F492883
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1312 | 673 | 2624 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_100365714|Ga0068858_1003657143 |
| Length | 128 |
| Sequence | MAPDMLYFYNMSNPENVPPNAISEQQDRVFRALASHHRRAILDVLRDQPLTTGALCAQFLELDRCTVMQHLKVLEAADLIIAERKGRERWNHLNPLPIHAIHERWIGPHAERAVAMLARLKHDLEKSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 111 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 114 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 115 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 116 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 117 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 118 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 179 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 180 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 181 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 184 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 197 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 198 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 207 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 208 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 209 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 213 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 214 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 215 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 216 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 217 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 218 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 219 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 220 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 221 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 222 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 223 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 224 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 225 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 226 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 227 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 228 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 229 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 230 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 231 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 232 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 233 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 280 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 281 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 282 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 283 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 284 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 285 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 286 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 287 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 288 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 289 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 308 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 310 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 314 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 316 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 321 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 322 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 324 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 331 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 332 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 333 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 334 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 335 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 336 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 337 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 338 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 339 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 340 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 341 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 343 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 345 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 347 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 353 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 354 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 355 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 356 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 357 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 358 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 359 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 360 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 361 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 362 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 363 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 364 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 365 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 366 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 367 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 368 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 369 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 370 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 371 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 372 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 373 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 374 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 375 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 376 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 377 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 378 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 379 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 380 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 381 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 382 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 383 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 384 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 385 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 386 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 387 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 388 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 389 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 390 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 391 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 392 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 393 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 394 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 395 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 396 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 397 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 398 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 399 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 400 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 401 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 402 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 403 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 404 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 405 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 406 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 407 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 408 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 409 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 410 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 411 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 412 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 413 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 414 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 415 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 416 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 417 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 418 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 419 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 420 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 421 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 422 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 423 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 424 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 425 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 426 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 427 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 428 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 429 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 430 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 431 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 432 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 433 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 434 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 435 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 436 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 437 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 438 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 439 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 440 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 441 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 442 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 443 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 444 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 445 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 446 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 447 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 448 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 449 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 450 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 451 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 452 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 453 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 454 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 455 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 456 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 457 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 458 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 459 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 460 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 461 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 462 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 463 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 464 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 465 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 466 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 467 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 468 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 469 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 470 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 471 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 472 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 473 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 474 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 475 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 476 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 477 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 478 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 479 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 480 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 481 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 482 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 483 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 484 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 485 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 486 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 487 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 488 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 489 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 490 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 491 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 492 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 493 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 494 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 495 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 496 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 497 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 498 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 499 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 500 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 501 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 502 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 503 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 504 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 505 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 506 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 507 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 508 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 509 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 510 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 511 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 512 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 513 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 514 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 515 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 516 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 517 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 518 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 519 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 520 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 521 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 522 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 523 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 524 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 525 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 526 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 527 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 528 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 529 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 530 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 531 