F492804

General Info

Members Datasets Scaffolds Average Seq Length
1305 541 2610 189

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10065248|Ga0070717_100652483
Length 219
Sequence VDASDVGADLKDVLIPEERLRARVTELAAQIDADYAGRELLLVGVLKGAVMVMADLARAMHMPVQMDWMAVSSYGSGTRSSGVVRILKDLDTDITGKDVLVIEDIVDSGLTLSWLVGNLRSRGPASVQVCVMLRKPAAIRMDVDVAYTGFDIENEFVVGYGLDYAEKYRNLPFIGTLAPHVYKGEESAETDAEPRTEESAEAPPGRQADPGNRISDEER

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
147 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
148 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
162 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
163 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
167 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
211 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
212 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
215 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
216 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
219 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
223 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
224 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
225 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
226 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
227 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
228 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
229 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
230 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
231 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
232 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
274 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
277 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
278 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
308 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
319 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
322 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
323 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
324 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
325 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
329 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
334 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
335 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
336 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
337 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
338 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
341 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
342 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
346 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
347 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
350 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
358 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
383 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
386 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
387 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
388 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
389 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
390 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
391 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
392 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
398 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
399 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
400 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
401 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
402 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
403 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
404 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
405 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
406 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
407 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
408 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
409 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
410 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
411 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
412 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
413 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
414 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
415 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
416 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
417 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
418 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
419 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
420 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
421 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
422 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
423 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
424 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
425 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
426 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
427 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
428 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
429 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
430 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
431 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
432 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
433 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
434 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
435 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
436 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
437 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
438 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
439 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
440 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
441 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
442 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
443 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
444 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
445 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
446 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
447 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
448 2643221613 Oerskovia sp. Root22 Isolate Unclassified
449 2643221670 Streptomyces sp. Root431 Isolate Unclassified
450 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
451 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
452 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
453 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
454 2643221714 Streptomyces sp. Root264 Isolate Unclassified
455 2643221721 Oerskovia sp. Root918 Isolate Unclassified
456 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
457 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
458 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
459 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
460 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
461 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
462 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
463 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
464 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
465 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
466 2808606448 Streptomyces sp. 193411 Isolate Unclassified
467 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
468 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
469 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
470 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
471 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
472 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
473 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
474 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
475 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
476 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
477 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
478 2862574272 Streptomyces sp. AcE210 Isolate Nodule
479 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
480 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
481 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
482 2867428634 Streptomyces sp. RP5T Isolate Unclassified
483 2867475112 Streptomyces sp. TM32 Isolate Unclassified
484 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
485 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
486 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
487 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
488 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
489 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
490 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
491 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
492 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
493 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
494 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
495 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
496 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
497 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
498 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
499 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
500 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
501 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
502 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
503 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
504 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
505 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
506 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
507 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
508 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
509 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
510 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
511 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
512 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
513 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
514 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
515 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
516 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
517 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
518 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
519 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
520 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
521 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
522 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
523 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
524 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
525 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
526 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
527 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
528 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
529 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
530 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
531 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
532 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
533 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
534 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
535 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
536 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
537 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
538 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
539 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
540 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
541 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.96
Metatranscriptomes 1.23
Isolates 7.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.22
Nodule 0.23
Rhizoplane 3.45
Rhizosphere 85.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10065248 3300006028 Bacteria 3026
2 JGI24739J22299_10010829 3300001989 Bacteria 3377
3 JGI24739J22299_10054830 3300001989 Bacteria 1276
4 JGI24735J21928_10082150 3300002067 Bacteria 923
5 JGI24735J21928_10108197 3300002067 Bacteria 799
6 JGI25153J46596_10033766 3300003215 Bacteria 1683
7 rootL2_10055055 3300003322 Bacteria 1462
8 JGI25160J50197_1018765 3300003354 Bacteria 2143
9 Ga0070658_10095112 3300005327 Bacteria 2459
10 Ga0070683_100135277 3300005329 Bacteria 2333
11 Ga0070683_100448463 3300005329 Bacteria 1231
12 Ga0070680_100237792 3300005336 Bacteria 1539
13 Ga0070691_10026742 3300005341 Bacteria 2690
14 Ga0070671_100378328 3300005355 Bacteria 1210
15 Ga0070667_100122393 3300005367 Bacteria 2264
16 Ga0070709_10000303 3300005434 Bacteria 31301
17 Ga0070709_10000658 3300005434 Bacteria 19667
18 Ga0070709_10063183 3300005434 Bacteria 2364
19 Ga0070714_100001285 3300005435 Bacteria 18158
20 Ga0070714_100007011 3300005435 Bacteria 8736
21 Ga0070714_100017017 3300005435 Bacteria 5883
22 Ga0070714_100042447 3300005435 Bacteria 3843
23 Ga0070714_100082975 3300005435 Bacteria 2793
24 Ga0070714_100084104 3300005435 Bacteria 2776
25 Ga0070714_100126586 3300005435 Bacteria 2278
26 Ga0070714_100254436 3300005435 Bacteria 1625
27 Ga0070714_100710830 3300005435 Bacteria 970
28 Ga0070713_100000735 3300005436 Bacteria 20988
