 3300035111 | Bacteria | 1767 |
| 347 | Ga0373923_0084512 | 3300035111 | Bacteria | 1381 |
| 348 | Ga0373923_0109734 | 3300035111 | Bacteria | 1224 |
| 349 | Ga0373932_0003623 | 3300035112 | Bacteria | 3694 |
| 350 | Ga0373936_0032597 | 3300035113 | Bacteria | 2061 |
| 351 | Ga0373936_0046718 | 3300035113 | Bacteria | 1746 |
| 352 | Ga0373936_0100073 | 3300035113 | Bacteria | 1222 |
| 353 | Ga0373936_0170120 | 3300035113 | Bacteria | 952 |
| 354 | Ga0373939_0057298 | 3300035114 | Bacteria | 1229 |
| 355 | Ga0373941_0078018 | 3300035115 | Bacteria | 1113 |
| 356 | Ga0373945_0009754 | 3300035116 | Bacteria | 3150 |
| 357 | Ga0373945_0049152 | 3300035116 | Bacteria | 1547 |
| 358 | Ga0373945_0082988 | 3300035116 | Bacteria | 1230 |
| 359 | Ga0373945_0131611 | 3300035116 | Bacteria | 1002 |
| 360 | Ga0373953_0000116 | 3300035117 | Bacteria | 19418 |
| 361 | Ga0373953_0005235 | 3300035117 | Bacteria | 4194 |
| 362 | Ga0373953_0012677 | 3300035117 | Bacteria | 2992 |
| 363 | Ga0373953_0026389 | 3300035117 | Bacteria | 2225 |
| 364 | Ga0373954_0001000 | 3300035118 | Bacteria | 11155 |
| 365 | Ga0373954_0024414 | 3300035118 | Bacteria | 2756 |
| 366 | Ga0373954_0106711 | 3300035118 | Bacteria | 1353 |
| 367 | Ga0373956_0000136 | 3300035119 | Bacteria | 26262 |
| 368 | Ga0373956_0011462 | 3300035119 | Bacteria | 3655 |
| 369 | Ga0373956_0103573 | 3300035119 | Bacteria | 1322 |
| 370 | Ga0373956_0109470 | 3300035119 | Bacteria | 1285 |
| 371 | Ga0373957_0000035 | 3300035120 | Bacteria | 34674 |
| 372 | Ga0373957_0002953 | 3300035120 | Bacteria | 4931 |
| 373 | Ga0373957_0003000 | 3300035120 | Bacteria | 4901 |
| 374 | Ga0373957_0018235 | 3300035120 | Bacteria | 2455 |
| 375 | Ga0373957_0061778 | 3300035120 | Bacteria | 1453 |
| 376 | Ga0373960_0011091 | 3300035121 | Bacteria | 2213 |
| 377 | Ga0373943_0494058 | 3300035170 | Bacteria | 714 |
| 378 | Ga0373946_0132812 | 3300035171 | Bacteria | 1147 |
| 379 | Ga0373946_0299054 | 3300035171 | Bacteria | 795 |
| 380 | Ga0373955_0000072 | 3300035172 | Bacteria | 40814 |
| 381 | Ga0373955_0010552 | 3300035172 | Bacteria | 4367 |
| 382 | Ga0373955_0042016 | 3300035172 | Bacteria | 2453 |
| 383 | Ga0373955_0048357 | 3300035172 | Bacteria | 2306 |
| 384 | Ga0373955_0091799 | 3300035172 | Bacteria | 1731 |
| 385 | Ga0373955_0264755 | 3300035172 | Bacteria | 1032 |
| 386 | Ga0373942_0035611 | 3300035207 | Bacteria | 1336 |
| 387 | Ga0373962_0009821 | 3300035242 | Bacteria | 2377 |
| 388 | Ga0316574_0021271 | 3300035398 | Bacteria | 3851 |
| 389 | Ga0316574_0209927 | 3300035398 | Bacteria | 1249 |
| 390 | Ga0373924_0001000 | 3300035410 | Bacteria | 8959 |
| 391 | Ga0373924_0002302 | 3300035410 | Bacteria | 6408 |
| 392 | Ga0373924_0012374 | 3300035410 | Bacteria | 3186 |
| 393 | Ga0373924_0026843 | 3300035410 | Bacteria | 2286 |
| 394 | Ga0373931_0143278 | 3300035691 | Bacteria | 1386 |
| 395 | Ga0373931_0291280 | 3300035691 | Bacteria | 1005 |
| 396 | Ga0373931_0550532 | 3300035691 | Bacteria | 749 |
| 397 | Ga0373935_0045702 | 3300035692 | Bacteria | 2763 |
| 398 | Ga0373935_0120221 | 3300035692 | Bacteria | 1754 |
| 399 | Ga0373935_0151149 | 3300035692 | Bacteria | 1576 |
| 400 | Ga0373935_0170699 | 3300035692 | Bacteria | 1488 |
| 401 | Ga0373935_0396466 | 3300035692 | Bacteria | 990 |
| 402 | Ga0373927_0080460 | 3300035695 | Bacteria | 2111 |
| 403 | Ga0373933_0000327 | 3300035724 | Bacteria | 30644 |
| 404 | Ga0373933_0006553 | 3300035724 | Bacteria | 6344 |
| 405 | Ga0373933_0018940 | 3300035724 | Bacteria | 3878 |
| 406 | Ga0373933_0036349 | 3300035724 | Bacteria | 2882 |
| 407 | Ga0373933_0160018 | 3300035724 | Bacteria | 1429 |
| 408 | Ga0373933_0200604 | 3300035724 | Bacteria | 1276 |
| 409 | Ga0373947_0075049 | 3300035725 | Bacteria | 2081 |
| 410 | Ga0373947_0100587 | 3300035725 | Bacteria | 1817 |
| 411 | Ga0373947_0129409 | 3300035725 | Bacteria | 1610 |
| 412 | Ga0373947_0161540 | 3300035725 | Bacteria | 1449 |
| 413 | Ga0373937_0000010 | 3300036401 | Bacteria | 163001 |
| 414 | Ga0373937_0001685 | 3300036401 | Bacteria | 18583 |
| 415 | Ga0373937_0009917 | 3300036401 | Bacteria | 8305 |
| 416 | Ga0373937_0017506 | 3300036401 | Bacteria | 6386 |
| 417 | Ga0373937_0803493 | 3300036401 | Bacteria | 888 |
| 418 | Ga0316582_0025759 | 3300036647 | Bacteria | 3534 |
| 419 | Ga0316584_0000468 | 3300036712 | Bacteria | 21119 |
| 420 | Ga0316584_0367146 | 3300036712 | Bacteria | 1031 |
| 421 | Ga0316584_0733065 | 3300036712 | Bacteria | 675 |
| 422 | Ga0373925_0103218 | 3300037068 | Bacteria | 2194 |
| 423 | Ga0373925_0134396 | 3300037068 | Bacteria | 1931 |
| 424 | Ga0373925_0300626 | 3300037068 | Bacteria | 1296 |
| 425 | Ga0373925_0377747 | 3300037068 | Bacteria | 1153 |
| 426 | Ga0395899_0002623 | 3300037312 | Bacteria | 14501 |
| 427 | Ga0395899_0203269 | 3300037312 | Bacteria | 1380 |
| 428 | Ga0395898_0031982 | 3300037466 | Bacteria | 5252 |
| 429 | Ga0395898_0058062 | 3300037466 | Bacteria | 3768 |
| 430 | Ga0316581_0002277 | 3300037588 | Bacteria | 4549 |
| 431 | Ga0436364_0849349 | 3300037853 | Bacteria | 1284 |
| 432 | Ga0436364_0894524 | 3300037853 | Bacteria | 2015 |
| 433 | Ga0436364_1059010 | 3300037853 | Bacteria | 60327 |
| 434 | Ga0436364_1147169 | 3300037853 | Bacteria | 29511 |
| 435 | Ga0395901_1541329 | 3300038443 | Bacteria | 619 |
| 436 | Ga0436363_1505785 | 3300039450 | Bacteria | 682 |
| 437 | Ga0436362_0845973 | 3300039453 | Bacteria | 1143 |
| 438 | Ga0439436_0003576 | 3300041404 | Bacteria | 4726 |
| 439 | Ga0439436_0008118 | 3300041404 | Bacteria | 3226 |
| 440 | Ga0439439_0000554 | 3300041406 | Bacteria | 6514 |
| 441 | Ga0439453_0021310 | 3300041408 | Bacteria | 1168 |
| 442 | Ga0451791_0512465 | 3300041451 | Bacteria | 1325 |
| 443 | Ga0451795_0794252 | 3300041456 | Bacteria | 1230 |
| 444 | Ga0451802_1325708 | 3300041460 | Bacteria | 1159 |
| 445 | Ga0451841_0752493 | 3300041498 | Bacteria | 1355 |
| 446 | Ga0451853_2214190 | 3300041512 | Bacteria | 2173 |
| 447 | Ga0439433_0000267 | 3300041999 | Bacteria | 8812 |
| 448 | Ga0439442_030524 | 3300042002 | Bacteria | 1125 |
| 449 | Ga0439448_0009759 | 3300042005 | Bacteria | 2833 |
| 450 | Ga0439448_0125248 | 3300042005 | Bacteria | 883 |
| 451 | Ga0439449_0003868 | 3300042007 | Bacteria | 5804 |
| 452 | Ga0439449_0006979 | 3300042007 | Bacteria | 4303 |
| 453 | Ga0439455_0085584 | 3300042012 | Bacteria | 860 |
| 454 | Ga0439457_000100 | 3300042014 | Bacteria | 20035 |
| 455 | Ga0439457_001085 | 3300042014 | Bacteria | 8211 |
| 456 | Ga0439462_0003676 | 3300042015 | Bacteria | 3699 |
| 457 | Ga0450894_001105 | 3300042131 | Bacteria | 4063 |
| 458 | Ga0450895_002110 | 3300042132 | Bacteria | 1451 |
| 459 | Ga0450898_001128 | 3300042134 | Bacteria | 3419 |
| 460 | Ga0450899_000632 | 3300042135 | Bacteria | 4017 |
| 461 | Ga0450903_000500 | 3300042138 | Bacteria | 8239 |
| 462 | Ga0450906_003967 | 3300042145 | Bacteria | 3131 |
| 463 | Ga0439458_0007753 | 3300042157 | Bacteria | 2390 |
| 464 | Ga0439458_0073582 | 3300042157 | Bacteria | 865 |
| 465 | Ga0450908_009782 | 3300042184 | Bacteria | 1776 |
| 466 | Ga0466969_0004692 | 3300044656 | Bacteria | 7281 |
| 467 | Ga0466969_0007675 | 3300044656 | Bacteria | 5734 |
| 468 | Ga0466969_0018099 | 3300044656 | Bacteria | 3675 |
| 469 | Ga0466969_0018877 | 3300044656 | Bacteria | 3590 |
| 470 | Ga0466969_0107910 | 3300044656 | Bacteria | 1305 |
| 471 | Ga0466972_0012556 | 3300044658 | Bacteria | 4256 |
| 472 | Ga0466972_0073178 | 3300044658 | Bacteria | 1633 |
| 473 | Ga0466972_0131987 | 3300044658 | Bacteria | 1176 |
| 474 | Ga0466972_0164257 | 3300044658 | Bacteria | 1043 |
| 475 | Ga0466965_0083545 | 3300044683 | Bacteria | 1617 |
| 476 | Ga0466965_0129997 | 3300044683 | Bacteria | 1305 |
| 477 | Ga0466965_0194482 | 3300044683 | Bacteria | 1074 |
| 478 | Ga0466966_0001731 | 3300044684 | Bacteria | 14107 |
| 479 | Ga0466966_0002839 | 3300044684 | Bacteria | 11406 |
| 480 | Ga0466966_0007222 | 3300044684 | Bacteria | 7363 |
| 481 | Ga0466966_0015224 | 3300044684 | Bacteria | 5087 |
| 482 | Ga0466966_0035646 | 3300044684 | Bacteria | 3213 |
| 483 | Ga0466966_0041189 | 3300044684 | Bacteria | 2968 |
| 484 | Ga0466966_0274986 | 3300044684 | Bacteria | 1013 |
| 485 | Ga0466961_0006951 | 3300044693 | Bacteria | 7200 |
| 486 | Ga0466961_0012581 | 3300044693 | Bacteria | 5417 |
| 487 | Ga0466961_0029154 | 3300044693 | Bacteria | 3548 |
| 488 | Ga0466961_0037073 | 3300044693 | Bacteria | 3129 |
| 489 | Ga0466961_0056218 | 3300044693 | Bacteria | 2507 |
| 490 | Ga0466961_0060219 | 3300044693 | Bacteria | 2414 |
| 491 | Ga0466961_0142714 | 3300044693 | Bacteria | 1498 |
| 492 | Ga0466961_0412060 | 3300044693 | Bacteria | 819 |
| 493 | Ga0466963_0004122 | 3300044694 | Bacteria | 8405 |
| 494 | Ga0466963_0004646 | 3300044694 | Bacteria | 8011 |
| 495 | Ga0466963_0180150 | 3300044694 | Bacteria | 1475 |
| 496 | Ga0466963_0283112 | 3300044694 | Bacteria | 1165 |
| 497 | Ga0466963_0759646 | 3300044694 | Bacteria | 684 |
| 498 | Ga0466963_0927377 | 3300044694 | Bacteria | 613 |
| 499 | Ga0466964_0080868 | 3300044706 | Bacteria | 1394 |
| 500 | Ga0466964_0299217 | 3300044706 | Bacteria | 810 |
| 501 | Ga0466971_0004706 | 3300044719 | Bacteria | 5899 |
| 502 | Ga0466971_0005777 | 3300044719 | Bacteria | 5381 |
| 503 | Ga0466971_0010182 | 3300044719 | Bacteria | 4106 |
| 504 | Ga0466971_0040149 | 3300044719 | Bacteria | 2102 |
| 505 | Ga0466971_0048922 | 3300044719 | Bacteria | 1901 |
| 506 | Ga0466971_0209622 | 3300044719 | Bacteria | 921 |
| 507 | Ga0466968_0087727 | 3300044735 | Bacteria | 1374 |
| 508 | Ga0466970_0000340 | 3300044765 | Bacteria | 22884 |
| 509 | Ga0466970_0007649 | 3300044765 | Bacteria | 5416 |
| 510 | Ga0466970_0011402 | 3300044765 | Bacteria | 4531 |
| 511 | Ga0466970_0105706 | 3300044765 | Bacteria | 1535 |
| 512 | Ga0466970_0264396 | 3300044765 | Bacteria | 965 |
| 513 | Ga0466970_0512832 | 3300044765 | Bacteria | 691 |
| 514 | Ga0466957_0000482 | 3300044842 | Bacteria | 19826 |
| 515 | Ga0466957_0031489 | 3300044842 | Bacteria | 3170 |
| 516 | Ga0466957_0349244 | 3300044842 | Bacteria | 1003 |
| 517 | Ga0466960_0002803 | 3300044901 | Bacteria | 6600 |
| 518 | Ga0466960_0125492 | 3300044901 | Bacteria | 1349 |
| 519 | Ga0466960_0171059 | 3300044901 | Bacteria | 1172 |
| 520 | Ga0466959_0001725 | 3300045049 | Bacteria | 13588 |
| 521 | Ga0466959_0012149 | 3300045049 | Bacteria | 6214 |
| 522 | Ga0466959_0015474 | 3300045049 | Bacteria | 5558 |
| 523 | Ga0466959_0024315 | 3300045049 | Bacteria | 4486 |
| 524 | Ga0466959_0097990 | 3300045049 | Bacteria | 2100 |
| 525 | Ga0466959_0125601 | 3300045049 | Bacteria | 1821 |
| 526 | Ga0466959_0218628 | 3300045049 | Bacteria | 1322 |
| 527 | Ga0466959_0244598 | 3300045049 | Bacteria | 1238 |
| 528 | Ga0466958_0000083 | 3300045836 | Bacteria | 28940 |
| 529 | Ga0466958_0014280 | 3300045836 | Bacteria | 4535 |
| 530 | Ga0466958_0070274 | 3300045836 | Bacteria | 2142 |
| 531 | Ga0466958_0127815 | 3300045836 | Bacteria | 1594 |
| 532 | Ga0466967_0035261 | 3300045976 | Bacteria | 4256 |
| 533 | Ga0466967_0105117 | 3300045976 | Bacteria | 2586 |
| 534 | Ga0466967_0201985 | 3300045976 | Bacteria | 1883 |
| 535 | Ga0466967_1645105 | 3300045976 | Bacteria | 639 |
| 536 | Ga0495617_003736 | 3300046452 | Bacteria | 5655 |
| 537 | Ga0495592_0000136 | 3300046454 | Bacteria | 65571 |
| 538 | Ga0495592_0006355 | 3300046454 | Bacteria | 8801 |
| 539 | Ga0495592_0015144 | 3300046454 | Bacteria | 5858 |
| 540 | Ga0495592_0075441 | 3300046454 | Bacteria | 2448 |
| 541 | Ga0495592_0093513 | 3300046454 | Bacteria | 2153 |
| 542 | Ga0495592_0131556 | 3300046454 | Bacteria | 1749 |
| 543 | Ga0495592_0180425 | 3300046454 | Bacteria | 1438 |
| 544 | Ga0495592_0372488 | 3300046454 | Bacteria | 911 |
| 545 | Ga0495603_0004768 | 3300046455 | Bacteria | 8096 |
| 546 | Ga0495603_0016026 | 3300046455 | Bacteria | 4531 |
| 547 | Ga0495603_0023453 | 3300046455 | Bacteria | 3733 |
| 548 | Ga0495603_0029409 | 3300046455 | Bacteria | 3312 |
| 549 | Ga0495603_0055964 | 3300046455 | Bacteria | 2336 |
| 550 | Ga0495603_0073210 | 3300046455 | Bacteria | 2013 |
| 551 | Ga0495629_0004137 | 3300046459 | Bacteria | 10881 |
| 552 | Ga0495629_0009288 | 3300046459 | Bacteria | 7194 |
| 553 | Ga0495629_0010861 | 3300046459 | Bacteria | 6621 |
| 554 | Ga0495629_0011501 | 3300046459 | Bacteria | 6429 |
| 555 | Ga0495629_0059207 | 3300046459 | Bacteria | 2677 |
| 556 | Ga0495629_0062453 | 3300046459 | Bacteria | 2602 |
| 557 | Ga0495629_0065153 | 3300046459 | Bacteria | 2543 |
| 558 | Ga0495629_0118408 | 3300046459 | Bacteria | 1845 |
| 559 | Ga0495629_0242946 | 3300046459 | Bacteria | 1239 |