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 532 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 533 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 534 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 535 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 536 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 537 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 538 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 539 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 540 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 541 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 542 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 543 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 544 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 545 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 546 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 547 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 548 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 549 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 550 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 551 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 552 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 553 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 554 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 555 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 556 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 557 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 558 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 559 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 560 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 561 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 562 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 563 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 564 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 565 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 566 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 567 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 568 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 569 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 570 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 571 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 572 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 573 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 574 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 575 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 576 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 577 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 578 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 579 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 580 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 581 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 582 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 583 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 584 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 585 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 586 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 587 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 588 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 589 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 590 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 591 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 592 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 593 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 594 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 595 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 596 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 597 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 598 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 599 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 600 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 601 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 602 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 603 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 604 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 605 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 606 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 607 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 608 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 609 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 610 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 611 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 612 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 613 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 614 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 615 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 616 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 617 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 618 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 619 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 620 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 621 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 622 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 623 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 624 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 625 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 626 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 627 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 628 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 629 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 630 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 631 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 632 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 633 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 634 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 635 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 636 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 637 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 638 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 639 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 640 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 641 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 642 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 643 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 644 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 645 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 646 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 647 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 648 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 649 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 650 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 651 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 652 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 653 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 654 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 655 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 656 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 657 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 658 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 659 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 660 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 661 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 662 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 663 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 664 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 665 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 666 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 667 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 668 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 669 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 670 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 671 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 672 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 673 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.46 |
| Metatranscriptomes | 0 |
| Isolates | 24.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.82 |
| Nodule | 22.33 |
| Rhizoplane | 1.52 |
| Rhizosphere | 60.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068858_100365714 | 3300005842 | Bacteria | 1383 |
| 2 | MBSR1b_contig_10712157 | 2162886012 | Bacteria | 939 |
| 3 | LJQas_1038148 | 3300000549 | Unclassified | 567 |
| 4 | JGI24740J21852_10001351 | 3300001979 | Bacteria | 11185 |
| 5 | JGI24034J26672_10118856 | 3300002239 | Unclassified | 510 |
| 6 | JGI24751J29686_10031269 | 3300002459 | Bacteria | 1104 |
| 7 | JGI24751J29686_10090805 | 3300002459 | Bacteria | 635 |
| 8 | JGI25159J45721_1000002 | 3300002987 | Bacteria | 289163 |
| 9 | JGI25151J46595_10161566 | 3300003187 | Bacteria | 526 |
| 10 | JGI25165J46597_1000947 | 3300003214 | Bacteria | 19871 |
| 11 | JGI25153J46596_10100412 | 3300003215 | Bacteria | 681 |
| 12 | rootL2_10188392 | 3300003322 | Bacteria | 2058 |
| 13 | rootH1_10287281 | 3300003323 | Bacteria | 2386 |
| 14 | JGI25160J50197_1000008 | 3300003354 | Bacteria | 289163 |
| 15 | JGI25161J50226_1000380 | 3300003374 | Bacteria | 22370 |
| 16 | Ga0055526_1001532 | 3300003771 | Bacteria | 16363 |
| 17 | Ga0055526_1020128 | 3300003771 | Bacteria | 2393 |
| 18 | Ga0055524_1012523 | 3300003775 | Bacteria | 3252 |
| 19 | Ga0055536_1002254 | 3300003781 | Bacteria | 10976 |
| 20 | Ga0055536_1006080 | 3300003781 | Bacteria | 5721 |
| 21 | Ga0055536_1009138 | 3300003781 | Bacteria | 4149 |
| 22 | Ga0055528_1000695 | 3300003790 | Bacteria | 23949 |
| 23 | Ga0055530_10001655 | 3300003791 | Bacteria | 15864 |
| 24 | Ga0055530_10028298 | 3300003791 | Bacteria | 1515 |
| 25 | Ga0055540_1000752 | 3300003792 | Bacteria | 21989 |
| 26 | Ga0055531_10000858 | 3300003794 | Bacteria | 24934 |
| 27 | Ga0055531_10001722 | 3300003794 | Bacteria | 15672 |
| 28 | Ga0055531_10021163 | 3300003794 | Bacteria | 2537 |
| 29 | Ga0055531_10026168 | 3300003794 | Bacteria | 2090 |
| 30 | Ga0055531_10042449 | 3300003794 | Bacteria | 1300 |
| 31 | Ga0055543_1001421 | 3300004625 | Bacteria | 9510 |
| 32 | Ga0065165_1000015 | 3300005262 | Bacteria | 289201 |
| 33 | Ga0065704_10095207 | 3300005289 | Unclassified | 2500 |
| 34 | Ga0065704_10290897 | 3300005289 | Bacteria | 904 |
| 35 | Ga0065712_10072765 | 3300005290 | Bacteria | 4625 |
| 36 | Ga0065715_10070852 | 3300005293 | Bacteria | 735 |
| 37 | Ga0065715_10115519 | 3300005293 | Bacteria | 2412 |
| 38 | Ga0065715_10233704 | 3300005293 | Bacteria | 1224 |
| 39 | Ga0065715_10448940 | 3300005293 | Bacteria | 821 |
| 40 | Ga0065707_10190157 | 3300005295 | Bacteria | 1366 |
| 41 | Ga0070658_10024500 | 3300005327 | Bacteria | 4840 |
| 42 | Ga0070658_10031287 | 3300005327 | Bacteria | 4273 |
| 43 | Ga0070676_10064522 | 3300005328 | Bacteria | 2184 |
| 44 | Ga0070676_10119508 | 3300005328 | Bacteria | 1652 |
| 45 | Ga0070676_10748776 | 3300005328 | Bacteria | 717 |
| 46 | Ga0070683_102442811 | 3300005329 | Bacteria | 501 |
| 47 | Ga0070670_100000350 | 3300005331 | Bacteria | 38698 |
| 48 | Ga0070670_100010030 | 3300005331 | Bacteria | 8084 |
| 49 | Ga0070670_100021035 | 3300005331 | Bacteria | 5610 |
| 50 | Ga0070670_100039511 | 3300005331 | Bacteria | 4057 |
| 51 | Ga0070670_100087996 | 3300005331 | Bacteria | 2670 |
| 52 | Ga0070670_100380736 | 3300005331 | Bacteria | 1243 |
| 53 | Ga0070670_100508862 | 3300005331 | Bacteria | 1071 |
| 54 | Ga0070677_10000600 | 3300005333 | Bacteria | 12160 |
| 55 | Ga0070677_10037260 | 3300005333 | Bacteria | 1896 |
| 56 | Ga0070677_10039893 | 3300005333 | Bacteria | 1845 |
| 57 | Ga0070677_10333296 | 3300005333 | Bacteria | 781 |
| 58 | Ga0070677_10788663 | 3300005333 | Bacteria | 542 |
| 59 | Ga0068869_100300833 | 3300005334 | Unclassified | 1295 |
| 60 | Ga0068869_100626883 | 3300005334 | Bacteria | 911 |
| 61 | Ga0068869_100856082 | 3300005334 | Bacteria | 784 |
| 62 | Ga0068869_100898790 | 3300005334 | Bacteria | 766 |
| 63 | Ga0068869_101021888 | 3300005334 | Bacteria | 720 |
| 64 | Ga0068868_100698703 | 3300005338 | Bacteria | 907 |
| 65 | Ga0068868_101436812 | 3300005338 | Bacteria | 644 |
| 66 | Ga0070660_100060990 | 3300005339 | Bacteria | 2928 |
| 67 | Ga0070660_100121687 | 3300005339 | Bacteria | 2083 |
| 68 | Ga0070660_100535787 | 3300005339 | Bacteria | 976 |
| 69 | Ga0070660_100935085 | 3300005339 | Bacteria | 732 |
| 70 | Ga0070660_101513291 | 3300005339 | Bacteria | 571 |
| 71 | Ga0070689_101453634 | 3300005340 | Bacteria | 620 |
| 72 | Ga0070689_101510986 | 3300005340 | Bacteria | 608 |
| 73 | Ga0070691_10664597 | 3300005341 | Bacteria | 622 |
| 74 | Ga0070687_100858606 | 3300005343 | Bacteria | 648 |
| 75 | Ga0070661_100120387 | 3300005344 | Bacteria | 1966 |
| 76 | Ga0070661_100123269 | 3300005344 | Bacteria | 1942 |
| 77 | Ga0070668_100024369 | 3300005347 | Bacteria | 4584 |
| 78 | Ga0070668_100027061 | 3300005347 | Bacteria | 4352 |
| 79 | Ga0070668_100029010 | 3300005347 | Bacteria | 4200 |
| 80 | Ga0070668_100038020 | 3300005347 | Bacteria | 3677 |
| 81 | Ga0070669_100009774 | 3300005353 | Bacteria | 6832 |
| 82 | Ga0070669_100044937 | 3300005353 | Bacteria | 3218 |
| 83 | Ga0070669_100173670 | 3300005353 | Bacteria | 1682 |
| 84 | Ga0070669_100307933 | 3300005353 | Bacteria | 1276 |
| 85 | Ga0070675_100001857 | 3300005354 | Bacteria | 15581 |
| 86 | Ga0070675_100002352 | 3300005354 | Bacteria | 14063 |
| 87 | Ga0070675_100078800 | 3300005354 | Bacteria | 2744 |
| 88 | Ga0070675_100107929 | 3300005354 | Bacteria | 2351 |
| 89 | Ga0070671_100001032 | 3300005355 | Bacteria | 20490 |
| 90 | Ga0070671_100164090 | 3300005355 | Bacteria | 1878 |
| 91 | Ga0070671_100715480 | 3300005355 | Bacteria | 869 |
| 92 | Ga0070671_100923306 | 3300005355 | Bacteria | 763 |
| 93 | Ga0070674_100003913 | 3300005356 | Bacteria | 8432 |
| 94 | Ga0070674_100020755 | 3300005356 | Bacteria | 4205 |
| 95 | Ga0070674_100027251 | 3300005356 | Bacteria | 3743 |
| 96 | Ga0070674_100073539 | 3300005356 | Bacteria | 2423 |
| 97 | Ga0070674_100701752 | 3300005356 | Bacteria | 865 |
| 98 | Ga0070673_100051731 | 3300005364 | Bacteria | 3219 |
| 99 | Ga0070673_100517358 | 3300005364 | Bacteria | 1081 |
| 100 | Ga0070673_101017085 | 3300005364 | Bacteria | 772 |
| 101 | Ga0070659_100064992 | 3300005366 | Bacteria | 2889 |
| 102 | Ga0070659_100071386 | 3300005366 | Bacteria | 2761 |