29 Ga0070713_100083338 3300005436 Bacteria 2733
30 Ga0070713_100084766 3300005436 Bacteria 2712
31 Ga0070713_100096675 3300005436 Bacteria 2550
32 Ga0070713_100107677 3300005436 Bacteria 2425
33 Ga0070713_101711383 3300005436 Bacteria 610
34 Ga0070710_10002868 3300005437 Bacteria 8210
35 Ga0070711_100001622 3300005439 Bacteria 12424
36 Ga0070711_100002814 3300005439 Bacteria 9988
37 Ga0070711_100042489 3300005439 Bacteria 3073
38 Ga0070711_100104285 3300005439 Bacteria 2068
39 Ga0070711_100270564 3300005439 Bacteria 1340
40 Ga0070711_100493291 3300005439 Bacteria 1009
41 Ga0070708_100254009 3300005445 Bacteria 1652
42 Ga0070663_100207088 3300005455 Bacteria 1534
43 Ga0070663_100474322 3300005455 Bacteria 1035
44 Ga0070678_100236706 3300005456 Bacteria 1525
45 Ga0070681_10115673 3300005458 Bacteria 2620
46 Ga0070681_10182789 3300005458 Bacteria 2018
47 Ga0070706_100001435 3300005467 Bacteria 25160
48 Ga0070706_100005954 3300005467 Bacteria 11534
49 Ga0070706_100038357 3300005467 Bacteria 4421
50 Ga0070706_100291256 3300005467 Bacteria 1523
51 Ga0070706_100409956 3300005467 Bacteria 1262
52 Ga0070707_100000833 3300005468 Bacteria 30514
53 Ga0070707_100019207 3300005468 Bacteria 6439
54 Ga0070707_100023123 3300005468 Bacteria 5880
55 Ga0070707_100398034 3300005468 Bacteria 1337
56 Ga0070698_100000680 3300005471 Bacteria 36332
57 Ga0070698_100001044 3300005471 Bacteria 30485
58 Ga0070698_100041951 3300005471 Bacteria 4695
59 Ga0070698_100051264 3300005471 Bacteria 4204
60 Ga0070699_100044519 3300005518 Bacteria 3842
61 Ga0070699_100359689 3300005518 Bacteria 1312
62 Ga0070699_100667491 3300005518 Bacteria 949
63 Ga0070697_100073899 3300005536 Bacteria 2800
64 Ga0070697_100168505 3300005536 Bacteria 1853
65 Ga0068853_100042399 3300005539 Bacteria 3891
66 Ga0068853_100168810 3300005539 Bacteria 1978
67 Ga0070695_100668750 3300005545 Bacteria 821
68 Ga0070696_100511849 3300005546 Bacteria 956
69 Ga0070665_100073321 3300005548 Bacteria 3430
70 Ga0070665_100093875 3300005548 Bacteria 3005
71 Ga0070665_100172659 3300005548 Bacteria 2163
72 Ga0068855_100110791 3300005563 Bacteria 3151
73 Ga0068855_100207190 3300005563 Bacteria 2205
74 Ga0070664_100358433 3300005564 Bacteria 1328
75 Ga0070664_100893661 3300005564 Bacteria 833
76 Ga0068854_100788008 3300005578 Bacteria 827
77 Ga0068852_100007469 3300005616 Bacteria 7976
78 Ga0068859_100737826 3300005617 Bacteria 1074
79 Ga0068863_100121156 3300005841 Bacteria 2494
80 Ga0068860_100126846 3300005843 Bacteria 2446
81 Ga0081455_10309069 3300005937 Bacteria 1131
82 Ga0081540_1003225 3300005983 Bacteria 12999
83 Ga0081540_1155036 3300005983 Bacteria 897
84 Ga0081539_10066960 3300005985 Bacteria 1944
85 Ga0070717_10004476 3300006028 Bacteria 10099
86 Ga0070717_10114967 3300006028 Bacteria 2299
87 Ga0070717_10123979 3300006028 Bacteria 2216
88 Ga0075365_10230197 3300006038 Bacteria 1301
89 Ga0075363_100066381 3300006048 Bacteria 1953
90 Ga0070715_10038014 3300006163 Bacteria 1996
91 Ga0070715_10071889 3300006163 Bacteria 1547
92 Ga0070716_100000094 3300006173 Bacteria 34515
93 Ga0070716_100004007 3300006173 Bacteria 6992
94 Ga0070716_100222343 3300006173 Bacteria 1269
95 Ga0070712_100224202 3300006175 Bacteria 1489
96 Ga0070712_100235700 3300006175 Bacteria 1455
97 Ga0070712_100562509 3300006175 Bacteria 962
98 Ga0075367_10120663 3300006178 Bacteria 1615
99 Ga0097621_100031362 3300006237 Bacteria 4217
100 Ga0097621_100105362 3300006237 Bacteria 2377
101 Ga0075370_10271902 3300006353 Bacteria 1006
102 Ga0075428_100013717 3300006844 Bacteria 9023
103 Ga0075428_100223572 3300006844 Bacteria 2033
104 Ga0075433_10011945 3300006852 Bacteria 7000
105 Ga0075433_10027801 3300006852 Bacteria 4802
106 Ga0075433_11107116 3300006852 Bacteria 689
107 Ga0075434_100017170 3300006871 Bacteria 6967
108 Ga0075434_100141004 3300006871 Bacteria 2430
109 Ga0075434_100848954 3300006871 Bacteria 929
110 Ga0075429_100184222 3300006880 Bacteria 1830
111 Ga0068865_100312719 3300006881 Bacteria 1261
112 Ga0075436_100002907 3300006914 Bacteria 11750
113 Ga0075436_100026649 3300006914 Bacteria 3980
114 Ga0097620_100737656 3300006931 Bacteria 1074
115 Ga0075435_100038265 3300007076 Bacteria 3824
116 Ga0075435_100128010 3300007076 Bacteria 2123
117 Ga0105251_10042952 3300009011 Bacteria 2191
118 Ga0105244_10138189 3300009036 Bacteria 1173
119 Ga0105240_10002593 3300009093 Bacteria 28927
120 Ga0111539_10217332 3300009094 Bacteria 2226
121 Ga0105245_10022695 3300009098 Bacteria 5508
122 Ga0105247_10097872 3300009101 Bacteria 1872
123 Ga0105247_10140142 3300009101 Bacteria 1584
124 Ga0114129_10008421 3300009147 Bacteria 14692
125 Ga0114129_10068964 3300009147 Bacteria 4929
126 Ga0105243_10364898 3300009148 Bacteria 1330
127 Ga0105243_10501073 3300009148 Bacteria 1151
128 Ga0105243_10534848 3300009148 Bacteria 1117
129 Ga0105241_10001133 3300009174 Bacteria 20315
130 Ga0105241_10054363 3300009174 Bacteria 3065
131 Ga0105241_10197349 3300009174 Bacteria 1679
132 Ga0105248_10112199 3300009177 Bacteria 3075
133 Ga0105248_10301486 3300009177 Bacteria 1804
134 Ga0105237_10033948 3300009545 Bacteria 5168
135 Ga0105237_10525944 3300009545 Bacteria 1189
136 Ga0105237_10587634 3300009545 Bacteria 1120
137 Ga0105238_10019076 3300009551 Bacteria 6987
138 Ga0105249_10574137 3300009553 Bacteria 1180
139 Ga0105239_10080227 3300010375 Bacteria 3590
140 Ga0105246_10012385 3300011119 Bacteria 5320
141 Ga0105246_10157689 3300011119 Bacteria 1726
142 Ga0105246_10173966 3300011119 Bacteria 1651
143 Ga0105246_10655340 3300011119 Bacteria 914
144 Ga0157370_10024372 3300013104 Bacteria 5992
145 Ga0157369_10231037 3300013105 Bacteria 1934
146 Ga0157374_10009898 3300013296 Bacteria 8182
147 Ga0157374_10028904 3300013296 Bacteria 5012
148 Ga0157378_10174862 3300013297 Bacteria 2016
149 Ga0163162_10391453 3300013306 Bacteria 1522
150 Ga0163162_10490143 3300013306 Bacteria 1360
151 Ga0157372_10062057 3300013307 Bacteria 4186
152 Ga0157372_10188025 3300013307 Bacteria 2391
153 Ga0157372_10281353 3300013307 Bacteria 1934
154 Ga0157372_10457540 3300013307 Bacteria 1487
155 Ga0157375_10277578 3300013308 Bacteria 1838
156 Ga0163163_10003442 3300014325 Bacteria 13446
157 Ga0157380_10255069 3300014326 Bacteria 1590
158 Ga0157377_10155670 3300014745 Bacteria 1417
159 Ga0157377_10852080 3300014745 Bacteria 677
160 Ga0157379_10002390 3300014968 Bacteria 15680
161 Ga0157376_10007343 3300014969 Bacteria 7856
162 Ga0157376_10102298 3300014969 Bacteria 2506
163 Ga0157376_10520189 3300014969 Bacteria 1173
164 Ga0182006_1047820 3300015261 Bacteria 1656
165 Ga0182007_10000948 3300015262 Bacteria 15950
166 Ga0182005_1024865 3300015265 Bacteria 1635
167 Ga0183367_1015 3300015688 Bacteria 298435
168 Ga0206356_10039005 3300020070 Bacteria 735
169 Ga0206355_1518046 3300020076 Bacteria 1732
170 Ga0206350_10371078 3300020080 Bacteria 1192
171 Ga0206353_10318742 3300020082 Bacteria 4638
172 Ga0213875_10016990 3300021388 Bacteria 3523
173 Ga0213875_10042697 3300021388 Bacteria 2130
174 Ga0224572_1002611 3300024225 Bacteria 2944
175 Ga0228598_1030632 3300024227 Bacteria 1059
176 Ga0209758_1020439 3300025297 Bacteria 3132
177 Ga0207426_1003984 3300025302 Bacteria 7520
178 Ga0207426_1072135 3300025302 Bacteria 959
179 Ga0209051_1112049 3300025303 Bacteria 709
180 Ga0207696_1038217 3300025711 Bacteria 1418
181 Ga0207692_10000198 3300025898 Bacteria 20008
182 Ga0207692_10005056 3300025898 Bacteria 5254
183 Ga0207692_10007347 3300025898 Bacteria 4515
184 Ga0207692_10026163 3300025898 Bacteria 2735
185 Ga0207692_10039943 3300025898 Bacteria 2312
186 Ga0207710_10263081 3300025900 Bacteria 865
187 Ga0207647_10007289 3300025904 Bacteria 8006
188 Ga0207647_10044080 3300025904 Bacteria 2788
189 Ga0207685_10007645 3300025905 Bacteria 3026
190 Ga0207685_10028498 3300025905 Bacteria 1967
191 Ga0207685_10048016 3300025905 Bacteria 1633
192 Ga0207699_10000355 3300025906 Bacteria 24243
193 Ga0207699_10008211 3300025906 Bacteria 5140
194 Ga0207699_10013730 3300025906 Bacteria 4154
195 Ga0207699_10014905 3300025906 Bacteria 4024
196 Ga0207699_10069936 3300025906 Bacteria 2142
197 Ga0207684_10000549 3300025910 Bacteria 46187
198 Ga0207684_10001867 3300025910 Bacteria 21943
199 Ga0207684_10023269 3300025910 Bacteria 5290
200 Ga0207684_10304429 3300025910 Bacteria 1374
201 Ga0207654_10002025 3300025911 Bacteria 10420
202 Ga0207707_10214262 3300025912 Bacteria 1677
203 Ga0207695_10001075 3300025913 Bacteria 47773
204 Ga0207671_10000122 3300025914 Bacteria 119512
205 Ga0207671_10858263 3300025914 Bacteria 719
206 Ga0207693_10012402 3300025915 Bacteria 6885
207 Ga0207693_10018785 3300025915 Bacteria 5501
208 Ga0207693_10056204 3300025915 Bacteria 3086
209 Ga0207693_10088416 3300025915 Bacteria 2428
210 Ga0207693_10166610 3300025915 Bacteria 1734
211 Ga0207663_10057034 3300025916 Bacteria 2459
212 Ga0207663_10647442 3300025916 Bacteria 834
213 Ga0207663_10990230 3300025916 Bacteria 674
214 Ga0207660_10372919 3300025917 Bacteria 1146
215 Ga0207646_10000577 3300025922 Bacteria 48073
216 Ga0207646_10017839 3300025922 Bacteria 6629
217 Ga0207646_10077134 3300025922 Bacteria 2978
218 Ga0207646_10104929 3300025922 Bacteria 2534
219 Ga0207646_10314217 3300025922 Bacteria 1416
220 Ga0207694_10000829 3300025924 Bacteria 27496
221 Ga0207700_10000427 3300025928 Bacteria 24804
222 Ga0207700_10008608 3300025928 Bacteria 6333
223 Ga0207700_10008868 3300025928 Bacteria 6254
224 Ga0207700_10037684 3300025928 Bacteria 3504
225 Ga0207700_10081039 3300025928 Bacteria 2533
226 Ga0207700_10111952 3300025928 Bacteria 2198
227 Ga0207700_10111987 3300025928 Bacteria 2198
228 Ga0207700_10293449 3300025928 Bacteria 1402
229 Ga0207664_10006111 3300025929 Bacteria 8246
230 Ga0207664_10010058 3300025929 Bacteria 6666
231 Ga0207664_10029954 3300025929 Bacteria 4152
232 Ga0207664_10039826 3300025929 Bacteria 3649
233 Ga0207664_10056279 3300025929 Bacteria 3123
234 Ga0207664_10075145 3300025929 Bacteria 2731
235 Ga0207664_10172013 3300025929 Bacteria 1854
236 Ga0207664_10409254 3300025929 Bacteria 1207
237 Ga0207664_10768876 3300025929 Bacteria 866
238 Ga0207686_10347464 3300025934 Bacteria 1116
239 Ga0207709_10238836 3300025935 Bacteria 1321
240 Ga0207665_10001080 3300025939 Bacteria 18366
241 Ga0207665_10003971 3300025939 Bacteria 9884
242 Ga0207665_10007451 3300025939 Bacteria 7235
243 Ga0207691_10137592 3300025940 Bacteria 2154
244 Ga0207691_10930167 3300025940 Bacteria 727
245 Ga0207691_11020483 3300025940 Bacteria 690
246 Ga0207711_10115701 3300025941 Bacteria 2390
247 Ga0207661_10138298 3300025944 Bacteria 2094
248 Ga0207667_10006929 3300025949 Bacteria 13696
249 Ga0207667_10094891 3300025949 Bacteria 3080
250 Ga0207667_10287468 3300025949 Bacteria 1680
251 Ga0207640_10006140 3300025981 Bacteria 6574
252 Ga0207658_10386164 3300025986 Bacteria 1227
253 Ga0207703_10146273 3300026035 Bacteria 2056
254 Ga0207639_10023348 3300026041 Bacteria 4466
255 Ga0207639_10048788 3300026041 Bacteria 3206
256 Ga0207678_10084430 3300026067 Bacteria 2716
257 Ga0207678_10486158 3300026067 Bacteria 1075
258 Ga0207702_10019973 3300026078 Bacteria 5550
259 Ga0207641_10059677 3300026088 Bacteria 3249
260 Ga0207674_10214750 3300026116 Bacteria 1872
261 Ga0207683_10188808 3300026121 Bacteria 1870
262 Ga0207698_10035262 3300026142 Bacteria 3658
263 Ga0209371_1008032 3300027312 Bacteria 3569
264 Ga0209371_1018659 3300027312 Bacteria 1754
265 Ga0207428_10053288 3300027907 Bacteria 3226
266 Ga0268266_10042600 3300028379 Bacteria 3878
267 Ga0307517_10008770 3300028786 Bacteria 14457
268 Ga0307517_10012587 3300028786 Bacteria 11590
269 Ga0307515_10001114 3300028794 Bacteria 61489
270 Ga0307515_10101266 3300028794 Bacteria 3479
271 Ga0265338_10000718 3300028800 Bacteria 56666
272 Ga0268256_1005719 3300030500 Bacteria 4800
273 Ga0268256_1015837 3300030500 Bacteria 2184
274 Ga0307511_10003592 3300030521 Bacteria 15888
275 Ga0307511_10089148 3300030521 Bacteria 2104
276 Ga0307511_10145549 3300030521 Bacteria 1378
277 Ga0307512_10006056 3300030522 Bacteria 12386
278 Ga0307513_10015029 3300031456 Bacteria 9397
279 Ga0307513_10036984 3300031456 Bacteria 5437
280 Ga0307509_10030305 3300031507 Bacteria 5987
281 Ga0307509_10166488 3300031507 Bacteria 2091
282 Ga0307509_10174524 3300031507 Bacteria 2023
283 Ga0265313_10125733 3300031595 Bacteria 1115
284 Ga0307508_10019325 3300031616 Bacteria 6193
285 Ga0307508_10105662 3300031616 Bacteria 2413
286 Ga0307508_10191297 3300031616 Bacteria 1647
287 Ga0307514_10001631 3300031649 Bacteria 26246
288 Ga0307514_10022169 3300031649 Bacteria 5166
289 Ga0307514_10303992 3300031649 Bacteria 891
290 Ga0316575_10000002 3300031665 Bacteria 148142
291 Ga0316575_10000356 3300031665 Bacteria 12976
292 Ga0316579_10011102 3300031691 Bacteria 3822
293 Ga0316576_10000206 3300031727 Bacteria 24729
294 Ga0316576_10001306 3300031727 Bacteria 13232
295 Ga0316576_10257292 3300031727 Bacteria 1310
296 Ga0316576_10353518 3300031727 Bacteria 1093
297 Ga0307516_10010607 3300031730 Bacteria 10108
298 Ga0307516_10051538 3300031730 Bacteria 4033
299 Ga0307516_10503110 3300031730 Bacteria 866
300 Ga0316577_10020948 3300031733 Bacteria 3623
301 Ga0307518_10039052 3300031838 Bacteria 3451
302 Ga0307518_10169360 3300031838 Bacteria 1490
303 Ga0307410_10078913 3300031852 Bacteria 2305