| 560 | Ga0495629_0545579 | 3300046459 | Bacteria | 778 |
| 561 | Ga0495638_0013477 | 3300046460 | Bacteria | 5565 |
| 562 | Ga0495638_0027916 | 3300046460 | Bacteria | 3649 |
| 563 | Ga0495638_0040475 | 3300046460 | Bacteria | 2953 |
| 564 | Ga0495638_0082360 | 3300046460 | Bacteria | 1952 |
| 565 | Ga0495641_0014933 | 3300046461 | Bacteria | 4180 |
| 566 | Ga0495641_0041104 | 3300046461 | Bacteria | 2148 |
| 567 | Ga0495641_0043399 | 3300046461 | Bacteria | 2079 |
| 568 | Ga0495641_0075536 | 3300046461 | Bacteria | 1511 |
| 569 | Ga0495641_0229465 | 3300046461 | Bacteria | 833 |
| 570 | Ga0495651_0000047 | 3300046462 | Bacteria | 89551 |
| 571 | Ga0495651_0000251 | 3300046462 | Bacteria | 41515 |
| 572 | Ga0495651_0000452 | 3300046462 | Bacteria | 31571 |
| 573 | Ga0495651_0006816 | 3300046462 | Bacteria | 8729 |
| 574 | Ga0495651_0014042 | 3300046462 | Bacteria | 6194 |
| 575 | Ga0495651_0015668 | 3300046462 | Bacteria | 5869 |
| 576 | Ga0495651_0123334 | 3300046462 | Bacteria | 1900 |
| 577 | Ga0495651_0148793 | 3300046462 | Bacteria | 1690 |
| 578 | Ga0495653_0000753 | 3300046463 | Bacteria | 24762 |
| 579 | Ga0495653_0016556 | 3300046463 | Bacteria | 6000 |
| 580 | Ga0495653_0019645 | 3300046463 | Bacteria | 5479 |
| 581 | Ga0495653_0039630 | 3300046463 | Bacteria | 3689 |
| 582 | Ga0495653_0061156 | 3300046463 | Bacteria | 2850 |
| 583 | Ga0495653_0065677 | 3300046463 | Bacteria | 2730 |
| 584 | Ga0495653_0149206 | 3300046463 | Bacteria | 1635 |
| 585 | Ga0495653_0195548 | 3300046463 | Bacteria | 1376 |
| 586 | Ga0495580_0035896 | 3300046472 | Bacteria | 3563 |
| 587 | Ga0495580_0094787 | 3300046472 | Bacteria | 2076 |
| 588 | Ga0495582_0004891 | 3300046473 | Bacteria | 7508 |
| 589 | Ga0495582_0041169 | 3300046473 | Bacteria | 2545 |
| 590 | Ga0495582_0122487 | 3300046473 | Bacteria | 1466 |
| 591 | Ga0495582_0244922 | 3300046473 | Bacteria | 1027 |
| 592 | Ga0495582_0538378 | 3300046473 | Bacteria | 675 |
| 593 | Ga0495639_0009946 | 3300046475 | Bacteria | 4088 |
| 594 | Ga0495639_0082203 | 3300046475 | Bacteria | 1501 |
| 595 | Ga0495662_0000990 | 3300046476 | Bacteria | 13904 |
| 596 | Ga0495662_0013161 | 3300046476 | Bacteria | 4028 |
| 597 | Ga0495662_0016011 | 3300046476 | Bacteria | 3638 |
| 598 | Ga0495662_0017846 | 3300046476 | Bacteria | 3435 |
| 599 | Ga0495662_0023647 | 3300046476 | Bacteria | 2967 |
| 600 | Ga0495662_0069877 | 3300046476 | Bacteria | 1701 |
| 601 | Ga0495662_0275317 | 3300046476 | Bacteria | 828 |
| 602 | Ga0495664_0000447 | 3300046477 | Bacteria | 20283 |
| 603 | Ga0495664_0006683 | 3300046477 | Bacteria | 6378 |
| 604 | Ga0495664_0007598 | 3300046477 | Bacteria | 6026 |
| 605 | Ga0495664_0012044 | 3300046477 | Bacteria | 4889 |
| 606 | Ga0495664_0033188 | 3300046477 | Bacteria | 3033 |
| 607 | Ga0495664_0084649 | 3300046477 | Bacteria | 1903 |
| 608 | Ga0495585_0009338 | 3300046492 | Bacteria | 5889 |
| 609 | Ga0495585_0028053 | 3300046492 | Bacteria | 3213 |
| 610 | Ga0495585_0079626 | 3300046492 | Bacteria | 1777 |
| 611 | Ga0495585_0080988 | 3300046492 | Bacteria | 1759 |
| 612 | Ga0495594_0006912 | 3300046499 | Bacteria | 5838 |
| 613 | Ga0495594_0013664 | 3300046499 | Bacteria | 4242 |
| 614 | Ga0495594_0051380 | 3300046499 | Bacteria | 2268 |
| 615 | Ga0495594_0090696 | 3300046499 | Bacteria | 1712 |
| 616 | Ga0495594_0141163 | 3300046499 | Bacteria | 1366 |
| 617 | Ga0495594_0169880 | 3300046499 | Bacteria | 1240 |
| 618 | Ga0495607_0016214 | 3300046501 | Bacteria | 4811 |
| 619 | Ga0495583_0015667 | 3300046506 | Bacteria | 4109 |
| 620 | Ga0495606_0010908 | 3300046507 | Bacteria | 7478 |
| 621 | Ga0495608_0000089 | 3300046511 | Bacteria | 65189 |
| 622 | Ga0495608_0005222 | 3300046511 | Bacteria | 9278 |
| 623 | Ga0495608_0010518 | 3300046511 | Bacteria | 6456 |
| 624 | Ga0495608_0012351 | 3300046511 | Bacteria | 5930 |
| 625 | Ga0495608_0029367 | 3300046511 | Bacteria | 3730 |
| 626 | Ga0495608_0030063 | 3300046511 | Bacteria | 3680 |
| 627 | Ga0495610_0028169 | 3300046512 | Bacteria | 2974 |
| 628 | Ga0495616_0005383 | 3300046513 | Bacteria | 7888 |
| 629 | Ga0495618_0027385 | 3300046514 | Bacteria | 3547 |
| 630 | Ga0495618_0152604 | 3300046514 | Bacteria | 1475 |
| 631 | Ga0495618_0306676 | 3300046514 | Bacteria | 985 |
| 632 | Ga0495620_0031352 | 3300046515 | Bacteria | 2436 |
| 633 | Ga0495628_0000325 | 3300046516 | Bacteria | 43145 |
| 634 | Ga0495628_0003602 | 3300046516 | Bacteria | 13858 |
| 635 | Ga0495628_0005690 | 3300046516 | Bacteria | 10917 |
| 636 | Ga0495628_0032896 | 3300046516 | Bacteria | 4182 |
| 637 | Ga0495628_0039248 | 3300046516 | Bacteria | 3787 |
| 638 | Ga0495628_0043744 | 3300046516 | Bacteria | 3565 |
| 639 | Ga0495628_0076458 | 3300046516 | Bacteria | 2605 |
| 640 | Ga0495628_0113392 | 3300046516 | Bacteria | 2083 |
| 641 | Ga0495628_0136341 | 3300046516 | Bacteria | 1876 |
| 642 | Ga0495628_0144274 | 3300046516 | Bacteria | 1815 |
| 643 | Ga0495628_0169940 | 3300046516 | Bacteria | 1653 |
| 644 | Ga0495628_0312066 | 3300046516 | Bacteria | 1162 |
| 645 | Ga0495630_0054579 | 3300046517 | Bacteria | 2993 |
| 646 | Ga0495630_0076461 | 3300046517 | Bacteria | 2522 |
| 647 | Ga0495630_0098499 | 3300046517 | Bacteria | 2211 |
| 648 | Ga0495630_0176416 | 3300046517 | Bacteria | 1629 |
| 649 | Ga0495630_0190313 | 3300046517 | Bacteria | 1565 |
| 650 | Ga0495630_0199897 | 3300046517 | Bacteria | 1525 |
| 651 | Ga0495631_0009662 | 3300046518 | Bacteria | 4809 |
| 652 | Ga0495631_0093134 | 3300046518 | Bacteria | 1297 |
| 653 | Ga0495632_0167646 | 3300046519 | Bacteria | 1010 |
| 654 | Ga0495637_0024609 | 3300046520 | Bacteria | 2723 |
| 655 | Ga0495643_0001898 | 3300046522 | Bacteria | 17653 |
| 656 | Ga0495643_0005581 | 3300046522 | Bacteria | 8467 |
| 657 | Ga0495643_0118303 | 3300046522 | Bacteria | 1341 |
| 658 | Ga0495648_0208265 | 3300046524 | Bacteria | 973 |
| 659 | Ga0495666_0000558 | 3300046526 | Bacteria | 16637 |
| 660 | Ga0495666_0005462 | 3300046526 | Bacteria | 6402 |
| 661 | Ga0495666_0011524 | 3300046526 | Bacteria | 4408 |
| 662 | Ga0495666_0129906 | 3300046526 | Bacteria | 1177 |
| 663 | Ga0495666_0169154 | 3300046526 | Bacteria | 1011 |
| 664 | Ga0495652_0000199 | 3300046529 | Bacteria | 69104 |
| 665 | Ga0495652_0000982 | 3300046529 | Bacteria | 32624 |
| 666 | Ga0495652_0006292 | 3300046529 | Bacteria | 11060 |
| 667 | Ga0495652_0017286 | 3300046529 | Bacteria | 6437 |
| 668 | Ga0495652_0023352 | 3300046529 | Bacteria | 5481 |
| 669 | Ga0495652_0031986 | 3300046529 | Bacteria | 4603 |
| 670 | Ga0495652_0038570 | 3300046529 | Bacteria | 4138 |
| 671 | Ga0495652_0047643 | 3300046529 | Bacteria | 3675 |
| 672 | Ga0495652_0062877 | 3300046529 | Bacteria | 3127 |
| 673 | Ga0495652_0084586 | 3300046529 | Bacteria | 2608 |
| 674 | Ga0495652_0140223 | 3300046529 | Bacteria | 1902 |
| 675 | Ga0495652_0324755 | 3300046529 | Bacteria | 1110 |
| 676 | Ga0495654_0003823 | 3300046530 | Bacteria | 9103 |
| 677 | Ga0495665_0003003 | 3300046531 | Bacteria | 9115 |
| 678 | Ga0495665_0014672 | 3300046531 | Bacteria | 4223 |
| 679 | Ga0495665_0017945 | 3300046531 | Bacteria | 3803 |
| 680 | Ga0495665_0209156 | 3300046531 | Bacteria | 1010 |
| 681 | Ga0495665_0284761 | 3300046531 | Bacteria | 847 |
| 682 | Ga0495640_0007528 | 3300046533 | Bacteria | 8556 |
| 683 | Ga0495640_0012287 | 3300046533 | Bacteria | 6549 |
| 684 | Ga0495640_0013458 | 3300046533 | Bacteria | 6215 |
| 685 | Ga0495640_0047394 | 3300046533 | Bacteria | 2974 |
| 686 | Ga0495640_0107147 | 3300046533 | Bacteria | 1829 |
| 687 | Ga0495640_0116559 | 3300046533 | Bacteria | 1739 |
| 688 | Ga0495640_0160390 | 3300046533 | Bacteria | 1441 |
| 689 | Ga0495586_0001586 | 3300046535 | Bacteria | 12508 |
| 690 | Ga0495586_0001723 | 3300046535 | Bacteria | 11943 |
| 691 | Ga0495586_0008008 | 3300046535 | Bacteria | 5637 |
| 692 | Ga0495586_0038041 | 3300046535 | Bacteria | 2583 |
| 693 | Ga0495586_0082919 | 3300046535 | Bacteria | 1763 |
| 694 | Ga0495586_0087249 | 3300046535 | Bacteria | 1720 |
| 695 | Ga0495586_0127408 | 3300046535 | Bacteria | 1424 |
| 696 | Ga0495587_0000074 | 3300046536 | Bacteria | 78796 |
| 697 | Ga0495587_0000644 | 3300046536 | Bacteria | 23420 |
| 698 | Ga0495587_0012793 | 3300046536 | Bacteria | 5278 |
| 699 | Ga0495587_0024905 | 3300046536 | Bacteria | 3662 |
| 700 | Ga0495587_0025699 | 3300046536 | Bacteria | 3597 |
| 701 | Ga0495587_0072375 | 3300046536 | Bacteria | 2004 |
| 702 | Ga0495587_0111917 | 3300046536 | Bacteria | 1567 |
| 703 | Ga0495587_0240668 | 3300046536 | Bacteria | 1018 |
| 704 | Ga0495609_0009209 | 3300046538 | Bacteria | 4784 |
| 705 | Ga0495597_0036879 | 3300046542 | Bacteria | 2198 |
| 706 | Ga0495597_0221597 | 3300046542 | Bacteria | 751 |
| 707 | Ga0495597_0332363 | 3300046542 | Bacteria | 585 |
| 708 | Ga0495645_0003455 | 3300046543 | Bacteria | 10718 |
| 709 | Ga0495645_0007656 | 3300046543 | Bacteria | 7515 |
| 710 | Ga0495645_0014924 | 3300046543 | Bacteria | 5520 |
| 711 | Ga0495645_0017450 | 3300046543 | Bacteria | 5141 |
| 712 | Ga0495645_0035334 | 3300046543 | Bacteria | 3643 |
| 713 | Ga0495645_0063472 | 3300046543 | Bacteria | 2674 |
| 714 | Ga0495645_0076533 | 3300046543 | Bacteria | 2407 |
| 715 | Ga0495645_0223340 | 3300046543 | Bacteria | 1266 |
| 716 | Ga0495645_0281841 | 3300046543 | Bacteria | 1092 |
| 717 | Ga0495645_0744917 | 3300046543 | Bacteria | 592 |
| 718 | Ga0495622_0002086 | 3300046557 | Bacteria | 9771 |
| 719 | Ga0495622_0004999 | 3300046557 | Bacteria | 6146 |
| 720 | Ga0495622_0045660 | 3300046557 | Bacteria | 2035 |
| 721 | Ga0495622_0063860 | 3300046557 | Bacteria | 1703 |
| 722 | Ga0495622_0066602 | 3300046557 | Bacteria | 1665 |
| 723 | Ga0495633_0004699 | 3300046558 | Bacteria | 8583 |
| 724 | Ga0495633_0052786 | 3300046558 | Bacteria | 1914 |
| 725 | Ga0495667_0000064 | 3300046559 | Bacteria | 89628 |
| 726 | Ga0495667_0000347 | 3300046559 | Bacteria | 29301 |
| 727 | Ga0495667_0002034 | 3300046559 | Bacteria | 13407 |
| 728 | Ga0495667_0008486 | 3300046559 | Bacteria | 6974 |
| 729 | Ga0495667_0022169 | 3300046559 | Bacteria | 4279 |
| 730 | Ga0495667_0038878 | 3300046559 | Bacteria | 3167 |
| 731 | Ga0495667_0088717 | 3300046559 | Bacteria | 2004 |
| 732 | Ga0495634_0000804 | 3300046642 | Bacteria | 30477 |
| 733 | Ga0495634_0006199 | 3300046642 | Bacteria | 9113 |
| 734 | Ga0495634_0032561 | 3300046642 | Bacteria | 3585 |
| 735 | Ga0495634_0036650 | 3300046642 | Bacteria | 3353 |
| 736 | Ga0495634_0101575 | 3300046642 | Bacteria | 1857 |
| 737 | Ga0495634_0667932 | 3300046642 | Bacteria | 599 |
| 738 | Ga0495611_0013516 | 3300046648 | Bacteria | 3477 |
| 739 | Ga0495611_0222453 | 3300046648 | Bacteria | 878 |
| 740 | Ga0495625_0104124 | 3300046660 | Bacteria | 1946 |
| 741 | Ga0495625_0150270 | 3300046660 | Bacteria | 1566 |
| 742 | Ga0495625_0279644 | 3300046660 | Bacteria | 1074 |
| 743 | Ga0495635_0001573 | 3300046663 | Bacteria | 15328 |
| 744 | Ga0495635_0020778 | 3300046663 | Bacteria | 4573 |
| 745 | Ga0495635_0023230 | 3300046663 | Bacteria | 4321 |
| 746 | Ga0495635_0045888 | 3300046663 | Bacteria | 3014 |
| 747 | Ga0495635_0051031 | 3300046663 | Bacteria | 2851 |
| 748 | Ga0495635_0089295 | 3300046663 | Bacteria | 2108 |
| 749 | Ga0495635_0103554 | 3300046663 | Bacteria | 1945 |
| 750 | Ga0495635_0375411 | 3300046663 | Bacteria | 946 |
| 751 | Ga0495635_0624193 | 3300046663 | Bacteria | 702 |
| 752 | Ga0495661_0014414 | 3300046665 | Bacteria | 5296 |
| 753 | Ga0495661_0160081 | 3300046665 | Bacteria | 1209 |
| 754 | Ga0495588_0009014 | 3300046674 | Bacteria | 4596 |
| 755 | Ga0495588_0033389 | 3300046674 | Bacteria | 2598 |
| 756 | Ga0495588_0079314 | 3300046674 | Bacteria | 1713 |
| 757 | Ga0495588_0153539 | 3300046674 | Bacteria | 1217 |
| 758 | Ga0495588_0243192 | 3300046674 | Bacteria | 949 |
| 759 | Ga0495657_0000009 | 3300046675 | Bacteria | 217555 |
| 760 | Ga0495657_0015381 | 3300046675 | Bacteria | 5601 |
| 761 | Ga0495657_0022658 | 3300046675 | Bacteria | 4495 |
| 762 | Ga0495657_0023773 | 3300046675 | Bacteria | 4375 |
| 763 | Ga0495657_0025398 | 3300046675 | Bacteria | 4207 |
| 764 | Ga0495657_0030262 | 3300046675 | Bacteria | 3793 |
| 765 | Ga0495657_0041850 | 3300046675 | Bacteria | 3132 |
| 766 | Ga0495657_0057845 | 3300046675 | Bacteria | 2576 |
| 767 | Ga0495657_0069033 | 3300046675 | Bacteria | 2313 |
| 768 | Ga0495657_0204768 | 3300046675 | Bacteria | 1201 |
| 769 | Ga0495599_0000084 | 3300046678 | Bacteria | 65440 |
| 770 | Ga0495599_0024103 | 3300046678 | Bacteria | 3805 |
| 771 | Ga0495599_0133992 | 3300046678 | Bacteria | 1538 |
| 772 | Ga0495599_0257210 | 3300046678 | Bacteria | 1061 |