| 103 | Ga0070659_100146835 | 3300005366 | Bacteria | 1922 |
| 104 | Ga0070659_100607835 | 3300005366 | Bacteria | 940 |
| 105 | Ga0070659_100849206 | 3300005366 | Bacteria | 796 |
| 106 | Ga0070659_102143984 | 3300005366 | Bacteria | 503 |
| 107 | Ga0070667_100065993 | 3300005367 | Bacteria | 3074 |
| 108 | Ga0070667_100236010 | 3300005367 | Bacteria | 1632 |
| 109 | Ga0070700_100088525 | 3300005441 | Bacteria | 2015 |
| 110 | Ga0070663_100020031 | 3300005455 | Bacteria | 4421 |
| 111 | Ga0070663_100224813 | 3300005455 | Bacteria | 1475 |
| 112 | Ga0070663_100338937 | 3300005455 | Bacteria | 1214 |
| 113 | Ga0070678_101486152 | 3300005456 | Bacteria | 634 |
| 114 | Ga0070678_101636009 | 3300005456 | Bacteria | 605 |
| 115 | Ga0070678_102173511 | 3300005456 | Bacteria | 526 |
| 116 | Ga0070662_100002989 | 3300005457 | Bacteria | 10511 |
| 117 | Ga0070662_100019821 | 3300005457 | Bacteria | 4573 |
| 118 | Ga0070662_100027985 | 3300005457 | Bacteria | 3919 |
| 119 | Ga0070662_100366589 | 3300005457 | Bacteria | 1183 |
| 120 | Ga0070662_100374457 | 3300005457 | Bacteria | 1171 |
| 121 | Ga0070662_100529236 | 3300005457 | Bacteria | 986 |
| 122 | Ga0070662_100875549 | 3300005457 | Bacteria | 766 |
| 123 | Ga0070662_101641616 | 3300005457 | Bacteria | 555 |
| 124 | Ga0068867_100374909 | 3300005459 | Bacteria | 1194 |
| 125 | Ga0068867_100433368 | 3300005459 | Bacteria | 1116 |
| 126 | Ga0068867_101915762 | 3300005459 | Bacteria | 559 |
| 127 | Ga0070685_11056339 | 3300005466 | Bacteria | 612 |
| 128 | Ga0070679_100252500 | 3300005530 | Bacteria | 1719 |
| 129 | Ga0070679_100981335 | 3300005530 | Bacteria | 789 |
| 130 | Ga0068853_100046888 | 3300005539 | Bacteria | 3708 |
| 131 | Ga0068853_100458275 | 3300005539 | Bacteria | 1200 |
| 132 | Ga0068853_100851270 | 3300005539 | Bacteria | 875 |
| 133 | Ga0070672_100005437 | 3300005543 | Bacteria | 8443 |
| 134 | Ga0070672_100017512 | 3300005543 | Bacteria | 5160 |
| 135 | Ga0070672_100098073 | 3300005543 | Bacteria | 2373 |
| 136 | Ga0070672_100169097 | 3300005543 | Bacteria | 1817 |
| 137 | Ga0070672_100371321 | 3300005543 | Bacteria | 1222 |
| 138 | Ga0070672_101968869 | 3300005543 | Bacteria | 526 |
| 139 | Ga0070696_101123912 | 3300005546 | Bacteria | 661 |
| 140 | Ga0070665_100132453 | 3300005548 | Bacteria | 2495 |
| 141 | Ga0068855_100103093 | 3300005563 | Bacteria | 3283 |
| 142 | Ga0068855_100174964 | 3300005563 | Bacteria | 2429 |
| 143 | Ga0068855_100270918 | 3300005563 | Bacteria | 1888 |
| 144 | Ga0070664_100004435 | 3300005564 | Bacteria | 11273 |
| 145 | Ga0070664_100094460 | 3300005564 | Bacteria | 2593 |
| 146 | Ga0070664_101054141 | 3300005564 | Bacteria | 765 |
| 147 | Ga0068857_100045180 | 3300005577 | Bacteria | 3907 |
| 148 | Ga0068854_100199288 | 3300005578 | Bacteria | 1573 |
| 149 | Ga0068854_100225001 | 3300005578 | Bacteria | 1486 |
| 150 | Ga0068856_100103731 | 3300005614 | Bacteria | 2837 |
| 151 | Ga0068859_100523410 | 3300005617 | Bacteria | 1281 |
| 152 | Ga0068864_100035579 | 3300005618 | Bacteria | 4240 |
| 153 | Ga0068864_100545028 | 3300005618 | Bacteria | 1120 |
| 154 | Ga0068864_101211167 | 3300005618 | Bacteria | 754 |
| 155 | Ga0068864_101612833 | 3300005618 | Bacteria | 653 |
| 156 | Ga0068866_10391222 | 3300005718 | Bacteria | 894 |
| 157 | Ga0068861_100231708 | 3300005719 | Bacteria | 1567 |
| 158 | Ga0068861_100847870 | 3300005719 | Bacteria | 861 |
| 159 | Ga0068851_10099229 | 3300005834 | Bacteria | 1543 |
| 160 | Ga0068863_102369896 | 3300005841 | Bacteria | 540 |
| 161 | Ga0068863_102433682 | 3300005841 | Bacteria | 533 |
| 162 | Ga0068858_100747326 | 3300005842 | Bacteria | 953 |
| 163 | Ga0068862_100016627 | 3300005844 | Bacteria | 6125 |
| 164 | Ga0068862_100092388 | 3300005844 | Bacteria | 2638 |
| 165 | Ga0068862_100322624 | 3300005844 | Bacteria | 1426 |
| 166 | Ga0068862_100978530 | 3300005844 | Bacteria | 836 |
| 167 | Ga0068862_101064551 | 3300005844 | Bacteria | 802 |
| 168 | Ga0081455_10244360 | 3300005937 | Bacteria | 1317 |
| 169 | Ga0075365_10001615 | 3300006038 | Bacteria | 10391 |
| 170 | Ga0075365_10006228 | 3300006038 | Bacteria | 6542 |
| 171 | Ga0075365_11007149 | 3300006038 | Bacteria | 587 |
| 172 | Ga0075368_10000318 | 3300006042 | Bacteria | 14124 |
| 173 | Ga0075363_100004443 | 3300006048 | Bacteria | 6138 |
| 174 | Ga0075363_100153476 | 3300006048 | Bacteria | 1301 |
| 175 | Ga0075363_100562892 | 3300006048 | Bacteria | 681 |
| 176 | Ga0075364_10015285 | 3300006051 | Bacteria | 4759 |
| 177 | Ga0075362_10003383 | 3300006177 | Bacteria | 5563 |
| 178 | Ga0075367_10002472 | 3300006178 | Bacteria | 8461 |
| 179 | Ga0075369_10019278 | 3300006186 | Bacteria | 2784 |
| 180 | Ga0075369_10196062 | 3300006186 | Bacteria | 931 |
| 181 | Ga0075369_10389580 | 3300006186 | Bacteria | 656 |
| 182 | Ga0075369_10390163 | 3300006186 | Bacteria | 656 |
| 183 | Ga0075369_10391814 | 3300006186 | Bacteria | 654 |
| 184 | Ga0075366_10153572 | 3300006195 | Bacteria | 1394 |
| 185 | Ga0075366_10809815 | 3300006195 | Bacteria | 583 |
| 186 | Ga0075370_10018867 | 3300006353 | Bacteria | 3746 |
| 187 | Ga0075370_10048468 | 3300006353 | Bacteria | 2407 |
| 188 | Ga0075370_10052920 | 3300006353 | Bacteria | 2304 |
| 189 | Ga0075370_10272970 | 3300006353 | Bacteria | 1004 |
| 190 | Ga0075370_10276764 | 3300006353 | Bacteria | 997 |
| 191 | Ga0075370_10501920 | 3300006353 | Bacteria | 732 |
| 192 | Ga0075428_100676383 | 3300006844 | Bacteria | 1100 |
| 193 | Ga0075431_101097603 | 3300006847 | Bacteria | 760 |
| 194 | Ga0075429_100705294 | 3300006880 | Bacteria | 884 |
| 195 | Ga0075429_101612913 | 3300006880 | Bacteria | 564 |
| 196 | Ga0068865_101821536 | 3300006881 | Bacteria | 550 |
| 197 | Ga0097620_100523434 | 3300006931 | Bacteria | 1281 |
| 198 | Ga0079104_1035919 | 3300006946 | Bacteria | 1193 |
| 199 | Ga0079104_1061617 | 3300006946 | Bacteria | 807 |
| 200 | Ga0111539_10176032 | 3300009094 | Bacteria | 2499 |
| 201 | Ga0111539_10568661 | 3300009094 | Bacteria | 1320 |
| 202 | Ga0111539_10870883 | 3300009094 | Bacteria | 1048 |
| 203 | Ga0111539_11142217 | 3300009094 | Unclassified | 905 |
| 204 | Ga0105245_11074055 | 3300009098 | Bacteria | 851 |
| 205 | Ga0105245_12896207 | 3300009098 | Bacteria | 532 |
| 206 | Ga0114129_12047192 | 3300009147 | Bacteria | 692 |
| 207 | Ga0105243_10129286 | 3300009148 | Bacteria | 2141 |
| 208 | Ga0105243_11069571 | 3300009148 | Bacteria | 813 |
| 209 | Ga0105241_10437784 | 3300009174 | Bacteria | 1154 |
| 210 | Ga0105248_10043271 | 3300009177 | Bacteria | 5050 |
| 211 | Ga0105237_10141188 | 3300009545 | Bacteria | 2403 |
| 212 | Ga0105237_10259227 | 3300009545 | Bacteria | 1741 |
| 213 | Ga0105238_10022705 | 3300009551 | Bacteria | 6395 |
| 214 | Ga0105238_10089554 | 3300009551 | Bacteria | 3064 |
| 215 | Ga0105249_10073177 | 3300009553 | Bacteria | 3170 |
| 216 | Ga0105239_10122221 | 3300010375 | Bacteria | 2893 |
| 217 | Ga0105239_10257858 | 3300010375 | Bacteria | 1959 |
| 218 | Ga0105239_10539227 | 3300010375 | Bacteria | 1328 |
| 219 | Ga0105239_11332316 | 3300010375 | Bacteria | 828 |
| 220 | Ga0105246_10794202 | 3300011119 | Bacteria | 839 |
| 221 | Ga0105246_11870196 | 3300011119 | Bacteria | 575 |
| 222 | Ga0157319_1000957 | 3300012497 | Bacteria | 1397 |
| 223 | Ga0157371_10354253 | 3300013102 | Bacteria | 1069 |
| 224 | Ga0157370_10124553 | 3300013104 | Bacteria | 2406 |
| 225 | Ga0157370_10920463 | 3300013104 | Bacteria | 793 |
| 226 | Ga0157369_10021987 | 3300013105 | Bacteria | 7128 |
| 227 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 228 | Ga0157374_10234791 | 3300013296 | Bacteria | 1802 |
| 229 | Ga0157374_10382641 | 3300013296 | Bacteria | 1402 |
| 230 | Ga0157378_10517297 | 3300013297 | Bacteria | 1194 |
| 231 | Ga0157378_10668493 | 3300013297 | Bacteria | 1056 |
| 232 | Ga0157378_11457143 | 3300013297 | Bacteria | 728 |
| 233 | Ga0163162_10108677 | 3300013306 | Bacteria | 2870 |
| 234 | Ga0163162_10413313 | 3300013306 | Bacteria | 1481 |
| 235 | Ga0157372_10044754 | 3300013307 | Bacteria | 4906 |
| 236 | Ga0157372_10154906 | 3300013307 | Bacteria | 2646 |
| 237 | Ga0157375_10036695 | 3300013308 | Bacteria | 4690 |
| 238 | Ga0157375_10067258 | 3300013308 | Bacteria | 3580 |
| 239 | Ga0157375_10978857 | 3300013308 | Bacteria | 986 |
| 240 | Ga0157375_11129954 | 3300013308 | Bacteria | 918 |
| 241 | Ga0157375_11835192 | 3300013308 | Bacteria | 719 |
| 242 | Ga0163163_10671575 | 3300014325 | Bacteria | 1100 |
| 243 | Ga0163163_10795752 | 3300014325 | Bacteria | 1009 |
| 244 | Ga0163163_10956203 | 3300014325 | Bacteria | 920 |
| 245 | Ga0157380_10022038 | 3300014326 | Bacteria | 4787 |
| 246 | Ga0157380_10033633 | 3300014326 | Bacteria | 3949 |
| 247 | Ga0157380_10036570 | 3300014326 | Bacteria | 3800 |
| 248 | Ga0157380_10568009 | 3300014326 | Bacteria | 1116 |
| 249 | Ga0157380_10628741 | 3300014326 | Bacteria | 1067 |
| 250 | Ga0157380_10632682 | 3300014326 | Bacteria | 1064 |
| 251 | Ga0157380_11382439 | 3300014326 | Bacteria | 754 |
| 252 | Ga0157380_11660983 | 3300014326 | Bacteria | 696 |
| 253 | Ga0157380_12094252 | 3300014326 | Bacteria | 629 |
| 254 | Ga0183365_12031 | 3300015684 | Bacteria | 729 |
| 255 | Ga0183363_1371 | 3300015690 | Bacteria | 4706 |
| 256 | Ga0163161_10049520 | 3300017792 | Bacteria | 3036 |
| 257 | Ga0163161_10086971 | 3300017792 | Bacteria | 2308 |
| 258 | Ga0163161_10120473 | 3300017792 | Bacteria | 1971 |
| 259 | Ga0163161_11524446 | 3300017792 | Bacteria | 587 |
| 260 | Ga0214544_1009397 | 3300021320 | Bacteria | 15366 |
| 261 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 262 | Ga0214542_1016019 | 3300021321 | Bacteria | 7491 |
| 263 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 264 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 265 | Ga0228711_1000001 | 3300022739 | Bacteria | 357377 |
| 266 | Ga0228710_1000001 | 3300022740 | Bacteria | 314328 |
| 267 | Ga0209436_103040 | 3300025208 | Bacteria | 4638 |
| 268 | Ga0207427_109513 | 3300025231 | Bacteria | 1042 |
| 269 | Ga0209437_100197 | 3300025233 | Bacteria | 120813 |
| 270 | Ga0209233_1000199 | 3300025261 | Bacteria | 123684 |
| 271 | Ga0209673_1000060 | 3300025273 | Bacteria | 263602 |
| 272 | Ga0209673_1001334 | 3300025273 | Bacteria | 24685 |
| 273 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 274 | Ga0209130_1020116 | 3300025284 | Bacteria | 1533 |
| 275 | Ga0209675_1000196 | 3300025291 | Bacteria | 65422 |
| 276 | Ga0209676_1000518 | 3300025292 | Bacteria | 60512 |
| 277 | Ga0209676_1000554 | 3300025292 | Bacteria | 56925 |
| 278 | Ga0209676_1000901 | 3300025292 | Bacteria | 37489 |
| 279 | Ga0209676_1000929 | 3300025292 | Bacteria | 36184 |
| 280 | Ga0209676_1020890 | 3300025292 | Bacteria | 2210 |
| 281 | Ga0209676_1030163 | 3300025292 | Bacteria | 1662 |
| 282 | Ga0209025_1000100 | 3300025294 | Bacteria | 229182 |
| 283 | Ga0209025_1006572 | 3300025294 | Bacteria | 8964 |
| 284 | Ga0209025_1030058 | 3300025294 | Bacteria | 2610 |
| 285 | Ga0209025_1059964 | 3300025294 | Bacteria | 1432 |
| 286 | Ga0209564_1000116 | 3300025295 | Bacteria | 207889 |
| 287 | Ga0209564_1000439 | 3300025295 | Bacteria | 71637 |
| 288 | Ga0209758_1002301 | 3300025297 | Bacteria | 19751 |
| 289 | Ga0209758_1025297 | 3300025297 | Bacteria | 2609 |
| 290 | Ga0209758_1033930 | 3300025297 | Bacteria | 2040 |
| 291 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 292 | Ga0209050_1001222 | 3300025298 | Bacteria | 29857 |
| 293 | Ga0209050_1008085 | 3300025298 | Bacteria | 5710 |
| 294 | Ga0209050_1009017 | 3300025298 | Bacteria | 5194 |
| 295 | Ga0209050_1021935 | 3300025298 | Bacteria | 2307 |
| 296 | Ga0209050_1029701 | 3300025298 | Bacteria | 1741 |
| 297 | Ga0209050_1067080 | 3300025298 | Bacteria | 819 |
| 298 | Ga0209256_1000302 | 3300025299 | Bacteria | 86634 |
| 299 | Ga0209256_1001410 | 3300025299 | Bacteria | 24985 |
| 300 | Ga0209256_1001505 | 3300025299 | Bacteria | 23627 |
| 301 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 302 | Ga0209051_1000217 | 3300025303 | Bacteria | 97218 |
| 303 | Ga0209051_1001024 | 3300025303 | Bacteria | 26621 |
| 304 | Ga0209051_1002714 | 3300025303 | Bacteria | 12314 |
| 305 | Ga0209257_1001405 | 3300025304 | Bacteria | 28723 |
| 306 | Ga0209257_1002894 | 3300025304 | Bacteria | 15934 |
| 307 | Ga0209257_1004371 | 3300025304 | Bacteria | 10994 |
| 308 | Ga0209257_1005509 | 3300025304 | Bacteria | 8841 |
| 309 | Ga0209257_1006913 | 3300025304 | Bacteria | 7096 |
| 310 | Ga0209257_1032597 | 3300025304 | Bacteria | 1649 |
| 311 | Ga0209257_1069401 | 3300025304 | Bacteria | 933 |
| 312 | Ga0209257_1104677 | 3300025304 | Bacteria | 684 |
| 313 | Ga0207697_10003012 | 3300025315 | Bacteria | 8476 |
| 314 | Ga0207697_10181534 | 3300025315 | Bacteria | 922 |
| 315 | Ga0207697_10193631 | 3300025315 | Bacteria | 893 |
| 316 | Ga0207682_10002530 | 3300025893 | Bacteria | 8177 |
| 317 | Ga0207682_10059152 | 3300025893 | Bacteria | 1601 |
| 318 | Ga0207682_10425647 | 3300025893 | Bacteria | 628 |
| 319 | Ga0207688_10050599 | 3300025901 | Bacteria | 2326 |
| 320 | Ga0207688_10372485 | 3300025901 | Bacteria | 882 |
| 321 | Ga0207645_10005867 | 3300025907 | Bacteria | 8845 |
| 322 | Ga0207645_10100033 | 3300025907 | Bacteria | 1870 |
| 323 | Ga0207645_10381462 | 3300025907 | Bacteria | 946 |
| 324 | Ga0207645_10896506 | 3300025907 | Bacteria | 602 |
| 325 | Ga0207705_10001064 | 3300025909 | Bacteria | 22327 |
| 326 | Ga0207705_10067557 | 3300025909 | Bacteria | 2587 |
| 327 | Ga0207705_10073195 | 3300025909 | Bacteria | 2486 |
| 328 | Ga0207695_10157189 | 3300025913 | Bacteria | 2208 |
| 329 | Ga0207671_10589513 | 3300025914 | Bacteria | 886 |
| 330 | Ga0207657_10015490 | 3300025919 | Bacteria | 7386 |
| 331 | Ga0207657_10123293 | 3300025919 | Bacteria | 2130 |
| 332 | Ga0207657_10237211 | 3300025919 | Bacteria | 1457 |
| 333 | Ga0207657_10359041 | 3300025919 | Bacteria | 1149 |
| 334 | Ga0207657_10580238 | 3300025919 | Bacteria | 876 |
| 335 | Ga0207649_10007890 | 3300025920 | Bacteria | 5792 |
| 336 | Ga0207649_10105896 | 3300025920 | Bacteria | 1870 |
| 337 | Ga0207649_10631175 | 3300025920 | Bacteria | 826 |
| 338 | Ga0207649_10854948 | 3300025920 | Bacteria | 712 |
| 339 | Ga0207652_10006724 | 3300025921 | Bacteria | 9266 |
| 340 | Ga0207652_10068552 | 3300025921 | Bacteria | 3078 |
| 341 | Ga0207681_10005401 | 3300025923 | Bacteria | 7849 |
| 342 | Ga0207681_10114929 | 3300025923 | Bacteria | 1964 |
| 343 | Ga0207681_10191695 | 3300025923 | Bacteria | 1564 |
| 344 | Ga0207681_10437430 | 3300025923 | Bacteria | 1062 |
| 345 | Ga0207681_10475544 | 3300025923 | Bacteria | 1020 |
| 346 | Ga0207681_10906585 | 3300025923 | Bacteria | 738 |