304 Ga0307406_10521558 3300031901 Bacteria 967
305 Ga0307412_10168871 3300031911 Bacteria 1634
306 Ga0307409_100100195 3300031995 Bacteria 2401
307 Ga0307409_100192306 3300031995 Bacteria 1817
308 Ga0307416_100148139 3300032002 Bacteria 2147
309 Ga0307416_100759353 3300032002 Bacteria 1063
310 Ga0307416_100990072 3300032002 Bacteria 943
311 Ga0307414_10112584 3300032004 Bacteria 2075
312 Ga0307414_10405169 3300032004 Bacteria 1186
313 Ga0307414_10867056 3300032004 Bacteria 826
314 Ga0307411_10117908 3300032005 Bacteria 1914
315 Ga0307411_10592719 3300032005 Bacteria 952
316 Ga0307415_100561399 3300032126 Bacteria 1009
317 Ga0307415_100829103 3300032126 Bacteria 847
318 Ga0316583_10037055 3300032133 Bacteria 1728
319 Ga0316580_10013909 3300032139 Bacteria 2453
320 Ga0307507_10000013 3300033179 Bacteria 242708
321 Ga0307507_10057967 3300033179 Bacteria 3641
322 Ga0307507_10097415 3300033179 Bacteria 2481
323 Ga0307507_10136125 3300033179 Bacteria 1902
324 Ga0307507_10140857 3300033179 Bacteria 1850
325 Ga0307510_10045037 3300033180 Bacteria 4770
326 Ga0307510_10152409 3300033180 Bacteria 1927
327 Ga0307510_10245106 3300033180 Bacteria 1283
328 Ga0307510_10287941 3300033180 Bacteria 1110
329 Ga0373930_0019205 3300034816 Bacteria 1321
330 Ga0373948_0006582 3300034817 Bacteria 1927
331 Ga0373958_0106638 3300034819 Bacteria 663
332 Ga0373938_0006469 3300034957 Bacteria 2025
333 Ga0373926_0040258 3300035083 Bacteria 1667
334 Ga0373926_0139670 3300035083 Bacteria 920
335 Ga0373929_0037106 3300035085 Bacteria 1067
336 Ga0373934_0000184 3300035086 Bacteria 22845
337 Ga0373934_0002392 3300035086 Bacteria 6905
338 Ga0373934_0018608 3300035086 Bacteria 2659
339 Ga0373934_0019406 3300035086 Bacteria 2609
340 Ga0373940_0048960 3300035088 Bacteria 1182
341 Ga0373949_0038148 3300035090 Bacteria 1171
342 Ga0373951_0030281 3300035091 Bacteria 1273
343 Ga0373952_0048375 3300035092 Bacteria 1006
344 Ga0373923_0006465 3300035111 Bacteria 4055
345 Ga0373923_0030219 3300035111 Bacteria 2177
346 Ga0373923_0048861 3300035111 Bacteria 1767
347 Ga0373923_0084512 3300035111 Bacteria 1381
348 Ga0373923_0109734 3300035111 Bacteria 1224
349 Ga0373932_0003623 3300035112 Bacteria 3694
350 Ga0373936_0032597 3300035113 Bacteria 2061
351 Ga0373936_0046718 3300035113 Bacteria 1746
352 Ga0373936_0100073 3300035113 Bacteria 1222
353 Ga0373936_0170120 3300035113 Bacteria 952
354 Ga0373939_0057298 3300035114 Bacteria 1229
355 Ga0373941_0078018 3300035115 Bacteria 1113
356 Ga0373945_0009754 3300035116 Bacteria 3150
357 Ga0373945_0049152 3300035116 Bacteria 1547
358 Ga0373945_0082988 3300035116 Bacteria 1230
359 Ga0373945_0131611 3300035116 Bacteria 1002
360 Ga0373953_0000116 3300035117 Bacteria 19418
361 Ga0373953_0005235 3300035117 Bacteria 4194
362 Ga0373953_0012677 3300035117 Bacteria 2992
363 Ga0373953_0026389 3300035117 Bacteria 2225
364 Ga0373954_0001000 3300035118 Bacteria 11155
365 Ga0373954_0024414 3300035118 Bacteria 2756
366 Ga0373954_0106711 3300035118 Bacteria 1353
367 Ga0373956_0000136 3300035119 Bacteria 26262
368 Ga0373956_0011462 3300035119 Bacteria 3655
369 Ga0373956_0103573 3300035119 Bacteria 1322
370 Ga0373956_0109470 3300035119 Bacteria 1285
371 Ga0373957_0000035 3300035120 Bacteria 34674
372 Ga0373957_0002953 3300035120 Bacteria 4931
373 Ga0373957_0003000 3300035120 Bacteria 4901
374 Ga0373957_0018235 3300035120 Bacteria 2455
375 Ga0373957_0061778 3300035120 Bacteria 1453
376 Ga0373960_0011091 3300035121 Bacteria 2213
377 Ga0373943_0494058 3300035170 Bacteria 714
378 Ga0373946_0132812 3300035171 Bacteria 1147
379 Ga0373946_0299054 3300035171 Bacteria 795
380 Ga0373955_0000072 3300035172 Bacteria 40814
381 Ga0373955_0010552 3300035172 Bacteria 4367
382 Ga0373955_0042016 3300035172 Bacteria 2453
383 Ga0373955_0048357 3300035172 Bacteria 2306
384 Ga0373955_0091799 3300035172 Bacteria 1731
385 Ga0373955_0264755 3300035172 Bacteria 1032
386 Ga0373942_0035611 3300035207 Bacteria 1336
387 Ga0373962_0009821 3300035242 Bacteria 2377
388 Ga0316574_0021271 3300035398 Bacteria 3851
389 Ga0316574_0209927 3300035398 Bacteria 1249
390 Ga0373924_0001000 3300035410 Bacteria 8959
391 Ga0373924_0002302 3300035410 Bacteria 6408
392 Ga0373924_0012374 3300035410 Bacteria 3186
393 Ga0373924_0026843 3300035410 Bacteria 2286
394 Ga0373931_0143278 3300035691 Bacteria 1386
395 Ga0373931_0291280 3300035691 Bacteria 1005
396 Ga0373931_0550532 3300035691 Bacteria 749
397 Ga0373935_0045702 3300035692 Bacteria 2763
398 Ga0373935_0120221 3300035692 Bacteria 1754
399 Ga0373935_0151149 3300035692 Bacteria 1576
400 Ga0373935_0170699 3300035692 Bacteria 1488
401 Ga0373935_0396466 3300035692 Bacteria 990
402 Ga0373927_0080460 3300035695 Bacteria 2111
403 Ga0373933_0000327 3300035724 Bacteria 30644
404 Ga0373933_0006553 3300035724 Bacteria 6344
405 Ga0373933_0018940 3300035724 Bacteria 3878
406 Ga0373933_0036349 3300035724 Bacteria 2882
407 Ga0373933_0160018 3300035724 Bacteria 1429
408 Ga0373933_0200604 3300035724 Bacteria 1276
409 Ga0373947_0075049 3300035725 Bacteria 2081
410 Ga0373947_0100587 3300035725 Bacteria 1817
411 Ga0373947_0129409 3300035725 Bacteria 1610
412 Ga0373947_0161540 3300035725 Bacteria 1449
413 Ga0373937_0000010 3300036401 Bacteria 163001
414 Ga0373937_0001685 3300036401 Bacteria 18583
415 Ga0373937_0009917 3300036401 Bacteria 8305
416 Ga0373937_0017506 3300036401 Bacteria 6386
417 Ga0373937_0803493 3300036401 Bacteria 888
418 Ga0316582_0025759 3300036647 Bacteria 3534
419 Ga0316584_0000468 3300036712 Bacteria 21119
420 Ga0316584_0367146 3300036712 Bacteria 1031
421 Ga0316584_0733065 3300036712 Bacteria 675
422 Ga0373925_0103218 3300037068 Bacteria 2194
423 Ga0373925_0134396 3300037068 Bacteria 1931
424 Ga0373925_0300626 3300037068 Bacteria 1296
425 Ga0373925_0377747 3300037068 Bacteria 1153
426 Ga0395899_0002623 3300037312 Bacteria 14501
427 Ga0395899_0203269 3300037312 Bacteria 1380
428 Ga0395898_0031982 3300037466 Bacteria 5252
429 Ga0395898_0058062 3300037466 Bacteria 3768
430 Ga0316581_0002277 3300037588 Bacteria 4549
431 Ga0436364_0849349 3300037853 Bacteria 1284
432 Ga0436364_0894524 3300037853 Bacteria 2015
433 Ga0436364_1059010 3300037853 Bacteria 60327
434 Ga0436364_1147169 3300037853 Bacteria 29511
435 Ga0395901_1541329 3300038443 Bacteria 619
436 Ga0436363_1505785 3300039450 Bacteria 682
437 Ga0436362_0845973 3300039453 Bacteria 1143
438 Ga0439436_0003576 3300041404 Bacteria 4726
439 Ga0439436_0008118 3300041404 Bacteria 3226
440 Ga0439439_0000554 3300041406 Bacteria 6514
441 Ga0439453_0021310 3300041408 Bacteria 1168
442 Ga0451791_0512465 3300041451 Bacteria 1325
443 Ga0451795_0794252 3300041456 Bacteria 1230
444 Ga0451802_1325708 3300041460 Bacteria 1159
445 Ga0451841_0752493 3300041498 Bacteria 1355
446 Ga0451853_2214190 3300041512 Bacteria 2173
447 Ga0439433_0000267 3300041999 Bacteria 8812
448 Ga0439442_030524 3300042002 Bacteria 1125
449 Ga0439448_0009759 3300042005 Bacteria 2833
450 Ga0439448_0125248 3300042005 Bacteria 883
451 Ga0439449_0003868 3300042007 Bacteria 5804
452 Ga0439449_0006979 3300042007 Bacteria 4303
453 Ga0439455_0085584 3300042012 Bacteria 860
454 Ga0439457_000100 3300042014 Bacteria 20035
455 Ga0439457_001085 3300042014 Bacteria 8211
456 Ga0439462_0003676 3300042015 Bacteria 3699
457 Ga0450894_001105 3300042131 Bacteria 4063
458 Ga0450895_002110 3300042132 Bacteria 1451
459 Ga0450898_001128 3300042134 Bacteria 3419
460 Ga0450899_000632 3300042135 Bacteria 4017
461 Ga0450903_000500 3300042138 Bacteria 8239
462 Ga0450906_003967 3300042145 Bacteria 3131
463 Ga0439458_0007753 3300042157 Bacteria 2390
464 Ga0439458_0073582 3300042157 Bacteria 865
465 Ga0450908_009782 3300042184 Bacteria 1776
466 Ga0466969_0004692 3300044656 Bacteria 7281
467 Ga0466969_0007675 3300044656 Bacteria 5734
468 Ga0466969_0018099 3300044656 Bacteria 3675
469 Ga0466969_0018877 3300044656 Bacteria 3590
470 Ga0466969_0107910 3300044656 Bacteria 1305
471 Ga0466972_0012556 3300044658 Bacteria 4256
472 Ga0466972_0073178 3300044658 Bacteria 1633
473 Ga0466972_0131987 3300044658 Bacteria 1176
474 Ga0466972_0164257 3300044658 Bacteria 1043
475 Ga0466965_0083545 3300044683 Bacteria 1617
476 Ga0466965_0129997 3300044683 Bacteria 1305
477 Ga0466965_0194482 3300044683 Bacteria 1074
478 Ga0466966_0001731 3300044684 Bacteria 14107
479 Ga0466966_0002839 3300044684 Bacteria 11406
480 Ga0466966_0007222 3300044684 Bacteria 7363
481 Ga0466966_0015224 3300044684 Bacteria 5087
482 Ga0466966_0035646 3300044684 Bacteria 3213
483 Ga0466966_0041189 3300044684 Bacteria 2968
484 Ga0466966_0274986 3300044684 Bacteria 1013
485 Ga0466961_0006951 3300044693 Bacteria 7200
486 Ga0466961_0012581 3300044693 Bacteria 5417
487 Ga0466961_0029154 3300044693 Bacteria 3548
488 Ga0466961_0037073 3300044693 Bacteria 3129
489 Ga0466961_0056218 3300044693 Bacteria 2507
490 Ga0466961_0060219 3300044693 Bacteria 2414
491 Ga0466961_0142714 3300044693 Bacteria 1498
492 Ga0466961_0412060 3300044693 Bacteria 819
493 Ga0466963_0004122 3300044694 Bacteria 8405
494 Ga0466963_0004646 3300044694 Bacteria 8011
495 Ga0466963_0180150 3300044694 Bacteria 1475
496 Ga0466963_0283112 3300044694 Bacteria 1165
497 Ga0466963_0759646 3300044694 Bacteria 684
498 Ga0466963_0927377 3300044694 Bacteria 613
499 Ga0466964_0080868 3300044706 Bacteria 1394
500 Ga0466964_0299217 3300044706 Bacteria 810
501 Ga0466971_0004706 3300044719 Bacteria 5899
502 Ga0466971_0005777 3300044719 Bacteria 5381
503 Ga0466971_0010182 3300044719 Bacteria 4106
504 Ga0466971_0040149 3300044719 Bacteria 2102
505 Ga0466971_0048922 3300044719 Bacteria 1901
506 Ga0466971_0209622 3300044719 Bacteria 921
507 Ga0466968_0087727 3300044735 Bacteria 1374
508 Ga0466970_0000340 3300044765 Bacteria 22884
509 Ga0466970_0007649 3300044765 Bacteria 5416
510 Ga0466970_0011402 3300044765 Bacteria 4531
511 Ga0466970_0105706 3300044765 Bacteria 1535
512 Ga0466970_0264396 3300044765 Bacteria 965
513 Ga0466970_0512832 3300044765 Bacteria 691
514 Ga0466957_0000482 3300044842 Bacteria 19826
515 Ga0466957_0031489 3300044842 Bacteria 3170
516 Ga0466957_0349244 3300044842 Bacteria 1003
517 Ga0466960_0002803 3300044901 Bacteria 6600
518 Ga0466960_0125492 3300044901 Bacteria 1349
519 Ga0466960_0171059 3300044901 Bacteria 1172
520 Ga0466959_0001725 3300045049 Bacteria 13588
521 Ga0466959_0012149 3300045049 Bacteria 6214
522 Ga0466959_0015474 3300045049 Bacteria 5558
523 Ga0466959_0024315 3300045049 Bacteria 4486
524 Ga0466959_0097990 3300045049 Bacteria 2100
525 Ga0466959_0125601 3300045049 Bacteria 1821
526 Ga0466959_0218628 3300045049 Bacteria 1322
527 Ga0466959_0244598 3300045049 Bacteria 1238
528 Ga0466958_0000083 3300045836 Bacteria 28940
529 Ga0466958_0014280 3300045836 Bacteria 4535
530 Ga0466958_0070274 3300045836 Bacteria 2142
531 Ga0466958_0127815 3300045836 Bacteria 1594
532 Ga0466967_0035261 3300045976 Bacteria 4256
533 Ga0466967_0105117 3300045976 Bacteria 2586
534 Ga0466967_0201985 3300045976 Bacteria 1883
535 Ga0466967_1645105 3300045976 Bacteria 639
536 Ga0495617_003736 3300046452 Bacteria 5655
537 Ga0495592_0000136 3300046454 Bacteria 65571
538 Ga0495592_0006355 3300046454 Bacteria 8801
539 Ga0495592_0015144 3300046454 Bacteria 5858
540 Ga0495592_0075441 3300046454 Bacteria 2448
541 Ga0495592_0093513 3300046454 Bacteria 2153
542 Ga0495592_0131556 3300046454 Bacteria 1749
543 Ga0495592_0180425 3300046454 Bacteria 1438
544 Ga0495592_0372488 3300046454 Bacteria 911
545 Ga0495603_0004768 3300046455 Bacteria 8096
546 Ga0495603_0016026 3300046455 Bacteria 4531
547 Ga0495603_0023453 3300046455 Bacteria 3733
548 Ga0495603_0029409 3300046455 Bacteria 3312
549 Ga0495603_0055964 3300046455 Bacteria 2336
550 Ga0495603_0073210 3300046455 Bacteria 2013
551 Ga0495629_0004137 3300046459 Bacteria 10881
552 Ga0495629_0009288 3300046459 Bacteria 7194
553 Ga0495629_0010861 3300046459 Bacteria 6621
554 Ga0495629_0011501 3300046459 Bacteria 6429
555 Ga0495629_0059207 3300046459 Bacteria 2677
556 Ga0495629_0062453 3300046459 Bacteria 2602
557 Ga0495629_0065153 3300046459 Bacteria 2543
558 Ga0495629_0118408 3300046459 Bacteria 1845
559 Ga0495629_0242946 3300046459 Bacteria 1239
560 Ga0495629_0545579 3300046459 Bacteria 778
561 Ga0495638_0013477 3300046460 Bacteria 5565
562 Ga0495638_0027916 3300046460 Bacteria 3649
563 Ga0495638_0040475 3300046460 Bacteria 2953
564 Ga0495638_0082360 3300046460 Bacteria 1952
565 Ga0495641_0014933 3300046461 Bacteria 4180
566 Ga0495641_0041104 3300046461 Bacteria 2148
567 Ga0495641_0043399 3300046461 Bacteria 2079
568 Ga0495641_0075536 3300046461 Bacteria 1511
569 Ga0495641_0229465 3300046461 Bacteria 833
570 Ga0495651_0000047 3300046462 Bacteria 89551
571 Ga0495651_0000251 3300046462 Bacteria 41515
572 Ga0495651_0000452 3300046462 Bacteria 31571
573 Ga0495651_0006816 3300046462 Bacteria 8729
574 Ga0495651_0014042 3300046462 Bacteria 6194
575 Ga0495651_0015668 3300046462 Bacteria 5869
576 Ga0495651_0123334 3300046462 Bacteria 1900
577 Ga0495651_0148793 3300046462 Bacteria 1690
578 Ga0495653_0000753 3300046463 Bacteria 24762
579 Ga0495653_0016556 3300046463 Bacteria 6000
580 Ga0495653_0019645 3300046463 Bacteria 5479
581 Ga0495653_0039630 3300046463 Bacteria 3689
582 Ga0495653_0061156 3300046463 Bacteria 2850
583 Ga0495653_0065677 3300046463 Bacteria 2730