| 773 | Ga0495599_0271365 | 3300046678 | Bacteria | 1029 |
| 774 | Ga0495623_0000168 | 3300046679 | Bacteria | 40826 |
| 775 | Ga0495623_0016760 | 3300046679 | Bacteria | 4734 |
| 776 | Ga0495623_0019236 | 3300046679 | Bacteria | 4415 |
| 777 | Ga0495623_0024851 | 3300046679 | Bacteria | 3858 |
| 778 | Ga0495623_0135912 | 3300046679 | Bacteria | 1467 |
| 779 | Ga0495623_0137406 | 3300046679 | Bacteria | 1457 |
| 780 | Ga0495623_0156499 | 3300046679 | Bacteria | 1343 |
| 781 | Ga0495623_0210545 | 3300046679 | Bacteria | 1113 |
| 782 | Ga0495623_0321023 | 3300046679 | Bacteria | 850 |
| 783 | Ga0495646_0000131 | 3300046680 | Bacteria | 37843 |
| 784 | Ga0495646_0006779 | 3300046680 | Bacteria | 7267 |
| 785 | Ga0495646_0010288 | 3300046680 | Bacteria | 5949 |
| 786 | Ga0495646_0030816 | 3300046680 | Bacteria | 3346 |
| 787 | Ga0495646_0084121 | 3300046680 | Bacteria | 1848 |
| 788 | Ga0495646_0264135 | 3300046680 | Bacteria | 919 |
| 789 | Ga0495647_0024412 | 3300046681 | Bacteria | 2201 |
| 790 | Ga0495658_0014985 | 3300046683 | Bacteria | 3972 |
| 791 | Ga0495658_0153570 | 3300046683 | Bacteria | 1415 |
| 792 | Ga0495613_0000387 | 3300046689 | Bacteria | 38006 |
| 793 | Ga0495613_0002214 | 3300046689 | Bacteria | 14721 |
| 794 | Ga0495613_0004116 | 3300046689 | Bacteria | 10877 |
| 795 | Ga0495613_0082328 | 3300046689 | Bacteria | 2337 |
| 796 | Ga0495613_0229356 | 3300046689 | Bacteria | 1301 |
| 797 | Ga0495613_0238367 | 3300046689 | Bacteria | 1272 |
| 798 | Ga0495624_0009562 | 3300046690 | Bacteria | 6710 |
| 799 | Ga0495624_0024942 | 3300046690 | Bacteria | 3933 |
| 800 | Ga0495624_0082931 | 3300046690 | Bacteria | 1983 |
| 801 | Ga0495624_0113025 | 3300046690 | Bacteria | 1669 |
| 802 | Ga0495670_0004170 | 3300046691 | Bacteria | 7082 |
| 803 | Ga0495670_0222664 | 3300046691 | Bacteria | 1002 |
| 804 | Ga0495671_0013623 | 3300046692 | Bacteria | 4396 |
| 805 | Ga0495649_0120395 | 3300046694 | Bacteria | 1388 |
| 806 | Ga0495649_0302760 | 3300046694 | Bacteria | 813 |
| 807 | Ga0495589_0013467 | 3300046794 | Bacteria | 4218 |
| 808 | Ga0495589_0141399 | 3300046794 | Bacteria | 1152 |
| 809 | Ga0495600_0009602 | 3300046809 | Bacteria | 5981 |
| 810 | Ga0495600_0009890 | 3300046809 | Bacteria | 5905 |
| 811 | Ga0495600_0011653 | 3300046809 | Bacteria | 5484 |
| 812 | Ga0495600_0012067 | 3300046809 | Bacteria | 5396 |
| 813 | Ga0495600_0015357 | 3300046809 | Bacteria | 4841 |
| 814 | Ga0495600_0020564 | 3300046809 | Bacteria | 4220 |
| 815 | Ga0495600_0086335 | 3300046809 | Bacteria | 2047 |
| 816 | Ga0495600_0122217 | 3300046809 | Bacteria | 1693 |
| 817 | Ga0495600_0178561 | 3300046809 | Bacteria | 1368 |
| 818 | Ga0495600_0223964 | 3300046809 | Bacteria | 1202 |
| 819 | Ga0495600_0336237 | 3300046809 | Bacteria | 947 |
| 820 | Ga0495660_0006126 | 3300046810 | Bacteria | 7140 |
| 821 | Ga0495660_0012927 | 3300046810 | Bacteria | 4839 |
| 822 | Ga0495581_0003195 | 3300047315 | Bacteria | 9376 |
| 823 | Ga0495581_0015726 | 3300047315 | Bacteria | 4393 |
| 824 | Ga0495581_0032518 | 3300047315 | Bacteria | 3020 |
| 825 | Ga0495581_0061905 | 3300047315 | Bacteria | 2162 |
| 826 | Ga0495581_0099920 | 3300047315 | Bacteria | 1685 |
| 827 | Ga0495581_0156169 | 3300047315 | Bacteria | 1333 |
| 828 | Ga0495581_0173333 | 3300047315 | Bacteria | 1262 |
| 829 | Ga0495581_0247640 | 3300047315 | Bacteria | 1042 |
| 830 | Ga0495581_0262280 | 3300047315 | Bacteria | 1010 |
| 831 | Ga0495604_0000070 | 3300047317 | Bacteria | 89500 |
| 832 | Ga0495604_0000385 | 3300047317 | Bacteria | 39910 |
| 833 | Ga0495604_0001476 | 3300047317 | Bacteria | 19368 |
| 834 | Ga0495604_0002049 | 3300047317 | Bacteria | 16276 |
| 835 | Ga0495604_0018002 | 3300047317 | Bacteria | 5654 |
| 836 | Ga0495604_0066109 | 3300047317 | Bacteria | 2751 |
| 837 | Ga0495604_0073929 | 3300047317 | Bacteria | 2570 |
| 838 | Ga0495604_0081059 | 3300047317 | Bacteria | 2430 |
| 839 | Ga0495604_0141052 | 3300047317 | Bacteria | 1721 |
| 840 | Ga0495604_0233206 | 3300047317 | Bacteria | 1261 |
| 841 | Ga0495604_0404711 | 3300047317 | Bacteria | 898 |
| 842 | Ga0495636_0004226 | 3300047318 | Bacteria | 5635 |
| 843 | Ga0495636_0036138 | 3300047318 | Bacteria | 2036 |
| 844 | Ga0495636_0088713 | 3300047318 | Bacteria | 1340 |
| 845 | Ga0495636_0343015 | 3300047318 | Bacteria | 704 |
| 846 | Ga0495674_0018316 | 3300047319 | Bacteria | 6519 |
| 847 | Ga0495674_0051585 | 3300047319 | Bacteria | 3625 |
| 848 | Ga0495674_0053562 | 3300047319 | Bacteria | 3546 |
| 849 | Ga0495674_0109000 | 3300047319 | Bacteria | 2349 |
| 850 | Ga0495674_0162255 | 3300047319 | Bacteria | 1869 |
| 851 | Ga0495674_0204688 | 3300047319 | Bacteria | 1636 |
| 852 | Ga0495674_0241459 | 3300047319 | Bacteria | 1488 |
| 853 | Ga0495674_0282899 | 3300047319 | Bacteria | 1358 |
| 854 | Ga0495672_0425365 | 3300047320 | Bacteria | 603 |
| 855 | Ga0495676_0004682 | 3300047321 | Bacteria | 12526 |
| 856 | Ga0495676_0027215 | 3300047321 | Bacteria | 4907 |
| 857 | Ga0495676_0062084 | 3300047321 | Bacteria | 2919 |
| 858 | Ga0495676_0076992 | 3300047321 | Bacteria | 2544 |
| 859 | Ga0495676_0203918 | 3300047321 | Bacteria | 1372 |
| 860 | Ga0495676_0257478 | 3300047321 | Bacteria | 1188 |
| 861 | Ga0495676_0481799 | 3300047321 | Bacteria | 816 |
| 862 | Ga0495680_0000195 | 3300047322 | Bacteria | 65440 |
| 863 | Ga0495680_0004196 | 3300047322 | Bacteria | 13841 |
| 864 | Ga0495680_0007153 | 3300047322 | Bacteria | 10280 |
| 865 | Ga0495680_0017098 | 3300047322 | Bacteria | 6205 |
| 866 | Ga0495680_0020452 | 3300047322 | Bacteria | 5569 |
| 867 | Ga0495680_0021436 | 3300047322 | Bacteria | 5409 |
| 868 | Ga0495680_0027349 | 3300047322 | Bacteria | 4688 |
| 869 | Ga0495683_0086524 | 3300047323 | Bacteria | 1523 |
| 870 | Ga0495683_0171299 | 3300047323 | Bacteria | 997 |
| 871 | Ga0495687_009716 | 3300047443 | Bacteria | 5348 |
| 872 | Ga0495687_067544 | 3300047443 | Bacteria | 1446 |
| 873 | Ga0495687_077248 | 3300047443 | Bacteria | 1315 |
| 874 | Ga0495675_0002990 | 3300047444 | Bacteria | 10145 |
| 875 | Ga0495675_0003023 | 3300047444 | Bacteria | 10102 |
| 876 | Ga0495675_0011010 | 3300047444 | Bacteria | 5669 |
| 877 | Ga0495675_0017663 | 3300047444 | Bacteria | 4523 |
| 878 | Ga0495675_0021862 | 3300047444 | Bacteria | 4075 |
| 879 | Ga0495675_0027933 | 3300047444 | Bacteria | 3596 |
| 880 | Ga0495675_0054932 | 3300047444 | Bacteria | 2526 |
| 881 | Ga0495675_0139644 | 3300047444 | Bacteria | 1502 |
| 882 | Ga0495679_024981 | 3300047446 | Bacteria | 2004 |
| 883 | Ga0495679_044078 | 3300047446 | Bacteria | 1368 |
| 884 | Ga0495685_001876 | 3300047447 | Bacteria | 6493 |
| 885 | Ga0495685_009339 | 3300047447 | Bacteria | 3274 |
| 886 | Ga0495685_011010 | 3300047447 | Bacteria | 3042 |
| 887 | Ga0495681_0003180 | 3300047470 | Bacteria | 11474 |
| 888 | Ga0495681_0017515 | 3300047470 | Bacteria | 3974 |
| 889 | Ga0495681_0157153 | 3300047470 | Bacteria | 949 |
| 890 | Ga0495684_0017677 | 3300047471 | Bacteria | 5491 |
| 891 | Ga0495684_0097621 | 3300047471 | Bacteria | 2222 |
| 892 | Ga0495684_0123162 | 3300047471 | Bacteria | 1951 |
| 893 | Ga0495684_0157045 | 3300047471 | Bacteria | 1698 |
| 894 | Ga0495686_0029178 | 3300047472 | Bacteria | 3590 |
| 895 | Ga0495686_0071898 | 3300047472 | Bacteria | 2128 |
| 896 | Ga0495686_0238381 | 3300047472 | Bacteria | 1027 |
| 897 | Ga0495686_0243020 | 3300047472 | Bacteria | 1014 |
| 898 | Ga0495593_0001454 | 3300047673 | Bacteria | 13885 |
| 899 | Ga0495593_0006130 | 3300047673 | Bacteria | 7072 |
| 900 | Ga0495593_0021962 | 3300047673 | Bacteria | 3560 |
| 901 | Ga0495593_0035826 | 3300047673 | Bacteria | 2692 |
| 902 | Ga0495593_0037710 | 3300047673 | Bacteria | 2612 |
| 903 | Ga0495593_0050511 | 3300047673 | Bacteria | 2203 |
| 904 | Ga0495593_0065512 | 3300047673 | Bacteria | 1895 |
| 905 | Ga0495593_0083795 | 3300047673 | Bacteria | 1646 |
| 906 | Ga0495602_0000122 | 3300048088 | Bacteria | 73031 |
| 907 | Ga0495602_0017568 | 3300048088 | Bacteria | 7166 |
| 908 | Ga0495602_0030008 | 3300048088 | Bacteria | 5166 |
| 909 | Ga0495602_0033322 | 3300048088 | Bacteria | 4834 |
| 910 | Ga0495602_0053483 | 3300048088 | Bacteria | 3576 |
| 911 | Ga0495602_0061115 | 3300048088 | Bacteria | 3278 |
| 912 | Ga0495602_0068896 | 3300048088 | Bacteria | 3036 |
| 913 | Ga0495602_0070400 | 3300048088 | Bacteria | 2993 |
| 914 | Ga0495602_0211322 | 3300048088 | Bacteria | 1472 |
| 915 | Ga0495602_0291745 | 3300048088 | Bacteria | 1197 |
| 916 | Ga0495602_0733293 | 3300048088 | Bacteria | 668 |
| 917 | Ga0495614_0000388 | 3300048089 | Bacteria | 17839 |
| 918 | Ga0495614_0016264 | 3300048089 | Bacteria | 3239 |
| 919 | Ga0495614_0042976 | 3300048089 | Bacteria | 1937 |
| 920 | Ga0495614_0127501 | 3300048089 | Bacteria | 1124 |
| 921 | Ga0495614_0202979 | 3300048089 | Bacteria | 897 |
| 922 | Ga0495626_0006119 | 3300048091 | Bacteria | 6905 |
| 923 | Ga0496100_0054621 | 3300048903 | Bacteria | 2606 |
| 924 | Ga0496100_0297860 | 3300048903 | Bacteria | 1206 |
| 925 | Ga0496101_0059634 | 3300048904 | Bacteria | 2766 |
| 926 | Ga0496101_0078212 | 3300048904 | Bacteria | 2439 |
| 927 | Ga0496101_0364105 | 3300048904 | Bacteria | 1137 |
| 928 | Ga0496102_0064355 | 3300048905 | Bacteria | 3359 |
| 929 | Ga0496104_0000909 | 3300048907 | Bacteria | 25355 |
| 930 | Ga0496104_0055242 | 3300048907 | Bacteria | 3754 |
| 931 | Ga0496104_0074102 | 3300048907 | Bacteria | 3240 |
| 932 | Ga0496104_0518311 | 3300048907 | Bacteria | 1103 |
| 933 | Ga0496104_1182853 | 3300048907 | Bacteria | 668 |
| 934 | Ga0496105_0009583 | 3300048908 | Bacteria | 7578 |
| 935 | Ga0496105_0056371 | 3300048908 | Bacteria | 3243 |
| 936 | Ga0496105_0197646 | 3300048908 | Bacteria | 1642 |
| 937 | Ga0496105_0779095 | 3300048908 | Bacteria | 729 |
| 938 | Ga0496106_0014561 | 3300048909 | Bacteria | 5812 |
| 939 | Ga0496106_0028480 | 3300048909 | Bacteria | 4161 |
| 940 | Ga0496106_0106933 | 3300048909 | Bacteria | 2175 |
| 941 | Ga0496106_0414000 | 3300048909 | Bacteria | 1083 |
| 942 | Ga0496107_0113543 | 3300048910 | Bacteria | 1993 |
| 943 | Ga0496107_0215977 | 3300048910 | Bacteria | 1426 |
| 944 | Ga0496108_0001829 | 3300048911 | Bacteria | 16995 |
| 945 | Ga0496108_0019071 | 3300048911 | Bacteria | 5628 |
| 946 | Ga0496108_0065031 | 3300048911 | Bacteria | 3073 |
| 947 | Ga0496109_0286016 | 3300048912 | Bacteria | 1554 |
| 948 | Ga0496109_0537695 | 3300048912 | Bacteria | 1102 |
| 949 | Ga0496110_0039855 | 3300048913 | Bacteria | 4092 |
| 950 | Ga0496110_1015379 | 3300048913 | Bacteria | 737 |
| 951 | Ga0496111_0176849 | 3300048914 | Bacteria | 1586 |
| 952 | Ga0496111_0348790 | 3300048914 | Bacteria | 1096 |
| 953 | Ga0496112_0000817 | 3300048915 | Bacteria | 22051 |
| 954 | Ga0496112_0098289 | 3300048915 | Bacteria | 2897 |
| 955 | Ga0496112_0213307 | 3300048915 | Bacteria | 1887 |
| 956 | Ga0496113_0020163 | 3300048916 | Bacteria | 4681 |
| 957 | Ga0496113_0134982 | 3300048916 | Bacteria | 1938 |
| 958 | Ga0496113_0570344 | 3300048916 | Bacteria | 907 |
| 959 | Ga0496114_0012843 | 3300048917 | Bacteria | 6707 |
| 960 | Ga0496114_0063734 | 3300048917 | Bacteria | 3086 |
| 961 | Ga0496114_0155272 | 3300048917 | Bacteria | 1987 |
| 962 | Ga0496114_0354594 | 3300048917 | Bacteria | 1298 |
| 963 | Ga0496114_0373705 | 3300048917 | Bacteria | 1262 |
| 964 | Ga0496115_0016929 | 3300048918 | Bacteria | 5561 |
| 965 | Ga0496117_0053353 | 3300048920 | Bacteria | 2841 |
| 966 | Ga0496118_0031289 | 3300048921 | Bacteria | 4414 |
| 967 | Ga0496118_0034550 | 3300048921 | Bacteria | 4122 |
| 968 | Ga0496118_0053609 | 3300048921 | Bacteria | 3063 |
| 969 | Ga0496119_0070378 | 3300048922 | Bacteria | 2052 |
| 970 | Ga0496121_0254923 | 3300048924 | Bacteria | 1215 |
| 971 | Ga0496122_0000206 | 3300048925 | Bacteria | 131731 |
| 972 | Ga0496122_0000583 | 3300048925 | Bacteria | 74712 |
| 973 | Ga0496122_0130527 | 3300048925 | Bacteria | 1598 |
| 974 | Ga0496123_0000112 | 3300048926 | Bacteria | 163990 |
| 975 | Ga0496124_0000290 | 3300048927 | Bacteria | 94803 |
| 976 | Ga0496124_0113231 | 3300048927 | Bacteria | 2180 |
| 977 | Ga0496125_0000069 | 3300048928 | Bacteria | 246981 |
| 978 | Ga0496125_0011923 | 3300048928 | Bacteria | 8660 |
| 979 | Ga0496126_0088751 | 3300048929 | Bacteria | 2723 |
| 980 | Ga0496126_0125238 | 3300048929 | Bacteria | 2225 |
| 981 | Ga0501308_040256 | 3300049128 | Bacteria | 656 |
| 982 | Ga0501310_020266 | 3300049130 | Bacteria | 824 |
| 983 | Ga0501307_030584 | 3300049162 | Bacteria | 745 |
| 984 | Ga0495682_0022616 | 3300049460 | Bacteria | 2351 |
| 985 | Ga0501311_000618 | 3300049527 | Bacteria | 2617 |