| 347 | Ga0207681_11481303 | 3300025923 | Bacteria | 569 |
| 348 | Ga0207650_10000916 | 3300025925 | Bacteria | 22264 |
| 349 | Ga0207650_10004697 | 3300025925 | Bacteria | 9334 |
| 350 | Ga0207650_10017569 | 3300025925 | Bacteria | 5009 |
| 351 | Ga0207650_10041076 | 3300025925 | Bacteria | 3387 |
| 352 | Ga0207650_10141041 | 3300025925 | Bacteria | 1894 |
| 353 | Ga0207650_10164481 | 3300025925 | Bacteria | 1760 |
| 354 | Ga0207650_10251599 | 3300025925 | Bacteria | 1431 |
| 355 | Ga0207659_10002256 | 3300025926 | Bacteria | 11474 |
| 356 | Ga0207659_10005898 | 3300025926 | Bacteria | 7478 |
| 357 | Ga0207659_10049103 | 3300025926 | Bacteria | 2991 |
| 358 | Ga0207659_10085347 | 3300025926 | Bacteria | 2345 |
| 359 | Ga0207687_11196681 | 3300025927 | Bacteria | 653 |
| 360 | Ga0207644_10009825 | 3300025931 | Bacteria | 6293 |
| 361 | Ga0207644_10604869 | 3300025931 | Bacteria | 910 |
| 362 | Ga0207644_11117396 | 3300025931 | Bacteria | 662 |
| 363 | Ga0207644_11681229 | 3300025931 | Bacteria | 532 |
| 364 | Ga0207690_10037801 | 3300025932 | Bacteria | 3137 |
| 365 | Ga0207690_10198044 | 3300025932 | Bacteria | 1523 |
| 366 | Ga0207690_10215011 | 3300025932 | Bacteria | 1468 |
| 367 | Ga0207690_11229462 | 3300025932 | Bacteria | 626 |
| 368 | Ga0207706_10045319 | 3300025933 | Bacteria | 3897 |
| 369 | Ga0207706_10088024 | 3300025933 | Bacteria | 2731 |
| 370 | Ga0207706_10247681 | 3300025933 | Bacteria | 1557 |
| 371 | Ga0207706_10311009 | 3300025933 | Bacteria | 1372 |
| 372 | Ga0207706_10323824 | 3300025933 | Bacteria | 1341 |
| 373 | Ga0207706_10501988 | 3300025933 | Bacteria | 1047 |
| 374 | Ga0207706_10599913 | 3300025933 | Bacteria | 946 |
| 375 | Ga0207706_10746090 | 3300025933 | Bacteria | 834 |
| 376 | Ga0207706_10776213 | 3300025933 | Bacteria | 815 |
| 377 | Ga0207709_10154504 | 3300025935 | Bacteria | 1593 |
| 378 | Ga0207669_10036896 | 3300025937 | Bacteria | 2798 |
| 379 | Ga0207669_10037527 | 3300025937 | Bacteria | 2781 |
| 380 | Ga0207669_10075641 | 3300025937 | Bacteria | 2134 |
| 381 | Ga0207669_10344178 | 3300025937 | Bacteria | 1149 |
| 382 | Ga0207669_10516271 | 3300025937 | Bacteria | 959 |
| 383 | Ga0207669_10578841 | 3300025937 | Bacteria | 910 |
| 384 | Ga0207669_10645267 | 3300025937 | Bacteria | 865 |
| 385 | Ga0207691_10006503 | 3300025940 | Bacteria | 11284 |
| 386 | Ga0207691_10015470 | 3300025940 | Bacteria | 7253 |
| 387 | Ga0207691_10146413 | 3300025940 | Bacteria | 2079 |
| 388 | Ga0207691_11546050 | 3300025940 | Bacteria | 541 |
| 389 | Ga0207711_10101908 | 3300025941 | Bacteria | 2541 |
| 390 | Ga0207661_11566308 | 3300025944 | Bacteria | 603 |
| 391 | Ga0207679_10015840 | 3300025945 | Bacteria | 4995 |
| 392 | Ga0207679_10047566 | 3300025945 | Bacteria | 3117 |
| 393 | Ga0207679_10137679 | 3300025945 | Bacteria | 1968 |
| 394 | Ga0207679_10257464 | 3300025945 | Bacteria | 1487 |
| 395 | Ga0207679_10916415 | 3300025945 | Bacteria | 802 |
| 396 | Ga0207667_10004509 | 3300025949 | Bacteria | 17062 |
| 397 | Ga0207667_10068990 | 3300025949 | Bacteria | 3680 |
| 398 | Ga0207651_10040548 | 3300025960 | Bacteria | 3082 |
| 399 | Ga0207651_10372654 | 3300025960 | Bacteria | 1208 |
| 400 | Ga0207651_10706277 | 3300025960 | Bacteria | 889 |
| 401 | Ga0207651_10782897 | 3300025960 | Bacteria | 845 |
| 402 | Ga0207712_10026570 | 3300025961 | Bacteria | 3858 |
| 403 | Ga0207712_10317656 | 3300025961 | Bacteria | 1284 |
| 404 | Ga0207668_10019850 | 3300025972 | Bacteria | 4258 |
| 405 | Ga0207668_10051999 | 3300025972 | Bacteria | 2833 |
| 406 | Ga0207668_10053537 | 3300025972 | Bacteria | 2797 |
| 407 | Ga0207668_10126134 | 3300025972 | Bacteria | 1947 |
| 408 | Ga0207640_10130945 | 3300025981 | Bacteria | 1813 |
| 409 | Ga0207640_10216336 | 3300025981 | Bacteria | 1464 |
| 410 | Ga0207658_10065281 | 3300025986 | Bacteria | 2733 |
| 411 | Ga0207658_10082351 | 3300025986 | Bacteria | 2471 |
| 412 | Ga0207658_10088112 | 3300025986 | Bacteria | 2399 |
| 413 | Ga0207639_10228607 | 3300026041 | Bacteria | 1611 |
| 414 | Ga0207639_10326200 | 3300026041 | Bacteria | 1364 |
| 415 | Ga0207639_11254500 | 3300026041 | Bacteria | 696 |
| 416 | Ga0207678_10080942 | 3300026067 | Bacteria | 2780 |
| 417 | Ga0207678_10112545 | 3300026067 | Bacteria | 2322 |
| 418 | Ga0207678_10164279 | 3300026067 | Bacteria | 1896 |
| 419 | Ga0207678_10298226 | 3300026067 | Bacteria | 1385 |
| 420 | Ga0207678_10598340 | 3300026067 | Bacteria | 967 |
| 421 | Ga0207678_10616878 | 3300026067 | Bacteria | 951 |
| 422 | Ga0207708_10149073 | 3300026075 | Bacteria | 1840 |
| 423 | Ga0207708_10494553 | 3300026075 | Bacteria | 1024 |
| 424 | Ga0207702_10489169 | 3300026078 | Bacteria | 1198 |
| 425 | Ga0207702_11310573 | 3300026078 | Bacteria | 718 |
| 426 | Ga0207648_10223064 | 3300026089 | Bacteria | 1675 |
| 427 | Ga0207676_10037982 | 3300026095 | Bacteria | 3674 |
| 428 | Ga0207676_10084122 | 3300026095 | Bacteria | 2593 |
| 429 | Ga0207676_10909574 | 3300026095 | Bacteria | 863 |
| 430 | Ga0207674_10155258 | 3300026116 | Bacteria | 2244 |
| 431 | Ga0207674_10317937 | 3300026116 | Bacteria | 1506 |
| 432 | Ga0207674_10354615 | 3300026116 | Bacteria | 1418 |
| 433 | Ga0207675_100036255 | 3300026118 | Bacteria | 4601 |
| 434 | Ga0207675_100913085 | 3300026118 | Bacteria | 895 |
| 435 | Ga0207698_10172821 | 3300026142 | Bacteria | 1905 |
| 436 | Ga0207698_11035642 | 3300026142 | Bacteria | 832 |
| 437 | Ga0209281_1000164 | 3300027111 | Bacteria | 157372 |
| 438 | Ga0209281_1000332 | 3300027111 | Bacteria | 81534 |
| 439 | Ga0209281_1026144 | 3300027111 | Bacteria | 1082 |
| 440 | Ga0209282_1000007 | 3300027666 | Bacteria | 254917 |
| 441 | Ga0209813_10000060 | 3300027866 | Bacteria | 44068 |
| 442 | Ga0207428_10893559 | 3300027907 | Bacteria | 628 |
| 443 | Ga0268266_10137298 | 3300028379 | Bacteria | 2191 |
| 444 | Ga0268266_10291785 | 3300028379 | Bacteria | 1519 |
| 445 | Ga0268266_10615116 | 3300028379 | Bacteria | 1044 |
| 446 | Ga0268265_10003419 | 3300028380 | Bacteria | 11426 |
| 447 | Ga0268265_10029713 | 3300028380 | Bacteria | 3928 |
| 448 | Ga0268265_10088850 | 3300028380 | Bacteria | 2463 |
| 449 | Ga0268265_10211716 | 3300028380 | Bacteria | 1689 |
| 450 | Ga0268265_10337359 | 3300028380 | Bacteria | 1371 |
| 451 | Ga0268265_10988257 | 3300028380 | Bacteria | 831 |
| 452 | Ga0268265_11027405 | 3300028380 | Bacteria | 815 |
| 453 | Ga0307517_10663691 | 3300028786 | Bacteria | 506 |
| 454 | Ga0316183_1130216 | 3300030742 | Bacteria | 1152 |
| 455 | Ga0316182_1057985 | 3300030745 | Bacteria | 1542 |
| 456 | Ga0316182_1346917 | 3300030745 | Bacteria | 545 |
| 457 | Ga0265327_10205876 | 3300031251 | Bacteria | 889 |
| 458 | Ga0307408_100014062 | 3300031548 | Bacteria | 5316 |
| 459 | Ga0307408_100014343 | 3300031548 | Bacteria | 5264 |
| 460 | Ga0307408_100051353 | 3300031548 | Bacteria | 2970 |
| 461 | Ga0307408_100205582 | 3300031548 | Bacteria | 1597 |
| 462 | Ga0307408_100284185 | 3300031548 | Bacteria | 1379 |
| 463 | Ga0307408_100506918 | 3300031548 | Bacteria | 1057 |
| 464 | Ga0307408_100940828 | 3300031548 | Bacteria | 793 |
| 465 | Ga0307408_100978124 | 3300031548 | Bacteria | 779 |
| 466 | Ga0307408_101310604 | 3300031548 | Unclassified | 679 |
| 467 | Ga0307508_10617556 | 3300031616 | Bacteria | 687 |
| 468 | Ga0307405_10028431 | 3300031731 | Bacteria | 3256 |
| 469 | Ga0307405_10150063 | 3300031731 | Bacteria | 1637 |
| 470 | Ga0307405_10171440 | 3300031731 | Bacteria | 1548 |
| 471 | Ga0307405_10175716 | 3300031731 | Bacteria | 1532 |
| 472 | Ga0307405_10218556 | 3300031731 | Bacteria | 1396 |
| 473 | Ga0307405_10237047 | 3300031731 | Bacteria | 1349 |
| 474 | Ga0307405_10450756 | 3300031731 | Bacteria | 1020 |
| 475 | Ga0307405_10478248 | 3300031731 | Bacteria | 994 |
| 476 | Ga0307405_10532523 | 3300031731 | Bacteria | 947 |
| 477 | Ga0307405_10552705 | 3300031731 | Bacteria | 932 |
| 478 | Ga0307405_10654518 | 3300031731 | Bacteria | 864 |
| 479 | Ga0307405_10991783 | 3300031731 | Bacteria | 716 |
| 480 | Ga0307405_11077023 | 3300031731 | Bacteria | 690 |
| 481 | Ga0307405_11159996 | 3300031731 | Bacteria | 666 |
| 482 | Ga0307405_11937040 | 3300031731 | Bacteria | 526 |
| 483 | Ga0307405_11973666 | 3300031731 | Bacteria | 522 |
| 484 | Ga0307413_10007256 | 3300031824 | Bacteria | 5130 |
| 485 | Ga0307413_10008368 | 3300031824 | Bacteria | 4880 |
| 486 | Ga0307413_10010474 | 3300031824 | Bacteria | 4500 |
| 487 | Ga0307413_10019834 | 3300031824 | Bacteria | 3562 |
| 488 | Ga0307413_10022551 | 3300031824 | Bacteria | 3395 |
| 489 | Ga0307413_10027919 | 3300031824 | Bacteria | 3135 |
| 490 | Ga0307413_10043051 | 3300031824 | Bacteria | 2658 |
| 491 | Ga0307413_10098545 | 3300031824 | Bacteria | 1925 |
| 492 | Ga0307413_10111022 | 3300031824 | Bacteria | 1835 |
| 493 | Ga0307413_10138431 | 3300031824 | Bacteria | 1678 |
| 494 | Ga0307413_10178685 | 3300031824 | Bacteria | 1510 |
| 495 | Ga0307413_10286121 | 3300031824 | Bacteria | 1242 |
| 496 | Ga0307413_10316911 | 3300031824 | Bacteria | 1190 |
| 497 | Ga0307413_10329468 | 3300031824 | Bacteria | 1170 |
| 498 | Ga0307413_10370861 | 3300031824 | Bacteria | 1112 |
| 499 | Ga0307413_10560691 | 3300031824 | Bacteria | 928 |
| 500 | Ga0307413_10728860 | 3300031824 | Bacteria | 826 |
| 501 | Ga0307413_11162028 | 3300031824 | Bacteria | 669 |
| 502 | Ga0307413_11438799 | 3300031824 | Bacteria | 607 |
| 503 | Ga0307413_11877905 | 3300031824 | Bacteria | 538 |
| 504 | Ga0307410_10001306 | 3300031852 | Bacteria | 11134 |
| 505 | Ga0307410_10002517 | 3300031852 | Bacteria | 8864 |
| 506 | Ga0307410_10006279 | 3300031852 | Bacteria | 6401 |
| 507 | Ga0307410_10016162 | 3300031852 | Bacteria | 4444 |
| 508 | Ga0307410_10023487 | 3300031852 | Bacteria | 3834 |
| 509 | Ga0307410_10025207 | 3300031852 | Bacteria | 3727 |
| 510 | Ga0307410_10026018 | 3300031852 | Bacteria | 3678 |
| 511 | Ga0307410_10073764 | 3300031852 | Bacteria | 2374 |
| 512 | Ga0307410_10074789 | 3300031852 | Bacteria | 2360 |
| 513 | Ga0307410_10075397 | 3300031852 | Bacteria | 2351 |
| 514 | Ga0307410_10084136 | 3300031852 | Bacteria | 2242 |
| 515 | Ga0307410_10085590 | 3300031852 | Bacteria | 2225 |
| 516 | Ga0307410_10096733 | 3300031852 | Bacteria | 2108 |
| 517 | Ga0307410_10127116 | 3300031852 | Bacteria | 1867 |
| 518 | Ga0307410_10140780 | 3300031852 | Bacteria | 1784 |
| 519 | Ga0307410_10187292 | 3300031852 | Bacteria | 1571 |
| 520 | Ga0307410_10392738 | 3300031852 | Bacteria | 1119 |
| 521 | Ga0307410_10422442 | 3300031852 | Bacteria | 1081 |
| 522 | Ga0307410_10499925 | 3300031852 | Bacteria | 1000 |
| 523 | Ga0307410_10557598 | 3300031852 | Bacteria | 950 |
| 524 | Ga0307410_10672132 | 3300031852 | Bacteria | 870 |
| 525 | Ga0307410_10710187 | 3300031852 | Bacteria | 848 |
| 526 | Ga0307410_10781805 | 3300031852 | Bacteria | 810 |
| 527 | Ga0307410_11357223 | 3300031852 | Bacteria | 623 |
| 528 | Ga0307410_11860803 | 3300031852 | Bacteria | 535 |
| 529 | Ga0307406_10042227 | 3300031901 | Bacteria | 2846 |
| 530 | Ga0307406_10042588 | 3300031901 | Bacteria | 2835 |
| 531 | Ga0307406_10056261 | 3300031901 | Bacteria | 2518 |
| 532 | Ga0307406_10099950 | 3300031901 | Bacteria | 1973 |
| 533 | Ga0307406_10198552 | 3300031901 | Bacteria | 1474 |
| 534 | Ga0307406_10284792 | 3300031901 | Bacteria | 1262 |
| 535 | Ga0307406_10310536 | 3300031901 | Unclassified | 1215 |
| 536 | Ga0307406_10359750 | 3300031901 | Bacteria | 1140 |
| 537 | Ga0307406_10404327 | 3300031901 | Bacteria | 1083 |
| 538 | Ga0307406_10405980 | 3300031901 | Bacteria | 1081 |
| 539 | Ga0307406_10451414 | 3300031901 | Bacteria | 1031 |
| 540 | Ga0307406_10544977 | 3300031901 | Bacteria | 948 |
| 541 | Ga0307406_10793946 | 3300031901 | Bacteria | 798 |
| 542 | Ga0307406_10951626 | 3300031901 | Bacteria | 734 |
| 543 | Ga0307406_11047220 | 3300031901 | Bacteria | 702 |
| 544 | Ga0307406_11144917 | 3300031901 | Bacteria | 673 |
| 545 | Ga0307406_11200408 | 3300031901 | Bacteria | 659 |
| 546 | Ga0307406_11201478 | 3300031901 | Bacteria | 658 |
| 547 | Ga0307407_10002403 | 3300031903 | Bacteria | 7314 |
| 548 | Ga0307407_10030175 | 3300031903 | Bacteria | 2922 |
| 549 | Ga0307407_10284270 | 3300031903 | Bacteria | 1147 |
| 550 | Ga0307407_10329137 | 3300031903 | Bacteria | 1075 |
| 551 | Ga0307407_10333136 | 3300031903 | Bacteria | 1069 |
| 552 | Ga0307407_10339967 | 3300031903 | Bacteria | 1059 |
| 553 | Ga0307407_10342885 | 3300031903 | Bacteria | 1055 |
| 554 | Ga0307407_10384831 | 3300031903 | Bacteria | 1002 |
| 555 | Ga0307407_10557376 | 3300031903 | Bacteria | 848 |
| 556 | Ga0307407_10594231 | 3300031903 | Bacteria | 823 |
| 557 | Ga0307407_10758836 | 3300031903 | Bacteria | 735 |
| 558 | Ga0307407_10923648 | 3300031903 | Bacteria | 671 |
| 559 | Ga0307407_10948066 | 3300031903 | Bacteria | 662 |
| 560 | Ga0307412_10019162 | 3300031911 | Bacteria | 4136 |
| 561 | Ga0307412_10030284 | 3300031911 | Bacteria | 3406 |
| 562 | Ga0307412_10046470 | 3300031911 | Bacteria | 2845 |
| 563 | Ga0307412_10046997 | 3300031911 | Bacteria | 2832 |
| 564 | Ga0307412_10053016 | 3300031911 | Bacteria | 2688 |
| 565 | Ga0307412_10159729 | 3300031911 | Bacteria | 1673 |
| 566 | Ga0307412_10308610 | 3300031911 | Bacteria | 1253 |
| 567 | Ga0307412_10342024 | 3300031911 | Bacteria | 1198 |
| 568 | Ga0307412_10382225 | 3300031911 | Bacteria | 1140 |
| 569 | Ga0307412_10434754 | 3300031911 | Bacteria | 1077 |
| 570 | Ga0307412_10483313 | 3300031911 | Bacteria | 1027 |
| 571 | Ga0307412_10580729 | 3300031911 | Bacteria | 946 |
| 572 | Ga0307412_10771205 | 3300031911 | Bacteria | 832 |
| 573 | Ga0307412_10863175 | 3300031911 | Bacteria | 790 |
| 574 | Ga0307412_11060993 | 3300031911 | Bacteria | 719 |
| 575 | Ga0307412_11220739 | 3300031911 | Bacteria | 674 |
| 576 | Ga0307412_11442023 | 3300031911 | Bacteria | 624 |
| 577 | Ga0307412_11501969 | 3300031911 | Unclassified | 612 |
| 578 | Ga0307412_11557808 | 3300031911 | Bacteria | 602 |
| 579 | Ga0315914_1000006 | 3300031967 | Bacteria | 239817 |
| 580 | Ga0307409_100000217 | 3300031995 | Bacteria | 22986 |
| 581 | Ga0307409_100004848 | 3300031995 | Bacteria | 7639 |
| 582 | Ga0307409_100035151 | 3300031995 | Bacteria | 3668 |
| 583 | Ga0307409_100036117 | 3300031995 | Bacteria | 3628 |
| 584 | Ga0307409_100082523 | 3300031995 | Bacteria | 2602 |
| 585 | Ga0307409_100108162 | 3300031995 | Bacteria | 2325 |
| 586 | Ga0307409_100135464 | 3300031995 | Bacteria | 2113 |
| 587 | Ga0307409_100154764 | 3300031995 | Bacteria | 1996 |
| 588 | Ga0307409_100154851 | 3300031995 | Bacteria | 1995 |
| 589 | Ga0307409_100191360 | 3300031995 | Bacteria | 1821 |