584 Ga0495653_0149206 3300046463 Bacteria 1635
585 Ga0495653_0195548 3300046463 Bacteria 1376
586 Ga0495580_0035896 3300046472 Bacteria 3563
587 Ga0495580_0094787 3300046472 Bacteria 2076
588 Ga0495582_0004891 3300046473 Bacteria 7508
589 Ga0495582_0041169 3300046473 Bacteria 2545
590 Ga0495582_0122487 3300046473 Bacteria 1466
591 Ga0495582_0244922 3300046473 Bacteria 1027
592 Ga0495582_0538378 3300046473 Bacteria 675
593 Ga0495639_0009946 3300046475 Bacteria 4088
594 Ga0495639_0082203 3300046475 Bacteria 1501
595 Ga0495662_0000990 3300046476 Bacteria 13904
596 Ga0495662_0013161 3300046476 Bacteria 4028
597 Ga0495662_0016011 3300046476 Bacteria 3638
598 Ga0495662_0017846 3300046476 Bacteria 3435
599 Ga0495662_0023647 3300046476 Bacteria 2967
600 Ga0495662_0069877 3300046476 Bacteria 1701
601 Ga0495662_0275317 3300046476 Bacteria 828
602 Ga0495664_0000447 3300046477 Bacteria 20283
603 Ga0495664_0006683 3300046477 Bacteria 6378
604 Ga0495664_0007598 3300046477 Bacteria 6026
605 Ga0495664_0012044 3300046477 Bacteria 4889
606 Ga0495664_0033188 3300046477 Bacteria 3033
607 Ga0495664_0084649 3300046477 Bacteria 1903
608 Ga0495585_0009338 3300046492 Bacteria 5889
609 Ga0495585_0028053 3300046492 Bacteria 3213
610 Ga0495585_0079626 3300046492 Bacteria 1777
611 Ga0495585_0080988 3300046492 Bacteria 1759
612 Ga0495594_0006912 3300046499 Bacteria 5838
613 Ga0495594_0013664 3300046499 Bacteria 4242
614 Ga0495594_0051380 3300046499 Bacteria 2268
615 Ga0495594_0090696 3300046499 Bacteria 1712
616 Ga0495594_0141163 3300046499 Bacteria 1366
617 Ga0495594_0169880 3300046499 Bacteria 1240
618 Ga0495607_0016214 3300046501 Bacteria 4811
619 Ga0495583_0015667 3300046506 Bacteria 4109
620 Ga0495606_0010908 3300046507 Bacteria 7478
621 Ga0495608_0000089 3300046511 Bacteria 65189
622 Ga0495608_0005222 3300046511 Bacteria 9278
623 Ga0495608_0010518 3300046511 Bacteria 6456
624 Ga0495608_0012351 3300046511 Bacteria 5930
625 Ga0495608_0029367 3300046511 Bacteria 3730
626 Ga0495608_0030063 3300046511 Bacteria 3680
627 Ga0495610_0028169 3300046512 Bacteria 2974
628 Ga0495616_0005383 3300046513 Bacteria 7888
629 Ga0495618_0027385 3300046514 Bacteria 3547
630 Ga0495618_0152604 3300046514 Bacteria 1475
631 Ga0495618_0306676 3300046514 Bacteria 985
632 Ga0495620_0031352 3300046515 Bacteria 2436
633 Ga0495628_0000325 3300046516 Bacteria 43145
634 Ga0495628_0003602 3300046516 Bacteria 13858
635 Ga0495628_0005690 3300046516 Bacteria 10917
636 Ga0495628_0032896 3300046516 Bacteria 4182
637 Ga0495628_0039248 3300046516 Bacteria 3787
638 Ga0495628_0043744 3300046516 Bacteria 3565
639 Ga0495628_0076458 3300046516 Bacteria 2605
640 Ga0495628_0113392 3300046516 Bacteria 2083
641 Ga0495628_0136341 3300046516 Bacteria 1876
642 Ga0495628_0144274 3300046516 Bacteria 1815
643 Ga0495628_0169940 3300046516 Bacteria 1653
644 Ga0495628_0312066 3300046516 Bacteria 1162
645 Ga0495630_0054579 3300046517 Bacteria 2993
646 Ga0495630_0076461 3300046517 Bacteria 2522
647 Ga0495630_0098499 3300046517 Bacteria 2211
648 Ga0495630_0176416 3300046517 Bacteria 1629
649 Ga0495630_0190313 3300046517 Bacteria 1565
650 Ga0495630_0199897 3300046517 Bacteria 1525
651 Ga0495631_0009662 3300046518 Bacteria 4809
652 Ga0495631_0093134 3300046518 Bacteria 1297
653 Ga0495632_0167646 3300046519 Bacteria 1010
654 Ga0495637_0024609 3300046520 Bacteria 2723
655 Ga0495643_0001898 3300046522 Bacteria 17653
656 Ga0495643_0005581 3300046522 Bacteria 8467
657 Ga0495643_0118303 3300046522 Bacteria 1341
658 Ga0495648_0208265 3300046524 Bacteria 973
659 Ga0495666_0000558 3300046526 Bacteria 16637
660 Ga0495666_0005462 3300046526 Bacteria 6402
661 Ga0495666_0011524 3300046526 Bacteria 4408
662 Ga0495666_0129906 3300046526 Bacteria 1177
663 Ga0495666_0169154 3300046526 Bacteria 1011
664 Ga0495652_0000199 3300046529 Bacteria 69104
665 Ga0495652_0000982 3300046529 Bacteria 32624
666 Ga0495652_0006292 3300046529 Bacteria 11060
667 Ga0495652_0017286 3300046529 Bacteria 6437
668 Ga0495652_0023352 3300046529 Bacteria 5481
669 Ga0495652_0031986 3300046529 Bacteria 4603
670 Ga0495652_0038570 3300046529 Bacteria 4138
671 Ga0495652_0047643 3300046529 Bacteria 3675
672 Ga0495652_0062877 3300046529 Bacteria 3127
673 Ga0495652_0084586 3300046529 Bacteria 2608
674 Ga0495652_0140223 3300046529 Bacteria 1902
675 Ga0495652_0324755 3300046529 Bacteria 1110
676 Ga0495654_0003823 3300046530 Bacteria 9103
677 Ga0495665_0003003 3300046531 Bacteria 9115
678 Ga0495665_0014672 3300046531 Bacteria 4223
679 Ga0495665_0017945 3300046531 Bacteria 3803
680 Ga0495665_0209156 3300046531 Bacteria 1010
681 Ga0495665_0284761 3300046531 Bacteria 847
682 Ga0495640_0007528 3300046533 Bacteria 8556
683 Ga0495640_0012287 3300046533 Bacteria 6549
684 Ga0495640_0013458 3300046533 Bacteria 6215
685 Ga0495640_0047394 3300046533 Bacteria 2974
686 Ga0495640_0107147 3300046533 Bacteria 1829
687 Ga0495640_0116559 3300046533 Bacteria 1739
688 Ga0495640_0160390 3300046533 Bacteria 1441
689 Ga0495586_0001586 3300046535 Bacteria 12508
690 Ga0495586_0001723 3300046535 Bacteria 11943
691 Ga0495586_0008008 3300046535 Bacteria 5637
692 Ga0495586_0038041 3300046535 Bacteria 2583
693 Ga0495586_0082919 3300046535 Bacteria 1763
694 Ga0495586_0087249 3300046535 Bacteria 1720
695 Ga0495586_0127408 3300046535 Bacteria 1424
696 Ga0495587_0000074 3300046536 Bacteria 78796
697 Ga0495587_0000644 3300046536 Bacteria 23420
698 Ga0495587_0012793 3300046536 Bacteria 5278
699 Ga0495587_0024905 3300046536 Bacteria 3662
700 Ga0495587_0025699 3300046536 Bacteria 3597
701 Ga0495587_0072375 3300046536 Bacteria 2004
702 Ga0495587_0111917 3300046536 Bacteria 1567
703 Ga0495587_0240668 3300046536 Bacteria 1018
704 Ga0495609_0009209 3300046538 Bacteria 4784
705 Ga0495597_0036879 3300046542 Bacteria 2198
706 Ga0495597_0221597 3300046542 Bacteria 751
707 Ga0495597_0332363 3300046542 Bacteria 585
708 Ga0495645_0003455 3300046543 Bacteria 10718
709 Ga0495645_0007656 3300046543 Bacteria 7515
710 Ga0495645_0014924 3300046543 Bacteria 5520
711 Ga0495645_0017450 3300046543 Bacteria 5141
712 Ga0495645_0035334 3300046543 Bacteria 3643
713 Ga0495645_0063472 3300046543 Bacteria 2674
714 Ga0495645_0076533 3300046543 Bacteria 2407
715 Ga0495645_0223340 3300046543 Bacteria 1266
716 Ga0495645_0281841 3300046543 Bacteria 1092
717 Ga0495645_0744917 3300046543 Bacteria 592
718 Ga0495622_0002086 3300046557 Bacteria 9771
719 Ga0495622_0004999 3300046557 Bacteria 6146
720 Ga0495622_0045660 3300046557 Bacteria 2035
721 Ga0495622_0063860 3300046557 Bacteria 1703
722 Ga0495622_0066602 3300046557 Bacteria 1665
723 Ga0495633_0004699 3300046558 Bacteria 8583
724 Ga0495633_0052786 3300046558 Bacteria 1914
725 Ga0495667_0000064 3300046559 Bacteria 89628
726 Ga0495667_0000347 3300046559 Bacteria 29301
727 Ga0495667_0002034 3300046559 Bacteria 13407
728 Ga0495667_0008486 3300046559 Bacteria 6974
729 Ga0495667_0022169 3300046559 Bacteria 4279
730 Ga0495667_0038878 3300046559 Bacteria 3167
731 Ga0495667_0088717 3300046559 Bacteria 2004
732 Ga0495634_0000804 3300046642 Bacteria 30477
733 Ga0495634_0006199 3300046642 Bacteria 9113
734 Ga0495634_0032561 3300046642 Bacteria 3585
735 Ga0495634_0036650 3300046642 Bacteria 3353
736 Ga0495634_0101575 3300046642 Bacteria 1857
737 Ga0495634_0667932 3300046642 Bacteria 599
738 Ga0495611_0013516 3300046648 Bacteria 3477
739 Ga0495611_0222453 3300046648 Bacteria 878
740 Ga0495625_0104124 3300046660 Bacteria 1946
741 Ga0495625_0150270 3300046660 Bacteria 1566
742 Ga0495625_0279644 3300046660 Bacteria 1074
743 Ga0495635_0001573 3300046663 Bacteria 15328
744 Ga0495635_0020778 3300046663 Bacteria 4573
745 Ga0495635_0023230 3300046663 Bacteria 4321
746 Ga0495635_0045888 3300046663 Bacteria 3014
747 Ga0495635_0051031 3300046663 Bacteria 2851
748 Ga0495635_0089295 3300046663 Bacteria 2108
749 Ga0495635_0103554 3300046663 Bacteria 1945
750 Ga0495635_0375411 3300046663 Bacteria 946
751 Ga0495635_0624193 3300046663 Bacteria 702
752 Ga0495661_0014414 3300046665 Bacteria 5296
753 Ga0495661_0160081 3300046665 Bacteria 1209
754 Ga0495588_0009014 3300046674 Bacteria 4596
755 Ga0495588_0033389 3300046674 Bacteria 2598
756 Ga0495588_0079314 3300046674 Bacteria 1713
757 Ga0495588_0153539 3300046674 Bacteria 1217
758 Ga0495588_0243192 3300046674 Bacteria 949
759 Ga0495657_0000009 3300046675 Bacteria 217555
760 Ga0495657_0015381 3300046675 Bacteria 5601
761 Ga0495657_0022658 3300046675 Bacteria 4495
762 Ga0495657_0023773 3300046675 Bacteria 4375
763 Ga0495657_0025398 3300046675 Bacteria 4207
764 Ga0495657_0030262 3300046675 Bacteria 3793
765 Ga0495657_0041850 3300046675 Bacteria 3132
766 Ga0495657_0057845 3300046675 Bacteria 2576
767 Ga0495657_0069033 3300046675 Bacteria 2313
768 Ga0495657_0204768 3300046675 Bacteria 1201
769 Ga0495599_0000084 3300046678 Bacteria 65440
770 Ga0495599_0024103 3300046678 Bacteria 3805
771 Ga0495599_0133992 3300046678 Bacteria 1538
772 Ga0495599_0257210 3300046678 Bacteria 1061
773 Ga0495599_0271365 3300046678 Bacteria 1029
774 Ga0495623_0000168 3300046679 Bacteria 40826
775 Ga0495623_0016760 3300046679 Bacteria 4734
776 Ga0495623_0019236 3300046679 Bacteria 4415
777 Ga0495623_0024851 3300046679 Bacteria 3858
778 Ga0495623_0135912 3300046679 Bacteria 1467
779 Ga0495623_0137406 3300046679 Bacteria 1457
780 Ga0495623_0156499 3300046679 Bacteria 1343
781 Ga0495623_0210545 3300046679 Bacteria 1113
782 Ga0495623_0321023 3300046679 Bacteria 850
783 Ga0495646_0000131 3300046680 Bacteria 37843
784 Ga0495646_0006779 3300046680 Bacteria 7267
785 Ga0495646_0010288 3300046680 Bacteria 5949
786 Ga0495646_0030816 3300046680 Bacteria 3346
787 Ga0495646_0084121 3300046680 Bacteria 1848
788 Ga0495646_0264135 3300046680 Bacteria 919
789 Ga0495647_0024412 3300046681 Bacteria 2201
790 Ga0495658_0014985 3300046683 Bacteria 3972
791 Ga0495658_0153570 3300046683 Bacteria 1415
792 Ga0495613_0000387 3300046689 Bacteria 38006
793 Ga0495613_0002214 3300046689 Bacteria 14721
794 Ga0495613_0004116 3300046689 Bacteria 10877
795 Ga0495613_0082328 3300046689 Bacteria 2337
796 Ga0495613_0229356 3300046689 Bacteria 1301
797 Ga0495613_0238367 3300046689 Bacteria 1272
798 Ga0495624_0009562 3300046690 Bacteria 6710
799 Ga0495624_0024942 3300046690 Bacteria 3933
800 Ga0495624_0082931 3300046690 Bacteria 1983
801 Ga0495624_0113025 3300046690 Bacteria 1669
802 Ga0495670_0004170 3300046691 Bacteria 7082
803 Ga0495670_0222664 3300046691 Bacteria 1002
804 Ga0495671_0013623 3300046692 Bacteria 4396
805 Ga0495649_0120395 3300046694 Bacteria 1388
806 Ga0495649_0302760 3300046694 Bacteria 813
807 Ga0495589_0013467 3300046794 Bacteria 4218
808 Ga0495589_0141399 3300046794 Bacteria 1152
809 Ga0495600_0009602 3300046809 Bacteria 5981
810 Ga0495600_0009890 3300046809 Bacteria 5905
811 Ga0495600_0011653 3300046809 Bacteria 5484
812 Ga0495600_0012067 3300046809 Bacteria 5396
813 Ga0495600_0015357 3300046809 Bacteria 4841
814 Ga0495600_0020564 3300046809 Bacteria 4220
815 Ga0495600_0086335 3300046809 Bacteria 2047
816 Ga0495600_0122217 3300046809 Bacteria 1693
817 Ga0495600_0178561 3300046809 Bacteria 1368
818 Ga0495600_0223964 3300046809 Bacteria 1202
819 Ga0495600_0336237 3300046809 Bacteria 947
820 Ga0495660_0006126 3300046810 Bacteria 7140
821 Ga0495660_0012927 3300046810 Bacteria 4839
822 Ga0495581_0003195 3300047315 Bacteria 9376
823 Ga0495581_0015726 3300047315 Bacteria 4393
824 Ga0495581_0032518 3300047315 Bacteria 3020
825 Ga0495581_0061905 3300047315 Bacteria 2162
826 Ga0495581_0099920 3300047315 Bacteria 1685
827 Ga0495581_0156169 3300047315 Bacteria 1333
828 Ga0495581_0173333 3300047315 Bacteria 1262
829 Ga0495581_0247640 3300047315 Bacteria 1042
830 Ga0495581_0262280 3300047315 Bacteria 1010
831 Ga0495604_0000070 3300047317 Bacteria 89500
832 Ga0495604_0000385 3300047317 Bacteria 39910
833 Ga0495604_0001476 3300047317 Bacteria 19368
834 Ga0495604_0002049 3300047317 Bacteria 16276
835 Ga0495604_0018002 3300047317 Bacteria 5654
836 Ga0495604_0066109 3300047317 Bacteria 2751
837 Ga0495604_0073929 3300047317 Bacteria 2570
838 Ga0495604_0081059 3300047317 Bacteria 2430
839 Ga0495604_0141052 3300047317 Bacteria 1721
840 Ga0495604_0233206 3300047317 Bacteria 1261
841 Ga0495604_0404711 3300047317 Bacteria 898
842 Ga0495636_0004226 3300047318 Bacteria 5635
843 Ga0495636_0036138 3300047318 Bacteria 2036
844 Ga0495636_0088713 3300047318 Bacteria 1340
845 Ga0495636_0343015 3300047318 Bacteria 704
846 Ga0495674_0018316 3300047319 Bacteria 6519
847 Ga0495674_0051585 3300047319 Bacteria 3625
848 Ga0495674_0053562 3300047319 Bacteria 3546
849 Ga0495674_0109000 3300047319 Bacteria 2349
850 Ga0495674_0162255 3300047319 Bacteria 1869
851 Ga0495674_0204688 3300047319 Bacteria 1636
852 Ga0495674_0241459 3300047319 Bacteria 1488
853 Ga0495674_0282899 3300047319 Bacteria 1358
854 Ga0495672_0425365 3300047320 Bacteria 603
855 Ga0495676_0004682 3300047321 Bacteria 12526
856 Ga0495676_0027215 3300047321 Bacteria 4907
857 Ga0495676_0062084 3300047321 Bacteria 2919
858 Ga0495676_0076992 3300047321 Bacteria 2544
859 Ga0495676_0203918 3300047321 Bacteria 1372
860 Ga0495676_0257478 3300047321 Bacteria 1188
861 Ga0495676_0481799 3300047321 Bacteria 816
862 Ga0495680_0000195 3300047322 Bacteria 65440
863 Ga0495680_0004196 3300047322 Bacteria 13841