| 986 | Ga0501313_040960 | 3300049529 | Bacteria | 622 |
| 987 | Ga0501315_000989 | 3300049531 | Bacteria | 2250 |
| 988 | Ga0501316_011534 | 3300049532 | Bacteria | 1021 |
| 989 | Ga0501317_001679 | 3300049533 | Bacteria | 1960 |
| 990 | Ga0501323_001534 | 3300049539 | Bacteria | 2077 |
| 991 | Ga0501323_001795 | 3300049539 | Bacteria | 1978 |
| 992 | Ga0501324_003212 | 3300049540 | Bacteria | 1241 |
| 993 | Ga0501324_006757 | 3300049540 | Bacteria | 974 |
| 994 | Ga0501031_0057014 | 3300049568 | Bacteria | 2545 |
| 995 | Ga0501031_0118152 | 3300049568 | Bacteria | 1732 |
| 996 | Ga0501032_0013368 | 3300049569 | Bacteria | 5842 |
| 997 | Ga0501032_0023444 | 3300049569 | Bacteria | 4263 |
| 998 | Ga0501032_0045515 | 3300049569 | Bacteria | 2967 |
| 999 | Ga0501032_0449553 | 3300049569 | Bacteria | 825 |
| 1000 | Ga0501032_0528863 | 3300049569 | Bacteria | 752 |
| 1001 | Ga0501033_0020260 | 3300049570 | Bacteria | 5025 |
| 1002 | Ga0501033_0037370 | 3300049570 | Bacteria | 3635 |
| 1003 | Ga0501033_0057008 | 3300049570 | Bacteria | 2887 |
| 1004 | Ga0501033_0066039 | 3300049570 | Bacteria | 2660 |
| 1005 | Ga0501033_0090480 | 3300049570 | Bacteria | 2239 |
| 1006 | Ga0501033_0110208 | 3300049570 | Bacteria | 2004 |
| 1007 | Ga0501033_0179412 | 3300049570 | Bacteria | 1518 |
| 1008 | Ga0501033_0322770 | 3300049570 | Bacteria | 1084 |
| 1009 | Ga0501033_0656214 | 3300049570 | Bacteria | 716 |
| 1010 | Ga0501034_0012571 | 3300049571 | Bacteria | 8738 |
| 1011 | Ga0501034_0054193 | 3300049571 | Bacteria | 4037 |
| 1012 | Ga0501034_0064608 | 3300049571 | Bacteria | 3673 |
| 1013 | Ga0501034_0067569 | 3300049571 | Bacteria | 3586 |
| 1014 | Ga0501034_0122802 | 3300049571 | Bacteria | 2583 |
| 1015 | Ga0501034_0144207 | 3300049571 | Bacteria | 2359 |
| 1016 | Ga0501034_0173514 | 3300049571 | Bacteria | 2122 |
| 1017 | Ga0501034_0184832 | 3300049571 | Bacteria | 2048 |
| 1018 | Ga0501034_0196901 | 3300049571 | Bacteria | 1974 |
| 1019 | Ga0501036_0001212 | 3300049572 | Bacteria | 19704 |
| 1020 | Ga0501036_0010825 | 3300049572 | Bacteria | 7536 |
| 1021 | Ga0501036_0019020 | 3300049572 | Bacteria | 5762 |
| 1022 | Ga0501036_0103822 | 3300049572 | Bacteria | 2403 |
| 1023 | Ga0501036_0116899 | 3300049572 | Bacteria | 2252 |
| 1024 | Ga0501036_0121639 | 3300049572 | Bacteria | 2204 |
| 1025 | Ga0501037_0003070 | 3300049573 | Bacteria | 12096 |
| 1026 | Ga0501037_0029527 | 3300049573 | Bacteria | 4051 |
| 1027 | Ga0501037_0034235 | 3300049573 | Bacteria | 3748 |
| 1028 | Ga0501038_0002444 | 3300049574 | Bacteria | 17293 |
| 1029 | Ga0501038_0032589 | 3300049574 | Bacteria | 4596 |
| 1030 | Ga0501038_0033075 | 3300049574 | Bacteria | 4556 |
| 1031 | Ga0501038_0048790 | 3300049574 | Bacteria | 3662 |
| 1032 | Ga0501038_0056405 | 3300049574 | Bacteria | 3373 |
| 1033 | Ga0501038_0159952 | 3300049574 | Bacteria | 1831 |
| 1034 | Ga0501039_0101931 | 3300049575 | Bacteria | 2240 |
| 1035 | Ga0501039_0179252 | 3300049575 | Bacteria | 1666 |
| 1036 | Ga0501039_0394748 | 3300049575 | Bacteria | 1086 |
| 1037 | Ga0501039_0495527 | 3300049575 | Bacteria | 959 |
| 1038 | Ga0501040_0015630 | 3300049576 | Bacteria | 5017 |
| 1039 | Ga0501041_0055004 | 3300049577 | Bacteria | 2429 |
| 1040 | Ga0501041_0099014 | 3300049577 | Bacteria | 1803 |
| 1041 | Ga0501042_0009583 | 3300049578 | Bacteria | 6461 |
| 1042 | Ga0501042_0130741 | 3300049578 | Bacteria | 1809 |
| 1043 | Ga0501042_0145961 | 3300049578 | Bacteria | 1706 |
| 1044 | Ga0501042_0200902 | 3300049578 | Bacteria | 1437 |
| 1045 | Ga0501042_0234895 | 3300049578 | Bacteria | 1323 |
| 1046 | Ga0501042_0426463 | 3300049578 | Bacteria | 961 |
| 1047 | Ga0501043_0002529 | 3300049579 | Bacteria | 15462 |
| 1048 | Ga0501043_0050030 | 3300049579 | Bacteria | 3285 |
| 1049 | Ga0501043_0050056 | 3300049579 | Bacteria | 3284 |
| 1050 | Ga0501043_0078531 | 3300049579 | Bacteria | 2593 |
| 1051 | Ga0501043_0087964 | 3300049579 | Bacteria | 2441 |
| 1052 | Ga0501043_0091296 | 3300049579 | Bacteria | 2394 |
| 1053 | Ga0501043_0375761 | 3300049579 | Bacteria | 1076 |
| 1054 | Ga0501046_0010869 | 3300049580 | Bacteria | 7801 |
| 1055 | Ga0501046_0197949 | 3300049580 | Bacteria | 1496 |
| 1056 | Ga0501046_0258282 | 3300049580 | Bacteria | 1280 |
| 1057 | Ga0501047_0000072 | 3300049581 | Bacteria | 126542 |
| 1058 | Ga0501047_0002236 | 3300049581 | Bacteria | 18522 |
| 1059 | Ga0501047_0023511 | 3300049581 | Bacteria | 5914 |
| 1060 | Ga0501047_0032695 | 3300049581 | Bacteria | 5023 |
| 1061 | Ga0501047_0052175 | 3300049581 | Bacteria | 3952 |
| 1062 | Ga0501047_0095566 | 3300049581 | Bacteria | 2850 |
| 1063 | Ga0501047_0131287 | 3300049581 | Bacteria | 2385 |
| 1064 | Ga0501047_0162290 | 3300049581 | Bacteria | 2106 |
| 1065 | Ga0501047_0249736 | 3300049581 | Bacteria | 1622 |
| 1066 | Ga0501047_0402959 | 3300049581 | Bacteria | 1201 |
| 1067 | Ga0501048_0023021 | 3300049582 | Bacteria | 4554 |
| 1068 | Ga0501048_0024072 | 3300049582 | Bacteria | 4446 |
| 1069 | Ga0501048_0096263 | 3300049582 | Bacteria | 2088 |
| 1070 | Ga0501048_0099477 | 3300049582 | Bacteria | 2052 |
| 1071 | Ga0501068_0119074 | 3300049584 | Bacteria | 1645 |
| 1072 | Ga0501068_0509124 | 3300049584 | Bacteria | 781 |
| 1073 | Ga0501068_0852955 | 3300049584 | Bacteria | 598 |
| 1074 | Ga0501070_0012353 | 3300049586 | Bacteria | 7205 |
| 1075 | Ga0501070_0042504 | 3300049586 | Bacteria | 3786 |
| 1076 | Ga0501070_0121758 | 3300049586 | Bacteria | 2156 |
| 1077 | Ga0501070_0160054 | 3300049586 | Bacteria | 1856 |
| 1078 | Ga0501070_0537854 | 3300049586 | Bacteria | 936 |
| 1079 | Ga0501071_0045006 | 3300049587 | Bacteria | 3167 |
| 1080 | Ga0501071_1189265 | 3300049587 | Bacteria | 589 |
| 1081 | Ga0501072_0076238 | 3300049588 | Bacteria | 2653 |
| 1082 | Ga0501072_0148963 | 3300049588 | Bacteria | 1866 |
| 1083 | Ga0501073_0008499 | 3300049589 | Bacteria | 7614 |
| 1084 | Ga0501073_0499502 | 3300049589 | Bacteria | 841 |
| 1085 | Ga0501074_0000848 | 3300049590 | Bacteria | 19450 |
| 1086 | Ga0501074_0057023 | 3300049590 | Bacteria | 2814 |
| 1087 | Ga0501076_0049046 | 3300049592 | Bacteria | 3338 |
| 1088 | Ga0501076_0425975 | 3300049592 | Bacteria | 1092 |
| 1089 | Ga0501235_037277 | 3300049669 | Bacteria | 1106 |
| 1090 | Ga0501257_019938 | 3300049686 | Bacteria | 1571 |
| 1091 | Ga0501079_0170812 | 3300049741 | Bacteria | 1695 |
| 1092 | Ga0501079_0562151 | 3300049741 | Bacteria | 897 |
| 1093 | Ga0501081_0112361 | 3300049743 | Bacteria | 1934 |
| 1094 | Ga0501083_0010851 | 3300049744 | Bacteria | 6408 |
| 1095 | Ga0501035_0003491 | 3300049822 | Bacteria | 15035 |
| 1096 | Ga0501035_0013355 | 3300049822 | Bacteria | 7580 |
| 1097 | Ga0501035_0032338 | 3300049822 | Bacteria | 4760 |
| 1098 | Ga0501035_0039755 | 3300049822 | Bacteria | 4255 |
| 1099 | Ga0501035_0045118 | 3300049822 | Bacteria | 3966 |
| 1100 | Ga0501035_0087511 | 3300049822 | Bacteria | 2745 |
| 1101 | Ga0501035_0105874 | 3300049822 | Bacteria | 2466 |
| 1102 | Ga0501035_0187169 | 3300049822 | Bacteria | 1781 |
| 1103 | Ga0501035_0597542 | 3300049822 | Bacteria | 899 |
| 1104 | Ga0501044_0002742 | 3300049823 | Bacteria | 20039 |
| 1105 | Ga0501044_0013235 | 3300049823 | Bacteria | 8931 |
| 1106 | Ga0501044_0018277 | 3300049823 | Bacteria | 7513 |
| 1107 | Ga0501044_0123954 | 3300049823 | Bacteria | 2582 |
| 1108 | Ga0501044_0124468 | 3300049823 | Bacteria | 2576 |
| 1109 | Ga0501044_0213395 | 3300049823 | Bacteria | 1883 |
| 1110 | Ga0501044_0305518 | 3300049823 | Bacteria | 1518 |
| 1111 | Ga0501044_0412336 | 3300049823 | Bacteria | 1262 |
| 1112 | Ga0501044_0456093 | 3300049823 | Bacteria | 1184 |
| 1113 | Ga0501044_0512674 | 3300049823 | Bacteria | 1099 |
| 1114 | Ga0501044_0601664 | 3300049823 | Bacteria | 992 |
| 1115 | Ga0501044_0747551 | 3300049823 | Bacteria | 860 |
| 1116 | Ga0501044_0818626 | 3300049823 | Bacteria | 809 |
| 1117 | Ga0501045_0068330 | 3300049824 | Bacteria | 2610 |
| 1118 | Ga0501045_0094604 | 3300049824 | Bacteria | 2210 |
| 1119 | Ga0501045_0667884 | 3300049824 | Bacteria | 767 |
| 1120 | nmdc:mga0yw44_240120_c1 | 3300050492 | Bacteria | 1204 |
| 1121 | nmdc:mga06z11_7684_c1 | 3300050494 | Bacteria | 4451 |
| 1122 | nmdc:mga05p37_21063_c1 | 3300050507 | Bacteria | 7892 |
| 1123 | nmdc:mga05p37_59022_c1 | 3300050507 | Bacteria | 4725 |
| 1124 | nmdc:mga09592_189829_c1 | 3300050508 | Bacteria | 1778 |
| 1125 | nmdc:mga0qj67_187915_c1 | 3300050509 | Bacteria | 1678 |
| 1126 | nmdc:mga06r32_977402_c1 | 3300050510 | Bacteria | 800 |
| 1127 | nmdc:mga08y16_79556_c1 | 3300050511 | Bacteria | 3416 |
| 1128 | nmdc:mga0n895_134032_c1 | 3300050512 | Bacteria | 2503 |
| 1129 | nmdc:mga0n895_5271_c1 | 3300050512 | Bacteria | 10765 |
| 1130 | nmdc:mga0n895_59113_c1 | 3300050512 | Bacteria | 3783 |
| 1131 | nmdc:mga0rr50_121363_c1 | 3300050513 | Bacteria | 2081 |
| 1132 | nmdc:mga0rr50_179158_c1 | 3300050513 | Bacteria | 1731 |
| 1133 | nmdc:mga0rr50_23778_c1 | 3300050513 | Bacteria | 4234 |
| 1134 | nmdc:mga08x19_13898_c1 | 3300050514 | Bacteria | 4876 |
| 1135 | nmdc:mga08x19_68539_c1 | 3300050514 | Bacteria | 2309 |
| 1136 | nmdc:mga0a205_41756_c1 | 3300050515 | Bacteria | 4419 |
| 1137 | nmdc:mga0a205_9759_c1 | 3300050515 | Bacteria | 8794 |
| 1138 | Ga0495601_0010340 | 3300053077 | Bacteria | 5551 |
| 1139 | Ga0495601_0011920 | 3300053077 | Bacteria | 5211 |
| 1140 | Ga0495601_0036290 | 3300053077 | Bacteria | 3077 |
| 1141 | Ga0495601_0081211 | 3300053077 | Bacteria | 2080 |
| 1142 | Ga0495601_0086161 | 3300053077 | Bacteria | 2018 |
| 1143 | Ga0495601_0182998 | 3300053077 | Bacteria | 1370 |
| 1144 | Ga0495601_0409881 | 3300053077 | Bacteria | 878 |
| 1145 | Ga0495612_0009788 | 3300053078 | Bacteria | 3884 |
| 1146 | Ga0495612_0015980 | 3300053078 | Bacteria | 3007 |
| 1147 | Ga0495612_0073321 | 3300053078 | Bacteria | 1430 |
| 1148 | Ga0495612_0075689 | 3300053078 | Bacteria | 1409 |
| 1149 | Ga0495612_0076115 | 3300053078 | Bacteria | 1405 |
| 1150 | Ga0495612_0101488 | 3300053078 | Bacteria | 1225 |
| 1151 | Ga0495612_0189865 | 3300053078 | Bacteria | 904 |
| 1152 | Ga0495595_0000288 | 3300053084 | Bacteria | 19645 |
| 1153 | Ga0495595_0004237 | 3300053084 | Bacteria | 5767 |
| 1154 | Ga0495595_0065626 | 3300053084 | Bacteria | 1707 |
| 1155 | Ga0495619_0014125 | 3300053085 | Bacteria | 5041 |
| 1156 | Ga0495619_0029190 | 3300053085 | Bacteria | 3562 |
| 1157 | Ga0495619_0052770 | 3300053085 | Bacteria | 2688 |
| 1158 | Ga0495619_0103750 | 3300053085 | Bacteria | 1937 |
| 1159 | Ga0495619_0105858 | 3300053085 | Bacteria | 1918 |
| 1160 | Ga0495619_0271904 | 3300053085 | Bacteria | 1174 |
| 1161 | Ga0495619_0288624 | 3300053085 | Bacteria | 1136 |
| 1162 | Ga0495619_0317201 | 3300053085 | Bacteria | 1079 |
| 1163 | Ga0500578_0027273 | 3300053086 | Bacteria | 3666 |
| 1164 | Ga0500644_0038061 | 3300053088 | Bacteria | 1576 |
| 1165 | Ga0500651_0229966 | 3300053093 | Bacteria | 1085 |
| 1166 | Ga0500640_005745 | 3300053095 | Bacteria | 4663 |
| 1167 | Ga0500641_0077403 | 3300053096 | Bacteria | 1408 |
| 1168 | Ga0500654_067044 | 3300053099 | Bacteria | 1782 |
| 1169 | Ga0500553_037039 | 3300053101 | Bacteria | 2410 |
| 1170 | Ga0500556_0026382 | 3300053104 | Bacteria | 1930 |
| 1171 | Ga0500572_021039 | 3300053111 | Bacteria | 1723 |
| 1172 | Ga0500614_011290 | 3300053123 | Bacteria | 1931 |
| 1173 | Ga0500628_003764 | 3300053129 | Bacteria | 2503 |
| 1174 | Ga0500652_009578 | 3300053131 | Bacteria | 3283 |
| 1175 | Ga0500652_105384 | 3300053131 | Bacteria | 1179 |
| 1176 | Ga0500658_0009142 | 3300053134 | Bacteria | 3656 |
| 1177 | Ga0500561_0001882 | 3300053137 | Bacteria | 3465 |
| 1178 | Ga0500573_0020678 | 3300053140 | Bacteria | 3771 |
| 1179 | Ga0500573_0117994 | 3300053140 | Bacteria | 1480 |
| 1180 | Ga0500577_0156008 | 3300053142 | Bacteria | 970 |
| 1181 | Ga0500579_020565 | 3300053143 | Bacteria | 4281 |
| 1182 | Ga0500588_0019540 | 3300053146 | Bacteria | 1803 |
| 1183 | Ga0500600_0014804 | 3300053149 | Bacteria | 4740 |
| 1184 | Ga0500604_0067508 | 3300053151 | Bacteria | 1135 |
| 1185 | Ga0500606_088096 | 3300053152 | Bacteria | 1050 |
| 1186 | Ga0500616_0003674 | 3300053153 | Bacteria | 11511 |
| 1187 | Ga0500616_0011658 | 3300053153 | Bacteria | 5179 |
| 1188 | Ga0500624_001358 | 3300053157 | Bacteria | 4108 |
| 1189 | Ga0500633_0009991 | 3300053160 | Bacteria | 2519 |
| 1190 | Ga0500634_0047199 | 3300053161 | Bacteria | 2325 |
| 1191 | Ga0500656_001101 | 3300053732 | Bacteria | 2236 |
| 1192 | Ga0500587_000440 | 3300053739 | Bacteria | 4891 |
| 1193 | Ga0501084_0078228 | 3300054114 | Bacteria | 2772 |
| 1194 | Ga0501082_0008414 | 3300060353 | Bacteria | 8902 |