| 590 | Ga0307409_100224574 | 3300031995 | Bacteria | 1698 |
| 591 | Ga0307409_100281961 | 3300031995 | Bacteria | 1536 |
| 592 | Ga0307409_100405469 | 3300031995 | Bacteria | 1303 |
| 593 | Ga0307409_100453122 | 3300031995 | Bacteria | 1239 |
| 594 | Ga0307409_100454096 | 3300031995 | Bacteria | 1237 |
| 595 | Ga0307409_100524748 | 3300031995 | Bacteria | 1157 |
| 596 | Ga0307409_100569832 | 3300031995 | Bacteria | 1114 |
| 597 | Ga0307409_100650992 | 3300031995 | Bacteria | 1047 |
| 598 | Ga0307409_100656591 | 3300031995 | Bacteria | 1043 |
| 599 | Ga0307409_100693902 | 3300031995 | Bacteria | 1016 |
| 600 | Ga0307409_100823870 | 3300031995 | Bacteria | 937 |
| 601 | Ga0307409_100888193 | 3300031995 | Bacteria | 904 |
| 602 | Ga0307409_101019133 | 3300031995 | Bacteria | 846 |
| 603 | Ga0307409_101619202 | 3300031995 | Unclassified | 676 |
| 604 | Ga0307409_102702423 | 3300031995 | Bacteria | 524 |
| 605 | Ga0307416_100008213 | 3300032002 | Bacteria | 6713 |
| 606 | Ga0307416_100014578 | 3300032002 | Bacteria | 5395 |
| 607 | Ga0307416_100027573 | 3300032002 | Bacteria | 4209 |
| 608 | Ga0307416_100053742 | 3300032002 | Bacteria | 3233 |
| 609 | Ga0307416_100136130 | 3300032002 | Bacteria | 2222 |
| 610 | Ga0307416_100278501 | 3300032002 | Bacteria | 1647 |
| 611 | Ga0307416_100321447 | 3300032002 | Bacteria | 1550 |
| 612 | Ga0307416_100342349 | 3300032002 | Bacteria | 1509 |
| 613 | Ga0307416_100359682 | 3300032002 | Bacteria | 1477 |
| 614 | Ga0307416_100431452 | 3300032002 | Bacteria | 1365 |
| 615 | Ga0307416_100432819 | 3300032002 | Bacteria | 1363 |
| 616 | Ga0307416_100458297 | 3300032002 | Bacteria | 1329 |
| 617 | Ga0307416_100460002 | 3300032002 | Bacteria | 1327 |
| 618 | Ga0307416_100739987 | 3300032002 | Bacteria | 1075 |
| 619 | Ga0307416_100755504 | 3300032002 | Unclassified | 1065 |
| 620 | Ga0307416_100895295 | 3300032002 | Bacteria | 987 |
| 621 | Ga0307416_100960212 | 3300032002 | Bacteria | 957 |
| 622 | Ga0307416_101623611 | 3300032002 | Bacteria | 752 |
| 623 | Ga0307416_101918966 | 3300032002 | Unclassified | 695 |
| 624 | Ga0307416_102131873 | 3300032002 | Bacteria | 662 |
| 625 | Ga0307416_102508581 | 3300032002 | Bacteria | 614 |
| 626 | Ga0307416_103151597 | 3300032002 | Bacteria | 552 |
| 627 | Ga0307416_103752870 | 3300032002 | Bacteria | 508 |
| 628 | Ga0307414_10000346 | 3300032004 | Bacteria | 26022 |
| 629 | Ga0307414_10000797 | 3300032004 | Bacteria | 16139 |
| 630 | Ga0307414_10001040 | 3300032004 | Bacteria | 14198 |
| 631 | Ga0307414_10006477 | 3300032004 | Bacteria | 6528 |
| 632 | Ga0307414_10009428 | 3300032004 | Bacteria | 5608 |
| 633 | Ga0307414_10012420 | 3300032004 | Bacteria | 5034 |
| 634 | Ga0307414_10036346 | 3300032004 | Bacteria | 3288 |
| 635 | Ga0307414_10055229 | 3300032004 | Bacteria | 2780 |
| 636 | Ga0307414_10058244 | 3300032004 | Bacteria | 2721 |
| 637 | Ga0307414_10085171 | 3300032004 | Bacteria | 2327 |
| 638 | Ga0307414_10133550 | 3300032004 | Bacteria | 1931 |
| 639 | Ga0307414_10190603 | 3300032004 | Bacteria | 1658 |
| 640 | Ga0307414_10194198 | 3300032004 | Bacteria | 1645 |
| 641 | Ga0307414_10224063 | 3300032004 | Bacteria | 1545 |
| 642 | Ga0307414_10544913 | 3300032004 | Bacteria | 1033 |
| 643 | Ga0307414_10605597 | 3300032004 | Unclassified | 983 |
| 644 | Ga0307414_10829788 | 3300032004 | Bacteria | 844 |
| 645 | Ga0307414_10998148 | 3300032004 | Bacteria | 770 |
| 646 | Ga0307414_11092276 | 3300032004 | Bacteria | 736 |
| 647 | Ga0307414_11232535 | 3300032004 | Bacteria | 693 |
| 648 | Ga0307414_12134026 | 3300032004 | Bacteria | 523 |
| 649 | Ga0307414_12168157 | 3300032004 | Bacteria | 519 |
| 650 | Ga0307411_10000748 | 3300032005 | Bacteria | 11981 |
| 651 | Ga0307411_10001464 | 3300032005 | Bacteria | 9682 |
| 652 | Ga0307411_10003067 | 3300032005 | Bacteria | 7633 |
| 653 | Ga0307411_10006109 | 3300032005 | Bacteria | 5991 |
| 654 | Ga0307411_10009598 | 3300032005 | Bacteria | 5102 |
| 655 | Ga0307411_10027126 | 3300032005 | Bacteria | 3460 |
| 656 | Ga0307411_10029138 | 3300032005 | Bacteria | 3367 |
| 657 | Ga0307411_10044982 | 3300032005 | Bacteria | 2836 |
| 658 | Ga0307411_10108630 | 3300032005 | Bacteria | 1979 |
| 659 | Ga0307411_10135937 | 3300032005 | Bacteria | 1805 |
| 660 | Ga0307411_10138660 | 3300032005 | Bacteria | 1790 |
| 661 | Ga0307411_10191879 | 3300032005 | Bacteria | 1561 |
| 662 | Ga0307411_10222851 | 3300032005 | Bacteria | 1464 |
| 663 | Ga0307411_10244720 | 3300032005 | Bacteria | 1406 |
| 664 | Ga0307411_10256430 | 3300032005 | Bacteria | 1378 |
| 665 | Ga0307411_10409819 | 3300032005 | Bacteria | 1123 |
| 666 | Ga0307411_10480958 | 3300032005 | Bacteria | 1046 |
| 667 | Ga0307411_10484507 | 3300032005 | Bacteria | 1042 |
| 668 | Ga0307411_10500253 | 3300032005 | Bacteria | 1027 |
| 669 | Ga0307411_10536708 | 3300032005 | Bacteria | 996 |
| 670 | Ga0307411_10560322 | 3300032005 | Bacteria | 976 |
| 671 | Ga0307411_10578869 | 3300032005 | Bacteria | 962 |
| 672 | Ga0307411_10671252 | 3300032005 | Bacteria | 899 |
| 673 | Ga0307411_10991978 | 3300032005 | Bacteria | 751 |
| 674 | Ga0307411_11187869 | 3300032005 | Bacteria | 691 |
| 675 | Ga0307411_11263107 | 3300032005 | Bacteria | 671 |
| 676 | Ga0307411_11331501 | 3300032005 | Unclassified | 655 |
| 677 | Ga0307411_11593361 | 3300032005 | Bacteria | 602 |
| 678 | Ga0307411_11645092 | 3300032005 | Bacteria | 593 |
| 679 | Ga0307411_11878271 | 3300032005 | Bacteria | 557 |
| 680 | Ga0307415_100002106 | 3300032126 | Bacteria | 9844 |
| 681 | Ga0307415_100006836 | 3300032126 | Bacteria | 6191 |
| 682 | Ga0307415_100064731 | 3300032126 | Bacteria | 2545 |
| 683 | Ga0307415_100067602 | 3300032126 | Bacteria | 2498 |
| 684 | Ga0307415_100107648 | 3300032126 | Bacteria | 2060 |
| 685 | Ga0307415_100163828 | 3300032126 | Bacteria | 1727 |
| 686 | Ga0307415_100164200 | 3300032126 | Unclassified | 1725 |
| 687 | Ga0307415_100211123 | 3300032126 | Bacteria | 1549 |
| 688 | Ga0307415_100299510 | 3300032126 | Bacteria | 1331 |
| 689 | Ga0307415_100600128 | 3300032126 | Bacteria | 980 |
| 690 | Ga0307415_101131026 | 3300032126 | Bacteria | 734 |
| 691 | Ga0307415_101624711 | 3300032126 | Bacteria | 621 |
| 692 | Ga0307415_101686709 | 3300032126 | Bacteria | 611 |
| 693 | Ga0315913_1000002 | 3300033430 | Bacteria | 241452 |
| 694 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 695 | Ga0373941_0270863 | 3300035115 | Bacteria | 669 |
| 696 | Ga0373931_0370185 | 3300035691 | Bacteria | 901 |
| 697 | Ga0395899_0000124 | 3300037312 | Bacteria | 122011 |
| 698 | Ga0395900_0000086 | 3300037418 | Bacteria | 171749 |
| 699 | Ga0395900_0542594 | 3300037418 | Bacteria | 1108 |
| 700 | Ga0395898_0000285 | 3300037466 | Bacteria | 122279 |
| 701 | Ga0395905_0000133 | 3300037471 | Bacteria | 123500 |
| 702 | Ga0395905_0357035 | 3300037471 | Bacteria | 1354 |
| 703 | Ga0395905_0448397 | 3300037471 | Bacteria | 1188 |
| 704 | Ga0395905_0734928 | 3300037471 | Bacteria | 889 |
| 705 | Ga0395905_0738849 | 3300037471 | Bacteria | 886 |
| 706 | Ga0395905_0844519 | 3300037471 | Bacteria | 819 |
| 707 | Ga0395905_0966085 | 3300037471 | Bacteria | 755 |
| 708 | Ga0395901_0000092 | 3300038443 | Bacteria | 121976 |
| 709 | Ga0395901_0623049 | 3300038443 | Bacteria | 1085 |
| 710 | Ga0395901_0996682 | 3300038443 | Bacteria | 814 |
| 711 | Ga0436365_0105016 | 3300039437 | Bacteria | 679 |
| 712 | Ga0439436_0030162 | 3300041404 | Bacteria | 1576 |
| 713 | Ga0439438_024814 | 3300041405 | Bacteria | 1639 |
| 714 | Ga0439465_0011348 | 3300041413 | Bacteria | 2796 |
| 715 | Ga0439465_0053742 | 3300041413 | Bacteria | 1324 |
| 716 | Ga0451791_0343439 | 3300041451 | Bacteria | 630 |
| 717 | Ga0451791_0456541 | 3300041451 | Bacteria | 554 |
| 718 | Ga0451793_0443755 | 3300041452 | Bacteria | 517 |
| 719 | Ga0451807_0663369 | 3300041486 | Bacteria | 647 |
| 720 | Ga0451807_2638188 | 3300041486 | Bacteria | 896 |
| 721 | Ga0451807_2716419 | 3300041486 | Bacteria | 593 |
| 722 | Ga0451835_0321473 | 3300041492 | Bacteria | 637 |
| 723 | Ga0451837_0281783 | 3300041494 | Bacteria | 788 |
| 724 | Ga0451837_0877181 | 3300041494 | Bacteria | 589 |
| 725 | Ga0451837_1015036 | 3300041494 | Bacteria | 579 |
| 726 | Ga0451839_1273499 | 3300041496 | Bacteria | 637 |
| 727 | Ga0451841_0095796 | 3300041498 | Bacteria | 908 |
| 728 | Ga0451841_0230948 | 3300041498 | Bacteria | 703 |
| 729 | Ga0451845_0468910 | 3300041501 | Bacteria | 823 |
| 730 | Ga0451853_3825811 | 3300041512 | Bacteria | 1551 |
| 731 | Ga0439431_0272600 | 3300041997 | Bacteria | 505 |
| 732 | Ga0439445_0000389 | 3300042004 | Bacteria | 8864 |
| 733 | Ga0439432_098194 | 3300042006 | Bacteria | 877 |
| 734 | Ga0439432_204285 | 3300042006 | Bacteria | 572 |
| 735 | Ga0439449_0004505 | 3300042007 | Bacteria | 5381 |
| 736 | Ga0439449_0078415 | 3300042007 | Bacteria | 1218 |
| 737 | Ga0439449_0124791 | 3300042007 | Bacteria | 956 |
| 738 | Ga0439449_0125927 | 3300042007 | Bacteria | 951 |
| 739 | Ga0439449_0161858 | 3300042007 | Bacteria | 836 |
| 740 | Ga0439452_055554 | 3300042010 | Bacteria | 897 |
| 741 | Ga0439457_039816 | 3300042014 | Bacteria | 1047 |
| 742 | Ga0439462_0071060 | 3300042015 | Bacteria | 945 |
| 743 | Ga0439462_0074065 | 3300042015 | Bacteria | 926 |
| 744 | Ga0439462_0242360 | 3300042015 | Bacteria | 518 |
| 745 | Ga0450912_024682 | 3300042116 | Bacteria | 599 |
| 746 | Ga0450920_029182 | 3300042122 | Bacteria | 1082 |
| 747 | Ga0450894_079262 | 3300042131 | Bacteria | 510 |
| 748 | Ga0450907_020776 | 3300042146 | Bacteria | 1103 |
| 749 | Ga0439446_0038165 | 3300042156 | Bacteria | 1408 |
| 750 | Ga0439434_0033026 | 3300042435 | Bacteria | 1576 |
| 751 | Ga0439434_0220219 | 3300042435 | Bacteria | 644 |
| 752 | Ga0439434_0266696 | 3300042435 | Bacteria | 588 |
| 753 | Ga0439464_0315881 | 3300042439 | Bacteria | 512 |
| 754 | Ga0450918_077345 | 3300042531 | Unclassified | 631 |
| 755 | Ga0450901_011938 | 3300042533 | Bacteria | 904 |
| 756 | Ga0451577_0507762 | 3300042876 | Bacteria | 1095 |
| 757 | Ga0453684_0203560 | 3300044712 | Bacteria | 2306 |
| 758 | Ga0466967_1187677 | 3300045976 | Bacteria | 760 |
| 759 | Ga0495617_129242 | 3300046452 | Bacteria | 811 |
| 760 | Ga0495638_0010960 | 3300046460 | Bacteria | 6270 |
| 761 | Ga0495638_0014449 | 3300046460 | Bacteria | 5335 |
| 762 | Ga0495638_0034944 | 3300046460 | Bacteria | 3206 |
| 763 | Ga0495638_0549108 | 3300046460 | Bacteria | 575 |
| 764 | Ga0495596_0264005 | 3300046500 | Bacteria | 668 |
| 765 | Ga0495607_0009645 | 3300046501 | Bacteria | 6523 |
| 766 | Ga0495583_0046142 | 3300046506 | Bacteria | 2011 |
| 767 | Ga0495606_0080835 | 3300046507 | Bacteria | 2021 |
| 768 | Ga0495606_0566136 | 3300046507 | Bacteria | 563 |
| 769 | Ga0495606_0589518 | 3300046507 | Bacteria | 547 |
| 770 | Ga0495610_0084939 | 3300046512 | Bacteria | 1445 |
| 771 | Ga0495610_0209922 | 3300046512 | Bacteria | 792 |
| 772 | Ga0495620_0300627 | 3300046515 | Bacteria | 610 |
| 773 | Ga0495632_0012798 | 3300046519 | Bacteria | 4816 |
| 774 | Ga0495643_0019902 | 3300046522 | Bacteria | 3879 |
| 775 | Ga0495648_0103025 | 3300046524 | Bacteria | 1571 |
| 776 | Ga0495663_0001773 | 3300046525 | Bacteria | 6687 |
| 777 | Ga0495663_0022610 | 3300046525 | Bacteria | 1817 |
| 778 | Ga0495663_0035591 | 3300046525 | Bacteria | 1496 |
| 779 | Ga0495663_0102981 | 3300046525 | Bacteria | 942 |
| 780 | Ga0495663_0270116 | 3300046525 | Bacteria | 607 |
| 781 | Ga0495642_0182352 | 3300046528 | Bacteria | 914 |
| 782 | Ga0495654_0010554 | 3300046530 | Bacteria | 5025 |
| 783 | Ga0495654_0360229 | 3300046530 | Bacteria | 583 |
| 784 | Ga0495598_0016102 | 3300046537 | Bacteria | 1901 |
| 785 | Ga0495598_0081258 | 3300046537 | Unclassified | 1040 |
| 786 | Ga0495598_0084910 | 3300046537 | Bacteria | 1022 |
| 787 | Ga0495621_0001191 | 3300046539 | Bacteria | 6715 |
| 788 | Ga0495621_0001733 | 3300046539 | Bacteria | 5718 |
| 789 | Ga0495621_0039729 | 3300046539 | Bacteria | 1646 |
| 790 | Ga0495597_0037563 | 3300046542 | Bacteria | 2174 |
| 791 | Ga0495622_0220692 | 3300046557 | Bacteria | 840 |
| 792 | Ga0495633_0359128 | 3300046558 | Bacteria | 660 |
| 793 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 794 | Ga0495668_0648659 | 3300046616 | Bacteria | 583 |
| 795 | Ga0495625_0000553 | 3300046660 | Bacteria | 54796 |
| 796 | Ga0495625_0016088 | 3300046660 | Bacteria | 5895 |
| 797 | Ga0495625_0035484 | 3300046660 | Bacteria | 3675 |
| 798 | Ga0495625_0159861 | 3300046660 | Bacteria | 1510 |
| 799 | Ga0495625_0382484 | 3300046660 | Bacteria | 883 |
| 800 | Ga0495659_0086772 | 3300046664 | Bacteria | 1196 |
| 801 | Ga0495659_0156568 | 3300046664 | Bacteria | 918 |
| 802 | Ga0495659_0528271 | 3300046664 | Bacteria | 519 |
| 803 | Ga0495588_0101380 | 3300046674 | Bacteria | 1513 |
| 804 | Ga0495669_0000602 | 3300046684 | Bacteria | 15746 |
| 805 | Ga0495669_0077318 | 3300046684 | Bacteria | 1524 |
| 806 | Ga0495670_0004937 | 3300046691 | Bacteria | 6551 |
| 807 | Ga0495670_0009300 | 3300046691 | Bacteria | 4836 |
| 808 | Ga0495670_0052728 | 3300046691 | Bacteria | 2037 |
| 809 | Ga0495670_0123687 | 3300046691 | Bacteria | 1345 |
| 810 | Ga0495670_0248402 | 3300046691 | Bacteria | 948 |
| 811 | Ga0495670_0349574 | 3300046691 | Bacteria | 796 |
| 812 | Ga0495670_0501266 | 3300046691 | Bacteria | 659 |
| 813 | Ga0495671_0017144 | 3300046692 | Bacteria | 3855 |
| 814 | Ga0495671_0030512 | 3300046692 | Bacteria | 2761 |
| 815 | Ga0495671_0038954 | 3300046692 | Bacteria | 2401 |
| 816 | Ga0495589_0276032 | 3300046794 | Bacteria | 782 |
| 817 | Ga0495660_0023484 | 3300046810 | Bacteria | 3516 |
| 818 | Ga0495677_0024775 | 3300047445 | Bacteria | 2177 |
| 819 | Ga0495677_0027004 | 3300047445 | Bacteria | 2083 |
| 820 | Ga0495677_0208479 | 3300047445 | Bacteria | 760 |
| 821 | Ga0495681_0082006 | 3300047470 | Bacteria | 1438 |
| 822 | Ga0495681_0118381 | 3300047470 | Bacteria | 1139 |
| 823 | Ga0495686_0012540 | 3300047472 | Bacteria | 5925 |
| 824 | Ga0495686_0067518 | 3300047472 | Bacteria | 2207 |
| 825 | Ga0495686_0259720 | 3300047472 | Bacteria | 973 |
| 826 | Ga0496100_0613825 | 3300048903 | Bacteria | 845 |
| 827 | Ga0496101_0748635 | 3300048904 | Bacteria | 771 |
| 828 | Ga0496102_0250891 | 3300048905 | Bacteria | 1669 |
| 829 | Ga0496106_0973151 | 3300048909 | Bacteria | 668 |
| 830 | Ga0496107_0386275 | 3300048910 | Bacteria | 1041 |
| 831 | Ga0496108_0067853 | 3300048911 | Bacteria | 3008 |
| 832 | Ga0496109_0485983 | 3300048912 | Bacteria | 1166 |
| 833 | Ga0496109_0513593 | 3300048912 | Bacteria | 1131 |
| 834 | Ga0496109_0528814 | 3300048912 | Bacteria | 1113 |
| 835 | Ga0496110_0001413 | 3300048913 | Bacteria | 17353 |