864 Ga0495680_0007153 3300047322 Bacteria 10280
865 Ga0495680_0017098 3300047322 Bacteria 6205
866 Ga0495680_0020452 3300047322 Bacteria 5569
867 Ga0495680_0021436 3300047322 Bacteria 5409
868 Ga0495680_0027349 3300047322 Bacteria 4688
869 Ga0495683_0086524 3300047323 Bacteria 1523
870 Ga0495683_0171299 3300047323 Bacteria 997
871 Ga0495687_009716 3300047443 Bacteria 5348
872 Ga0495687_067544 3300047443 Bacteria 1446
873 Ga0495687_077248 3300047443 Bacteria 1315
874 Ga0495675_0002990 3300047444 Bacteria 10145
875 Ga0495675_0003023 3300047444 Bacteria 10102
876 Ga0495675_0011010 3300047444 Bacteria 5669
877 Ga0495675_0017663 3300047444 Bacteria 4523
878 Ga0495675_0021862 3300047444 Bacteria 4075
879 Ga0495675_0027933 3300047444 Bacteria 3596
880 Ga0495675_0054932 3300047444 Bacteria 2526
881 Ga0495675_0139644 3300047444 Bacteria 1502
882 Ga0495679_024981 3300047446 Bacteria 2004
883 Ga0495679_044078 3300047446 Bacteria 1368
884 Ga0495685_001876 3300047447 Bacteria 6493
885 Ga0495685_009339 3300047447 Bacteria 3274
886 Ga0495685_011010 3300047447 Bacteria 3042
887 Ga0495681_0003180 3300047470 Bacteria 11474
888 Ga0495681_0017515 3300047470 Bacteria 3974
889 Ga0495681_0157153 3300047470 Bacteria 949
890 Ga0495684_0017677 3300047471 Bacteria 5491
891 Ga0495684_0097621 3300047471 Bacteria 2222
892 Ga0495684_0123162 3300047471 Bacteria 1951
893 Ga0495684_0157045 3300047471 Bacteria 1698
894 Ga0495686_0029178 3300047472 Bacteria 3590
895 Ga0495686_0071898 3300047472 Bacteria 2128
896 Ga0495686_0238381 3300047472 Bacteria 1027
897 Ga0495686_0243020 3300047472 Bacteria 1014
898 Ga0495593_0001454 3300047673 Bacteria 13885
899 Ga0495593_0006130 3300047673 Bacteria 7072
900 Ga0495593_0021962 3300047673 Bacteria 3560
901 Ga0495593_0035826 3300047673 Bacteria 2692
902 Ga0495593_0037710 3300047673 Bacteria 2612
903 Ga0495593_0050511 3300047673 Bacteria 2203
904 Ga0495593_0065512 3300047673 Bacteria 1895
905 Ga0495593_0083795 3300047673 Bacteria 1646
906 Ga0495602_0000122 3300048088 Bacteria 73031
907 Ga0495602_0017568 3300048088 Bacteria 7166
908 Ga0495602_0030008 3300048088 Bacteria 5166
909 Ga0495602_0033322 3300048088 Bacteria 4834
910 Ga0495602_0053483 3300048088 Bacteria 3576
911 Ga0495602_0061115 3300048088 Bacteria 3278
912 Ga0495602_0068896 3300048088 Bacteria 3036
913 Ga0495602_0070400 3300048088 Bacteria 2993
914 Ga0495602_0211322 3300048088 Bacteria 1472
915 Ga0495602_0291745 3300048088 Bacteria 1197
916 Ga0495602_0733293 3300048088 Bacteria 668
917 Ga0495614_0000388 3300048089 Bacteria 17839
918 Ga0495614_0016264 3300048089 Bacteria 3239
919 Ga0495614_0042976 3300048089 Bacteria 1937
920 Ga0495614_0127501 3300048089 Bacteria 1124
921 Ga0495614_0202979 3300048089 Bacteria 897
922 Ga0495626_0006119 3300048091 Bacteria 6905
923 Ga0496100_0054621 3300048903 Bacteria 2606
924 Ga0496100_0297860 3300048903 Bacteria 1206
925 Ga0496101_0059634 3300048904 Bacteria 2766
926 Ga0496101_0078212 3300048904 Bacteria 2439
927 Ga0496101_0364105 3300048904 Bacteria 1137
928 Ga0496102_0064355 3300048905 Bacteria 3359
929 Ga0496104_0000909 3300048907 Bacteria 25355
930 Ga0496104_0055242 3300048907 Bacteria 3754
931 Ga0496104_0074102 3300048907 Bacteria 3240
932 Ga0496104_0518311 3300048907 Bacteria 1103
933 Ga0496104_1182853 3300048907 Bacteria 668
934 Ga0496105_0009583 3300048908 Bacteria 7578
935 Ga0496105_0056371 3300048908 Bacteria 3243
936 Ga0496105_0197646 3300048908 Bacteria 1642
937 Ga0496105_0779095 3300048908 Bacteria 729
938 Ga0496106_0014561 3300048909 Bacteria 5812
939 Ga0496106_0028480 3300048909 Bacteria 4161
940 Ga0496106_0106933 3300048909 Bacteria 2175
941 Ga0496106_0414000 3300048909 Bacteria 1083
942 Ga0496107_0113543 3300048910 Bacteria 1993
943 Ga0496107_0215977 3300048910 Bacteria 1426
944 Ga0496108_0001829 3300048911 Bacteria 16995
945 Ga0496108_0019071 3300048911 Bacteria 5628
946 Ga0496108_0065031 3300048911 Bacteria 3073
947 Ga0496109_0286016 3300048912 Bacteria 1554
948 Ga0496109_0537695 3300048912 Bacteria 1102
949 Ga0496110_0039855 3300048913 Bacteria 4092
950 Ga0496110_1015379 3300048913 Bacteria 737
951 Ga0496111_0176849 3300048914 Bacteria 1586
952 Ga0496111_0348790 3300048914 Bacteria 1096
953 Ga0496112_0000817 3300048915 Bacteria 22051
954 Ga0496112_0098289 3300048915 Bacteria 2897
955 Ga0496112_0213307 3300048915 Bacteria 1887
956 Ga0496113_0020163 3300048916 Bacteria 4681
957 Ga0496113_0134982 3300048916 Bacteria 1938
958 Ga0496113_0570344 3300048916 Bacteria 907
959 Ga0496114_0012843 3300048917 Bacteria 6707
960 Ga0496114_0063734 3300048917 Bacteria 3086
961 Ga0496114_0155272 3300048917 Bacteria 1987
962 Ga0496114_0354594 3300048917 Bacteria 1298
963 Ga0496114_0373705 3300048917 Bacteria 1262
964 Ga0496115_0016929 3300048918 Bacteria 5561
965 Ga0496117_0053353 3300048920 Bacteria 2841
966 Ga0496118_0031289 3300048921 Bacteria 4414
967 Ga0496118_0034550 3300048921 Bacteria 4122
968 Ga0496118_0053609 3300048921 Bacteria 3063
969 Ga0496119_0070378 3300048922 Bacteria 2052
970 Ga0496121_0254923 3300048924 Bacteria 1215
971 Ga0496122_0000206 3300048925 Bacteria 131731
972 Ga0496122_0000583 3300048925 Bacteria 74712
973 Ga0496122_0130527 3300048925 Bacteria 1598
974 Ga0496123_0000112 3300048926 Bacteria 163990
975 Ga0496124_0000290 3300048927 Bacteria 94803
976 Ga0496124_0113231 3300048927 Bacteria 2180
977 Ga0496125_0000069 3300048928 Bacteria 246981
978 Ga0496125_0011923 3300048928 Bacteria 8660
979 Ga0496126_0088751 3300048929 Bacteria 2723
980 Ga0496126_0125238 3300048929 Bacteria 2225
981 Ga0501308_040256 3300049128 Bacteria 656
982 Ga0501310_020266 3300049130 Bacteria 824
983 Ga0501307_030584 3300049162 Bacteria 745
984 Ga0495682_0022616 3300049460 Bacteria 2351
985 Ga0501311_000618 3300049527 Bacteria 2617
986 Ga0501313_040960 3300049529 Bacteria 622
987 Ga0501315_000989 3300049531 Bacteria 2250
988 Ga0501316_011534 3300049532 Bacteria 1021
989 Ga0501317_001679 3300049533 Bacteria 1960
990 Ga0501323_001534 3300049539 Bacteria 2077
991 Ga0501323_001795 3300049539 Bacteria 1978
992 Ga0501324_003212 3300049540 Bacteria 1241
993 Ga0501324_006757 3300049540 Bacteria 974
994 Ga0501031_0057014 3300049568 Bacteria 2545
995 Ga0501031_0118152 3300049568 Bacteria 1732
996 Ga0501032_0013368 3300049569 Bacteria 5842
997 Ga0501032_0023444 3300049569 Bacteria 4263
998 Ga0501032_0045515 3300049569 Bacteria 2967
999 Ga0501032_0449553 3300049569 Bacteria 825
1000 Ga0501032_0528863 3300049569 Bacteria 752
1001 Ga0501033_0020260 3300049570 Bacteria 5025
1002 Ga0501033_0037370 3300049570 Bacteria 3635
1003 Ga0501033_0057008 3300049570 Bacteria 2887
1004 Ga0501033_0066039 3300049570 Bacteria 2660
1005 Ga0501033_0090480 3300049570 Bacteria 2239
1006 Ga0501033_0110208 3300049570 Bacteria 2004
1007 Ga0501033_0179412 3300049570 Bacteria 1518
1008 Ga0501033_0322770 3300049570 Bacteria 1084
1009 Ga0501033_0656214 3300049570 Bacteria 716
1010 Ga0501034_0012571 3300049571 Bacteria 8738
1011 Ga0501034_0054193 3300049571 Bacteria 4037
1012 Ga0501034_0064608 3300049571 Bacteria 3673
1013 Ga0501034_0067569 3300049571 Bacteria 3586
1014 Ga0501034_0122802 3300049571 Bacteria 2583
1015 Ga0501034_0144207 3300049571 Bacteria 2359
1016 Ga0501034_0173514 3300049571 Bacteria 2122
1017 Ga0501034_0184832 3300049571 Bacteria 2048
1018 Ga0501034_0196901 3300049571 Bacteria 1974
1019 Ga0501036_0001212 3300049572 Bacteria 19704
1020 Ga0501036_0010825 3300049572 Bacteria 7536
1021 Ga0501036_0019020 3300049572 Bacteria 5762
1022 Ga0501036_0103822 3300049572 Bacteria 2403
1023 Ga0501036_0116899 3300049572 Bacteria 2252
1024 Ga0501036_0121639 3300049572 Bacteria 2204
1025 Ga0501037_0003070 3300049573 Bacteria 12096
1026 Ga0501037_0029527 3300049573 Bacteria 4051
1027 Ga0501037_0034235 3300049573 Bacteria 3748
1028 Ga0501038_0002444 3300049574 Bacteria 17293
1029 Ga0501038_0032589 3300049574 Bacteria 4596
1030 Ga0501038_0033075 3300049574 Bacteria 4556
1031 Ga0501038_0048790 3300049574 Bacteria 3662
1032 Ga0501038_0056405 3300049574 Bacteria 3373
1033 Ga0501038_0159952 3300049574 Bacteria 1831
1034 Ga0501039_0101931 3300049575 Bacteria 2240
1035 Ga0501039_0179252 3300049575 Bacteria 1666
1036 Ga0501039_0394748 3300049575 Bacteria 1086
1037 Ga0501039_0495527 3300049575 Bacteria 959
1038 Ga0501040_0015630 3300049576 Bacteria 5017
1039 Ga0501041_0055004 3300049577 Bacteria 2429
1040 Ga0501041_0099014 3300049577 Bacteria 1803
1041 Ga0501042_0009583 3300049578 Bacteria 6461
1042 Ga0501042_0130741 3300049578 Bacteria 1809
1043 Ga0501042_0145961 3300049578 Bacteria 1706
1044 Ga0501042_0200902 3300049578 Bacteria 1437
1045 Ga0501042_0234895 3300049578 Bacteria 1323
1046 Ga0501042_0426463 3300049578 Bacteria 961
1047 Ga0501043_0002529 3300049579 Bacteria 15462
1048 Ga0501043_0050030 3300049579 Bacteria 3285
1049 Ga0501043_0050056 3300049579 Bacteria 3284
1050 Ga0501043_0078531 3300049579 Bacteria 2593
1051 Ga0501043_0087964 3300049579 Bacteria 2441
1052 Ga0501043_0091296 3300049579 Bacteria 2394
1053 Ga0501043_0375761 3300049579 Bacteria 1076
1054 Ga0501046_0010869 3300049580 Bacteria 7801
1055 Ga0501046_0197949 3300049580 Bacteria 1496
1056 Ga0501046_0258282 3300049580 Bacteria 1280
1057 Ga0501047_0000072 3300049581 Bacteria 126542
1058 Ga0501047_0002236 3300049581 Bacteria 18522
1059 Ga0501047_0023511 3300049581 Bacteria 5914
1060 Ga0501047_0032695 3300049581 Bacteria 5023
1061 Ga0501047_0052175 3300049581 Bacteria 3952
1062 Ga0501047_0095566 3300049581 Bacteria 2850
1063 Ga0501047_0131287 3300049581 Bacteria 2385
1064 Ga0501047_0162290 3300049581 Bacteria 2106
1065 Ga0501047_0249736 3300049581 Bacteria 1622
1066 Ga0501047_0402959 3300049581 Bacteria 1201
1067 Ga0501048_0023021 3300049582 Bacteria 4554
1068 Ga0501048_0024072 3300049582 Bacteria 4446
1069 Ga0501048_0096263 3300049582 Bacteria 2088
1070 Ga0501048_0099477 3300049582 Bacteria 2052
1071 Ga0501068_0119074 3300049584 Bacteria 1645
1072 Ga0501068_0509124 3300049584 Bacteria 781
1073 Ga0501068_0852955 3300049584 Bacteria 598
1074 Ga0501070_0012353 3300049586 Bacteria 7205
1075 Ga0501070_0042504 3300049586 Bacteria 3786
1076 Ga0501070_0121758 3300049586 Bacteria 2156
1077 Ga0501070_0160054 3300049586 Bacteria 1856
1078 Ga0501070_0537854 3300049586 Bacteria 936
1079 Ga0501071_0045006 3300049587 Bacteria 3167
1080 Ga0501071_1189265 3300049587 Bacteria 589
1081 Ga0501072_0076238 3300049588 Bacteria 2653
1082 Ga0501072_0148963 3300049588 Bacteria 1866
1083 Ga0501073_0008499 3300049589 Bacteria 7614
1084 Ga0501073_0499502 3300049589 Bacteria 841
1085 Ga0501074_0000848 3300049590 Bacteria 19450
1086 Ga0501074_0057023 3300049590 Bacteria 2814
1087 Ga0501076_0049046 3300049592 Bacteria 3338
1088 Ga0501076_0425975 3300049592 Bacteria 1092
1089 Ga0501235_037277 3300049669 Bacteria 1106
1090 Ga0501257_019938 3300049686 Bacteria 1571
1091 Ga0501079_0170812 3300049741 Bacteria 1695
1092 Ga0501079_0562151 3300049741 Bacteria 897
1093 Ga0501081_0112361 3300049743 Bacteria 1934
1094 Ga0501083_0010851 3300049744 Bacteria 6408
1095 Ga0501035_0003491 3300049822 Bacteria 15035
1096 Ga0501035_0013355 3300049822 Bacteria 7580
1097 Ga0501035_0032338 3300049822 Bacteria 4760
1098 Ga0501035_0039755 3300049822 Bacteria 4255
1099 Ga0501035_0045118 3300049822 Bacteria 3966
1100 Ga0501035_0087511 3300049822 Bacteria 2745
1101 Ga0501035_0105874 3300049822 Bacteria 2466
1102 Ga0501035_0187169 3300049822 Bacteria 1781
1103 Ga0501035_0597542 3300049822 Bacteria 899
1104 Ga0501044_0002742 3300049823 Bacteria 20039
1105 Ga0501044_0013235 3300049823 Bacteria 8931
1106 Ga0501044_0018277 3300049823 Bacteria 7513
1107 Ga0501044_0123954 3300049823 Bacteria 2582
1108 Ga0501044_0124468 3300049823 Bacteria 2576
1109 Ga0501044_0213395 3300049823 Bacteria 1883
1110 Ga0501044_0305518 3300049823 Bacteria 1518
1111 Ga0501044_0412336 3300049823 Bacteria 1262
1112 Ga0501044_0456093 3300049823 Bacteria 1184
1113 Ga0501044_0512674 3300049823 Bacteria 1099
1114 Ga0501044_0601664 3300049823 Bacteria 992
1115 Ga0501044_0747551 3300049823 Bacteria 860
1116 Ga0501044_0818626 3300049823 Bacteria 809
1117 Ga0501045_0068330 3300049824 Bacteria 2610
1118 Ga0501045_0094604 3300049824 Bacteria 2210
1119 Ga0501045_0667884 3300049824 Bacteria 767
1120 nmdc:mga0yw44_240120_c1 3300050492 Bacteria 1204
1121 nmdc:mga06z11_7684_c1 3300050494 Bacteria 4451
1122 nmdc:mga05p37_21063_c1 3300050507 Bacteria 7892
1123 nmdc:mga05p37_59022_c1 3300050507 Bacteria 4725
1124 nmdc:mga09592_189829_c1 3300050508 Bacteria 1778
1125 nmdc:mga0qj67_187915_c1 3300050509 Bacteria 1678
1126 nmdc:mga06r32_977402_c1 3300050510 Bacteria 800
1127 nmdc:mga08y16_79556_c1 3300050511 Bacteria 3416
1128 nmdc:mga0n895_134032_c1 3300050512 Bacteria 2503
1129 nmdc:mga0n895_5271_c1 3300050512 Bacteria 10765
1130 nmdc:mga0n895_59113_c1 3300050512 Bacteria 3783
1131 nmdc:mga0rr50_121363_c1 3300050513 Bacteria 2081
1132 nmdc:mga0rr50_179158_c1 3300050513 Bacteria 1731
1133 nmdc:mga0rr50_23778_c1 3300050513 Bacteria 4234
1134 nmdc:mga08x19_13898_c1 3300050514 Bacteria 4876
1135 nmdc:mga08x19_68539_c1 3300050514 Bacteria 2309
1136 nmdc:mga0a205_41756_c1 3300050515 Bacteria 4419
1137 nmdc:mga0a205_9759_c1 3300050515 Bacteria 8794
1138 Ga0495601_0010340 3300053077 Bacteria 5551
1139 Ga0495601_0011920 3300053077 Bacteria 5211