| 1195 | Ga0501082_0017727 | 3300060353 | Bacteria | 6132 |
| 1196 | Ga0501082_0051409 | 3300060353 | Bacteria | 3552 |
| 1197 | Ga0501082_1058406 | 3300060353 | Bacteria | 709 |
| 1198 | Ga0466962_0000156 | 3300061719 | Bacteria | 28746 |
| 1199 | Ga0466962_0008705 | 3300061719 | Bacteria | 4865 |
| 1200 | Ga0466962_0048045 | 3300061719 | Bacteria | 2039 |
| 1201 | Ga0466962_0053482 | 3300061719 | Bacteria | 1930 |
| 1202 | Ga0466962_0374035 | 3300061719 | Bacteria | 711 |
| 1203 | Ga0530510_0479338 | 3300061734 | Bacteria | 942 |
| 1204 | 2515852502 | 2515154155 | Bacteria | 7985436 |
| 1205 | 2547411635 | 2547132111 | Bacteria | 8013147 |
| 1206 | 2554257041 | 2554235005 | Bacteria | 6457341 |
| 1207 | 2585305148 | 2582581313 | Bacteria | 10042643 |
| 1208 | 2585318320 | 2582581314 | Bacteria | 11452267 |
| 1209 | 2616701484 | 2616644814 | Bacteria | 11555299 |
| 1210 | 2643947631 | 2643221587 | Bacteria | 7586415 |
| 1211 | 2644080885 | 2643221613 | Bacteria | 4622396 |
| 1212 | 2644390187 | 2643221670 | Bacteria | 6497041 |
| 1213 | 2644435323 | 2643221677 | Bacteria | 7584031 |
| 1214 | 2644437585 | 2643221678 | Bacteria | 9540101 |
| 1215 | 2644504751 | 2643221690 | Bacteria | 4654705 |
| 1216 | 2644523783 | 2643221694 | Bacteria | 4392972 |
| 1217 | 2644627957 | 2643221714 | Bacteria | 9015452 |
| 1218 | 2644663798 | 2643221721 | Bacteria | 4486924 |
| 1219 | 2644667886 | 2643221722 | Bacteria | 4247614 |
| 1220 | 2676474503 | 2675903058 | Bacteria | 6822861 |
| 1221 | 2731907236 | 2731639228 | Bacteria | 4187555 |
| 1222 | 2784589400 | 2784132148 | Bacteria | 8627943 |
| 1223 | 2785342178 | 2784746763 | Bacteria | 9783172 |
| 1224 | 2785370479 | 2784746768 | Bacteria | 10036182 |
| 1225 | 2786671635 | 2786546132 | Bacteria | 10419719 |
| 1226 | 2799186590 | 2799112218 | Bacteria | 4315149 |
| 1227 | 2808843040 | 2808606359 | Bacteria | 9866990 |
| 1228 | 2808921381 | 2808606375 | Bacteria | 9466072 |
| 1229 | 2809233062 | 2808606448 | Bacteria | 8656184 |
| 1230 | 2812357083 | 2811994879 | Bacteria | 9313447 |
| 1231 | 2812479742 | 2811994917 | Bacteria | 7761064 |
| 1232 | 2827633023 | 2827628540 | Bacteria | 6858585 |
| 1233 | 2839986595 | 2839986021 | Bacteria | 3685650 |
| 1234 | 2839986601 | 2839986021 | Bacteria | 3685650 |
| 1235 | 2852640054 | 2852635781 | Bacteria | 8251373 |
| 1236 | 2856742144 | 2856741275 | Bacteria | 8096094 |
| 1237 | 2862179483 | 2862178590 | Bacteria | 8583590 |
| 1238 | 2862286665 | 2862281513 | Bacteria | 9621493 |
| 1239 | 2862296055 | 2862290372 | Bacteria | 7471434 |
| 1240 | 2862392519 | 2862382967 | Bacteria | 10317375 |
| 1241 | 2862510259 | 2862507626 | Bacteria | 9425308 |
| 1242 | 2862578449 | 2862574272 | Bacteria | 10567477 |
| 1243 | 2862709571 | 2862705112 | Bacteria | 6563286 |
| 1244 | 2863411860 | 2863404153 | Bacteria | 9672205 |
| 1245 | 2867348536 | 2867346516 | Bacteria | 7608576 |
| 1246 | 2867435698 | 2867428634 | Bacteria | 9590268 |
| 1247 | 2867475976 | 2867475112 | Bacteria | 6909112 |
| 1248 | 2873154962 | 2873151551 | Bacteria | 8625867 |
| 1249 | 2875394681 | 2875391855 | Bacteria | 7600475 |
| 1250 | 2877680142 | 2877676314 | Bacteria | 9512378 |
| 1251 | 2884704093 | 2884693830 | Bacteria | 11273186 |
| 1252 | 2884998045 | 2884994152 | Bacteria | 4492978 |
| 1253 | 2891401064 | 2891395885 | Bacteria | 9251614 |
| 1254 | 2891560060 | 2891554331 | Bacteria | 8812224 |
| 1255 | 2895431884 | 2895427314 | Bacteria | 13147766 |
| 1256 | 2895448552 | 2895442618 | Bacteria | 11027144 |
| 1257 | 2912718732 | 2912715099 | Bacteria | 9460473 |
| 1258 | 2918504620 | 2918501144 | Bacteria | 8668083 |
| 1259 | 2919471456 | 2919468124 | Bacteria | 9133025 |
| 1260 | 2932434730 | 2932431166 | Bacteria | 4215299 |
| 1261 | 2935892381 | 2935890801 | Bacteria | 4593001 |
| 1262 | 2946049954 | 2946045630 | Bacteria | 8527308 |
| 1263 | 2946068795 | 2946064051 | Bacteria | 8957905 |
| 1264 | 2946076841 | 2946072368 | Bacteria | 8999607 |
| 1265 | 2947228116 | 2947224130 | Bacteria | 9938529 |
| 1266 | 2954005941 | 2954002825 | Bacteria | 9173742 |
| 1267 | 2954385074 | 2954380949 | Bacteria | 10050426 |
| 1268 | 2954677921 | 2954673503 | Bacteria | 9685905 |
| 1269 | 2954686236 | 2954682443 | Bacteria | 9862841 |
| 1270 | 2954695892 | 2954691527 | Bacteria | 10720516 |
| 1271 | 2954711083 | 2954701450 | Bacteria | 10834262 |
| 1272 | 2954715297 | 2954711539 | Bacteria | 10867210 |
| 1273 | 2954725239 | 2954721474 | Bacteria | 10456478 |
| 1274 | 2954736577 | 2954731030 | Bacteria | 10243860 |
| 1275 | 2954744172 | 2954740390 | Bacteria | 10229294 |
| 1276 | 2954755427 | 2954749733 | Bacteria | 10366972 |
| 1277 | 2954763115 | 2954759201 | Bacteria | 9358192 |
| 1278 | 2964328240 | 2964326757 | Bacteria | 3290868 |
| 1279 | 2966602464 | 2966598605 | Bacteria | 7676064 |
| 1280 | 2990045583 | 2990044586 | Bacteria | 6603797 |
| 1281 | 2990063957 | 2990059506 | Bacteria | 9321252 |
| 1282 | 2995468033 | 2995463766 | Bacteria | 8577691 |
| 1283 | 2995726985 | 2995726249 | Bacteria | 3470435 |
| 1284 | 2997454284 | 2997451912 | Bacteria | 8492419 |
| 1285 | 3003000921 | 3002998708 | Bacteria | 11715108 |
| 1286 | 3006397265 | 3006393351 | Bacteria | 6615579 |
| 1287 | 3006428474 | 3006425503 | Bacteria | 6491253 |
| 1288 | 3006492248 | 3006486233 | Bacteria | 8157040 |
| 1289 | 3006500341 | 3006493962 | Bacteria | 8825450 |
| 1290 | 8008485877 | 8008485437 | Bacteria | 7198341 |
| 1291 | 8008566228 | 8008558824 | Bacteria | 10610750 |
| 1292 | 8023629554 | 8023623736 | Bacteria | 8593882 |
| 1293 | 8025484504 | 8025478263 | Bacteria | 8209203 |
| 1294 | 8025524961 | 8025524527 | Bacteria | 7197316 |
| 1295 | 8025538148 | 8025530807 | Bacteria | 8495698 |
| 1296 | 8033687542 | 8033684223 | Bacteria | 6906479 |
| 1297 | 8048409575 | 8048406513 | Bacteria | 8936924 |
| 1298 | 8053951463 | 8053945823 | Bacteria | 8962862 |
| 1299 | 8054161374 | 8054160619 | Bacteria | 7783213 |
| 1300 | 8055036861 | 8055034563 | Bacteria | 3562128 |
| 1301 | 8055040707 | 8055037949 | Bacteria | 3337834 |
| 1302 | 8056060990 | 8056060235 | Bacteria | 7259403 |
| 1303 | 8056454018 | 8056447290 | Bacteria | 7680491 |
| 1304 | 8056669205 | 8056667051 | Bacteria | 6953971 |
| 1305 | 8056833224 | 8056829672 | Bacteria | 9045328 |
| 1306 | Ga0070717_10065248 | |||
| 1307 | JGI24739J22299_10010829 | |||
| 1308 | JGI24739J22299_10054830 | |||
| 1309 | JGI24735J21928_10082150 | |||
| 1310 | JGI24735J21928_10108197 | |||
| 1311 | JGI25153J46596_10033766 | |||
| 1312 | rootL2_10055055 | |||
| 1313 | JGI25160J50197_1018765 | |||
| 1314 | Ga0070658_10095112 | |||
| 1315 | Ga0070683_100135277 | |||
| 1316 | Ga0070683_100448463 | |||
| 1317 | Ga0070680_100237792 | |||
| 1318 | Ga0070691_10026742 | |||
| 1319 | Ga0070671_100378328 | |||
| 1320 | Ga0070667_100122393 | |||
| 1321 | Ga0070709_10000303 | |||
| 1322 | Ga0070709_10000658 | |||
| 1323 | Ga0070709_10063183 | |||
| 1324 | Ga0070714_100001285 | |||
| 1325 | Ga0070714_100007011 | |||
| 1326 | Ga0070714_100017017 | |||
| 1327 | Ga0070714_100042447 | |||
| 1328 | Ga0070714_100082975 | |||
| 1329 | Ga0070714_100084104 | |||
| 1330 | Ga0070714_100126586 | |||
| 1331 | Ga0070714_100254436 | |||
| 1332 | Ga0070714_100710830 | |||
| 1333 | Ga0070713_100000735 | |||
| 1334 | Ga0070713_100083338 | |||
| 1335 | Ga0070713_100084766 | |||
| 1336 | Ga0070713_100096675 | |||
| 1337 | Ga0070713_100107677 | |||
| 1338 | Ga0070713_101711383 | |||
| 1339 | Ga0070710_10002868 | |||
| 1340 | Ga0070711_100001622 | |||
| 1341 | Ga0070711_100002814 | |||
| 1342 | Ga0070711_100042489 | |||
| 1343 | Ga0070711_100104285 | |||
| 1344 | Ga0070711_100270564 | |||
| 1345 | Ga0070711_100493291 | |||
| 1346 | Ga0070708_100254009 | |||
| 1347 | Ga0070663_100207088 | |||
| 1348 | Ga0070663_100474322 | |||
| 1349 | Ga0070678_100236706 | |||
| 1350 | Ga0070681_10115673 | |||
| 1351 | Ga0070681_10182789 | |||
| 1352 | Ga0070706_100001435 | |||
| 1353 | Ga0070706_100005954 | |||
| 1354 | Ga0070706_100038357 | |||
| 1355 | Ga0070706_100291256 | |||
| 1356 | Ga0070706_100409956 | |||
| 1357 | Ga0070707_100000833 | |||
| 1358 | Ga0070707_100019207 | |||
| 1359 | Ga0070707_100023123 | |||
| 1360 | Ga0070707_100398034 | |||
| 1361 | Ga0070698_100000680 | |||
| 1362 | Ga0070698_100001044 | |||
| 1363 | Ga0070698_100041951 | |||
| 1364 | Ga0070698_100051264 | |||
| 1365 | Ga0070699_100044519 | |||
| 1366 | Ga0070699_100359689 | |||
| 1367 | Ga0070699_100667491 | |||
| 1368 | Ga0070697_100073899 | |||
| 1369 | Ga0070697_100168505 | |||
| 1370 | Ga0068853_100042399 | |||
| 1371 | Ga0068853_100168810 | |||
| 1372 | Ga0070695_100668750 | |||
| 1373 | Ga0070696_100511849 | |||
| 1374 | Ga0070665_100073321 | |||
| 1375 | Ga0070665_100093875 | |||
| 1376 | Ga0070665_100172659 | |||
| 1377 | Ga0068855_100110791 | |||
| 1378 | Ga0068855_100207190 | |||
| 1379 | Ga0070664_100358433 | |||
| 1380 | Ga0070664_100893661 | |||
| 1381 | Ga0068854_100788008 | |||
| 1382 | Ga0068852_100007469 | |||
| 1383 | Ga0068859_100737826 | |||
| 1384 | Ga0068863_100121156 | |||
| 1385 | Ga0068860_100126846 | |||
| 1386 | Ga0081455_10309069 | |||
| 1387 | Ga0081540_1003225 | |||
| 1388 | Ga0081540_1155036 | |||
| 1389 | Ga0081539_10066960 | |||
| 1390 | Ga0070717_10004476 | |||
| 1391 | Ga0070717_10114967 | |||
| 1392 | Ga0070717_10123979 | |||
| 1393 | Ga0075365_10230197 | |||
| 1394 | Ga0075363_100066381 | |||
| 1395 | Ga0070715_10038014 | |||
| 1396 | Ga0070715_10071889 | |||
| 1397 | Ga0070716_100000094 | |||
| 1398 | Ga0070716_100004007 | |||
| 1399 | Ga0070716_100222343 | |||
| 1400 | Ga0070712_100224202 | |||
| 1401 | Ga0070712_100235700 | |||
| 1402 | Ga0070712_100562509 | |||
| 1403 | Ga0075367_10120663 | |||
| 1404 | Ga0097621_100031362 | |||
| 1405 | Ga0097621_100105362 | |||
| 1406 | Ga0075370_10271902 | |||
| 1407 | Ga0075428_100013717 | |||
| 1408 | Ga0075428_100223572 | |||
| 1409 | Ga0075433_10011945 | |||
| 1410 | Ga0075433_10027801 | |||
| 1411 | Ga0075433_11107116 | |||
| 1412 | Ga0075434_100017170 | |||
| 1413 | Ga0075434_100141004 | |||
| 1414 | Ga0075434_100848954 | |||
| 1415 | Ga0075429_100184222 | |||
| 1416 | Ga0068865_100312719 | |||
| 1417 | Ga0075436_100002907 | |||
| 1418 | Ga0075436_100026649 | |||
| 1419 | Ga0097620_100737656 | |||
| 1420 | Ga0075435_100038265 | |||
| 1421 | Ga0075435_100128010 | |||
| 1422 | Ga0105251_10042952 | |||
| 1423 | Ga0105244_10138189 | |||
| 1424 | Ga0105240_10002593 | |||
| 1425 | Ga0111539_10217332 | |||
| 1426 | Ga0105245_10022695 | |||
| 1427 | Ga0105247_10097872 | |||
| 1428 | Ga0105247_10140142 | |||
| 1429 | Ga0114129_10008421 | |||
| 1430 | Ga0114129_10068964 | |||
| 1431 | Ga0105243_10364898 | |||
| 1432 | Ga0105243_10501073 | |||
| 1433 | Ga0105243_10534848 | |||
| 1434 | Ga0105241_10001133 | |||
| 1435 | Ga0105241_10054363 | |||
| 1436 | Ga0105241_10197349 | |||
| 1437 | Ga0105248_10112199 | |||
| 1438 | Ga0105248_10301486 | |||
| 1439 | Ga0105237_10033948 | |||
| 1440 | Ga0105237_10525944 | |||
| 1441 | Ga0105237_10587634 | |||
| 1442 | Ga0105238_10019076 | |||
| 1443 | Ga0105249_10574137 | |||
| 1444 | Ga0105239_10080227 | |||
| 1445 | Ga0105246_10012385 | |||
| 1446 | Ga0105246_10157689 | |||
| 1447 | Ga0105246_10173966 | |||
| 1448 | Ga0105246_10655340 | |||
| 1449 | Ga0157370_10024372 | |||
| 1450 | Ga0157369_10231037 | |||
| 1451 | Ga0157374_10009898 | |||
| 1452 | Ga0157374_10028904 | |||
| 1453 | Ga0157378_10174862 | |||
| 1454 | Ga0163162_10391453 | |||
| 1455 | Ga0163162_10490143 | |||
| 1456 | Ga0157372_10062057 | |||
| 1457 | Ga0157372_10188025 | |||
| 1458 | Ga0157372_10281353 | |||
| 1459 | Ga0157372_10457540 | |||
| 1460 | Ga0157375_10277578 | |||
| 1461 | Ga0163163_10003442 | |||
| 1462 | Ga0157380_10255069 | |||
| 1463 | Ga0157377_10155670 | |||
| 1464 | Ga0157377_10852080 | |||
| 1465 | Ga0157379_10002390 | |||
| 1466 | Ga0157376_10007343 | |||
| 1467 | Ga0157376_10102298 | |||
| 1468 | Ga0157376_10520189 | |||
| 1469 | Ga0182006_1047820 | |||
| 1470 | Ga0182007_10000948 | |||
| 1471 | Ga0182005_1024865 | |||
| 1472 | Ga0183367_1015 | |||
| 1473 | Ga0206356_10039005 | |||
| 1474 | Ga0206355_1518046 | |||
| 1475 | Ga0206350_10371078 | |||
| 1476 | Ga0206353_10318742 | |||
| 1477 | Ga0213875_10016990 | |||
| 1478 | Ga0213875_10042697 | |||
| 1479 | Ga0224572_1002611 | |||
| 1480 | Ga0228598_1030632 | |||
| 1481 | Ga0209758_1020439 | |||
| 1482 | Ga0207426_1003984 | |||
| 1483 | Ga0207426_1072135 | |||
| 1484 | Ga0209051_1112049 | |||
| 1485 | Ga0207696_1038217 | |||
| 1486 | Ga0207692_10000198 | |||
| 1487 | Ga0207692_10005056 | |||
| 1488 | Ga0207692_10007347 | |||