| 836 | Ga0496111_0368954 | 3300048914 | Bacteria | 1062 |
| 837 | Ga0496114_0391067 | 3300048917 | Bacteria | 1231 |
| 838 | Ga0496115_0010329 | 3300048918 | Bacteria | 6971 |
| 839 | Ga0496115_1372783 | 3300048918 | Bacteria | 523 |
| 840 | Ga0496117_0205089 | 3300048920 | Bacteria | 1111 |
| 841 | Ga0496118_0019743 | 3300048921 | Bacteria | 6009 |
| 842 | Ga0496119_0088685 | 3300048922 | Bacteria | 1763 |
| 843 | Ga0496120_0366153 | 3300048923 | Bacteria | 644 |
| 844 | Ga0496121_0220606 | 3300048924 | Bacteria | 1336 |
| 845 | Ga0496121_0448158 | 3300048924 | Bacteria | 832 |
| 846 | Ga0496122_0000416 | 3300048925 | Bacteria | 90497 |
| 847 | Ga0496123_0000460 | 3300048926 | Bacteria | 71476 |
| 848 | Ga0496123_0002043 | 3300048926 | Bacteria | 26051 |
| 849 | Ga0496124_0066588 | 3300048927 | Bacteria | 2999 |
| 850 | Ga0496124_0125990 | 3300048927 | Bacteria | 2040 |
| 851 | Ga0496124_0212210 | 3300048927 | Bacteria | 1464 |
| 852 | Ga0496125_0006717 | 3300048928 | Bacteria | 12370 |
| 853 | Ga0496125_0222569 | 3300048928 | Bacteria | 1214 |
| 854 | Ga0496126_0310346 | 3300048929 | Bacteria | 1299 |
| 855 | Ga0496126_0316405 | 3300048929 | Bacteria | 1284 |
| 856 | Ga0496126_0618377 | 3300048929 | Bacteria | 851 |
| 857 | Ga0496126_0635387 | 3300048929 | Bacteria | 837 |
| 858 | Ga0496126_1149026 | 3300048929 | Bacteria | 574 |
| 859 | Ga0501031_0000016 | 3300049568 | Bacteria | 110858 |
| 860 | Ga0501031_0027499 | 3300049568 | Bacteria | 3708 |
| 861 | Ga0501031_0099578 | 3300049568 | Bacteria | 1897 |
| 862 | Ga0501031_0102979 | 3300049568 | Bacteria | 1863 |
| 863 | Ga0501032_0000044 | 3300049569 | Bacteria | 110899 |
| 864 | Ga0501032_0094726 | 3300049569 | Bacteria | 1979 |
| 865 | Ga0501032_0182038 | 3300049569 | Bacteria | 1375 |
| 866 | Ga0501032_0326164 | 3300049569 | Bacteria | 990 |
| 867 | Ga0501033_0000052 | 3300049570 | Bacteria | 110545 |
| 868 | Ga0501033_0050698 | 3300049570 | Bacteria | 3078 |
| 869 | Ga0501033_0081474 | 3300049570 | Bacteria | 2373 |
| 870 | Ga0501033_0336342 | 3300049570 | Bacteria | 1059 |
| 871 | Ga0501033_0435063 | 3300049570 | Bacteria | 912 |
| 872 | Ga0501034_0000212 | 3300049571 | Bacteria | 110795 |
| 873 | Ga0501034_0069338 | 3300049571 | Bacteria | 3537 |
| 874 | Ga0501034_0106196 | 3300049571 | Bacteria | 2801 |
| 875 | Ga0501034_0488781 | 3300049571 | Bacteria | 1145 |
| 876 | Ga0501034_0827334 | 3300049571 | Bacteria | 817 |
| 877 | Ga0501036_0000022 | 3300049572 | Bacteria | 111251 |
| 878 | Ga0501036_0025253 | 3300049572 | Bacteria | 5013 |
| 879 | Ga0501036_0153146 | 3300049572 | Bacteria | 1944 |
| 880 | Ga0501036_0859510 | 3300049572 | Bacteria | 745 |
| 881 | Ga0501037_0000052 | 3300049573 | Bacteria | 110932 |
| 882 | Ga0501037_0045871 | 3300049573 | Bacteria | 3207 |
| 883 | Ga0501037_0238039 | 3300049573 | Bacteria | 1276 |
| 884 | Ga0501037_0301995 | 3300049573 | Bacteria | 1111 |
| 885 | Ga0501037_0392552 | 3300049573 | Bacteria | 952 |
| 886 | Ga0501037_0564047 | 3300049573 | Bacteria | 767 |
| 887 | Ga0501038_0000044 | 3300049574 | Bacteria | 110876 |
| 888 | Ga0501038_0030959 | 3300049574 | Bacteria | 4731 |
| 889 | Ga0501038_0155608 | 3300049574 | Bacteria | 1861 |
| 890 | Ga0501038_0276789 | 3300049574 | Bacteria | 1322 |
| 891 | Ga0501039_0000042 | 3300049575 | Bacteria | 113008 |
| 892 | Ga0501039_0007777 | 3300049575 | Bacteria | 8176 |
| 893 | Ga0501039_0323905 | 3300049575 | Bacteria | 1211 |
| 894 | Ga0501040_0057517 | 3300049576 | Bacteria | 2670 |
| 895 | Ga0501040_0118622 | 3300049576 | Bacteria | 1855 |
| 896 | Ga0501043_0000054 | 3300049579 | Bacteria | 105924 |
| 897 | Ga0501043_0016295 | 3300049579 | Bacteria | 5828 |
| 898 | Ga0501043_0137547 | 3300049579 | Bacteria | 1913 |
| 899 | Ga0501046_0147468 | 3300049580 | Bacteria | 1776 |
| 900 | Ga0501046_0519621 | 3300049580 | Bacteria | 851 |
| 901 | Ga0501047_0000247 | 3300049581 | Bacteria | 64318 |
| 902 | Ga0501047_0172411 | 3300049581 | Bacteria | 2032 |
| 903 | Ga0501068_0189543 | 3300049584 | Bacteria | 1302 |
| 904 | Ga0501068_0629984 | 3300049584 | Bacteria | 700 |
| 905 | Ga0501070_0363765 | 3300049586 | Bacteria | 1173 |
| 906 | Ga0501072_0015756 | 3300049588 | Bacteria | 5795 |
| 907 | Ga0501072_0108654 | 3300049588 | Bacteria | 2207 |
| 908 | Ga0501073_0216155 | 3300049589 | Unclassified | 1325 |
| 909 | Ga0501073_0496014 | 3300049589 | Bacteria | 844 |
| 910 | Ga0501074_0385756 | 3300049590 | Bacteria | 994 |
| 911 | Ga0501074_1311875 | 3300049590 | Bacteria | 507 |
| 912 | Ga0501075_0194058 | 3300049591 | Bacteria | 1549 |
| 913 | Ga0501202_113772 | 3300049652 | Bacteria | 673 |
| 914 | Ga0501224_005346 | 3300049664 | Bacteria | 1837 |
| 915 | Ga0501238_027115 | 3300049671 | Bacteria | 823 |
| 916 | Ga0501249_038320 | 3300049679 | Bacteria | 1082 |
| 917 | Ga0501079_0724422 | 3300049741 | Bacteria | 783 |
| 918 | Ga0501081_0012442 | 3300049743 | Bacteria | 5593 |
| 919 | Ga0501262_013742 | 3300049759 | Bacteria | 1047 |
| 920 | Ga0501262_065171 | 3300049759 | Bacteria | 588 |
| 921 | Ga0501268_086003 | 3300049765 | Bacteria | 656 |
| 922 | Ga0501269_005517 | 3300049766 | Bacteria | 1521 |
| 923 | Ga0501279_066484 | 3300049775 | Bacteria | 599 |
| 924 | Ga0501035_0000095 | 3300049822 | Bacteria | 110735 |
| 925 | Ga0501035_0023615 | 3300049822 | Bacteria | 5641 |
| 926 | Ga0501035_0297143 | 3300049822 | Bacteria | 1361 |
| 927 | Ga0501035_0363431 | 3300049822 | Bacteria | 1209 |
| 928 | Ga0501044_0000091 | 3300049823 | Bacteria | 111251 |
| 929 | Ga0501044_0000280 | 3300049823 | Bacteria | 64928 |
| 930 | Ga0501044_0027138 | 3300049823 | Bacteria | 6056 |
| 931 | Ga0501044_0172718 | 3300049823 | Bacteria | 2131 |
| 932 | Ga0501045_0024385 | 3300049824 | Bacteria | 4343 |
| 933 | Ga0501045_0651172 | 3300049824 | Bacteria | 779 |
| 934 | nmdc:mga03683_721_c1 | 3300050489 | Bacteria | 9466 |
| 935 | nmdc:mga03n38_59950_c1 | 3300050490 | Bacteria | 1729 |
| 936 | nmdc:mga0yw44_31385_c1 | 3300050492 | Bacteria | 3089 |
| 937 | nmdc:mga0yw44_81252_c1 | 3300050492 | Bacteria | 2032 |
| 938 | nmdc:mga0k408_104336_c1 | 3300050493 | Bacteria | 1673 |
| 939 | nmdc:mga0k408_323284_c1 | 3300050493 | Bacteria | 920 |
| 940 | nmdc:mga0k408_492351_c1 | 3300050493 | Bacteria | 727 |
| 941 | nmdc:mga06z11_388_c1 | 3300050494 | Bacteria | 16612 |
| 942 | nmdc:mga04h51_73_c1 | 3300050495 | Bacteria | 32039 |
| 943 | nmdc:mga07m45_251251_c1 | 3300050496 | Bacteria | 1029 |
| 944 | nmdc:mga07m45_330852_c1 | 3300050496 | Bacteria | 885 |
| 945 | nmdc:mga07m45_47316_c1 | 3300050496 | Bacteria | 2418 |
| 946 | nmdc:mga07m45_5_c2 | 3300050496 | Bacteria | 297012 |
| 947 | nmdc:mga07m45_979_c1 | 3300050496 | Bacteria | 11290 |
| 948 | nmdc:mga09592_1279878_c1 | 3300050508 | Bacteria | 603 |
| 949 | nmdc:mga08y16_1245842_c1 | 3300050511 | Bacteria | 713 |
| 950 | nmdc:mga08y16_406877_c1 | 3300050511 | Bacteria | 1392 |
| 951 | nmdc:mga0sz30_209_c1 | 3300050516 | Bacteria | 21984 |
| 952 | nmdc:mga0sz30_351964_c1 | 3300050516 | Bacteria | 658 |
| 953 | nmdc:mga0sz30_382860_c1 | 3300050516 | Bacteria | 630 |
| 954 | nmdc:mga0sz30_9804_c1 | 3300050516 | Bacteria | 3653 |
| 955 | Ga0500643_002982 | 3300053087 | Bacteria | 8386 |
| 956 | Ga0500643_030835 | 3300053087 | Bacteria | 1639 |
| 957 | Ga0500643_218016 | 3300053087 | Bacteria | 512 |
| 958 | Ga0500651_0336984 | 3300053093 | Bacteria | 858 |
| 959 | Ga0500650_0054600 | 3300053098 | Bacteria | 1860 |
| 960 | Ga0500555_059803 | 3300053103 | Bacteria | 1027 |
| 961 | Ga0500556_0000339 | 3300053104 | Bacteria | 34934 |
| 962 | Ga0500562_025902 | 3300053108 | Bacteria | 1536 |
| 963 | Ga0500569_009439 | 3300053109 | Bacteria | 2267 |
| 964 | Ga0500592_020911 | 3300053116 | Bacteria | 1053 |
| 965 | Ga0500592_027000 | 3300053116 | Bacteria | 926 |
| 966 | Ga0500595_023762 | 3300053119 | Bacteria | 2150 |
| 967 | Ga0500608_000105 | 3300053122 | Bacteria | 34366 |
| 968 | Ga0500608_000764 | 3300053122 | Bacteria | 11718 |
| 969 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 970 | Ga0500658_0000769 | 3300053134 | Bacteria | 13202 |
| 971 | Ga0500658_0358583 | 3300053134 | Bacteria | 669 |
| 972 | Ga0500559_0312546 | 3300053136 | Bacteria | 737 |
| 973 | Ga0500568_0001734 | 3300053139 | Bacteria | 13523 |
| 974 | Ga0500568_0051944 | 3300053139 | Bacteria | 1611 |
| 975 | Ga0500568_0081725 | 3300053139 | Bacteria | 1226 |
| 976 | Ga0500573_0006606 | 3300053140 | Bacteria | 6291 |
| 977 | Ga0500573_0285408 | 3300053140 | Bacteria | 833 |
| 978 | Ga0500616_0000421 | 3300053153 | Bacteria | 56739 |
| 979 | Ga0500616_0039441 | 3300053153 | Bacteria | 2546 |
| 980 | Ga0500616_0318064 | 3300053153 | Bacteria | 641 |
| 981 | Ga0500622_0030266 | 3300053156 | Bacteria | 2843 |
| 982 | Ga0500627_0000049 | 3300053158 | Bacteria | 58947 |
| 983 | Ga0500627_0479965 | 3300053158 | Bacteria | 520 |
| 984 | Ga0500636_0000156 | 3300053177 | Bacteria | 35625 |
| 985 | Ga0500645_000312 | 3300053730 | Bacteria | 34754 |
| 986 | Ga0501084_0819463 | 3300054114 | Bacteria | 784 |
| 987 | Ga0501084_1141472 | 3300054114 | Bacteria | 654 |
| 988 | Ga0501082_0275088 | 3300060353 | Bacteria | 1466 |
| 989 | Ga0501082_1747598 | 3300060353 | Bacteria | 543 |
| 990 | Ga0501082_2037177 | 3300060353 | Bacteria | 500 |
| 991 | 2509079156 | 2508501114 | Bacteria | 7082538 |
| 992 | 2509108476 | 2508501122 | Bacteria | 6292184 |
| 993 | 2509374497 | 2509276019 | Bacteria | 6802256 |
| 994 | 2510134718 | 2510065019 | Bacteria | 6903379 |
| 995 | 2510306608 | 2510065057 | Bacteria | 6649661 |
| 996 | 2510896067 | 2510461076 | Bacteria | 8618824 |
| 997 | 2511500971 | 2511231052 | Bacteria | 6974333 |
| 998 | 2512972287 | 2512875026 | Bacteria | 6861065 |
| 999 | 2513583491 | 2513237086 | Bacteria | 7265287 |
| 1000 | 2513603366 | 2513237089 | Bacteria | 6553624 |
| 1001 | 2513620774 | 2513237091 | Bacteria | 6900273 |
| 1002 | 2513631444 | 2513237093 | Bacteria | 7545552 |
| 1003 | 2513710622 | 2513237103 | Bacteria | 7647401 |
| 1004 | 2513881140 | 2513237140 | Bacteria | 7076289 |
| 1005 | 2513907125 | 2513237143 | Bacteria | 6664116 |
| 1006 | 2513983971 | 2513237156 | Bacteria | 6402557 |
| 1007 | 2514004821 | 2513237160 | Bacteria | 6650282 |
| 1008 | 2514023732 | 2513237162 | Bacteria | 7468464 |
| 1009 | 2515608086 | 2515154107 | Bacteria | 6795637 |
| 1010 | 2515634671 | 2515154113 | Bacteria | 7807172 |
| 1011 | 2515646027 | 2515154114 | Bacteria | 7848616 |
| 1012 | 2515656906 | 2515154116 | Bacteria | 7552979 |
| 1013 | 2515743529 | 2515154134 | Bacteria | 7220242 |
| 1014 | 2516208840 | 2516143018 | Bacteria | 6951533 |
| 1015 | 2516892252 | 2516653046 | Bacteria | 6989037 |
| 1016 | 2517037420 | 2516653077 | Bacteria | 7555578 |
| 1017 | 2517077717 | 2516653085 | Bacteria | 7346596 |
| 1018 | 2517410616 | 2517287029 | Bacteria | 6905599 |
| 1019 | 2517569048 | 2517487022 | Bacteria | 7227575 |
| 1020 | 2520377860 | 2519899620 | Bacteria | 6499161 |
| 1021 | 2524451186 | 2524023207 | Bacteria | 6813453 |
| 1022 | 2551676431 | 2551306084 | Bacteria | 8942552 |
| 1023 | 2551687212 | 2551306085 | Bacteria | 7347181 |
| 1024 | 2551692941 | 2551306086 | Bacteria | 6843938 |
| 1025 | 2551703186 | 2551306087 | Bacteria | 7351905 |
| 1026 | 2551712353 | 2551306089 | Bacteria | 7162724 |
| 1027 | 2551720674 | 2551306090 | Bacteria | 7953713 |
| 1028 | 2551731098 | 2551306091 | Bacteria | 7086830 |
| 1029 | 2551731976 | 2551306092 | Bacteria | 6992595 |
| 1030 | 2551740402 | 2551306093 | Bacteria | 7064773 |
| 1031 | 2558863524 | 2558860100 | Bacteria | 8458965 |
| 1032 | 2585270292 | 2582581306 | Bacteria | 6450535 |
| 1033 | 2585388731 | 2582581865 | Bacteria | 6644329 |
| 1034 | 2585541139 | 2585427528 | Bacteria | 6842387 |
| 1035 | 2585839902 | 2585427593 | Bacteria | 7141551 |
| 1036 | 2587919815 | 2585428106 | Bacteria | 5179711 |
| 1037 | 2616295438 | 2615840624 | Bacteria | 6557588 |
| 1038 | 2643820086 | 2643221560 | Bacteria | 4801179 |
| 1039 | 2643836387 | 2643221563 | Bacteria | 4726935 |
| 1040 | 2643910490 | 2643221580 | Bacteria | 3816678 |
| 1041 | 2644052863 | 2643221608 | Bacteria | 4724829 |
| 1042 | 2644109039 | 2643221618 | Bacteria | 7717186 |
| 1043 | 2644151560 | 2643221626 | Bacteria | 8069654 |
| 1044 | 2644223557 | 2643221640 | Bacteria | 5258820 |
| 1045 | 2644236353 | 2643221642 | Bacteria | 5357871 |
| 1046 | 2644311695 | 2643221655 | Bacteria | 7722067 |
| 1047 | 2644329952 | 2643221659 | Bacteria | 7890716 |
| 1048 | 2644494368 | 2643221688 | Bacteria | 5260751 |
| 1049 | 2644546626 | 2643221698 | Bacteria | 7756764 |
| 1050 | 2644617494 | 2643221712 | Bacteria | 7729434 |
| 1051 | 2657683308 | 2657244999 | Bacteria | 5946535 |
| 1052 | 2692316866 | 2690316117 | Bacteria | 6800650 |
| 1053 | 2725947705 | 2724679232 | Bacteria | 7646494 |
| 1054 | 2739035691 | 2738541333 | Bacteria | 7106503 |
| 1055 | 2753460768 | 2751185821 | Bacteria | 6189929 |
| 1056 | 2766065449 | 2765235942 | Bacteria | 7445910 |
| 1057 | 2792622724 | 2791355091 | Bacteria | 6135441 |
| 1058 | 2792628355 | 2791355092 | Bacteria | 6248105 |
| 1059 | 2793319840 | 2791355260 | Bacteria | 6598818 |
| 1060 | 2793328156 | 2791355261 | Bacteria | 6661293 |
| 1061 | 2793362933 | 2791355266 | Bacteria | 7116587 |
| 1062 | 2793370041 | 2791355267 | Bacteria | 7222458 |
| 1063 | 2802717691 | 2802428858 | Bacteria | 6636079 |
| 1064 | 2802723381 | 2802428859 | Bacteria | 6667919 |
| 1065 | 2802731168 | 2802428860 | Bacteria | 6525526 |
| 1066 | 2802736175 | 2802428861 | Bacteria | 6534206 |
| 1067 | 2802743615 | 2802428862 | Bacteria | 6633353 |
| 1068 | 2802750673 | 2802428863 | Bacteria | 6410669 |
| 1069 | 2804751302 | 2802429268 | Bacteria | 6094027 |
| 1070 | 2806044678 | 2802429633 | Bacteria | 7341974 |
| 1071 | 2806052878 | 2802429634 | Bacteria | 7083200 |
| 1072 | 2806059178 | 2802429635 | Bacteria | 7650140 |
| 1073 | 2806068159 | 2802429636 | Bacteria | 7597525 |
| 1074 | 2806074279 | 2802429637 | Bacteria | 7067217 |
| 1075 | 2838046371 | 2838042994 | Bacteria | 6046894 |
| 1076 | 2838076400 | 2838074704 | Bacteria | 6785777 |
| 1077 | 2838685079 | 2838680041 | Bacteria | 6545511 |
| 1078 | 2838691449 | 2838686498 | Bacteria | 7807632 |
| 1079 | 2838699084 | 2838694306 | Bacteria | 6853137 |
| 1080 | 2838712565 | 2838707686 | Bacteria | 6619912 |
| 1081 | 2838733408 | 2838729681 | Bacteria | 7400765 |
| 1082 | 2838746020 | 2838742623 | Bacteria | 7396178 |
| 1083 | 2841853732 | 2841851746 | Bacteria | 7532261 |
| 1084 | 2842082042 | 2842077413 | Bacteria | 6508645 |
| 1085 | 2842113565 | 2842110456 | Bacteria | 7656360 |
| 1086 | 2842122964 | 2842118031 | Bacteria | 7033875 |