1140 Ga0495601_0036290 3300053077 Bacteria 3077
1141 Ga0495601_0081211 3300053077 Bacteria 2080
1142 Ga0495601_0086161 3300053077 Bacteria 2018
1143 Ga0495601_0182998 3300053077 Bacteria 1370
1144 Ga0495601_0409881 3300053077 Bacteria 878
1145 Ga0495612_0009788 3300053078 Bacteria 3884
1146 Ga0495612_0015980 3300053078 Bacteria 3007
1147 Ga0495612_0073321 3300053078 Bacteria 1430
1148 Ga0495612_0075689 3300053078 Bacteria 1409
1149 Ga0495612_0076115 3300053078 Bacteria 1405
1150 Ga0495612_0101488 3300053078 Bacteria 1225
1151 Ga0495612_0189865 3300053078 Bacteria 904
1152 Ga0495595_0000288 3300053084 Bacteria 19645
1153 Ga0495595_0004237 3300053084 Bacteria 5767
1154 Ga0495595_0065626 3300053084 Bacteria 1707
1155 Ga0495619_0014125 3300053085 Bacteria 5041
1156 Ga0495619_0029190 3300053085 Bacteria 3562
1157 Ga0495619_0052770 3300053085 Bacteria 2688
1158 Ga0495619_0103750 3300053085 Bacteria 1937
1159 Ga0495619_0105858 3300053085 Bacteria 1918
1160 Ga0495619_0271904 3300053085 Bacteria 1174
1161 Ga0495619_0288624 3300053085 Bacteria 1136
1162 Ga0495619_0317201 3300053085 Bacteria 1079
1163 Ga0500578_0027273 3300053086 Bacteria 3666
1164 Ga0500644_0038061 3300053088 Bacteria 1576
1165 Ga0500651_0229966 3300053093 Bacteria 1085
1166 Ga0500640_005745 3300053095 Bacteria 4663
1167 Ga0500641_0077403 3300053096 Bacteria 1408
1168 Ga0500654_067044 3300053099 Bacteria 1782
1169 Ga0500553_037039 3300053101 Bacteria 2410
1170 Ga0500556_0026382 3300053104 Bacteria 1930
1171 Ga0500572_021039 3300053111 Bacteria 1723
1172 Ga0500614_011290 3300053123 Bacteria 1931
1173 Ga0500628_003764 3300053129 Bacteria 2503
1174 Ga0500652_009578 3300053131 Bacteria 3283
1175 Ga0500652_105384 3300053131 Bacteria 1179
1176 Ga0500658_0009142 3300053134 Bacteria 3656
1177 Ga0500561_0001882 3300053137 Bacteria 3465
1178 Ga0500573_0020678 3300053140 Bacteria 3771
1179 Ga0500573_0117994 3300053140 Bacteria 1480
1180 Ga0500577_0156008 3300053142 Bacteria 970
1181 Ga0500579_020565 3300053143 Bacteria 4281
1182 Ga0500588_0019540 3300053146 Bacteria 1803
1183 Ga0500600_0014804 3300053149 Bacteria 4740
1184 Ga0500604_0067508 3300053151 Bacteria 1135
1185 Ga0500606_088096 3300053152 Bacteria 1050
1186 Ga0500616_0003674 3300053153 Bacteria 11511
1187 Ga0500616_0011658 3300053153 Bacteria 5179
1188 Ga0500624_001358 3300053157 Bacteria 4108
1189 Ga0500633_0009991 3300053160 Bacteria 2519
1190 Ga0500634_0047199 3300053161 Bacteria 2325
1191 Ga0500656_001101 3300053732 Bacteria 2236
1192 Ga0500587_000440 3300053739 Bacteria 4891
1193 Ga0501084_0078228 3300054114 Bacteria 2772
1194 Ga0501082_0008414 3300060353 Bacteria 8902
1195 Ga0501082_0017727 3300060353 Bacteria 6132
1196 Ga0501082_0051409 3300060353 Bacteria 3552
1197 Ga0501082_1058406 3300060353 Bacteria 709
1198 Ga0466962_0000156 3300061719 Bacteria 28746
1199 Ga0466962_0008705 3300061719 Bacteria 4865
1200 Ga0466962_0048045 3300061719 Bacteria 2039
1201 Ga0466962_0053482 3300061719 Bacteria 1930
1202 Ga0466962_0374035 3300061719 Bacteria 711
1203 Ga0530510_0479338 3300061734 Bacteria 942
1204 2515852502 2515154155 Bacteria 7985436
1205 2547411635 2547132111 Bacteria 8013147
1206 2554257041 2554235005 Bacteria 6457341
1207 2585305148 2582581313 Bacteria 10042643
1208 2585318320 2582581314 Bacteria 11452267
1209 2616701484 2616644814 Bacteria 11555299
1210 2643947631 2643221587 Bacteria 7586415
1211 2644080885 2643221613 Bacteria 4622396
1212 2644390187 2643221670 Bacteria 6497041
1213 2644435323 2643221677 Bacteria 7584031
1214 2644437585 2643221678 Bacteria 9540101
1215 2644504751 2643221690 Bacteria 4654705
1216 2644523783 2643221694 Bacteria 4392972
1217 2644627957 2643221714 Bacteria 9015452
1218 2644663798 2643221721 Bacteria 4486924
1219 2644667886 2643221722 Bacteria 4247614
1220 2676474503 2675903058 Bacteria 6822861
1221 2731907236 2731639228 Bacteria 4187555
1222 2784589400 2784132148 Bacteria 8627943
1223 2785342178 2784746763 Bacteria 9783172
1224 2785370479 2784746768 Bacteria 10036182
1225 2786671635 2786546132 Bacteria 10419719
1226 2799186590 2799112218 Bacteria 4315149
1227 2808843040 2808606359 Bacteria 9866990
1228 2808921381 2808606375 Bacteria 9466072
1229 2809233062 2808606448 Bacteria 8656184
1230 2812357083 2811994879 Bacteria 9313447
1231 2812479742 2811994917 Bacteria 7761064
1232 2827633023 2827628540 Bacteria 6858585
1233 2839986595 2839986021 Bacteria 3685650
1234 2839986601 2839986021 Bacteria 3685650
1235 2852640054 2852635781 Bacteria 8251373
1236 2856742144 2856741275 Bacteria 8096094
1237 2862179483 2862178590 Bacteria 8583590
1238 2862286665 2862281513 Bacteria 9621493
1239 2862296055 2862290372 Bacteria 7471434
1240 2862392519 2862382967 Bacteria 10317375
1241 2862510259 2862507626 Bacteria 9425308
1242 2862578449 2862574272 Bacteria 10567477
1243 2862709571 2862705112 Bacteria 6563286
1244 2863411860 2863404153 Bacteria 9672205
1245 2867348536 2867346516 Bacteria 7608576
1246 2867435698 2867428634 Bacteria 9590268
1247 2867475976 2867475112 Bacteria 6909112
1248 2873154962 2873151551 Bacteria 8625867
1249 2875394681 2875391855 Bacteria 7600475
1250 2877680142 2877676314 Bacteria 9512378
1251 2884704093 2884693830 Bacteria 11273186
1252 2884998045 2884994152 Bacteria 4492978
1253 2891401064 2891395885 Bacteria 9251614
1254 2891560060 2891554331 Bacteria 8812224
1255 2895431884 2895427314 Bacteria 13147766
1256 2895448552 2895442618 Bacteria 11027144
1257 2912718732 2912715099 Bacteria 9460473
1258 2918504620 2918501144 Bacteria 8668083
1259 2919471456 2919468124 Bacteria 9133025
1260 2932434730 2932431166 Bacteria 4215299
1261 2935892381 2935890801 Bacteria 4593001
1262 2946049954 2946045630 Bacteria 8527308
1263 2946068795 2946064051 Bacteria 8957905
1264 2946076841 2946072368 Bacteria 8999607
1265 2947228116 2947224130 Bacteria 9938529
1266 2954005941 2954002825 Bacteria 9173742
1267 2954385074 2954380949 Bacteria 10050426
1268 2954677921 2954673503 Bacteria 9685905
1269 2954686236 2954682443 Bacteria 9862841
1270 2954695892 2954691527 Bacteria 10720516
1271 2954711083 2954701450 Bacteria 10834262
1272 2954715297 2954711539 Bacteria 10867210
1273 2954725239 2954721474 Bacteria 10456478
1274 2954736577 2954731030 Bacteria 10243860
1275 2954744172 2954740390 Bacteria 10229294
1276 2954755427 2954749733 Bacteria 10366972
1277 2954763115 2954759201 Bacteria 9358192
1278 2964328240 2964326757 Bacteria 3290868
1279 2966602464 2966598605 Bacteria 7676064
1280 2990045583 2990044586 Bacteria 6603797
1281 2990063957 2990059506 Bacteria 9321252
1282 2995468033 2995463766 Bacteria 8577691
1283 2995726985 2995726249 Bacteria 3470435
1284 2997454284 2997451912 Bacteria 8492419
1285 3003000921 3002998708 Bacteria 11715108
1286 3006397265 3006393351 Bacteria 6615579
1287 3006428474 3006425503 Bacteria 6491253
1288 3006492248 3006486233 Bacteria 8157040
1289 3006500341 3006493962 Bacteria 8825450
1290 8008485877 8008485437 Bacteria 7198341
1291 8008566228 8008558824 Bacteria 10610750
1292 8023629554 8023623736 Bacteria 8593882
1293 8025484504 8025478263 Bacteria 8209203
1294 8025524961 8025524527 Bacteria 7197316
1295 8025538148 8025530807 Bacteria 8495698
1296 8033687542 8033684223 Bacteria 6906479
1297 8048409575 8048406513 Bacteria 8936924
1298 8053951463 8053945823 Bacteria 8962862
1299 8054161374 8054160619 Bacteria 7783213
1300 8055036861 8055034563 Bacteria 3562128
1301 8055040707 8055037949 Bacteria 3337834
1302 8056060990 8056060235 Bacteria 7259403
1303 8056454018 8056447290 Bacteria 7680491
1304 8056669205 8056667051 Bacteria 6953971
1305 8056833224 8056829672 Bacteria 9045328
1306 Ga0070717_10065248
1307 JGI24739J22299_10010829
1308 JGI24739J22299_10054830
1309 JGI24735J21928_10082150
1310 JGI24735J21928_10108197
1311 JGI25153J46596_10033766
1312 rootL2_10055055
1313 JGI25160J50197_1018765
1314 Ga0070658_10095112
1315 Ga0070683_100135277
1316 Ga0070683_100448463
1317 Ga0070680_100237792
1318 Ga0070691_10026742
1319 Ga0070671_100378328
1320 Ga0070667_100122393
1321 Ga0070709_10000303
1322 Ga0070709_10000658
1323 Ga0070709_10063183
1324 Ga0070714_100001285
1325 Ga0070714_100007011
1326 Ga0070714_100017017
1327 Ga0070714_100042447
1328 Ga0070714_100082975
1329 Ga0070714_100084104
1330 Ga0070714_100126586
1331 Ga0070714_100254436
1332 Ga0070714_100710830
1333 Ga0070713_100000735
1334 Ga0070713_100083338
1335 Ga0070713_100084766
1336 Ga0070713_100096675
1337 Ga0070713_100107677
1338 Ga0070713_101711383
1339 Ga0070710_10002868
1340 Ga0070711_100001622
1341 Ga0070711_100002814
1342 Ga0070711_100042489
1343 Ga0070711_100104285
1344 Ga0070711_100270564
1345 Ga0070711_100493291
1346 Ga0070708_100254009
1347 Ga0070663_100207088
1348 Ga0070663_100474322
1349 Ga0070678_100236706
1350 Ga0070681_10115673
1351 Ga0070681_10182789
1352 Ga0070706_100001435
1353 Ga0070706_100005954
1354 Ga0070706_100038357
1355 Ga0070706_100291256
1356 Ga0070706_100409956
1357 Ga0070707_100000833
1358 Ga0070707_100019207
1359 Ga0070707_100023123
1360 Ga0070707_100398034
1361 Ga0070698_100000680
1362 Ga0070698_100001044
1363 Ga0070698_100041951
1364 Ga0070698_100051264
1365 Ga0070699_100044519
1366 Ga0070699_100359689
1367 Ga0070699_100667491
1368 Ga0070697_100073899
1369 Ga0070697_100168505
1370 Ga0068853_100042399
1371 Ga0068853_100168810
1372 Ga0070695_100668750
1373 Ga0070696_100511849
1374 Ga0070665_100073321
1375 Ga0070665_100093875
1376 Ga0070665_100172659
1377 Ga0068855_100110791
1378 Ga0068855_100207190
1379 Ga0070664_100358433
1380 Ga0070664_100893661
1381 Ga0068854_100788008
1382 Ga0068852_100007469
1383 Ga0068859_100737826
1384 Ga0068863_100121156
1385 Ga0068860_100126846
1386 Ga0081455_10309069
1387 Ga0081540_1003225
1388 Ga0081540_1155036
1389 Ga0081539_10066960
1390 Ga0070717_10004476
1391 Ga0070717_10114967
1392 Ga0070717_10123979
1393 Ga0075365_10230197
1394 Ga0075363_100066381
1395 Ga0070715_10038014
1396 Ga0070715_10071889
1397 Ga0070716_100000094
1398 Ga0070716_100004007
1399 Ga0070716_100222343
1400 Ga0070712_100224202
1401 Ga0070712_100235700
1402 Ga0070712_100562509
1403 Ga0075367_10120663
1404 Ga0097621_100031362
1405 Ga0097621_100105362
1406 Ga0075370_10271902
1407 Ga0075428_100013717
1408 Ga0075428_100223572
1409 Ga0075433_10011945
1410 Ga0075433_10027801
1411 Ga0075433_11107116
1412 Ga0075434_100017170
1413 Ga0075434_100141004
1414 Ga0075434_100848954
1415 Ga0075429_100184222
1416 Ga0068865_100312719
1417 Ga0075436_100002907
1418 Ga0075436_100026649
1419 Ga0097620_100737656
1420 Ga0075435_100038265
1421 Ga0075435_100128010
1422 Ga0105251_10042952
1423 Ga0105244_10138189
1424 Ga0105240_10002593
1425 Ga0111539_10217332
1426 Ga0105245_10022695
1427 Ga0105247_10097872
1428 Ga0105247_10140142
1429 Ga0114129_10008421
1430 Ga0114129_10068964
1431 Ga0105243_10364898
1432 Ga0105243_10501073
1433 Ga0105243_10534848
1434 Ga0105241_10001133
1435 Ga0105241_10054363
1436 Ga0105241_10197349
1437 Ga0105248_10112199
1438 Ga0105248_10301486
1439 Ga0105237_10033948
1440 Ga0105237_10525944
1441 Ga0105237_10587634
1442 Ga0105238_10019076
1443 Ga0105249_10574137
1444 Ga0105239_10080227
1445 Ga0105246_10012385
1446 Ga0105246_10157689
1447 Ga0105246_10173966
1448 Ga0105246_10655340
1449 Ga0157370_10024372
1450 Ga0157369_10231037
1451 Ga0157374_10009898
1452 Ga0157374_10028904
1453 Ga0157378_10174862
1454 Ga0163162_10391453
1455 Ga0163162_10490143
1456 Ga0157372_10062057
1457 Ga0157372_10188025
1458 Ga0157372_10281353
1459 Ga0157372_10457540
1460 Ga0157375_10277578
1461 Ga0163163_10003442
1462 Ga0157380_10255069
1463 Ga0157377_10155670
1464 Ga0157377_10852080
1465 Ga0157379_10002390
1466 Ga0157376_10007343
1467 Ga0157376_10102298
1468 Ga0157376_10520189
1469 Ga0182006_1047820
1470 Ga0182007_10000948
1471 Ga0182005_1024865
1472 Ga0183367_1015
1473 Ga0206356_10039005
1474 Ga0206355_1518046
1475 Ga0206350_10371078
1476 Ga0206353_10318742
1477 Ga0213875_10016990
1478 Ga0213875_10042697
1479 Ga0224572_1002611
1480 Ga0228598_1030632
1481 Ga0209758_1020439
1482 Ga0207426_1003984
1483 Ga0207426_1072135
1484 Ga0209051_1112049
1485 Ga0207696_1038217
1486 Ga0207692_10000198
1487 Ga0207692_10005056
1488 Ga0207692_10007347
1489 Ga0207692_10026163
1490 Ga0207692_10039943
1491 Ga0207710_10263081
1492 Ga0207647_10007289
1493 Ga0207647_10044080
1494 Ga0207685_10007645
1495 Ga0207685_10028498
1496 Ga0207685_10048016
1497 Ga0207699_10000355
1498 Ga0207699_10008211
1499 Ga0207699_10013730
1500 Ga0207699_10014905
1501 Ga0207699_10069936
1502 Ga0207684_10000549
1503 Ga0207684_10001867
1504 Ga0207684_10023269
1505 Ga0207684_10304429
1506 Ga0207654_10002025
1507 Ga0207707_10214262
1508 Ga0207695_10001075
1509 Ga0207671_10000122
1510 Ga0207671_10858263
1511 Ga0207693_10012402
1512 Ga0207693_10018785
1513 Ga0207693_10056204
1514 Ga0207693_10088416
1515 Ga0207693_10166610
1516 Ga0207663_10057034
1517 Ga0207663_10647442
1518 Ga0207663_10990230
1519 Ga0207660_10372919
1520 Ga0207646_10000577
1521 Ga0207646_10017839
1522 Ga0207646_10077134
1523 Ga0207646_10104929
1524 Ga0207646_10314217
1525 Ga0207694_10000829
1526 Ga0207700_10000427
1527 Ga0207700_10008608
1528 Ga0207700_10008868
1529 Ga0207700_10037684
1530 Ga0207700_10081039
1531 Ga0207700_10111952
1532 Ga0207700_10111987
1533 Ga0207700_10293449
1534 Ga0207664_10006111
1535 Ga0207664_10010058