| 1489 | Ga0207692_10026163 | |||
| 1490 | Ga0207692_10039943 | |||
| 1491 | Ga0207710_10263081 | |||
| 1492 | Ga0207647_10007289 | |||
| 1493 | Ga0207647_10044080 | |||
| 1494 | Ga0207685_10007645 | |||
| 1495 | Ga0207685_10028498 | |||
| 1496 | Ga0207685_10048016 | |||
| 1497 | Ga0207699_10000355 | |||
| 1498 | Ga0207699_10008211 | |||
| 1499 | Ga0207699_10013730 | |||
| 1500 | Ga0207699_10014905 | |||
| 1501 | Ga0207699_10069936 | |||
| 1502 | Ga0207684_10000549 | |||
| 1503 | Ga0207684_10001867 | |||
| 1504 | Ga0207684_10023269 | |||
| 1505 | Ga0207684_10304429 | |||
| 1506 | Ga0207654_10002025 | |||
| 1507 | Ga0207707_10214262 | |||
| 1508 | Ga0207695_10001075 | |||
| 1509 | Ga0207671_10000122 | |||
| 1510 | Ga0207671_10858263 | |||
| 1511 | Ga0207693_10012402 | |||
| 1512 | Ga0207693_10018785 | |||
| 1513 | Ga0207693_10056204 | |||
| 1514 | Ga0207693_10088416 | |||
| 1515 | Ga0207693_10166610 | |||
| 1516 | Ga0207663_10057034 | |||
| 1517 | Ga0207663_10647442 | |||
| 1518 | Ga0207663_10990230 | |||
| 1519 | Ga0207660_10372919 | |||
| 1520 | Ga0207646_10000577 | |||
| 1521 | Ga0207646_10017839 | |||
| 1522 | Ga0207646_10077134 | |||
| 1523 | Ga0207646_10104929 | |||
| 1524 | Ga0207646_10314217 | |||
| 1525 | Ga0207694_10000829 | |||
| 1526 | Ga0207700_10000427 | |||
| 1527 | Ga0207700_10008608 | |||
| 1528 | Ga0207700_10008868 | |||
| 1529 | Ga0207700_10037684 | |||
| 1530 | Ga0207700_10081039 | |||
| 1531 | Ga0207700_10111952 | |||
| 1532 | Ga0207700_10111987 | |||
| 1533 | Ga0207700_10293449 | |||
| 1534 | Ga0207664_10006111 | |||
| 1535 | Ga0207664_10010058 | |||
| 1536 | Ga0207664_10029954 | |||
| 1537 | Ga0207664_10039826 | |||
| 1538 | Ga0207664_10056279 | |||
| 1539 | Ga0207664_10075145 | |||
| 1540 | Ga0207664_10172013 | |||
| 1541 | Ga0207664_10409254 | |||
| 1542 | Ga0207664_10768876 | |||
| 1543 | Ga0207686_10347464 | |||
| 1544 | Ga0207709_10238836 | |||
| 1545 | Ga0207665_10001080 | |||
| 1546 | Ga0207665_10003971 | |||
| 1547 | Ga0207665_10007451 | |||
| 1548 | Ga0207691_10137592 | |||
| 1549 | Ga0207691_10930167 | |||
| 1550 | Ga0207691_11020483 | |||
| 1551 | Ga0207711_10115701 | |||
| 1552 | Ga0207661_10138298 | |||
| 1553 | Ga0207667_10006929 | |||
| 1554 | Ga0207667_10094891 | |||
| 1555 | Ga0207667_10287468 | |||
| 1556 | Ga0207640_10006140 | |||
| 1557 | Ga0207658_10386164 | |||
| 1558 | Ga0207703_10146273 | |||
| 1559 | Ga0207639_10023348 | |||
| 1560 | Ga0207639_10048788 | |||
| 1561 | Ga0207678_10084430 | |||
| 1562 | Ga0207678_10486158 | |||
| 1563 | Ga0207702_10019973 | |||
| 1564 | Ga0207641_10059677 | |||
| 1565 | Ga0207674_10214750 | |||
| 1566 | Ga0207683_10188808 | |||
| 1567 | Ga0207698_10035262 | |||
| 1568 | Ga0209371_1008032 | |||
| 1569 | Ga0209371_1018659 | |||
| 1570 | Ga0207428_10053288 | |||
| 1571 | Ga0268266_10042600 | |||
| 1572 | Ga0307517_10008770 | |||
| 1573 | Ga0307517_10012587 | |||
| 1574 | Ga0307515_10001114 | |||
| 1575 | Ga0307515_10101266 | |||
| 1576 | Ga0265338_10000718 | |||
| 1577 | Ga0268256_1005719 | |||
| 1578 | Ga0268256_1015837 | |||
| 1579 | Ga0307511_10003592 | |||
| 1580 | Ga0307511_10089148 | |||
| 1581 | Ga0307511_10145549 | |||
| 1582 | Ga0307512_10006056 | |||
| 1583 | Ga0307513_10015029 | |||
| 1584 | Ga0307513_10036984 | |||
| 1585 | Ga0307509_10030305 | |||
| 1586 | Ga0307509_10166488 | |||
| 1587 | Ga0307509_10174524 | |||
| 1588 | Ga0265313_10125733 | |||
| 1589 | Ga0307508_10019325 | |||
| 1590 | Ga0307508_10105662 | |||
| 1591 | Ga0307508_10191297 | |||
| 1592 | Ga0307514_10001631 | |||
| 1593 | Ga0307514_10022169 | |||
| 1594 | Ga0307514_10303992 | |||
| 1595 | Ga0316575_10000002 | |||
| 1596 | Ga0316575_10000356 | |||
| 1597 | Ga0316579_10011102 | |||
| 1598 | Ga0316576_10000206 | |||
| 1599 | Ga0316576_10001306 | |||
| 1600 | Ga0316576_10257292 | |||
| 1601 | Ga0316576_10353518 | |||
| 1602 | Ga0307516_10010607 | |||
| 1603 | Ga0307516_10051538 | |||
| 1604 | Ga0307516_10503110 | |||
| 1605 | Ga0316577_10020948 | |||
| 1606 | Ga0307518_10039052 | |||
| 1607 | Ga0307518_10169360 | |||
| 1608 | Ga0307410_10078913 | |||
| 1609 | Ga0307406_10521558 | |||
| 1610 | Ga0307412_10168871 | |||
| 1611 | Ga0307409_100100195 | |||
| 1612 | Ga0307409_100192306 | |||
| 1613 | Ga0307416_100148139 | |||
| 1614 | Ga0307416_100759353 | |||
| 1615 | Ga0307416_100990072 | |||
| 1616 | Ga0307414_10112584 | |||
| 1617 | Ga0307414_10405169 | |||
| 1618 | Ga0307414_10867056 | |||
| 1619 | Ga0307411_10117908 | |||
| 1620 | Ga0307411_10592719 | |||
| 1621 | Ga0307415_100561399 | |||
| 1622 | Ga0307415_100829103 | |||
| 1623 | Ga0316583_10037055 | |||
| 1624 | Ga0316580_10013909 | |||
| 1625 | Ga0307507_10000013 | |||
| 1626 | Ga0307507_10057967 | |||
| 1627 | Ga0307507_10097415 | |||
| 1628 | Ga0307507_10136125 | |||
| 1629 | Ga0307507_10140857 | |||
| 1630 | Ga0307510_10045037 | |||
| 1631 | Ga0307510_10152409 | |||
| 1632 | Ga0307510_10245106 | |||
| 1633 | Ga0307510_10287941 | |||
| 1634 | Ga0373930_0019205 | |||
| 1635 | Ga0373948_0006582 | |||
| 1636 | Ga0373958_0106638 | |||
| 1637 | Ga0373938_0006469 | |||
| 1638 | Ga0373926_0040258 | |||
| 1639 | Ga0373926_0139670 | |||
| 1640 | Ga0373929_0037106 | |||
| 1641 | Ga0373934_0000184 | |||
| 1642 | Ga0373934_0002392 | |||
| 1643 | Ga0373934_0018608 | |||
| 1644 | Ga0373934_0019406 | |||
| 1645 | Ga0373940_0048960 | |||
| 1646 | Ga0373949_0038148 | |||
| 1647 | Ga0373951_0030281 | |||
| 1648 | Ga0373952_0048375 | |||
| 1649 | Ga0373923_0006465 | |||
| 1650 | Ga0373923_0030219 | |||
| 1651 | Ga0373923_0048861 | |||
| 1652 | Ga0373923_0084512 | |||
| 1653 | Ga0373923_0109734 | |||
| 1654 | Ga0373932_0003623 | |||
| 1655 | Ga0373936_0032597 | |||
| 1656 | Ga0373936_0046718 | |||
| 1657 | Ga0373936_0100073 | |||
| 1658 | Ga0373936_0170120 | |||
| 1659 | Ga0373939_0057298 | |||
| 1660 | Ga0373941_0078018 | |||
| 1661 | Ga0373945_0009754 | |||
| 1662 | Ga0373945_0049152 | |||
| 1663 | Ga0373945_0082988 | |||
| 1664 | Ga0373945_0131611 | |||
| 1665 | Ga0373953_0000116 | |||
| 1666 | Ga0373953_0005235 | |||
| 1667 | Ga0373953_0012677 | |||
| 1668 | Ga0373953_0026389 | |||
| 1669 | Ga0373954_0001000 | |||
| 1670 | Ga0373954_0024414 | |||
| 1671 | Ga0373954_0106711 | |||
| 1672 | Ga0373956_0000136 | |||
| 1673 | Ga0373956_0011462 | |||
| 1674 | Ga0373956_0103573 | |||
| 1675 | Ga0373956_0109470 | |||
| 1676 | Ga0373957_0000035 | |||
| 1677 | Ga0373957_0002953 | |||
| 1678 | Ga0373957_0003000 | |||
| 1679 | Ga0373957_0018235 | |||
| 1680 | Ga0373957_0061778 | |||
| 1681 | Ga0373960_0011091 | |||
| 1682 | Ga0373943_0494058 | |||
| 1683 | Ga0373946_0132812 | |||
| 1684 | Ga0373946_0299054 | |||
| 1685 | Ga0373955_0000072 | |||
| 1686 | Ga0373955_0010552 | |||
| 1687 | Ga0373955_0042016 | |||
| 1688 | Ga0373955_0048357 | |||
| 1689 | Ga0373955_0091799 | |||
| 1690 | Ga0373955_0264755 | |||
| 1691 | Ga0373942_0035611 | |||
| 1692 | Ga0373962_0009821 | |||
| 1693 | Ga0316574_0021271 | |||
| 1694 | Ga0316574_0209927 | |||
| 1695 | Ga0373924_0001000 | |||
| 1696 | Ga0373924_0002302 | |||
| 1697 | Ga0373924_0012374 | |||
| 1698 | Ga0373924_0026843 | |||
| 1699 | Ga0373931_0143278 | |||
| 1700 | Ga0373931_0291280 | |||
| 1701 | Ga0373931_0550532 | |||
| 1702 | Ga0373935_0045702 | |||
| 1703 | Ga0373935_0120221 | |||
| 1704 | Ga0373935_0151149 | |||
| 1705 | Ga0373935_0170699 | |||
| 1706 | Ga0373935_0396466 | |||
| 1707 | Ga0373927_0080460 | |||
| 1708 | Ga0373933_0000327 | |||
| 1709 | Ga0373933_0006553 | |||
| 1710 | Ga0373933_0018940 | |||
| 1711 | Ga0373933_0036349 | |||
| 1712 | Ga0373933_0160018 | |||
| 1713 | Ga0373933_0200604 | |||
| 1714 | Ga0373947_0075049 | |||
| 1715 | Ga0373947_0100587 | |||
| 1716 | Ga0373947_0129409 | |||
| 1717 | Ga0373947_0161540 | |||
| 1718 | Ga0373937_0000010 | |||
| 1719 | Ga0373937_0001685 | |||
| 1720 | Ga0373937_0009917 | |||
| 1721 | Ga0373937_0017506 | |||
| 1722 | Ga0373937_0803493 | |||
| 1723 | Ga0316582_0025759 | |||
| 1724 | Ga0316584_0000468 | |||
| 1725 | Ga0316584_0367146 | |||
| 1726 | Ga0316584_0733065 | |||
| 1727 | Ga0373925_0103218 | |||
| 1728 | Ga0373925_0134396 | |||
| 1729 | Ga0373925_0300626 | |||
| 1730 | Ga0373925_0377747 | |||
| 1731 | Ga0395899_0002623 | |||
| 1732 | Ga0395899_0203269 | |||
| 1733 | Ga0395898_0031982 | |||
| 1734 | Ga0395898_0058062 | |||
| 1735 | Ga0316581_0002277 | |||
| 1736 | Ga0436364_0849349 | |||
| 1737 | Ga0436364_0894524 | |||
| 1738 | Ga0436364_1059010 | |||
| 1739 | Ga0436364_1147169 | |||
| 1740 | Ga0395901_1541329 | |||
| 1741 | Ga0436363_1505785 | |||
| 1742 | Ga0436362_0845973 | |||
| 1743 | Ga0439436_0003576 | |||
| 1744 | Ga0439436_0008118 | |||
| 1745 | Ga0439439_0000554 | |||
| 1746 | Ga0439453_0021310 | |||
| 1747 | Ga0451791_0512465 | |||
| 1748 | Ga0451795_0794252 | |||
| 1749 | Ga0451802_1325708 | |||
| 1750 | Ga0451841_0752493 | |||
| 1751 | Ga0451853_2214190 | |||
| 1752 | Ga0439433_0000267 | |||
| 1753 | Ga0439442_030524 | |||
| 1754 | Ga0439448_0009759 | |||
| 1755 | Ga0439448_0125248 | |||
| 1756 | Ga0439449_0003868 | |||
| 1757 | Ga0439449_0006979 | |||
| 1758 | Ga0439455_0085584 | |||
| 1759 | Ga0439457_000100 | |||
| 1760 | Ga0439457_001085 | |||
| 1761 | Ga0439462_0003676 | |||
| 1762 | Ga0450894_001105 | |||
| 1763 | Ga0450895_002110 | |||
| 1764 | Ga0450898_001128 | |||
| 1765 | Ga0450899_000632 | |||
| 1766 | Ga0450903_000500 | |||
| 1767 | Ga0450906_003967 | |||
| 1768 | Ga0439458_0007753 | |||
| 1769 | Ga0439458_0073582 | |||
| 1770 | Ga0450908_009782 | |||
| 1771 | Ga0466969_0004692 | |||
| 1772 | Ga0466969_0007675 | |||
| 1773 | Ga0466969_0018099 | |||
| 1774 | Ga0466969_0018877 | |||
| 1775 | Ga0466969_0107910 | |||
| 1776 | Ga0466972_0012556 | |||
| 1777 | Ga0466972_0073178 | |||
| 1778 | Ga0466972_0131987 | |||
| 1779 | Ga0466972_0164257 | |||
| 1780 | Ga0466965_0083545 | |||
| 1781 | Ga0466965_0129997 | |||
| 1782 | Ga0466965_0194482 | |||
| 1783 | Ga0466966_0001731 | |||
| 1784 | Ga0466966_0002839 | |||
| 1785 | Ga0466966_0007222 | |||
| 1786 | Ga0466966_0015224 | |||
| 1787 | Ga0466966_0035646 | |||
| 1788 | Ga0466966_0041189 | |||
| 1789 | Ga0466966_0274986 | |||
| 1790 | Ga0466961_0006951 | |||
| 1791 | Ga0466961_0012581 | |||
| 1792 | Ga0466961_0029154 | |||
| 1793 | Ga0466961_0037073 | |||
| 1794 | Ga0466961_0056218 | |||
| 1795 | Ga0466961_0060219 | |||
| 1796 | Ga0466961_0142714 | |||
| 1797 | Ga0466961_0412060 | |||
| 1798 | Ga0466963_0004122 | |||
| 1799 | Ga0466963_0004646 | |||
| 1800 | Ga0466963_0180150 | |||
| 1801 | Ga0466963_0283112 | |||
| 1802 | Ga0466963_0759646 | |||
| 1803 | Ga0466963_0927377 | |||
| 1804 | Ga0466964_0080868 | |||
| 1805 | Ga0466964_0299217 | |||
| 1806 | Ga0466971_0004706 | |||
| 1807 | Ga0466971_0005777 | |||
| 1808 | Ga0466971_0010182 | |||
| 1809 | Ga0466971_0040149 | |||
| 1810 | Ga0466971_0048922 | |||
| 1811 | Ga0466971_0209622 | |||
| 1812 | Ga0466968_0087727 | |||
| 1813 | Ga0466970_0000340 | |||
| 1814 | Ga0466970_0007649 | |||
| 1815 | Ga0466970_0011402 | |||
| 1816 | Ga0466970_0105706 | |||
| 1817 | Ga0466970_0264396 | |||
| 1818 | Ga0466970_0512832 | |||
| 1819 | Ga0466957_0000482 | |||
| 1820 | Ga0466957_0031489 | |||
| 1821 | Ga0466957_0349244 | |||
| 1822 | Ga0466960_0002803 | |||
| 1823 | Ga0466960_0125492 | |||
| 1824 | Ga0466960_0171059 | |||
| 1825 | Ga0466959_0001725 | |||
| 1826 | Ga0466959_0012149 | |||
| 1827 | Ga0466959_0015474 | |||
| 1828 | Ga0466959_0024315 | |||
| 1829 | Ga0466959_0097990 | |||
| 1830 | Ga0466959_0125601 | |||
| 1831 | Ga0466959_0218628 | |||
| 1832 | Ga0466959_0244598 | |||
| 1833 | Ga0466958_0000083 | |||
| 1834 | Ga0466958_0014280 | |||
| 1835 | Ga0466958_0070274 | |||
| 1836 | Ga0466958_0127815 | |||
| 1837 | Ga0466967_0035261 | |||
| 1838 | Ga0466967_0105117 | |||
| 1839 | Ga0466967_0201985 | |||
| 1840 | Ga0466967_1645105 | |||
| 1841 | Ga0495617_003736 | |||
| 1842 | Ga0495592_0000136 | |||
| 1843 | Ga0495592_0006355 | |||
| 1844 | Ga0495592_0015144 | |||
| 1845 | Ga0495592_0075441 | |||
| 1846 | Ga0495592_0093513 | |||
| 1847 | Ga0495592_0131556 | |||
| 1848 | Ga0495592_0180425 | |||
| 1849 | Ga0495592_0372488 | |||
| 1850 | Ga0495603_0004768 | |||
| 1851 | Ga0495603_0016026 | |||
| 1852 | Ga0495603_0023453 | |||
| 1853 | Ga0495603_0029409 | |||
| 1854 | Ga0495603_0055964 | |||
| 1855 | Ga0495603_0073210 | |||
| 1856 | Ga0495629_0004137 | |||
| 1857 | Ga0495629_0009288 | |||
| 1858 | Ga0495629_0010861 | |||
| 1859 | Ga0495629_0011501 | |||
| 1860 | Ga0495629_0059207 | |||
| 1861 | Ga0495629_0062453 | |||
| 1862 | Ga0495629_0065153 | |||
| 1863 | Ga0495629_0118408 | |||
| 1864 | Ga0495629_0242946 | |||
| 1865 | Ga0495629_0545579 | |||