| 1087 | 2842162261 | 2842156927 | Bacteria | 6894975 |
| 1088 | 2842169816 | 2842163707 | Bacteria | 6916235 |
| 1089 | 2842185187 | 2842180545 | Bacteria | 6888678 |
| 1090 | 2842208184 | 2842205361 | Bacteria | 6340321 |
| 1091 | 2842220204 | 2842217011 | Bacteria | 7497767 |
| 1092 | 2842233674 | 2842229732 | Bacteria | 7475766 |
| 1093 | 2842242133 | 2842237096 | Bacteria | 6620661 |
| 1094 | 2842247718 | 2842243621 | Bacteria | 7421798 |
| 1095 | 2842262014 | 2842257432 | Bacteria | 7401195 |
| 1096 | 2842275923 | 2842271015 | Bacteria | 7807131 |
| 1097 | 2842281807 | 2842278818 | Bacteria | 6340002 |
| 1098 | 2842296042 | 2842291075 | Bacteria | 7076806 |
| 1099 | 2842308093 | 2842304105 | Bacteria | 7023636 |
| 1100 | 2842375757 | 2842370503 | Bacteria | 7038661 |
| 1101 | 2842382441 | 2842377471 | Bacteria | 7140707 |
| 1102 | 2842389842 | 2842384541 | Bacteria | 7057858 |
| 1103 | 2844168563 | 2844163670 | Bacteria | 7266046 |
| 1104 | 2844457623 | 2844454524 | Bacteria | 7952546 |
| 1105 | 2847418068 | 2847417321 | Bacteria | 6913799 |
| 1106 | 2848993042 | 2848992105 | Bacteria | 6810864 |
| 1107 | 2850080437 | 2850079185 | Bacteria | 6848280 |
| 1108 | 2852653987 | 2852653556 | Bacteria | 4050083 |
| 1109 | 2855831322 | 2855825444 | Bacteria | 6785811 |
| 1110 | 2855840447 | 2855839649 | Bacteria | 7135830 |
| 1111 | 2855879180 | 2855872281 | Bacteria | 6964271 |
| 1112 | 2857505938 | 2857504554 | Bacteria | 5369913 |
| 1113 | 2857519032 | 2857516855 | Bacteria | 7787325 |
| 1114 | 2858800976 | 2858800743 | Bacteria | 6603254 |
| 1115 | 2867512749 | 2867507094 | Bacteria | 6506033 |
| 1116 | 2896386601 | 2896384573 | Bacteria | 7700774 |
| 1117 | 2913297483 | 2913295892 | Bacteria | 6333755 |
| 1118 | 2915986171 | 2915980308 | Bacteria | 6624279 |
| 1119 | 2915990591 | 2915986958 | Bacteria | 6739310 |
| 1120 | 2915996261 | 2915993759 | Bacteria | 7016183 |
| 1121 | 2916005739 | 2916000859 | Bacteria | 6865702 |
| 1122 | 2916010926 | 2916007675 | Bacteria | 6898660 |
| 1123 | 2916016563 | 2916014648 | Bacteria | 6946486 |
| 1124 | 2916024762 | 2916021584 | Bacteria | 6854472 |
| 1125 | 2916032181 | 2916028427 | Bacteria | 6748433 |
| 1126 | 2916038164 | 2916035215 | Bacteria | 6755766 |
| 1127 | 2916047184 | 2916041962 | Bacteria | 6820487 |
| 1128 | 2916053212 | 2916048683 | Bacteria | 6543552 |
| 1129 | 2916055358 | 2916055098 | Bacteria | 6758838 |
| 1130 | 2916062822 | 2916061851 | Bacteria | 6737736 |
| 1131 | 2916074961 | 2916068649 | Bacteria | 6943657 |
| 1132 | 2916079315 | 2916076590 | Bacteria | 6596108 |
| 1133 | 2920762914 | 2920760137 | Bacteria | 7427611 |
| 1134 | 2921205724 | 2921201388 | Bacteria | 6926299 |
| 1135 | 2921213530 | 2921208531 | Bacteria | 6745326 |
| 1136 | 2921241622 | 2921237296 | Bacteria | 6876710 |
| 1137 | 2921247516 | 2921244191 | Bacteria | 6568419 |
| 1138 | 2921250953 | 2921250672 | Bacteria | 6677771 |
| 1139 | 2921260005 | 2921257292 | Bacteria | 6808382 |
| 1140 | 2921264235 | 2921263974 | Bacteria | 6864552 |
| 1141 | 2921282768 | 2921282425 | Bacteria | 6826397 |
| 1142 | 2921290130 | 2921289301 | Bacteria | 7316391 |
| 1143 | 2921299967 | 2921296804 | Bacteria | 7176999 |
| 1144 | 2924145600 | 2924144063 | Bacteria | 6883928 |
| 1145 | 2924155881 | 2924150972 | Bacteria | 7169444 |
| 1146 | 2924160573 | 2924158325 | Bacteria | 7188855 |
| 1147 | 2924168151 | 2924165586 | Bacteria | 7260590 |
| 1148 | 2924177847 | 2924172951 | Bacteria | 6749356 |
| 1149 | 2924186314 | 2924179722 | Bacteria | 6843264 |
| 1150 | 2924189512 | 2924186466 | Bacteria | 6876637 |
| 1151 | 2924198248 | 2924193448 | Bacteria | 6955718 |
| 1152 | 2924204059 | 2924200457 | Bacteria | 6757188 |
| 1153 | 2924209909 | 2924207177 | Bacteria | 6917007 |
| 1154 | 2924215176 | 2924214083 | Bacteria | 7080103 |
| 1155 | 2924226229 | 2924221636 | Bacteria | 7113495 |
| 1156 | 2924234934 | 2924228884 | Bacteria | 6633132 |
| 1157 | 2928531957 | 2928531327 | Bacteria | 5101314 |
| 1158 | 2929202040 | 2929199973 | Bacteria | 7260745 |
| 1159 | 2932402362 | 2932401849 | Bacteria | 4262978 |
| 1160 | 2933574542 | 2933570622 | Bacteria | 7023390 |
| 1161 | 2933589145 | 2933586486 | Bacteria | 7667493 |
| 1162 | 2935899854 | 2935894831 | Bacteria | 6620579 |
| 1163 | 2935907025 | 2935901341 | Bacteria | 7341747 |
| 1164 | 2936374993 | 2936367885 | Bacteria | 7324495 |
| 1165 | 2936380684 | 2936375103 | Bacteria | 6652732 |
| 1166 | 2937009514 | 2937002841 | Bacteria | 6934057 |
| 1167 | 2937010886 | 2937009748 | Bacteria | 6746052 |
| 1168 | 2937018984 | 2937016420 | Bacteria | 6782579 |
| 1169 | 2937027925 | 2937023124 | Bacteria | 6815156 |
| 1170 | 2937029868 | 2937029754 | Bacteria | 6424026 |
| 1171 | 2937036894 | 2937036028 | Bacteria | 6846469 |
| 1172 | 2937048989 | 2937042894 | Bacteria | 6741576 |
| 1173 | 2937056284 | 2937049772 | Bacteria | 6757901 |
| 1174 | 2937061298 | 2937056579 | Bacteria | 7107896 |
| 1175 | 2937064388 | 2937063883 | Bacteria | 7199456 |
| 1176 | 2937072868 | 2937071275 | Bacteria | 6984483 |
| 1177 | 2937082975 | 2937078374 | Bacteria | 6610289 |
| 1178 | 2937091253 | 2937084907 | Bacteria | 6618516 |
| 1179 | 2937095589 | 2937091812 | Bacteria | 6979387 |
| 1180 | 2937103635 | 2937098957 | Bacteria | 7249374 |
| 1181 | 2937109776 | 2937106411 | Bacteria | 6947143 |
| 1182 | 2937118318 | 2937113482 | Bacteria | 6505872 |
| 1183 | 2937121185 | 2937119839 | Bacteria | 6597547 |
| 1184 | 2937129819 | 2937126314 | Bacteria | 6771275 |
| 1185 | 2941500262 | 2941499720 | Bacteria | 7599444 |
| 1186 | 2957380027 | 2957375807 | Bacteria | 6425588 |
| 1187 | 2957385069 | 2957382221 | Bacteria | 6737050 |
| 1188 | 2957389132 | 2957388812 | Bacteria | 6778072 |
| 1189 | 2957396752 | 2957395598 | Bacteria | 6822399 |
| 1190 | 2957405448 | 2957402308 | Bacteria | 6741770 |
| 1191 | 2957413251 | 2957408893 | Bacteria | 6558585 |
| 1192 | 2957419199 | 2957415311 | Bacteria | 6991633 |
| 1193 | 2957427733 | 2957422303 | Bacteria | 7172205 |
| 1194 | 2957431091 | 2957430029 | Bacteria | 7022557 |
| 1195 | 2957441965 | 2957437181 | Bacteria | 6568994 |
| 1196 | 2957446653 | 2957443900 | Bacteria | 6869977 |
| 1197 | 2957454190 | 2957450854 | Bacteria | 6765715 |
| 1198 | 2957462450 | 2957457609 | Bacteria | 6967680 |
| 1199 | 2957467748 | 2957464669 | Bacteria | 6568877 |
| 1200 | 2957477790 | 2957471148 | Bacteria | 6797643 |
| 1201 | 2957480628 | 2957478035 | Bacteria | 6756658 |
| 1202 | 2957485790 | 2957484790 | Bacteria | 6703082 |
| 1203 | 2957495994 | 2957491536 | Bacteria | 6695180 |
| 1204 | 2957501036 | 2957498199 | Bacteria | 7126688 |
| 1205 | 2957509592 | 2957505466 | Bacteria | 7253085 |
| 1206 | 2960586644 | 2960584000 | Bacteria | 6864594 |
| 1207 | 2960595571 | 2960591022 | Bacteria | 6622873 |
| 1208 | 2960600575 | 2960597568 | Bacteria | 6550735 |
| 1209 | 2960609475 | 2960603979 | Bacteria | 6898737 |
| 1210 | 2960616786 | 2960610863 | Bacteria | 6691244 |
| 1211 | 2960617704 | 2960617483 | Bacteria | 6727748 |
| 1212 | 2960625692 | 2960624210 | Bacteria | 6875384 |
| 1213 | 2960633228 | 2960631154 | Bacteria | 6732508 |
| 1214 | 2960640207 | 2960637947 | Bacteria | 7296468 |
| 1215 | 2960648728 | 2960645483 | Bacteria | 7211087 |
| 1216 | 2960653707 | 2960652885 | Bacteria | 7083688 |
| 1217 | 2960666405 | 2960660292 | Bacteria | 7041660 |
| 1218 | 2960673925 | 2960667422 | Bacteria | 6763020 |
| 1219 | 2960678832 | 2960674078 | Bacteria | 6609048 |
| 1220 | 2960684160 | 2960680706 | Bacteria | 6624464 |
| 1221 | 2960692024 | 2960687367 | Bacteria | 6535474 |
| 1222 | 2960696371 | 2960693952 | Bacteria | 6749742 |
| 1223 | 2964610231 | 2964607997 | Bacteria | 7101408 |
| 1224 | 2964620008 | 2964615318 | Bacteria | 6809089 |
| 1225 | 2964627807 | 2964621998 | Bacteria | 6834995 |
| 1226 | 2964633117 | 2964628898 | Bacteria | 7083044 |
| 1227 | 2964641282 | 2964636051 | Bacteria | 7091832 |
| 1228 | 2964646161 | 2964643177 | Bacteria | 6820887 |
| 1229 | 2964653103 | 2964649959 | Bacteria | 6675118 |
| 1230 | 2964661884 | 2964656573 | Bacteria | 7100150 |
| 1231 | 2964665972 | 2964663802 | Bacteria | 7019362 |
| 1232 | 2964671686 | 2964670856 | Bacteria | 6851364 |
| 1233 | 2964681098 | 2964678106 | Bacteria | 6792020 |
| 1234 | 2964688108 | 2964685014 | Bacteria | 6839111 |
| 1235 | 2964695841 | 2964691889 | Bacteria | 6802758 |
| 1236 | 2964703595 | 2964698721 | Bacteria | 6765331 |
| 1237 | 2964708094 | 2964705432 | Bacteria | 7114648 |
| 1238 | 2964716299 | 2964712639 | Bacteria | 6695970 |
| 1239 | 2964726457 | 2964719344 | Bacteria | 7286602 |
| 1240 | 2967667371 | 2967664464 | Bacteria | 6948836 |
| 1241 | 2967672144 | 2967671571 | Bacteria | 7021409 |
| 1242 | 2967681043 | 2967678726 | Bacteria | 7264382 |
| 1243 | 2967686413 | 2967686174 | Bacteria | 6678622 |
| 1244 | 2967693246 | 2967693043 | Bacteria | 6804451 |
| 1245 | 2967704240 | 2967699805 | Bacteria | 6854538 |
| 1246 | 2967712948 | 2967706974 | Bacteria | 7186053 |
| 1247 | 2967716529 | 2967714385 | Bacteria | 7000047 |
| 1248 | 2967724587 | 2967721400 | Bacteria | 7073753 |
| 1249 | 2967734737 | 2967728569 | Bacteria | 6641507 |
| 1250 | 2967737580 | 2967735183 | Bacteria | 6827012 |
| 1251 | 2967747873 | 2967742019 | Bacteria | 6794534 |
| 1252 | 2967752105 | 2967748971 | Bacteria | 6733771 |
| 1253 | 2967756314 | 2967755722 | Bacteria | 6814706 |
| 1254 | 2967764431 | 2967762386 | Bacteria | 6923502 |
| 1255 | 2967770792 | 2967769361 | Bacteria | 6587838 |
| 1256 | 2967782177 | 2967775926 | Bacteria | 6738189 |
| 1257 | 2970026071 | 2970019648 | Bacteria | 7072033 |
| 1258 | 2970031791 | 2970026789 | Bacteria | 6785236 |
| 1259 | 2970037802 | 2970033650 | Bacteria | 7118744 |
| 1260 | 2970043285 | 2970040964 | Bacteria | 6731123 |
| 1261 | 2970052887 | 2970047711 | Bacteria | 7088379 |
| 1262 | 2970059608 | 2970054988 | Bacteria | 6611507 |
| 1263 | 2970065294 | 2970061556 | Bacteria | 7099761 |
| 1264 | 2970069514 | 2970068827 | Bacteria | 7123112 |
| 1265 | 2970076969 | 2970076120 | Bacteria | 6697332 |
| 1266 | 2970085648 | 2970082768 | Bacteria | 6183754 |
| 1267 | 2970093308 | 2970088815 | Bacteria | 6933825 |
| 1268 | 2970096866 | 2970095765 | Bacteria | 6936963 |
| 1269 | 2970106929 | 2970102677 | Bacteria | 6812532 |
| 1270 | 2970109819 | 2970109326 | Bacteria | 6863976 |
| 1271 | 2970117968 | 2970116247 | Bacteria | 6501857 |
| 1272 | 2970124461 | 2970122695 | Bacteria | 6625855 |
| 1273 | 2970129518 | 2970129317 | Bacteria | 6806560 |
| 1274 | 2970143150 | 2970136068 | Bacteria | 7207982 |
| 1275 | 2970148648 | 2970143518 | Bacteria | 6446480 |
| 1276 | 2970153814 | 2970149975 | Bacteria | 6779706 |
| 1277 | 2970163692 | 2970156795 | Bacteria | 7168044 |
| 1278 | 2970167504 | 2970164137 | Bacteria | 6861252 |
| 1279 | 2970171794 | 2970170962 | Bacteria | 6876229 |
| 1280 | 2970182814 | 2970177841 | Bacteria | 6768001 |
| 1281 | 2970188255 | 2970184632 | Bacteria | 7054431 |
| 1282 | 2970198324 | 2970191845 | Bacteria | 7032787 |
| 1283 | 2977518434 | 2977516862 | Bacteria | 6940108 |
| 1284 | 2977527656 | 2977523885 | Bacteria | 6960446 |
| 1285 | 2977531897 | 2977530762 | Bacteria | 6951399 |
| 1286 | 2977537989 | 2977537788 | Bacteria | 6929320 |
| 1287 | 2977544930 | 2977544691 | Bacteria | 6875412 |
| 1288 | 2977551987 | 2977551784 | Bacteria | 7125765 |
| 1289 | 2977561672 | 2977558990 | Bacteria | 6863948 |
| 1290 | 2977568982 | 2977565890 | Bacteria | 6901543 |
| 1291 | 2977578961 | 2977572785 | Bacteria | 6763888 |
| 1292 | 2977581494 | 2977579622 | Bacteria | 6772100 |
| 1293 | 3005415621 | 3005409236 | Bacteria | 7188837 |
| 1294 | 639649880 | 639633055 | Bacteria | 7751309 |
| 1295 | 643825045 | 643692032 | Bacteria | 6891900 |
| 1296 | 648736366 | 648276728 | Bacteria | 6968865 |
| 1297 | 8003992945 | 8003992118 | Bacteria | 7266902 |
| 1298 | 8004000181 | 8003999396 | Bacteria | 7063185 |
| 1299 | 8005294413 | 8005289223 | Bacteria | 6634003 |
| 1300 | 8005310832 | 8005307578 | Bacteria | 7395396 |
| 1301 | 8005378316 | 8005376324 | Bacteria | 6590079 |
| 1302 | 8005383961 | 8005382845 | Bacteria | 6732062 |
| 1303 | 8005401289 | 8005395548 | Bacteria | 6806915 |
| 1304 | 8005558509 | 8005556819 | Bacteria | 6908598 |
| 1305 | 8005566647 | 8005563573 | Bacteria | 7153261 |
| 1306 | 8005575064 | 8005570704 | Bacteria | 6957481 |
| 1307 | 8018133735 | 8018127388 | Bacteria | 7351159 |
| 1308 | 8018170091 | 8018163183 | Bacteria | 7277977 |
| 1309 | 8024481658 | 8024479707 | Bacteria | 6954785 |
| 1310 | 8055911039 | 8055909800 | Bacteria | 7278581 |
| 1311 | 8056381461 | 8056375014 | Bacteria | 7006639 |
| 1312 | 8057876697 | 8057874678 | Bacteria | 7494653 |
| 1313 | Ga0068858_100365714 | |||
| 1314 | MBSR1b_contig_10712157 | |||
| 1315 | LJQas_1038148 | |||
| 1316 | JGI24740J21852_10001351 | |||
| 1317 | JGI24034J26672_10118856 | |||
| 1318 | JGI24751J29686_10031269 | |||
| 1319 | JGI24751J29686_10090805 | |||
| 1320 | JGI25159J45721_1000002 | |||
| 1321 | JGI25151J46595_10161566 | |||
| 1322 | JGI25165J46597_1000947 | |||
| 1323 | JGI25153J46596_10100412 | |||
| 1324 | rootL2_10188392 | |||
| 1325 | rootH1_10287281 | |||
| 1326 | JGI25160J50197_1000008 | |||
| 1327 | JGI25161J50226_1000380 | |||
| 1328 | Ga0055526_1001532 | |||
| 1329 | Ga0055526_1020128 | |||
| 1330 | Ga0055524_1012523 | |||
| 1331 | Ga0055536_1002254 | |||
| 1332 | Ga0055536_1006080 | |||
| 1333 | Ga0055536_1009138 | |||
| 1334 | Ga0055528_1000695 | |||
| 1335 | Ga0055530_10001655 | |||
| 1336 | Ga0055530_10028298 | |||
| 1337 | Ga0055540_1000752 | |||
| 1338 | Ga0055531_10000858 | |||
| 1339 | Ga0055531_10001722 | |||
| 1340 | Ga0055531_10021163 | |||
| 1341 | Ga0055531_10026168 | |||
| 1342 | Ga0055531_10042449 | |||
| 1343 | Ga0055543_1001421 | |||
| 1344 | Ga0065165_1000015 | |||
| 1345 | Ga0065704_10095207 | |||
| 1346 | Ga0065704_10290897 | |||
| 1347 | Ga0065712_10072765 | |||
| 1348 | Ga0065715_10070852 | |||
| 1349 | Ga0065715_10115519 | |||
| 1350 | Ga0065715_10233704 | |||
| 1351 | Ga0065715_10448940 | |||
| 1352 | Ga0065707_10190157 | |||
| 1353 | Ga0070658_10024500 | |||
| 1354 | Ga0070658_10031287 | |||
| 1355 | Ga0070676_10064522 | |||
| 1356 | Ga0070676_10119508 | |||
| 1357 | Ga0070676_10748776 | |||
| 1358 | Ga0070683_102442811 | |||
| 1359 | Ga0070670_100000350 | |||
| 1360 | Ga0070670_100010030 | |||
| 1361 | Ga0070670_100021035 | |||
| 1362 | Ga0070670_100039511 | |||
| 1363 | Ga0070670_100087996 | |||
| 1364 | Ga0070670_100380736 | |||
| 1365 | Ga0070670_100508862 | |||
| 1366 | Ga0070677_10000600 | |||
| 1367 | Ga0070677_10037260 | |||
| 1368 | Ga0070677_10039893 | |||