1536 Ga0207664_10029954
1537 Ga0207664_10039826
1538 Ga0207664_10056279
1539 Ga0207664_10075145
1540 Ga0207664_10172013
1541 Ga0207664_10409254
1542 Ga0207664_10768876
1543 Ga0207686_10347464
1544 Ga0207709_10238836
1545 Ga0207665_10001080
1546 Ga0207665_10003971
1547 Ga0207665_10007451
1548 Ga0207691_10137592
1549 Ga0207691_10930167
1550 Ga0207691_11020483
1551 Ga0207711_10115701
1552 Ga0207661_10138298
1553 Ga0207667_10006929
1554 Ga0207667_10094891
1555 Ga0207667_10287468
1556 Ga0207640_10006140
1557 Ga0207658_10386164
1558 Ga0207703_10146273
1559 Ga0207639_10023348
1560 Ga0207639_10048788
1561 Ga0207678_10084430
1562 Ga0207678_10486158
1563 Ga0207702_10019973
1564 Ga0207641_10059677
1565 Ga0207674_10214750
1566 Ga0207683_10188808
1567 Ga0207698_10035262
1568 Ga0209371_1008032
1569 Ga0209371_1018659
1570 Ga0207428_10053288
1571 Ga0268266_10042600
1572 Ga0307517_10008770
1573 Ga0307517_10012587
1574 Ga0307515_10001114
1575 Ga0307515_10101266
1576 Ga0265338_10000718
1577 Ga0268256_1005719
1578 Ga0268256_1015837
1579 Ga0307511_10003592
1580 Ga0307511_10089148
1581 Ga0307511_10145549
1582 Ga0307512_10006056
1583 Ga0307513_10015029
1584 Ga0307513_10036984
1585 Ga0307509_10030305
1586 Ga0307509_10166488
1587 Ga0307509_10174524
1588 Ga0265313_10125733
1589 Ga0307508_10019325
1590 Ga0307508_10105662
1591 Ga0307508_10191297
1592 Ga0307514_10001631
1593 Ga0307514_10022169
1594 Ga0307514_10303992
1595 Ga0316575_10000002
1596 Ga0316575_10000356
1597 Ga0316579_10011102
1598 Ga0316576_10000206
1599 Ga0316576_10001306
1600 Ga0316576_10257292
1601 Ga0316576_10353518
1602 Ga0307516_10010607
1603 Ga0307516_10051538
1604 Ga0307516_10503110
1605 Ga0316577_10020948
1606 Ga0307518_10039052
1607 Ga0307518_10169360
1608 Ga0307410_10078913
1609 Ga0307406_10521558
1610 Ga0307412_10168871
1611 Ga0307409_100100195
1612 Ga0307409_100192306
1613 Ga0307416_100148139
1614 Ga0307416_100759353
1615 Ga0307416_100990072
1616 Ga0307414_10112584
1617 Ga0307414_10405169
1618 Ga0307414_10867056
1619 Ga0307411_10117908
1620 Ga0307411_10592719
1621 Ga0307415_100561399
1622 Ga0307415_100829103
1623 Ga0316583_10037055
1624 Ga0316580_10013909
1625 Ga0307507_10000013
1626 Ga0307507_10057967
1627 Ga0307507_10097415
1628 Ga0307507_10136125
1629 Ga0307507_10140857
1630 Ga0307510_10045037
1631 Ga0307510_10152409
1632 Ga0307510_10245106
1633 Ga0307510_10287941
1634 Ga0373930_0019205
1635 Ga0373948_0006582
1636 Ga0373958_0106638
1637 Ga0373938_0006469
1638 Ga0373926_0040258
1639 Ga0373926_0139670
1640 Ga0373929_0037106
1641 Ga0373934_0000184
1642 Ga0373934_0002392
1643 Ga0373934_0018608
1644 Ga0373934_0019406
1645 Ga0373940_0048960
1646 Ga0373949_0038148
1647 Ga0373951_0030281
1648 Ga0373952_0048375
1649 Ga0373923_0006465
1650 Ga0373923_0030219
1651 Ga0373923_0048861
1652 Ga0373923_0084512
1653 Ga0373923_0109734
1654 Ga0373932_0003623
1655 Ga0373936_0032597
1656 Ga0373936_0046718
1657 Ga0373936_0100073
1658 Ga0373936_0170120
1659 Ga0373939_0057298
1660 Ga0373941_0078018
1661 Ga0373945_0009754
1662 Ga0373945_0049152
1663 Ga0373945_0082988
1664 Ga0373945_0131611
1665 Ga0373953_0000116
1666 Ga0373953_0005235
1667 Ga0373953_0012677
1668 Ga0373953_0026389
1669 Ga0373954_0001000
1670 Ga0373954_0024414
1671 Ga0373954_0106711
1672 Ga0373956_0000136
1673 Ga0373956_0011462
1674 Ga0373956_0103573
1675 Ga0373956_0109470
1676 Ga0373957_0000035
1677 Ga0373957_0002953
1678 Ga0373957_0003000
1679 Ga0373957_0018235
1680 Ga0373957_0061778
1681 Ga0373960_0011091
1682 Ga0373943_0494058
1683 Ga0373946_0132812
1684 Ga0373946_0299054
1685 Ga0373955_0000072
1686 Ga0373955_0010552
1687 Ga0373955_0042016
1688 Ga0373955_0048357
1689 Ga0373955_0091799
1690 Ga0373955_0264755
1691 Ga0373942_0035611
1692 Ga0373962_0009821
1693 Ga0316574_0021271
1694 Ga0316574_0209927
1695 Ga0373924_0001000
1696 Ga0373924_0002302
1697 Ga0373924_0012374
1698 Ga0373924_0026843
1699 Ga0373931_0143278
1700 Ga0373931_0291280
1701 Ga0373931_0550532
1702 Ga0373935_0045702
1703 Ga0373935_0120221
1704 Ga0373935_0151149
1705 Ga0373935_0170699
1706 Ga0373935_0396466
1707 Ga0373927_0080460
1708 Ga0373933_0000327
1709 Ga0373933_0006553
1710 Ga0373933_0018940
1711 Ga0373933_0036349
1712 Ga0373933_0160018
1713 Ga0373933_0200604
1714 Ga0373947_0075049
1715 Ga0373947_0100587
1716 Ga0373947_0129409
1717 Ga0373947_0161540
1718 Ga0373937_0000010
1719 Ga0373937_0001685
1720 Ga0373937_0009917
1721 Ga0373937_0017506
1722 Ga0373937_0803493
1723 Ga0316582_0025759
1724 Ga0316584_0000468
1725 Ga0316584_0367146
1726 Ga0316584_0733065
1727 Ga0373925_0103218
1728 Ga0373925_0134396
1729 Ga0373925_0300626
1730 Ga0373925_0377747
1731 Ga0395899_0002623
1732 Ga0395899_0203269
1733 Ga0395898_0031982
1734 Ga0395898_0058062
1735 Ga0316581_0002277
1736 Ga0436364_0849349
1737 Ga0436364_0894524
1738 Ga0436364_1059010
1739 Ga0436364_1147169
1740 Ga0395901_1541329
1741 Ga0436363_1505785
1742 Ga0436362_0845973
1743 Ga0439436_0003576
1744 Ga0439436_0008118
1745 Ga0439439_0000554
1746 Ga0439453_0021310
1747 Ga0451791_0512465
1748 Ga0451795_0794252
1749 Ga0451802_1325708
1750 Ga0451841_0752493
1751 Ga0451853_2214190
1752 Ga0439433_0000267
1753 Ga0439442_030524
1754 Ga0439448_0009759
1755 Ga0439448_0125248
1756 Ga0439449_0003868
1757 Ga0439449_0006979
1758 Ga0439455_0085584
1759 Ga0439457_000100
1760 Ga0439457_001085
1761 Ga0439462_0003676
1762 Ga0450894_001105
1763 Ga0450895_002110
1764 Ga0450898_001128
1765 Ga0450899_000632
1766 Ga0450903_000500
1767 Ga0450906_003967
1768 Ga0439458_0007753
1769 Ga0439458_0073582
1770 Ga0450908_009782
1771 Ga0466969_0004692
1772 Ga0466969_0007675
1773 Ga0466969_0018099
1774 Ga0466969_0018877
1775 Ga0466969_0107910
1776 Ga0466972_0012556
1777 Ga0466972_0073178
1778 Ga0466972_0131987
1779 Ga0466972_0164257
1780 Ga0466965_0083545
1781 Ga0466965_0129997
1782 Ga0466965_0194482
1783 Ga0466966_0001731
1784 Ga0466966_0002839
1785 Ga0466966_0007222
1786 Ga0466966_0015224
1787 Ga0466966_0035646
1788 Ga0466966_0041189
1789 Ga0466966_0274986
1790 Ga0466961_0006951
1791 Ga0466961_0012581
1792 Ga0466961_0029154
1793 Ga0466961_0037073
1794 Ga0466961_0056218
1795 Ga0466961_0060219
1796 Ga0466961_0142714
1797 Ga0466961_0412060
1798 Ga0466963_0004122
1799 Ga0466963_0004646
1800 Ga0466963_0180150
1801 Ga0466963_0283112
1802 Ga0466963_0759646
1803 Ga0466963_0927377
1804 Ga0466964_0080868
1805 Ga0466964_0299217
1806 Ga0466971_0004706
1807 Ga0466971_0005777
1808 Ga0466971_0010182
1809 Ga0466971_0040149
1810 Ga0466971_0048922
1811 Ga0466971_0209622
1812 Ga0466968_0087727
1813 Ga0466970_0000340
1814 Ga0466970_0007649
1815 Ga0466970_0011402
1816 Ga0466970_0105706
1817 Ga0466970_0264396
1818 Ga0466970_0512832
1819 Ga0466957_0000482
1820 Ga0466957_0031489
1821 Ga0466957_0349244
1822 Ga0466960_0002803
1823 Ga0466960_0125492
1824 Ga0466960_0171059
1825 Ga0466959_0001725
1826 Ga0466959_0012149
1827 Ga0466959_0015474
1828 Ga0466959_0024315
1829 Ga0466959_0097990
1830 Ga0466959_0125601
1831 Ga0466959_0218628
1832 Ga0466959_0244598
1833 Ga0466958_0000083
1834 Ga0466958_0014280
1835 Ga0466958_0070274
1836 Ga0466958_0127815
1837 Ga0466967_0035261
1838 Ga0466967_0105117
1839 Ga0466967_0201985
1840 Ga0466967_1645105
1841 Ga0495617_003736
1842 Ga0495592_0000136
1843 Ga0495592_0006355
1844 Ga0495592_0015144
1845 Ga0495592_0075441
1846 Ga0495592_0093513
1847 Ga0495592_0131556
1848 Ga0495592_0180425
1849 Ga0495592_0372488
1850 Ga0495603_0004768
1851 Ga0495603_0016026
1852 Ga0495603_0023453
1853 Ga0495603_0029409
1854 Ga0495603_0055964
1855 Ga0495603_0073210
1856 Ga0495629_0004137
1857 Ga0495629_0009288
1858 Ga0495629_0010861
1859 Ga0495629_0011501
1860 Ga0495629_0059207
1861 Ga0495629_0062453
1862 Ga0495629_0065153
1863 Ga0495629_0118408
1864 Ga0495629_0242946
1865 Ga0495629_0545579
1866 Ga0495638_0013477
1867 Ga0495638_0027916
1868 Ga0495638_0040475
1869 Ga0495638_0082360
1870 Ga0495641_0014933
1871 Ga0495641_0041104
1872 Ga0495641_0043399
1873 Ga0495641_0075536
1874 Ga0495641_0229465
1875 Ga0495651_0000047
1876 Ga0495651_0000251
1877 Ga0495651_0000452
1878 Ga0495651_0006816
1879 Ga0495651_0014042
1880 Ga0495651_0015668
1881 Ga0495651_0123334
1882 Ga0495651_0148793
1883 Ga0495653_0000753
1884 Ga0495653_0016556
1885 Ga0495653_0019645
1886 Ga0495653_0039630
1887 Ga0495653_0061156
1888 Ga0495653_0065677
1889 Ga0495653_0149206
1890 Ga0495653_0195548
1891 Ga0495580_0035896
1892 Ga0495580_0094787
1893 Ga0495582_0004891
1894 Ga0495582_0041169
1895 Ga0495582_0122487
1896 Ga0495582_0244922
1897 Ga0495582_0538378
1898 Ga0495639_0009946
1899 Ga0495639_0082203
1900 Ga0495662_0000990
1901 Ga0495662_0013161
1902 Ga0495662_0016011
1903 Ga0495662_0017846
1904 Ga0495662_0023647
1905 Ga0495662_0069877
1906 Ga0495662_0275317
1907 Ga0495664_0000447
1908 Ga0495664_0006683
1909 Ga0495664_0007598
1910 Ga0495664_0012044
1911 Ga0495664_0033188
1912 Ga0495664_0084649
1913 Ga0495585_0009338
1914 Ga0495585_0028053
1915 Ga0495585_0079626
1916 Ga0495585_0080988
1917 Ga0495594_0006912
1918 Ga0495594_0013664
1919 Ga0495594_0051380
1920 Ga0495594_0090696
1921 Ga0495594_0141163
1922 Ga0495594_0169880
1923 Ga0495607_0016214
1924 Ga0495583_0015667
1925 Ga0495606_0010908
1926 Ga0495608_0000089
1927 Ga0495608_0005222
1928 Ga0495608_0010518
1929 Ga0495608_0012351
1930 Ga0495608_0029367
1931 Ga0495608_0030063
1932 Ga0495610_0028169
1933 Ga0495616_0005383
1934 Ga0495618_0027385
1935 Ga0495618_0152604
1936 Ga0495618_0306676
1937 Ga0495620_0031352
1938 Ga0495628_0000325
1939 Ga0495628_0003602
1940 Ga0495628_0005690
1941 Ga0495628_0032896
1942 Ga0495628_0039248
1943 Ga0495628_0043744
1944 Ga0495628_0076458
1945 Ga0495628_0113392
1946 Ga0495628_0136341
1947 Ga0495628_0144274
1948 Ga0495628_0169940
1949 Ga0495628_0312066
1950 Ga0495630_0054579
1951 Ga0495630_0076461
1952 Ga0495630_0098499
1953 Ga0495630_0176416
1954 Ga0495630_0190313
1955 Ga0495630_0199897
1956 Ga0495631_0009662
1957 Ga0495631_0093134
1958 Ga0495632_0167646
1959 Ga0495637_0024609
1960 Ga0495643_0001898
1961 Ga0495643_0005581
1962 Ga0495643_0118303
1963 Ga0495648_0208265
1964 Ga0495666_0000558
1965 Ga0495666_0005462
1966 Ga0495666_0011524
1967 Ga0495666_0129906
1968 Ga0495666_0169154
1969 Ga0495652_0000199
1970 Ga0495652_0000982
1971 Ga0495652_0006292
1972 Ga0495652_0017286
1973 Ga0495652_0023352
1974 Ga0495652_0031986
1975 Ga0495652_0038570
1976 Ga0495652_0047643
1977 Ga0495652_0062877
1978 Ga0495652_0084586
1979 Ga0495652_0140223
1980 Ga0495652_0324755
1981 Ga0495654_0003823
1982 Ga0495665_0003003
1983 Ga0495665_0014672
1984 Ga0495665_0017945
1985 Ga0495665_0209156
1986 Ga0495665_0284761
1987 Ga0495640_0007528
1988 Ga0495640_0012287
1989 Ga0495640_0013458
1990 Ga0495640_0047394
1991 Ga0495640_0107147
1992 Ga0495640_0116559
1993 Ga0495640_0160390
1994 Ga0495586_0001586
1995 Ga0495586_0001723
1996 Ga0495586_0008008
1997 Ga0495586_0038041
1998 Ga0495586_0082919
1999 Ga0495586_0087249
2000 Ga0495586_0127408
2001 Ga0495587_0000074
2002 Ga0495587_0000644
2003 Ga0495587_0012793
2004 Ga0495587_0024905
2005 Ga0495587_0025699
2006 Ga0495587_0072375
2007 Ga0495587_0111917
2008 Ga0495587_0240668
2009 Ga0495609_0009209
2010 Ga0495597_0036879
2011 Ga0495597_0221597
2012 Ga0495597_0332363
2013 Ga0495645_0003455
2014 Ga0495645_0007656
2015 Ga0495645_0014924
2016 Ga0495645_0017450
2017 Ga0495645_0035334
2018 Ga0495645_0063472
2019 Ga0495645_0076533
2020 Ga0495645_0223340
2021 Ga0495645_0281841
2022 Ga0495645_0744917
2023 Ga0495622_0002086
2024 Ga0495622_0004999
2025 Ga0495622_0045660
2026 Ga0495622_0063860
2027 Ga0495622_0066602
2028 Ga0495633_0004699
2029 Ga0495633_0052786
2030 Ga0495667_0000064
2031 Ga0495667_0000347
2032 Ga0495667_0002034
2033 Ga0495667_0008486
2034 Ga0495667_0022169
2035 Ga0495667_0038878
2036 Ga0495667_0088717
2037 Ga0495634_0000804
2038 Ga0495634_0006199
2039 Ga0495634_0032561
2040 Ga0495634_0036650
2041 Ga0495634_0101575
2042 Ga0495634_0667932
2043 Ga0495611_0013516
2044 Ga0495611_0222453
2045 Ga0495625_0104124
2046 Ga0495625_0150270
2047 Ga0495625_0279644
2048 Ga0495635_0001573
2049 Ga0495635_0020778
2050 Ga0495635_0023230
2051 Ga0495635_0045888
2052 Ga0495635_0051031
2053 Ga0495635_0089295
2054 Ga0495635_0103554
2055 Ga0495635_0375411
2056 Ga0495635_0624193
2057 Ga0495661_0014414
2058 Ga0495661_0160081
2059 Ga0495588_0009014
2060 Ga0495588_0033389
2061 Ga0495588_0079314
2062 Ga0495588_0153539
2063 Ga0495588_0243192
2064 Ga0495657_0000009
2065 Ga0495657_0015381
2066 Ga0495657_0022658
2067 Ga0495657_0023773
2068 Ga0495657_0025398
2069 Ga0495657_0030262
2070 Ga0495657_0041850
2071 Ga0495657_0057845
2072 Ga0495657_0069033
2073 Ga0495657_0204768
2074 Ga0495599_0000084
2075 Ga0495599_0024103
2076 Ga0495599_0133992
2077 Ga0495599_0257210
2078 Ga0495599_0271365
2079 Ga0495623_0000168
2080 Ga0495623_0016760
2081 Ga0495623_0019236
2082 Ga0495623_0024851
2083 Ga0495623_0135912
2084 Ga0495623_0137406
2085 Ga0495623_0156499
2086 Ga0495623_0210545
2087 Ga0495623_0321023
2088 Ga0495646_0000131
2089 Ga0495646_0006779
2090 Ga0495646_0010288
2091 Ga0495646_0030816
2092 Ga0495646_0084121
2093 Ga0495646_0264135
2094 Ga0495647_0024412
2095 Ga0495658_0014985
2096 Ga0495658_0153570
2097 Ga0495613_0000387
2098 Ga0495613_0002214
2099 Ga0495613_0004116
2100 Ga0495613_0082328
2101 Ga0495613_0229356
2102 Ga0495613_0238367
2103 Ga0495624_0009562
2104 Ga0495624_0024942