| 1866 | Ga0495638_0013477 | |||
| 1867 | Ga0495638_0027916 | |||
| 1868 | Ga0495638_0040475 | |||
| 1869 | Ga0495638_0082360 | |||
| 1870 | Ga0495641_0014933 | |||
| 1871 | Ga0495641_0041104 | |||
| 1872 | Ga0495641_0043399 | |||
| 1873 | Ga0495641_0075536 | |||
| 1874 | Ga0495641_0229465 | |||
| 1875 | Ga0495651_0000047 | |||
| 1876 | Ga0495651_0000251 | |||
| 1877 | Ga0495651_0000452 | |||
| 1878 | Ga0495651_0006816 | |||
| 1879 | Ga0495651_0014042 | |||
| 1880 | Ga0495651_0015668 | |||
| 1881 | Ga0495651_0123334 | |||
| 1882 | Ga0495651_0148793 | |||
| 1883 | Ga0495653_0000753 | |||
| 1884 | Ga0495653_0016556 | |||
| 1885 | Ga0495653_0019645 | |||
| 1886 | Ga0495653_0039630 | |||
| 1887 | Ga0495653_0061156 | |||
| 1888 | Ga0495653_0065677 | |||
| 1889 | Ga0495653_0149206 | |||
| 1890 | Ga0495653_0195548 | |||
| 1891 | Ga0495580_0035896 | |||
| 1892 | Ga0495580_0094787 | |||
| 1893 | Ga0495582_0004891 | |||
| 1894 | Ga0495582_0041169 | |||
| 1895 | Ga0495582_0122487 | |||
| 1896 | Ga0495582_0244922 | |||
| 1897 | Ga0495582_0538378 | |||
| 1898 | Ga0495639_0009946 | |||
| 1899 | Ga0495639_0082203 | |||
| 1900 | Ga0495662_0000990 | |||
| 1901 | Ga0495662_0013161 | |||
| 1902 | Ga0495662_0016011 | |||
| 1903 | Ga0495662_0017846 | |||
| 1904 | Ga0495662_0023647 | |||
| 1905 | Ga0495662_0069877 | |||
| 1906 | Ga0495662_0275317 | |||
| 1907 | Ga0495664_0000447 | |||
| 1908 | Ga0495664_0006683 | |||
| 1909 | Ga0495664_0007598 | |||
| 1910 | Ga0495664_0012044 | |||
| 1911 | Ga0495664_0033188 | |||
| 1912 | Ga0495664_0084649 | |||
| 1913 | Ga0495585_0009338 | |||
| 1914 | Ga0495585_0028053 | |||
| 1915 | Ga0495585_0079626 | |||
| 1916 | Ga0495585_0080988 | |||
| 1917 | Ga0495594_0006912 | |||
| 1918 | Ga0495594_0013664 | |||
| 1919 | Ga0495594_0051380 | |||
| 1920 | Ga0495594_0090696 | |||
| 1921 | Ga0495594_0141163 | |||
| 1922 | Ga0495594_0169880 | |||
| 1923 | Ga0495607_0016214 | |||
| 1924 | Ga0495583_0015667 | |||
| 1925 | Ga0495606_0010908 | |||
| 1926 | Ga0495608_0000089 | |||
| 1927 | Ga0495608_0005222 | |||
| 1928 | Ga0495608_0010518 | |||
| 1929 | Ga0495608_0012351 | |||
| 1930 | Ga0495608_0029367 | |||
| 1931 | Ga0495608_0030063 | |||
| 1932 | Ga0495610_0028169 | |||
| 1933 | Ga0495616_0005383 | |||
| 1934 | Ga0495618_0027385 | |||
| 1935 | Ga0495618_0152604 | |||
| 1936 | Ga0495618_0306676 | |||
| 1937 | Ga0495620_0031352 | |||
| 1938 | Ga0495628_0000325 | |||
| 1939 | Ga0495628_0003602 | |||
| 1940 | Ga0495628_0005690 | |||
| 1941 | Ga0495628_0032896 | |||
| 1942 | Ga0495628_0039248 | |||
| 1943 | Ga0495628_0043744 | |||
| 1944 | Ga0495628_0076458 | |||
| 1945 | Ga0495628_0113392 | |||
| 1946 | Ga0495628_0136341 | |||
| 1947 | Ga0495628_0144274 | |||
| 1948 | Ga0495628_0169940 | |||
| 1949 | Ga0495628_0312066 | |||
| 1950 | Ga0495630_0054579 | |||
| 1951 | Ga0495630_0076461 | |||
| 1952 | Ga0495630_0098499 | |||
| 1953 | Ga0495630_0176416 | |||
| 1954 | Ga0495630_0190313 | |||
| 1955 | Ga0495630_0199897 | |||
| 1956 | Ga0495631_0009662 | |||
| 1957 | Ga0495631_0093134 | |||
| 1958 | Ga0495632_0167646 | |||
| 1959 | Ga0495637_0024609 | |||
| 1960 | Ga0495643_0001898 | |||
| 1961 | Ga0495643_0005581 | |||
| 1962 | Ga0495643_0118303 | |||
| 1963 | Ga0495648_0208265 | |||
| 1964 | Ga0495666_0000558 | |||
| 1965 | Ga0495666_0005462 | |||
| 1966 | Ga0495666_0011524 | |||
| 1967 | Ga0495666_0129906 | |||
| 1968 | Ga0495666_0169154 | |||
| 1969 | Ga0495652_0000199 | |||
| 1970 | Ga0495652_0000982 | |||
| 1971 | Ga0495652_0006292 | |||
| 1972 | Ga0495652_0017286 | |||
| 1973 | Ga0495652_0023352 | |||
| 1974 | Ga0495652_0031986 | |||
| 1975 | Ga0495652_0038570 | |||
| 1976 | Ga0495652_0047643 | |||
| 1977 | Ga0495652_0062877 | |||
| 1978 | Ga0495652_0084586 | |||
| 1979 | Ga0495652_0140223 | |||
| 1980 | Ga0495652_0324755 | |||
| 1981 | Ga0495654_0003823 | |||
| 1982 | Ga0495665_0003003 | |||
| 1983 | Ga0495665_0014672 | |||
| 1984 | Ga0495665_0017945 | |||
| 1985 | Ga0495665_0209156 | |||
| 1986 | Ga0495665_0284761 | |||
| 1987 | Ga0495640_0007528 | |||
| 1988 | Ga0495640_0012287 | |||
| 1989 | Ga0495640_0013458 | |||
| 1990 | Ga0495640_0047394 | |||
| 1991 | Ga0495640_0107147 | |||
| 1992 | Ga0495640_0116559 | |||
| 1993 | Ga0495640_0160390 | |||
| 1994 | Ga0495586_0001586 | |||
| 1995 | Ga0495586_0001723 | |||
| 1996 | Ga0495586_0008008 | |||
| 1997 | Ga0495586_0038041 | |||
| 1998 | Ga0495586_0082919 | |||
| 1999 | Ga0495586_0087249 | |||
| 2000 | Ga0495586_0127408 | |||
| 2001 | Ga0495587_0000074 | |||
| 2002 | Ga0495587_0000644 | |||
| 2003 | Ga0495587_0012793 | |||
| 2004 | Ga0495587_0024905 | |||
| 2005 | Ga0495587_0025699 | |||
| 2006 | Ga0495587_0072375 | |||
| 2007 | Ga0495587_0111917 | |||
| 2008 | Ga0495587_0240668 | |||
| 2009 | Ga0495609_0009209 | |||
| 2010 | Ga0495597_0036879 | |||
| 2011 | Ga0495597_0221597 | |||
| 2012 | Ga0495597_0332363 | |||
| 2013 | Ga0495645_0003455 | |||
| 2014 | Ga0495645_0007656 | |||
| 2015 | Ga0495645_0014924 | |||
| 2016 | Ga0495645_0017450 | |||
| 2017 | Ga0495645_0035334 | |||
| 2018 | Ga0495645_0063472 | |||
| 2019 | Ga0495645_0076533 | |||
| 2020 | Ga0495645_0223340 | |||
| 2021 | Ga0495645_0281841 | |||
| 2022 | Ga0495645_0744917 | |||
| 2023 | Ga0495622_0002086 | |||
| 2024 | Ga0495622_0004999 | |||
| 2025 | Ga0495622_0045660 | |||
| 2026 | Ga0495622_0063860 | |||
| 2027 | Ga0495622_0066602 | |||
| 2028 | Ga0495633_0004699 | |||
| 2029 | Ga0495633_0052786 | |||
| 2030 | Ga0495667_0000064 | |||
| 2031 | Ga0495667_0000347 | |||
| 2032 | Ga0495667_0002034 | |||
| 2033 | Ga0495667_0008486 | |||
| 2034 | Ga0495667_0022169 | |||
| 2035 | Ga0495667_0038878 | |||
| 2036 | Ga0495667_0088717 | |||
| 2037 | Ga0495634_0000804 | |||
| 2038 | Ga0495634_0006199 | |||
| 2039 | Ga0495634_0032561 | |||
| 2040 | Ga0495634_0036650 | |||
| 2041 | Ga0495634_0101575 | |||
| 2042 | Ga0495634_0667932 | |||
| 2043 | Ga0495611_0013516 | |||
| 2044 | Ga0495611_0222453 | |||
| 2045 | Ga0495625_0104124 | |||
| 2046 | Ga0495625_0150270 | |||
| 2047 | Ga0495625_0279644 | |||
| 2048 | Ga0495635_0001573 | |||
| 2049 | Ga0495635_0020778 | |||
| 2050 | Ga0495635_0023230 | |||
| 2051 | Ga0495635_0045888 | |||
| 2052 | Ga0495635_0051031 | |||
| 2053 | Ga0495635_0089295 | |||
| 2054 | Ga0495635_0103554 | |||
| 2055 | Ga0495635_0375411 | |||
| 2056 | Ga0495635_0624193 | |||
| 2057 | Ga0495661_0014414 | |||
| 2058 | Ga0495661_0160081 | |||
| 2059 | Ga0495588_0009014 | |||
| 2060 | Ga0495588_0033389 | |||
| 2061 | Ga0495588_0079314 | |||
| 2062 | Ga0495588_0153539 | |||
| 2063 | Ga0495588_0243192 | |||
| 2064 | Ga0495657_0000009 | |||
| 2065 | Ga0495657_0015381 | |||
| 2066 | Ga0495657_0022658 | |||
| 2067 | Ga0495657_0023773 | |||
| 2068 | Ga0495657_0025398 | |||
| 2069 | Ga0495657_0030262 | |||
| 2070 | Ga0495657_0041850 | |||
| 2071 | Ga0495657_0057845 | |||
| 2072 | Ga0495657_0069033 | |||
| 2073 | Ga0495657_0204768 | |||
| 2074 | Ga0495599_0000084 | |||
| 2075 | Ga0495599_0024103 | |||
| 2076 | Ga0495599_0133992 | |||
| 2077 | Ga0495599_0257210 | |||
| 2078 | Ga0495599_0271365 | |||
| 2079 | Ga0495623_0000168 | |||
| 2080 | Ga0495623_0016760 | |||
| 2081 | Ga0495623_0019236 | |||
| 2082 | Ga0495623_0024851 | |||
| 2083 | Ga0495623_0135912 | |||
| 2084 | Ga0495623_0137406 | |||
| 2085 | Ga0495623_0156499 | |||
| 2086 | Ga0495623_0210545 | |||
| 2087 | Ga0495623_0321023 | |||
| 2088 | Ga0495646_0000131 | |||
| 2089 | Ga0495646_0006779 | |||
| 2090 | Ga0495646_0010288 | |||
| 2091 | Ga0495646_0030816 | |||
| 2092 | Ga0495646_0084121 | |||
| 2093 | Ga0495646_0264135 | |||
| 2094 | Ga0495647_0024412 | |||
| 2095 | Ga0495658_0014985 | |||
| 2096 | Ga0495658_0153570 | |||
| 2097 | Ga0495613_0000387 | |||
| 2098 | Ga0495613_0002214 | |||
| 2099 | Ga0495613_0004116 | |||
| 2100 | Ga0495613_0082328 | |||
| 2101 | Ga0495613_0229356 | |||
| 2102 | Ga0495613_0238367 | |||
| 2103 | Ga0495624_0009562 | |||
| 2104 | Ga0495624_0024942 | |||
| 2105 | Ga0495624_0082931 | |||
| 2106 | Ga0495624_0113025 | |||
| 2107 | Ga0495670_0004170 | |||
| 2108 | Ga0495670_0222664 | |||
| 2109 | Ga0495671_0013623 | |||
| 2110 | Ga0495649_0120395 | |||
| 2111 | Ga0495649_0302760 | |||
| 2112 | Ga0495589_0013467 | |||
| 2113 | Ga0495589_0141399 | |||
| 2114 | Ga0495600_0009602 | |||
| 2115 | Ga0495600_0009890 | |||
| 2116 | Ga0495600_0011653 | |||
| 2117 | Ga0495600_0012067 | |||
| 2118 | Ga0495600_0015357 | |||
| 2119 | Ga0495600_0020564 | |||
| 2120 | Ga0495600_0086335 | |||
| 2121 | Ga0495600_0122217 | |||
| 2122 | Ga0495600_0178561 | |||
| 2123 | Ga0495600_0223964 | |||
| 2124 | Ga0495600_0336237 | |||
| 2125 | Ga0495660_0006126 | |||
| 2126 | Ga0495660_0012927 | |||
| 2127 | Ga0495581_0003195 | |||
| 2128 | Ga0495581_0015726 | |||
| 2129 | Ga0495581_0032518 | |||
| 2130 | Ga0495581_0061905 | |||
| 2131 | Ga0495581_0099920 | |||
| 2132 | Ga0495581_0156169 | |||
| 2133 | Ga0495581_0173333 | |||
| 2134 | Ga0495581_0247640 | |||
| 2135 | Ga0495581_0262280 | |||
| 2136 | Ga0495604_0000070 | |||
| 2137 | Ga0495604_0000385 | |||
| 2138 | Ga0495604_0001476 | |||
| 2139 | Ga0495604_0002049 | |||
| 2140 | Ga0495604_0018002 | |||
| 2141 | Ga0495604_0066109 | |||
| 2142 | Ga0495604_0073929 | |||
| 2143 | Ga0495604_0081059 | |||
| 2144 | Ga0495604_0141052 | |||
| 2145 | Ga0495604_0233206 | |||
| 2146 | Ga0495604_0404711 | |||
| 2147 | Ga0495636_0004226 | |||
| 2148 | Ga0495636_0036138 | |||
| 2149 | Ga0495636_0088713 | |||
| 2150 | Ga0495636_0343015 | |||
| 2151 | Ga0495674_0018316 | |||
| 2152 | Ga0495674_0051585 | |||
| 2153 | Ga0495674_0053562 | |||
| 2154 | Ga0495674_0109000 | |||
| 2155 | Ga0495674_0162255 | |||
| 2156 | Ga0495674_0204688 | |||
| 2157 | Ga0495674_0241459 | |||
| 2158 | Ga0495674_0282899 | |||
| 2159 | Ga0495672_0425365 | |||
| 2160 | Ga0495676_0004682 | |||
| 2161 | Ga0495676_0027215 | |||
| 2162 | Ga0495676_0062084 | |||
| 2163 | Ga0495676_0076992 | |||
| 2164 | Ga0495676_0203918 | |||
| 2165 | Ga0495676_0257478 | |||
| 2166 | Ga0495676_0481799 | |||
| 2167 | Ga0495680_0000195 | |||
| 2168 | Ga0495680_0004196 | |||
| 2169 | Ga0495680_0007153 | |||
| 2170 | Ga0495680_0017098 | |||
| 2171 | Ga0495680_0020452 | |||
| 2172 | Ga0495680_0021436 | |||
| 2173 | Ga0495680_0027349 | |||
| 2174 | Ga0495683_0086524 | |||
| 2175 | Ga0495683_0171299 | |||
| 2176 | Ga0495687_009716 | |||
| 2177 | Ga0495687_067544 | |||
| 2178 | Ga0495687_077248 | |||
| 2179 | Ga0495675_0002990 | |||
| 2180 | Ga0495675_0003023 | |||
| 2181 | Ga0495675_0011010 | |||
| 2182 | Ga0495675_0017663 | |||
| 2183 | Ga0495675_0021862 | |||
| 2184 | Ga0495675_0027933 | |||
| 2185 | Ga0495675_0054932 | |||
| 2186 | Ga0495675_0139644 | |||
| 2187 | Ga0495679_024981 | |||
| 2188 | Ga0495679_044078 | |||
| 2189 | Ga0495685_001876 | |||
| 2190 | Ga0495685_009339 | |||
| 2191 | Ga0495685_011010 | |||
| 2192 | Ga0495681_0003180 | |||
| 2193 | Ga0495681_0017515 | |||
| 2194 | Ga0495681_0157153 | |||
| 2195 | Ga0495684_0017677 | |||
| 2196 | Ga0495684_0097621 | |||
| 2197 | Ga0495684_0123162 | |||
| 2198 | Ga0495684_0157045 | |||
| 2199 | Ga0495686_0029178 | |||
| 2200 | Ga0495686_0071898 | |||
| 2201 | Ga0495686_0238381 | |||
| 2202 | Ga0495686_0243020 | |||
| 2203 | Ga0495593_0001454 | |||
| 2204 | Ga0495593_0006130 | |||
| 2205 | Ga0495593_0021962 | |||
| 2206 | Ga0495593_0035826 | |||
| 2207 | Ga0495593_0037710 | |||
| 2208 | Ga0495593_0050511 | |||
| 2209 | Ga0495593_0065512 | |||
| 2210 | Ga0495593_0083795 | |||
| 2211 | Ga0495602_0000122 | |||
| 2212 | Ga0495602_0017568 | |||
| 2213 | Ga0495602_0030008 | |||
| 2214 | Ga0495602_0033322 | |||
| 2215 | Ga0495602_0053483 | |||
| 2216 | Ga0495602_0061115 | |||
| 2217 | Ga0495602_0068896 | |||
| 2218 | Ga0495602_0070400 | |||
| 2219 | Ga0495602_0211322 | |||
| 2220 | Ga0495602_0291745 | |||
| 2221 | Ga0495602_0733293 | |||
| 2222 | Ga0495614_0000388 | |||
| 2223 | Ga0495614_0016264 | |||
| 2224 | Ga0495614_0042976 | |||
| 2225 | Ga0495614_0127501 | |||
| 2226 | Ga0495614_0202979 | |||
| 2227 | Ga0495626_0006119 | |||
| 2228 | Ga0496100_0054621 | |||
| 2229 | Ga0496100_0297860 | |||
| 2230 | Ga0496101_0059634 | |||
| 2231 | Ga0496101_0078212 | |||
| 2232 | Ga0496101_0364105 | |||
| 2233 | Ga0496102_0064355 | |||
| 2234 | Ga0496104_0000909 | |||
| 2235 | Ga0496104_0055242 | |||
| 2236 | Ga0496104_0074102 | |||
| 2237 | Ga0496104_0518311 | |||
| 2238 | Ga0496104_1182853 | |||
| 2239 | Ga0496105_0009583 | |||
| 2240 | Ga0496105_0056371 | |||
| 2241 | Ga0496105_0197646 | |||
| 2242 | Ga0496105_0779095 | |||
| 2243 | Ga0496106_0014561 | |||
| 2244 | Ga0496106_0028480 | |||
| 2245 | Ga0496106_0106933 | |||
| 2246 | Ga0496106_0414000 | |||
| 2247 | Ga0496107_0113543 | |||
| 2248 | Ga0496107_0215977 | |||
| 2249 | Ga0496108_0001829 | |||
| 2250 | Ga0496108_0019071 | |||
| 2251 | Ga0496108_0065031 | |||
| 2252 | Ga0496109_0286016 | |||
| 2253 | Ga0496109_0537695 | |||
| 2254 | Ga0496110_0039855 | |||
| 2255 | Ga0496110_1015379 | |||
| 2256 | Ga0496111_0176849 | |||
| 2257 | Ga0496111_0348790 | |||
| 2258 | Ga0496112_0000817 | |||
| 2259 | Ga0496112_0098289 | |||
| 2260 | Ga0496112_0213307 | |||
| 2261 | Ga0496113_0020163 | |||
| 2262 | Ga0496113_0134982 | |||
| 2263 | Ga0496113_0570344 | |||
| 2264 | Ga0496114_0012843 | |||
| 2265 | Ga0496114_0063734 | |||
| 2266 | Ga0496114_0155272 | |||
| 2267 | Ga0496114_0354594 | |||
| 2268 | Ga0496114_0373705 | |||
| 2269 | Ga0496115_0016929 | |||
| 2270 | Ga0496117_0053353 | |||
| 2271 | Ga0496118_0031289 | |||
| 2272 | Ga0496118_0034550 | |||
| 2273 | Ga0496118_0053609 | |||
| 2274 | Ga0496119_0070378 | |||
| 2275 | Ga0496121_0254923 | |||
| 2276 | Ga0496122_0000206 | |||
| 2277 | Ga0496122_0000583 | |||
| 2278 | Ga0496122_0130527 | |||
| 2279 | Ga0496123_0000112 | |||
| 2280 | Ga0496124_0000290 | |||
| 2281 | Ga0496124_0113231 | |||
| 2282 | Ga0496125_0000069 | |||
| 2283 | Ga0496125_0011923 | |||
| 2284 | Ga0496126_0088751 | |||
| 2285 | Ga0496126_0125238 | |||
| 2286 | Ga0501308_040256 | |||
| 2287 | Ga0501310_020266 | |||
| 2288 | Ga0501307_030584 | |||
| 2289 | Ga0495682_0022616 | |||
| 2290 | Ga0501311_000618 | |||
| 2291 | Ga0501313_040960 | |||
| 2292 | Ga0501315_000989 | |||
| 2293 | Ga0501316_011534 | |||
| 2294 | Ga0501317_001679 | |||
| 2295 | Ga0501323_001534 | |||
| 2296 | Ga0501323_001795 | |||
| 2297 | Ga0501324_003212 | |||
| 2298 | Ga0501324_006757 | |||
| 2299 | Ga0501031_0057014 | |||
| 2300 | Ga0501031_0118152 | |||
| 2301 | Ga0501032_0013368 | |||
| 2302 | Ga0501032_0023444 | |||
| 2303 | Ga0501032_0045515 | |||
| 2304 | Ga0501032_0449553 | |||
| 2305 | Ga0501032_0528863 | |||
| 2306 | Ga0501033_0020260 | |||
| 2307 | Ga0501033_0037370 | |||
| 2308 | Ga0501033_0057008 | |||
| 2309 | Ga0501033_0066039 | |||
| 2310 | Ga0501033_0090480 | |||
| 2311 | Ga0501033_0110208 | |||
| 2312 | Ga0501033_0179412 | |||
| 2313 | Ga0501033_0322770 | |||
| 2314 | Ga0501033_0656214 | |||
| 2315 | Ga0501034_0012571 | |||
| 2316 | Ga0501034_0054193 | |||
| 2317 | Ga0501034_0064608 | |||
| 2318 | Ga0501034_0067569 | |||
| 2319 | Ga0501034_0122802 | |||
| 2320 | Ga0501034_0144207 | |||
| 2321 | Ga0501034_0173514 | |||
| 2322 | Ga0501034_0184832 | |||
| 2323 | Ga0501034_0196901 | |||
| 2324 | Ga0501036_0001212 | |||
| 2325 | Ga0501036_0010825 | |||
| 2326 | Ga0501036_0019020 | |||
| 2327 | Ga0501036_0103822 | |||
| 2328 | Ga0501036_0116899 | |||
| 2329 | Ga0501036_0121639 | |||
| 2330 | Ga0501037_0003070 | |||
| 2331 | Ga0501037_0029527 | |||
| 2332 | Ga0501037_0034235 | |||
| 2333 | Ga0501038_0002444 | |||
| 2334 | Ga0501038_0032589 | |||
| 2335 | Ga0501038_0033075 | |||
| 2336 | Ga0501038_0048790 | |||
| 2337 | Ga0501038_0056405 | |||
| 2338 | Ga0501038_0159952 | |||
| 2339 | Ga0501039_0101931 | |||
| 2340 | Ga0501039_0179252 | |||
| 2341 | Ga0501039_0394748 | |||
| 2342 | Ga0501039_0495527 | |||
| 2343 | Ga0501040_0015630 | |||
| 2344 | Ga0501041_0055004 | |||
| 2345 | Ga0501041_0099014 | |||
| 2346 | Ga0501042_0009583 | |||
| 2347 | Ga0501042_0130741 | |||
| 2348 | Ga0501042_0145961 | |||
| 2349 | Ga0501042_0200902 | |||
| 2350 | Ga0501042_0234895 | |||
| 2351 | Ga0501042_0426463 | |||
| 2352 | Ga0501043_0002529 | |||
| 2353 | Ga0501043_0050030 | |||
| 2354 | Ga0501043_0050056 | |||
| 2355 | Ga0501043_0078531 | |||
| 2356 | Ga0501043_0087964 | |||
| 2357 | Ga0501043_0091296 | |||
| 2358 | Ga0501043_0375761 | |||
| 2359 | Ga0501046_0010869 | |||
| 2360 | Ga0501046_0197949 | |||
| 2361 | Ga0501046_0258282 | |||
| 2362 | Ga0501047_0000072 | |||
| 2363 | Ga0501047_0002236 | |||
| 2364 | Ga0501047_0023511 | |||
| 2365 | Ga0501047_0032695 | |||
| 2366 | Ga0501047_0052175 | |||
| 2367 | Ga0501047_0095566 | |||
| 2368 | Ga0501047_0131287 | |||
| 2369 | Ga0501047_0162290 | |||
| 2370 | Ga0501047_0249736 | |||
| 2371 | Ga0501047_0402959 | |||
| 2372 | Ga0501048_0023021 | |||
| 2373 | Ga0501048_0024072 | |||
| 2374 | Ga0501048_0096263 | |||
| 2375 | Ga0501048_0099477 | |||
| 2376 | Ga0501068_0119074 | |||
| 2377 | Ga0501068_0509124 | |||
| 2378 | Ga0501068_0852955 | |||
| 2379 | Ga0501070_0012353 | |||
| 2380 | Ga0501070_0042504 | |||
| 2381 | Ga0501070_0121758 | |||
| 2382 | Ga0501070_0160054 | |||
| 2383 | Ga0501070_0537854 | |||
| 2384 | Ga0501071_0045006 | |||
| 2385 | Ga0501071_1189265 | |||
| 2386 | Ga0501072_0076238 | |||
| 2387 | Ga0501072_0148963 | |||
| 2388 | Ga0501073_0008499 | |||
| 2389 | Ga0501073_0499502 | |||
| 2390 | Ga0501074_0000848 | |||
| 2391 | Ga0501074_0057023 | |||
| 2392 | Ga0501076_0049046 | |||
| 2393 | Ga0501076_0425975 | |||
| 2394 | Ga0501235_037277 | |||
| 2395 | Ga0501257_019938 | |||
| 2396 | Ga0501079_0170812 | |||
| 2397 | Ga0501079_0562151 | |||
| 2398 | Ga0501081_0112361 | |||
| 2399 | Ga0501083_0010851 | |||
| 2400 | Ga0501035_0003491 | |||
| 2401 | Ga0501035_0013355 | |||
| 2402 | Ga0501035_0032338 | |||
| 2403 | Ga0501035_0039755 | |||
| 2404 | Ga0501035_0045118 | |||
| 2405 | Ga0501035_0087511 | |||
| 2406 | Ga0501035_0105874 | |||
| 2407 | Ga0501035_0187169 | |||
| 2408 | Ga0501035_0597542 | |||
| 2409 | Ga0501044_0002742 | |||
| 2410 | Ga0501044_0013235 | |||
| 2411 | Ga0501044_0018277 | |||
| 2412 | Ga0501044_0123954 | |||
| 2413 | Ga0501044_0124468 | |||
| 2414 | Ga0501044_0213395 | |||
| 2415 | Ga0501044_0305518 | |||
| 2416 | Ga0501044_0412336 | |||
| 2417 | Ga0501044_0456093 | |||
| 2418 | Ga0501044_0512674 | |||
| 2419 | Ga0501044_0601664 | |||
| 2420 | Ga0501044_0747551 | |||
| 2421 | Ga0501044_0818626 | |||
| 2422 | Ga0501045_0068330 | |||
| 2423 | Ga0501045_0094604 | |||
| 2424 | Ga0501045_0667884 | |||
| 2425 | nmdc:mga0yw44_240120_c1 | |||
| 2426 | nmdc:mga06z11_7684_c1 | |||
| 2427 | nmdc:mga05p37_21063_c1 | |||
| 2428 | nmdc:mga05p37_59022_c1 | |||
| 2429 | nmdc:mga09592_189829_c1 | |||
| 2430 | nmdc:mga0qj67_187915_c1 | |||
| 2431 | nmdc:mga06r32_977402_c1 | |||
| 2432 | nmdc:mga08y16_79556_c1 | |||
| 2433 | nmdc:mga0n895_134032_c1 | |||
| 2434 | nmdc:mga0n895_5271_c1 | |||
| 2435 | nmdc:mga0n895_59113_c1 | |||
| 2436 | nmdc:mga0rr50_121363_c1 | |||
| 2437 | nmdc:mga0rr50_179158_c1 | |||
| 2438 | nmdc:mga0rr50_23778_c1 | |||
| 2439 | nmdc:mga08x19_13898_c1 | |||
| 2440 | nmdc:mga08x19_68539_c1 | |||
| 2441 | nmdc:mga0a205_41756_c1 | |||
| 2442 | nmdc:mga0a205_9759_c1 | |||
| 2443 | Ga0495601_0010340 | |||
| 2444 | Ga0495601_0011920 | |||
| 2445 | Ga0495601_0036290 | |||
| 2446 | Ga0495601_0081211 | |||
| 2447 | Ga0495601_0086161 | |||
| 2448 | Ga0495601_0182998 | |||
| 2449 | Ga0495601_0409881 | |||
| 2450 | Ga0495612_0009788 | |||
| 2451 | Ga0495612_0015980 | |||
| 2452 | Ga0495612_0073321 | |||
| 2453 | Ga0495612_0075689 | |||
| 2454 | Ga0495612_0076115 | |||
| 2455 | Ga0495612_0101488 | |||
| 2456 | Ga0495612_0189865 | |||
| 2457 | Ga0495595_0000288 | |||
| 2458 | Ga0495595_0004237 | |||
| 2459 | Ga0495595_0065626 | |||
| 2460 | Ga0495619_0014125 | |||
| 2461 | Ga0495619_0029190 | |||
| 2462 | Ga0495619_0052770 | |||
| 2463 | Ga0495619_0103750 | |||
| 2464 | Ga0495619_0105858 | |||
| 2465 | Ga0495619_0271904 | |||
| 2466 | Ga0495619_0288624 | |||
| 2467 | Ga0495619_0317201 | |||
| 2468 | Ga0500578_0027273 | |||
| 2469 | Ga0500644_0038061 | |||
| 2470 | Ga0500651_0229966 | |||
| 2471 | Ga0500640_005745 | |||
| 2472 | Ga0500641_0077403 | |||
| 2473 | Ga0500654_067044 | |||
| 2474 | Ga0500553_037039 | |||
| 2475 | Ga0500556_0026382 | |||
| 2476 | Ga0500572_021039 | |||
| 2477 | Ga0500614_011290 | |||
| 2478 | Ga0500628_003764 | |||
| 2479 | Ga0500652_009578 | |||
| 2480 | Ga0500652_105384 | |||
| 2481 | Ga0500658_0009142 | |||
| 2482 | Ga0500561_0001882 | |||
| 2483 | Ga0500573_0020678 | |||
| 2484 | Ga0500573_0117994 | |||
| 2485 | Ga0500577_0156008 | |||
| 2486 | Ga0500579_020565 | |||
| 2487 | Ga0500588_0019540 | |||
| 2488 | Ga0500600_0014804 | |||
| 2489 | Ga0500604_0067508 | |||
| 2490 | Ga0500606_088096 | |||
| 2491 | Ga0500616_0003674 | |||
| 2492 | Ga0500616_0011658 | |||
| 2493 | Ga0500624_001358 | |||
| 2494 | Ga0500633_0009991 | |||
| 2495 | Ga0500634_0047199 | |||
| 2496 | Ga0500656_001101 | |||
| 2497 | Ga0500587_000440 | |||
| 2498 | Ga0501084_0078228 | |||
| 2499 | Ga0501082_0008414 | |||
| 2500 | Ga0501082_0017727 | |||
| 2501 | Ga0501082_0051409 | |||
| 2502 | Ga0501082_1058406 | |||
| 2503 | Ga0466962_0000156 | |||
| 2504 | Ga0466962_0008705 | |||
| 2505 | Ga0466962_0048045 | |||
| 2506 | Ga0466962_0053482 | |||
| 2507 | Ga0466962_0374035 | |||
| 2508 | Ga0530510_0479338 | |||
| 2509 | 2515852502 | |||
| 2510 | 2547411635 | |||
| 2511 | 2554257041 | |||
| 2512 | 2585305148 | |||
| 2513 | 2585318320 | |||
| 2514 | 2616701484 | |||
| 2515 | 2643947631 | |||
| 2516 | 2644080885 | |||
| 2517 | 2644390187 | |||
| 2518 | 2644435323 | |||
| 2519 | 2644437585 | |||
| 2520 | 2644504751 | |||
| 2521 | 2644523783 | |||
| 2522 | 2644627957 | |||
| 2523 | 2644663798 | |||
| 2524 | 2644667886 | |||
| 2525 | 2676474503 | |||
| 2526 | 2731907236 | |||
| 2527 | 2784589400 | |||
| 2528 | 2785342178 | |||
| 2529 | 2785370479 | |||
| 2530 | 2786671635 | |||
| 2531 | 2799186590 | |||
| 2532 | 2808843040 | |||
| 2533 | 2808921381 | |||
| 2534 | 2809233062 | |||
| 2535 | 2812357083 | |||
| 2536 | 2812479742 | |||
| 2537 | 2827633023 | |||
| 2538 | 2839986595 | |||
| 2539 | 2839986601 | |||
| 2540 | 2852640054 | |||
| 2541 | 2856742144 | |||
| 2542 | 2862179483 | |||
| 2543 | 2862286665 | |||
| 2544 | 2862296055 | |||
| 2545 | 2862392519 | |||
| 2546 | 2862510259 | |||
| 2547 | 2862578449 | |||
| 2548 | 2862709571 | |||
| 2549 | 2863411860 | |||
| 2550 | 2867348536 | |||
| 2551 | 2867435698 | |||
| 2552 | 2867475976 | |||
| 2553 | 2873154962 | |||
| 2554 | 2875394681 | |||
| 2555 | 2877680142 | |||
| 2556 | 2884704093 | |||
| 2557 | 2884998045 | |||
| 2558 | 2891401064 | |||
| 2559 | 2891560060 | |||
| 2560 | 2895431884 | |||
| 2561 | 2895448552 | |||
| 2562 | 2912718732 | |||
| 2563 | 2918504620 | |||
| 2564 | 2919471456 | |||
| 2565 | 2932434730 | |||
| 2566 | 2935892381 | |||
| 2567 | 2946049954 | |||
| 2568 | 2946068795 | |||
| 2569 | 2946076841 | |||
| 2570 | 2947228116 | |||
| 2571 | 2954005941 | |||
| 2572 | 2954385074 | |||
| 2573 | 2954677921 | |||
| 2574 | 2954686236 | |||
| 2575 | 2954695892 | |||
| 2576 | 2954711083 | |||
| 2577 | 2954715297 | |||
| 2578 | 2954725239 | |||
| 2579 | 2954736577 | |||
| 2580 | 2954744172 | |||
| 2581 | 2954755427 | |||
| 2582 | 2954763115 | |||
| 2583 | 2964328240 | |||
| 2584 | 2966602464 | |||
| 2585 | 2990045583 | |||
| 2586 | 2990063957 | |||
| 2587 | 2995468033 | |||
| 2588 | 2995726985 | |||
| 2589 | 2997454284 | |||
| 2590 | 3003000921 | |||
| 2591 | 3006397265 | |||
| 2592 | 3006428474 | |||
| 2593 | 3006492248 | |||
| 2594 | 3006500341 | |||
| 2595 | 8008485877 | |||
| 2596 | 8008566228 | |||
| 2597 | 8023629554 | |||
| 2598 | 8025484504 | |||
| 2599 | 8025524961 | |||
| 2600 | 8025538148 | |||
| 2601 | 8033687542 | |||
| 2602 | 8048409575 | |||
| 2603 | 8053951463 | |||
| 2604 | 8054161374 | |||
| 2605 | 8055036861 | |||
| 2606 | 8055040707 | |||
| 2607 | 8056060990 | |||
| 2608 | 8056454018 | |||
| 2609 | 8056669205 | |||
| 2610 | 8056833224 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ohp-assembly1.cif.gz_D | crystal structure of hgprt from vibrio cholerae | 0.9466 | 14 | 177 |
| 2geb-assembly1.cif.gz_A | crystal structure of the thermoanaerobacter tengcongensis hypoxanthine-guanine phosphoribosyltransferase l160i mutant: insights into the inhibitor design | 0.9433 | 11 | 180 |
| 4rqb-assembly1.cif.gz_A | crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (tetragonal space group) | 0.9431 | 8 | 182 |
| 4rhu-assembly2.cif.gz_F | crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease | 0.9406 | 9 | 180 |
| 1r3u-assembly1.cif.gz_A | crystal structure of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis | 0.9392 | 11 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3acdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9368 | 17 | 177 | 3.40.50.2020 |
| af_I1LDB6_1_185_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9294 | 8 | 180 | 3.40.50.2020 |
| 4rhtD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9149 | 11 | 177 | 3.40.50.2020 |
| 4rhtD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9095 | 11 | 177 | 3.40.50.2020 |
| 1hgxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9028 | 11 | 180 | 3.40.50.2020 |