2105 Ga0495624_0082931
2106 Ga0495624_0113025
2107 Ga0495670_0004170
2108 Ga0495670_0222664
2109 Ga0495671_0013623
2110 Ga0495649_0120395
2111 Ga0495649_0302760
2112 Ga0495589_0013467
2113 Ga0495589_0141399
2114 Ga0495600_0009602
2115 Ga0495600_0009890
2116 Ga0495600_0011653
2117 Ga0495600_0012067
2118 Ga0495600_0015357
2119 Ga0495600_0020564
2120 Ga0495600_0086335
2121 Ga0495600_0122217
2122 Ga0495600_0178561
2123 Ga0495600_0223964
2124 Ga0495600_0336237
2125 Ga0495660_0006126
2126 Ga0495660_0012927
2127 Ga0495581_0003195
2128 Ga0495581_0015726
2129 Ga0495581_0032518
2130 Ga0495581_0061905
2131 Ga0495581_0099920
2132 Ga0495581_0156169
2133 Ga0495581_0173333
2134 Ga0495581_0247640
2135 Ga0495581_0262280
2136 Ga0495604_0000070
2137 Ga0495604_0000385
2138 Ga0495604_0001476
2139 Ga0495604_0002049
2140 Ga0495604_0018002
2141 Ga0495604_0066109
2142 Ga0495604_0073929
2143 Ga0495604_0081059
2144 Ga0495604_0141052
2145 Ga0495604_0233206
2146 Ga0495604_0404711
2147 Ga0495636_0004226
2148 Ga0495636_0036138
2149 Ga0495636_0088713
2150 Ga0495636_0343015
2151 Ga0495674_0018316
2152 Ga0495674_0051585
2153 Ga0495674_0053562
2154 Ga0495674_0109000
2155 Ga0495674_0162255
2156 Ga0495674_0204688
2157 Ga0495674_0241459
2158 Ga0495674_0282899
2159 Ga0495672_0425365
2160 Ga0495676_0004682
2161 Ga0495676_0027215
2162 Ga0495676_0062084
2163 Ga0495676_0076992
2164 Ga0495676_0203918
2165 Ga0495676_0257478
2166 Ga0495676_0481799
2167 Ga0495680_0000195
2168 Ga0495680_0004196
2169 Ga0495680_0007153
2170 Ga0495680_0017098
2171 Ga0495680_0020452
2172 Ga0495680_0021436
2173 Ga0495680_0027349
2174 Ga0495683_0086524
2175 Ga0495683_0171299
2176 Ga0495687_009716
2177 Ga0495687_067544
2178 Ga0495687_077248
2179 Ga0495675_0002990
2180 Ga0495675_0003023
2181 Ga0495675_0011010
2182 Ga0495675_0017663
2183 Ga0495675_0021862
2184 Ga0495675_0027933
2185 Ga0495675_0054932
2186 Ga0495675_0139644
2187 Ga0495679_024981
2188 Ga0495679_044078
2189 Ga0495685_001876
2190 Ga0495685_009339
2191 Ga0495685_011010
2192 Ga0495681_0003180
2193 Ga0495681_0017515
2194 Ga0495681_0157153
2195 Ga0495684_0017677
2196 Ga0495684_0097621
2197 Ga0495684_0123162
2198 Ga0495684_0157045
2199 Ga0495686_0029178
2200 Ga0495686_0071898
2201 Ga0495686_0238381
2202 Ga0495686_0243020
2203 Ga0495593_0001454
2204 Ga0495593_0006130
2205 Ga0495593_0021962
2206 Ga0495593_0035826
2207 Ga0495593_0037710
2208 Ga0495593_0050511
2209 Ga0495593_0065512
2210 Ga0495593_0083795
2211 Ga0495602_0000122
2212 Ga0495602_0017568
2213 Ga0495602_0030008
2214 Ga0495602_0033322
2215 Ga0495602_0053483
2216 Ga0495602_0061115
2217 Ga0495602_0068896
2218 Ga0495602_0070400
2219 Ga0495602_0211322
2220 Ga0495602_0291745
2221 Ga0495602_0733293
2222 Ga0495614_0000388
2223 Ga0495614_0016264
2224 Ga0495614_0042976
2225 Ga0495614_0127501
2226 Ga0495614_0202979
2227 Ga0495626_0006119
2228 Ga0496100_0054621
2229 Ga0496100_0297860
2230 Ga0496101_0059634
2231 Ga0496101_0078212
2232 Ga0496101_0364105
2233 Ga0496102_0064355
2234 Ga0496104_0000909
2235 Ga0496104_0055242
2236 Ga0496104_0074102
2237 Ga0496104_0518311
2238 Ga0496104_1182853
2239 Ga0496105_0009583
2240 Ga0496105_0056371
2241 Ga0496105_0197646
2242 Ga0496105_0779095
2243 Ga0496106_0014561
2244 Ga0496106_0028480
2245 Ga0496106_0106933
2246 Ga0496106_0414000
2247 Ga0496107_0113543
2248 Ga0496107_0215977
2249 Ga0496108_0001829
2250 Ga0496108_0019071
2251 Ga0496108_0065031
2252 Ga0496109_0286016
2253 Ga0496109_0537695
2254 Ga0496110_0039855
2255 Ga0496110_1015379
2256 Ga0496111_0176849
2257 Ga0496111_0348790
2258 Ga0496112_0000817
2259 Ga0496112_0098289
2260 Ga0496112_0213307
2261 Ga0496113_0020163
2262 Ga0496113_0134982
2263 Ga0496113_0570344
2264 Ga0496114_0012843
2265 Ga0496114_0063734
2266 Ga0496114_0155272
2267 Ga0496114_0354594
2268 Ga0496114_0373705
2269 Ga0496115_0016929
2270 Ga0496117_0053353
2271 Ga0496118_0031289
2272 Ga0496118_0034550
2273 Ga0496118_0053609
2274 Ga0496119_0070378
2275 Ga0496121_0254923
2276 Ga0496122_0000206
2277 Ga0496122_0000583
2278 Ga0496122_0130527
2279 Ga0496123_0000112
2280 Ga0496124_0000290
2281 Ga0496124_0113231
2282 Ga0496125_0000069
2283 Ga0496125_0011923
2284 Ga0496126_0088751
2285 Ga0496126_0125238
2286 Ga0501308_040256
2287 Ga0501310_020266
2288 Ga0501307_030584
2289 Ga0495682_0022616
2290 Ga0501311_000618
2291 Ga0501313_040960
2292 Ga0501315_000989
2293 Ga0501316_011534
2294 Ga0501317_001679
2295 Ga0501323_001534
2296 Ga0501323_001795
2297 Ga0501324_003212
2298 Ga0501324_006757
2299 Ga0501031_0057014
2300 Ga0501031_0118152
2301 Ga0501032_0013368
2302 Ga0501032_0023444
2303 Ga0501032_0045515
2304 Ga0501032_0449553
2305 Ga0501032_0528863
2306 Ga0501033_0020260
2307 Ga0501033_0037370
2308 Ga0501033_0057008
2309 Ga0501033_0066039
2310 Ga0501033_0090480
2311 Ga0501033_0110208
2312 Ga0501033_0179412
2313 Ga0501033_0322770
2314 Ga0501033_0656214
2315 Ga0501034_0012571
2316 Ga0501034_0054193
2317 Ga0501034_0064608
2318 Ga0501034_0067569
2319 Ga0501034_0122802
2320 Ga0501034_0144207
2321 Ga0501034_0173514
2322 Ga0501034_0184832
2323 Ga0501034_0196901
2324 Ga0501036_0001212
2325 Ga0501036_0010825
2326 Ga0501036_0019020
2327 Ga0501036_0103822
2328 Ga0501036_0116899
2329 Ga0501036_0121639
2330 Ga0501037_0003070
2331 Ga0501037_0029527
2332 Ga0501037_0034235
2333 Ga0501038_0002444
2334 Ga0501038_0032589
2335 Ga0501038_0033075
2336 Ga0501038_0048790
2337 Ga0501038_0056405
2338 Ga0501038_0159952
2339 Ga0501039_0101931
2340 Ga0501039_0179252
2341 Ga0501039_0394748
2342 Ga0501039_0495527
2343 Ga0501040_0015630
2344 Ga0501041_0055004
2345 Ga0501041_0099014
2346 Ga0501042_0009583
2347 Ga0501042_0130741
2348 Ga0501042_0145961
2349 Ga0501042_0200902
2350 Ga0501042_0234895
2351 Ga0501042_0426463
2352 Ga0501043_0002529
2353 Ga0501043_0050030
2354 Ga0501043_0050056
2355 Ga0501043_0078531
2356 Ga0501043_0087964
2357 Ga0501043_0091296
2358 Ga0501043_0375761
2359 Ga0501046_0010869
2360 Ga0501046_0197949
2361 Ga0501046_0258282
2362 Ga0501047_0000072
2363 Ga0501047_0002236
2364 Ga0501047_0023511
2365 Ga0501047_0032695
2366 Ga0501047_0052175
2367 Ga0501047_0095566
2368 Ga0501047_0131287
2369 Ga0501047_0162290
2370 Ga0501047_0249736
2371 Ga0501047_0402959
2372 Ga0501048_0023021
2373 Ga0501048_0024072
2374 Ga0501048_0096263
2375 Ga0501048_0099477
2376 Ga0501068_0119074
2377 Ga0501068_0509124
2378 Ga0501068_0852955
2379 Ga0501070_0012353
2380 Ga0501070_0042504
2381 Ga0501070_0121758
2382 Ga0501070_0160054
2383 Ga0501070_0537854
2384 Ga0501071_0045006
2385 Ga0501071_1189265
2386 Ga0501072_0076238
2387 Ga0501072_0148963
2388 Ga0501073_0008499
2389 Ga0501073_0499502
2390 Ga0501074_0000848
2391 Ga0501074_0057023
2392 Ga0501076_0049046
2393 Ga0501076_0425975
2394 Ga0501235_037277
2395 Ga0501257_019938
2396 Ga0501079_0170812
2397 Ga0501079_0562151
2398 Ga0501081_0112361
2399 Ga0501083_0010851
2400 Ga0501035_0003491
2401 Ga0501035_0013355
2402 Ga0501035_0032338
2403 Ga0501035_0039755
2404 Ga0501035_0045118
2405 Ga0501035_0087511
2406 Ga0501035_0105874
2407 Ga0501035_0187169
2408 Ga0501035_0597542
2409 Ga0501044_0002742
2410 Ga0501044_0013235
2411 Ga0501044_0018277
2412 Ga0501044_0123954
2413 Ga0501044_0124468
2414 Ga0501044_0213395
2415 Ga0501044_0305518
2416 Ga0501044_0412336
2417 Ga0501044_0456093
2418 Ga0501044_0512674
2419 Ga0501044_0601664
2420 Ga0501044_0747551
2421 Ga0501044_0818626
2422 Ga0501045_0068330
2423 Ga0501045_0094604
2424 Ga0501045_0667884
2425 nmdc:mga0yw44_240120_c1
2426 nmdc:mga06z11_7684_c1
2427 nmdc:mga05p37_21063_c1
2428 nmdc:mga05p37_59022_c1
2429 nmdc:mga09592_189829_c1
2430 nmdc:mga0qj67_187915_c1
2431 nmdc:mga06r32_977402_c1
2432 nmdc:mga08y16_79556_c1
2433 nmdc:mga0n895_134032_c1
2434 nmdc:mga0n895_5271_c1
2435 nmdc:mga0n895_59113_c1
2436 nmdc:mga0rr50_121363_c1
2437 nmdc:mga0rr50_179158_c1
2438 nmdc:mga0rr50_23778_c1
2439 nmdc:mga08x19_13898_c1
2440 nmdc:mga08x19_68539_c1
2441 nmdc:mga0a205_41756_c1
2442 nmdc:mga0a205_9759_c1
2443 Ga0495601_0010340
2444 Ga0495601_0011920
2445 Ga0495601_0036290
2446 Ga0495601_0081211
2447 Ga0495601_0086161
2448 Ga0495601_0182998
2449 Ga0495601_0409881
2450 Ga0495612_0009788
2451 Ga0495612_0015980
2452 Ga0495612_0073321
2453 Ga0495612_0075689
2454 Ga0495612_0076115
2455 Ga0495612_0101488
2456 Ga0495612_0189865
2457 Ga0495595_0000288
2458 Ga0495595_0004237
2459 Ga0495595_0065626
2460 Ga0495619_0014125
2461 Ga0495619_0029190
2462 Ga0495619_0052770
2463 Ga0495619_0103750
2464 Ga0495619_0105858
2465 Ga0495619_0271904
2466 Ga0495619_0288624
2467 Ga0495619_0317201
2468 Ga0500578_0027273
2469 Ga0500644_0038061
2470 Ga0500651_0229966
2471 Ga0500640_005745
2472 Ga0500641_0077403
2473 Ga0500654_067044
2474 Ga0500553_037039
2475 Ga0500556_0026382
2476 Ga0500572_021039
2477 Ga0500614_011290
2478 Ga0500628_003764
2479 Ga0500652_009578
2480 Ga0500652_105384
2481 Ga0500658_0009142
2482 Ga0500561_0001882
2483 Ga0500573_0020678
2484 Ga0500573_0117994
2485 Ga0500577_0156008
2486 Ga0500579_020565
2487 Ga0500588_0019540
2488 Ga0500600_0014804
2489 Ga0500604_0067508
2490 Ga0500606_088096
2491 Ga0500616_0003674
2492 Ga0500616_0011658
2493 Ga0500624_001358
2494 Ga0500633_0009991
2495 Ga0500634_0047199
2496 Ga0500656_001101
2497 Ga0500587_000440
2498 Ga0501084_0078228
2499 Ga0501082_0008414
2500 Ga0501082_0017727
2501 Ga0501082_0051409
2502 Ga0501082_1058406
2503 Ga0466962_0000156
2504 Ga0466962_0008705
2505 Ga0466962_0048045
2506 Ga0466962_0053482
2507 Ga0466962_0374035
2508 Ga0530510_0479338
2509 2515852502
2510 2547411635
2511 2554257041
2512 2585305148
2513 2585318320
2514 2616701484
2515 2643947631
2516 2644080885
2517 2644390187
2518 2644435323
2519 2644437585
2520 2644504751
2521 2644523783
2522 2644627957
2523 2644663798
2524 2644667886
2525 2676474503
2526 2731907236
2527 2784589400
2528 2785342178
2529 2785370479
2530 2786671635
2531 2799186590
2532 2808843040
2533 2808921381
2534 2809233062
2535 2812357083
2536 2812479742
2537 2827633023
2538 2839986595
2539 2839986601
2540 2852640054
2541 2856742144
2542 2862179483
2543 2862286665
2544 2862296055
2545 2862392519
2546 2862510259
2547 2862578449
2548 2862709571
2549 2863411860
2550 2867348536
2551 2867435698
2552 2867475976
2553 2873154962
2554 2875394681
2555 2877680142
2556 2884704093
2557 2884998045
2558 2891401064
2559 2891560060
2560 2895431884
2561 2895448552
2562 2912718732
2563 2918504620
2564 2919471456
2565 2932434730
2566 2935892381
2567 2946049954
2568 2946068795
2569 2946076841
2570 2947228116
2571 2954005941
2572 2954385074
2573 2954677921
2574 2954686236
2575 2954695892
2576 2954711083
2577 2954715297
2578 2954725239
2579 2954736577
2580 2954744172
2581 2954755427
2582 2954763115
2583 2964328240
2584 2966602464
2585 2990045583
2586 2990063957
2587 2995468033
2588 2995726985
2589 2997454284
2590 3003000921
2591 3006397265
2592 3006428474
2593 3006492248
2594 3006500341
2595 8008485877
2596 8008566228
2597 8023629554
2598 8025484504
2599 8025524961
2600 8025538148
2601 8033687542
2602 8048409575
2603 8053951463
2604 8054161374
2605 8055036861
2606 8055040707
2607 8056060990
2608 8056454018
2609 8056669205
2610 8056833224

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

16

165

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ohp-assembly1.cif.gz_D crystal structure of hgprt from vibrio cholerae 0.9466 14 177
2geb-assembly1.cif.gz_A crystal structure of the thermoanaerobacter tengcongensis hypoxanthine-guanine phosphoribosyltransferase l160i mutant: insights into the inhibitor design 0.9433 11 180
4rqb-assembly1.cif.gz_A crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (tetragonal space group) 0.9431 8 182
4rhu-assembly2.cif.gz_F crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease 0.9406 9 180
1r3u-assembly1.cif.gz_A crystal structure of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis 0.9392 11 180
ID Description Score Start End Superfamily
3acdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9368 17 177 3.40.50.2020
af_I1LDB6_1_185_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9294 8 180 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9149 11 177 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9095 11 177 3.40.50.2020
1hgxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9028 11 180 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A499V2Y7-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9758 3 181 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-N0E1Y8-F1-model_v4 tRNA(Ile)-lysidine synthase (EC 6.3.4.19) (tRNA(Ile)-2-lysyl-cytidine synthase) (tRNA(Ile)-lysidine synthetase) 0.9718 1 180 GO:0000287
GO:0004422
GO:0005524
GO:0005829
GO:0006166
GO:0006178
GO:0006400
GO:0032263
GO:0032264
GO:0032267
GO:0046100
AF-A0A7X7G7K8-F1-model_v4 tRNA(Ile)-lysidine synthase (EC 6.3.4.19) (tRNA(Ile)-2-lysyl-cytidine synthase) (tRNA(Ile)-lysidine synthetase) 0.9709 1 182 GO:0000287
GO:0004422
GO:0005524
GO:0005829
GO:0006166
GO:0006178
GO:0006400
GO:0016879
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-A0A511YXU0-F1-model_v4 tRNA(Ile)-lysidine synthase (EC 6.3.4.19) (tRNA(Ile)-2-lysyl-cytidine synthase) (tRNA(Ile)-lysidine synthetase) 0.9702 2 182 GO:0000287
GO:0004422
GO:0005524
GO:0005829
GO:0006166
GO:0006178
GO:0006400
GO:0032263
GO:0032264
GO:0032267
GO:0046100
GO:0052657
AF-A0A497W816-F1-model_v4 deleted 0.9701 1 182

Map