| 1369 | Ga0070677_10333296 | |||
| 1370 | Ga0070677_10788663 | |||
| 1371 | Ga0068869_100300833 | |||
| 1372 | Ga0068869_100626883 | |||
| 1373 | Ga0068869_100856082 | |||
| 1374 | Ga0068869_100898790 | |||
| 1375 | Ga0068869_101021888 | |||
| 1376 | Ga0068868_100698703 | |||
| 1377 | Ga0068868_101436812 | |||
| 1378 | Ga0070660_100060990 | |||
| 1379 | Ga0070660_100121687 | |||
| 1380 | Ga0070660_100535787 | |||
| 1381 | Ga0070660_100935085 | |||
| 1382 | Ga0070660_101513291 | |||
| 1383 | Ga0070689_101453634 | |||
| 1384 | Ga0070689_101510986 | |||
| 1385 | Ga0070691_10664597 | |||
| 1386 | Ga0070687_100858606 | |||
| 1387 | Ga0070661_100120387 | |||
| 1388 | Ga0070661_100123269 | |||
| 1389 | Ga0070668_100024369 | |||
| 1390 | Ga0070668_100027061 | |||
| 1391 | Ga0070668_100029010 | |||
| 1392 | Ga0070668_100038020 | |||
| 1393 | Ga0070669_100009774 | |||
| 1394 | Ga0070669_100044937 | |||
| 1395 | Ga0070669_100173670 | |||
| 1396 | Ga0070669_100307933 | |||
| 1397 | Ga0070675_100001857 | |||
| 1398 | Ga0070675_100002352 | |||
| 1399 | Ga0070675_100078800 | |||
| 1400 | Ga0070675_100107929 | |||
| 1401 | Ga0070671_100001032 | |||
| 1402 | Ga0070671_100164090 | |||
| 1403 | Ga0070671_100715480 | |||
| 1404 | Ga0070671_100923306 | |||
| 1405 | Ga0070674_100003913 | |||
| 1406 | Ga0070674_100020755 | |||
| 1407 | Ga0070674_100027251 | |||
| 1408 | Ga0070674_100073539 | |||
| 1409 | Ga0070674_100701752 | |||
| 1410 | Ga0070673_100051731 | |||
| 1411 | Ga0070673_100517358 | |||
| 1412 | Ga0070673_101017085 | |||
| 1413 | Ga0070659_100064992 | |||
| 1414 | Ga0070659_100071386 | |||
| 1415 | Ga0070659_100146835 | |||
| 1416 | Ga0070659_100607835 | |||
| 1417 | Ga0070659_100849206 | |||
| 1418 | Ga0070659_102143984 | |||
| 1419 | Ga0070667_100065993 | |||
| 1420 | Ga0070667_100236010 | |||
| 1421 | Ga0070700_100088525 | |||
| 1422 | Ga0070663_100020031 | |||
| 1423 | Ga0070663_100224813 | |||
| 1424 | Ga0070663_100338937 | |||
| 1425 | Ga0070678_101486152 | |||
| 1426 | Ga0070678_101636009 | |||
| 1427 | Ga0070678_102173511 | |||
| 1428 | Ga0070662_100002989 | |||
| 1429 | Ga0070662_100019821 | |||
| 1430 | Ga0070662_100027985 | |||
| 1431 | Ga0070662_100366589 | |||
| 1432 | Ga0070662_100374457 | |||
| 1433 | Ga0070662_100529236 | |||
| 1434 | Ga0070662_100875549 | |||
| 1435 | Ga0070662_101641616 | |||
| 1436 | Ga0068867_100374909 | |||
| 1437 | Ga0068867_100433368 | |||
| 1438 | Ga0068867_101915762 | |||
| 1439 | Ga0070685_11056339 | |||
| 1440 | Ga0070679_100252500 | |||
| 1441 | Ga0070679_100981335 | |||
| 1442 | Ga0068853_100046888 | |||
| 1443 | Ga0068853_100458275 | |||
| 1444 | Ga0068853_100851270 | |||
| 1445 | Ga0070672_100005437 | |||
| 1446 | Ga0070672_100017512 | |||
| 1447 | Ga0070672_100098073 | |||
| 1448 | Ga0070672_100169097 | |||
| 1449 | Ga0070672_100371321 | |||
| 1450 | Ga0070672_101968869 | |||
| 1451 | Ga0070696_101123912 | |||
| 1452 | Ga0070665_100132453 | |||
| 1453 | Ga0068855_100103093 | |||
| 1454 | Ga0068855_100174964 | |||
| 1455 | Ga0068855_100270918 | |||
| 1456 | Ga0070664_100004435 | |||
| 1457 | Ga0070664_100094460 | |||
| 1458 | Ga0070664_101054141 | |||
| 1459 | Ga0068857_100045180 | |||
| 1460 | Ga0068854_100199288 | |||
| 1461 | Ga0068854_100225001 | |||
| 1462 | Ga0068856_100103731 | |||
| 1463 | Ga0068859_100523410 | |||
| 1464 | Ga0068864_100035579 | |||
| 1465 | Ga0068864_100545028 | |||
| 1466 | Ga0068864_101211167 | |||
| 1467 | Ga0068864_101612833 | |||
| 1468 | Ga0068866_10391222 | |||
| 1469 | Ga0068861_100231708 | |||
| 1470 | Ga0068861_100847870 | |||
| 1471 | Ga0068851_10099229 | |||
| 1472 | Ga0068863_102369896 | |||
| 1473 | Ga0068863_102433682 | |||
| 1474 | Ga0068858_100747326 | |||
| 1475 | Ga0068862_100016627 | |||
| 1476 | Ga0068862_100092388 | |||
| 1477 | Ga0068862_100322624 | |||
| 1478 | Ga0068862_100978530 | |||
| 1479 | Ga0068862_101064551 | |||
| 1480 | Ga0081455_10244360 | |||
| 1481 | Ga0075365_10001615 | |||
| 1482 | Ga0075365_10006228 | |||
| 1483 | Ga0075365_11007149 | |||
| 1484 | Ga0075368_10000318 | |||
| 1485 | Ga0075363_100004443 | |||
| 1486 | Ga0075363_100153476 | |||
| 1487 | Ga0075363_100562892 | |||
| 1488 | Ga0075364_10015285 | |||
| 1489 | Ga0075362_10003383 | |||
| 1490 | Ga0075367_10002472 | |||
| 1491 | Ga0075369_10019278 | |||
| 1492 | Ga0075369_10196062 | |||
| 1493 | Ga0075369_10389580 | |||
| 1494 | Ga0075369_10390163 | |||
| 1495 | Ga0075369_10391814 | |||
| 1496 | Ga0075366_10153572 | |||
| 1497 | Ga0075366_10809815 | |||
| 1498 | Ga0075370_10018867 | |||
| 1499 | Ga0075370_10048468 | |||
| 1500 | Ga0075370_10052920 | |||
| 1501 | Ga0075370_10272970 | |||
| 1502 | Ga0075370_10276764 | |||
| 1503 | Ga0075370_10501920 | |||
| 1504 | Ga0075428_100676383 | |||
| 1505 | Ga0075431_101097603 | |||
| 1506 | Ga0075429_100705294 | |||
| 1507 | Ga0075429_101612913 | |||
| 1508 | Ga0068865_101821536 | |||
| 1509 | Ga0097620_100523434 | |||
| 1510 | Ga0079104_1035919 | |||
| 1511 | Ga0079104_1061617 | |||
| 1512 | Ga0111539_10176032 | |||
| 1513 | Ga0111539_10568661 | |||
| 1514 | Ga0111539_10870883 | |||
| 1515 | Ga0111539_11142217 | |||
| 1516 | Ga0105245_11074055 | |||
| 1517 | Ga0105245_12896207 | |||
| 1518 | Ga0114129_12047192 | |||
| 1519 | Ga0105243_10129286 | |||
| 1520 | Ga0105243_11069571 | |||
| 1521 | Ga0105241_10437784 | |||
| 1522 | Ga0105248_10043271 | |||
| 1523 | Ga0105237_10141188 | |||
| 1524 | Ga0105237_10259227 | |||
| 1525 | Ga0105238_10022705 | |||
| 1526 | Ga0105238_10089554 | |||
| 1527 | Ga0105249_10073177 | |||
| 1528 | Ga0105239_10122221 | |||
| 1529 | Ga0105239_10257858 | |||
| 1530 | Ga0105239_10539227 | |||
| 1531 | Ga0105239_11332316 | |||
| 1532 | Ga0105246_10794202 | |||
| 1533 | Ga0105246_11870196 | |||
| 1534 | Ga0157319_1000957 | |||
| 1535 | Ga0157371_10354253 | |||
| 1536 | Ga0157370_10124553 | |||
| 1537 | Ga0157370_10920463 | |||
| 1538 | Ga0157369_10021987 | |||
| 1539 | Ga0171463_1001 | |||
| 1540 | Ga0157374_10234791 | |||
| 1541 | Ga0157374_10382641 | |||
| 1542 | Ga0157378_10517297 | |||
| 1543 | Ga0157378_10668493 | |||
| 1544 | Ga0157378_11457143 | |||
| 1545 | Ga0163162_10108677 | |||
| 1546 | Ga0163162_10413313 | |||
| 1547 | Ga0157372_10044754 | |||
| 1548 | Ga0157372_10154906 | |||
| 1549 | Ga0157375_10036695 | |||
| 1550 | Ga0157375_10067258 | |||
| 1551 | Ga0157375_10978857 | |||
| 1552 | Ga0157375_11129954 | |||
| 1553 | Ga0157375_11835192 | |||
| 1554 | Ga0163163_10671575 | |||
| 1555 | Ga0163163_10795752 | |||
| 1556 | Ga0163163_10956203 | |||
| 1557 | Ga0157380_10022038 | |||
| 1558 | Ga0157380_10033633 | |||
| 1559 | Ga0157380_10036570 | |||
| 1560 | Ga0157380_10568009 | |||
| 1561 | Ga0157380_10628741 | |||
| 1562 | Ga0157380_10632682 | |||
| 1563 | Ga0157380_11382439 | |||
| 1564 | Ga0157380_11660983 | |||
| 1565 | Ga0157380_12094252 | |||
| 1566 | Ga0183365_12031 | |||
| 1567 | Ga0183363_1371 | |||
| 1568 | Ga0163161_10049520 | |||
| 1569 | Ga0163161_10086971 | |||
| 1570 | Ga0163161_10120473 | |||
| 1571 | Ga0163161_11524446 | |||
| 1572 | Ga0214544_1009397 | |||
| 1573 | Ga0214542_1000006 | |||
| 1574 | Ga0214542_1016019 | |||
| 1575 | Ga0214543_1000003 | |||
| 1576 | Ga0214543_1000014 | |||
| 1577 | Ga0228711_1000001 | |||
| 1578 | Ga0228710_1000001 | |||
| 1579 | Ga0209436_103040 | |||
| 1580 | Ga0207427_109513 | |||
| 1581 | Ga0209437_100197 | |||
| 1582 | Ga0209233_1000199 | |||
| 1583 | Ga0209673_1000060 | |||
| 1584 | Ga0209673_1001334 | |||
| 1585 | Ga0209130_1000007 | |||
| 1586 | Ga0209130_1020116 | |||
| 1587 | Ga0209675_1000196 | |||
| 1588 | Ga0209676_1000518 | |||
| 1589 | Ga0209676_1000554 | |||
| 1590 | Ga0209676_1000901 | |||
| 1591 | Ga0209676_1000929 | |||
| 1592 | Ga0209676_1020890 | |||
| 1593 | Ga0209676_1030163 | |||
| 1594 | Ga0209025_1000100 | |||
| 1595 | Ga0209025_1006572 | |||
| 1596 | Ga0209025_1030058 | |||
| 1597 | Ga0209025_1059964 | |||
| 1598 | Ga0209564_1000116 | |||
| 1599 | Ga0209564_1000439 | |||
| 1600 | Ga0209758_1002301 | |||
| 1601 | Ga0209758_1025297 | |||
| 1602 | Ga0209758_1033930 | |||
| 1603 | Ga0209050_1000017 | |||
| 1604 | Ga0209050_1001222 | |||
| 1605 | Ga0209050_1008085 | |||
| 1606 | Ga0209050_1009017 | |||
| 1607 | Ga0209050_1021935 | |||
| 1608 | Ga0209050_1029701 | |||
| 1609 | Ga0209050_1067080 | |||
| 1610 | Ga0209256_1000302 | |||
| 1611 | Ga0209256_1001410 | |||
| 1612 | Ga0209256_1001505 | |||
| 1613 | Ga0207426_1000064 | |||
| 1614 | Ga0209051_1000217 | |||
| 1615 | Ga0209051_1001024 | |||
| 1616 | Ga0209051_1002714 | |||
| 1617 | Ga0209257_1001405 | |||
| 1618 | Ga0209257_1002894 | |||
| 1619 | Ga0209257_1004371 | |||
| 1620 | Ga0209257_1005509 | |||
| 1621 | Ga0209257_1006913 | |||
| 1622 | Ga0209257_1032597 | |||
| 1623 | Ga0209257_1069401 | |||
| 1624 | Ga0209257_1104677 | |||
| 1625 | Ga0207697_10003012 | |||
| 1626 | Ga0207697_10181534 | |||
| 1627 | Ga0207697_10193631 | |||
| 1628 | Ga0207682_10002530 | |||
| 1629 | Ga0207682_10059152 | |||
| 1630 | Ga0207682_10425647 | |||
| 1631 | Ga0207688_10050599 | |||
| 1632 | Ga0207688_10372485 | |||
| 1633 | Ga0207645_10005867 | |||
| 1634 | Ga0207645_10100033 | |||
| 1635 | Ga0207645_10381462 | |||
| 1636 | Ga0207645_10896506 | |||
| 1637 | Ga0207705_10001064 | |||
| 1638 | Ga0207705_10067557 | |||
| 1639 | Ga0207705_10073195 | |||
| 1640 | Ga0207695_10157189 | |||
| 1641 | Ga0207671_10589513 | |||
| 1642 | Ga0207657_10015490 | |||
| 1643 | Ga0207657_10123293 | |||
| 1644 | Ga0207657_10237211 | |||
| 1645 | Ga0207657_10359041 | |||
| 1646 | Ga0207657_10580238 | |||
| 1647 | Ga0207649_10007890 | |||
| 1648 | Ga0207649_10105896 | |||
| 1649 | Ga0207649_10631175 | |||
| 1650 | Ga0207649_10854948 | |||
| 1651 | Ga0207652_10006724 | |||
| 1652 | Ga0207652_10068552 | |||
| 1653 | Ga0207681_10005401 | |||
| 1654 | Ga0207681_10114929 | |||
| 1655 | Ga0207681_10191695 | |||
| 1656 | Ga0207681_10437430 | |||
| 1657 | Ga0207681_10475544 | |||
| 1658 | Ga0207681_10906585 | |||
| 1659 | Ga0207681_11481303 | |||
| 1660 | Ga0207650_10000916 | |||
| 1661 | Ga0207650_10004697 | |||
| 1662 | Ga0207650_10017569 | |||
| 1663 | Ga0207650_10041076 | |||
| 1664 | Ga0207650_10141041 | |||
| 1665 | Ga0207650_10164481 | |||
| 1666 | Ga0207650_10251599 | |||
| 1667 | Ga0207659_10002256 | |||
| 1668 | Ga0207659_10005898 | |||
| 1669 | Ga0207659_10049103 | |||
| 1670 | Ga0207659_10085347 | |||
| 1671 | Ga0207687_11196681 | |||
| 1672 | Ga0207644_10009825 | |||
| 1673 | Ga0207644_10604869 | |||
| 1674 | Ga0207644_11117396 | |||
| 1675 | Ga0207644_11681229 | |||
| 1676 | Ga0207690_10037801 | |||
| 1677 | Ga0207690_10198044 | |||
| 1678 | Ga0207690_10215011 | |||
| 1679 | Ga0207690_11229462 | |||
| 1680 | Ga0207706_10045319 | |||
| 1681 | Ga0207706_10088024 | |||
| 1682 | Ga0207706_10247681 | |||
| 1683 | Ga0207706_10311009 | |||
| 1684 | Ga0207706_10323824 | |||
| 1685 | Ga0207706_10501988 | |||
| 1686 | Ga0207706_10599913 | |||
| 1687 | Ga0207706_10746090 | |||
| 1688 | Ga0207706_10776213 | |||
| 1689 | Ga0207709_10154504 | |||
| 1690 | Ga0207669_10036896 | |||
| 1691 | Ga0207669_10037527 | |||
| 1692 | Ga0207669_10075641 | |||
| 1693 | Ga0207669_10344178 | |||
| 1694 | Ga0207669_10516271 | |||
| 1695 | Ga0207669_10578841 | |||
| 1696 | Ga0207669_10645267 | |||
| 1697 | Ga0207691_10006503 | |||
| 1698 | Ga0207691_10015470 | |||
| 1699 | Ga0207691_10146413 | |||
| 1700 | Ga0207691_11546050 | |||
| 1701 | Ga0207711_10101908 | |||
| 1702 | Ga0207661_11566308 | |||
| 1703 | Ga0207679_10015840 | |||
| 1704 | Ga0207679_10047566 | |||
| 1705 | Ga0207679_10137679 | |||
| 1706 | Ga0207679_10257464 | |||
| 1707 | Ga0207679_10916415 | |||
| 1708 | Ga0207667_10004509 | |||
| 1709 | Ga0207667_10068990 | |||
| 1710 | Ga0207651_10040548 | |||
| 1711 | Ga0207651_10372654 | |||
| 1712 | Ga0207651_10706277 | |||
| 1713 | Ga0207651_10782897 | |||
| 1714 | Ga0207712_10026570 | |||
| 1715 | Ga0207712_10317656 | |||
| 1716 | Ga0207668_10019850 | |||
| 1717 | Ga0207668_10051999 | |||
| 1718 | Ga0207668_10053537 | |||
| 1719 | Ga0207668_10126134 | |||
| 1720 | Ga0207640_10130945 | |||
| 1721 | Ga0207640_10216336 | |||
| 1722 | Ga0207658_10065281 | |||
| 1723 | Ga0207658_10082351 | |||
| 1724 | Ga0207658_10088112 | |||
| 1725 | Ga0207639_10228607 | |||
| 1726 | Ga0207639_10326200 | |||
| 1727 | Ga0207639_11254500 | |||
| 1728 | Ga0207678_10080942 | |||
| 1729 | Ga0207678_10112545 | |||
| 1730 | Ga0207678_10164279 | |||
| 1731 | Ga0207678_10298226 | |||
| 1732 | Ga0207678_10598340 | |||
| 1733 | Ga0207678_10616878 | |||
| 1734 | Ga0207708_10149073 | |||
| 1735 | Ga0207708_10494553 | |||
| 1736 | Ga0207702_10489169 | |||
| 1737 | Ga0207702_11310573 | |||
| 1738 | Ga0207648_10223064 | |||
| 1739 | Ga0207676_10037982 | |||
| 1740 | Ga0207676_10084122 | |||
| 1741 | Ga0207676_10909574 | |||
| 1742 | Ga0207674_10155258 | |||
| 1743 | Ga0207674_10317937 | |||
| 1744 | Ga0207674_10354615 | |||
| 1745 | Ga0207675_100036255 | |||
| 1746 | Ga0207675_100913085 | |||
| 1747 | Ga0207698_10172821 | |||
| 1748 | Ga0207698_11035642 | |||
| 1749 | Ga0209281_1000164 | |||
| 1750 | Ga0209281_1000332 | |||
| 1751 | Ga0209281_1026144 | |||
| 1752 | Ga0209282_1000007 | |||
| 1753 | Ga0209813_10000060 | |||
| 1754 | Ga0207428_10893559 | |||
| 1755 | Ga0268266_10137298 | |||
| 1756 | Ga0268266_10291785 | |||
| 1757 | Ga0268266_10615116 | |||
| 1758 | Ga0268265_10003419 | |||
| 1759 | Ga0268265_10029713 | |||
| 1760 | Ga0268265_10088850 | |||
| 1761 | Ga0268265_10211716 | |||
| 1762 | Ga0268265_10337359 | |||
| 1763 | Ga0268265_10988257 | |||
| 1764 | Ga0268265_11027405 | |||
| 1765 | Ga0307517_10663691 | |||
| 1766 | Ga0316183_1130216 | |||
| 1767 | Ga0316182_1057985 | |||
| 1768 | Ga0316182_1346917 | |||
| 1769 | Ga0265327_10205876 | |||
| 1770 | Ga0307408_100014062 | |||
| 1771 | Ga0307408_100014343 | |||
| 1772 | Ga0307408_100051353 | |||
| 1773 | Ga0307408_100205582 | |||
| 1774 | Ga0307408_100284185 | |||
| 1775 | Ga0307408_100506918 | |||
| 1776 | Ga0307408_100940828 | |||
| 1777 | Ga0307408_100978124 | |||
| 1778 | Ga0307408_101310604 | |||
| 1779 | Ga0307508_10617556 | |||
| 1780 | Ga0307405_10028431 | |||
| 1781 | Ga0307405_10150063 | |||
| 1782 | Ga0307405_10171440 | |||
| 1783 | Ga0307405_10175716 | |||
| 1784 | Ga0307405_10218556 | |||
| 1785 | Ga0307405_10237047 | |||
| 1786 | Ga0307405_10450756 | |||
| 1787 | Ga0307405_10478248 | |||
| 1788 | Ga0307405_10532523 | |||
| 1789 | Ga0307405_10552705 | |||
| 1790 | Ga0307405_10654518 | |||
| 1791 | Ga0307405_10991783 | |||
| 1792 | Ga0307405_11077023 | |||
| 1793 | Ga0307405_11159996 | |||
| 1794 | Ga0307405_11937040 | |||
| 1795 | Ga0307405_11973666 | |||
| 1796 | Ga0307413_10007256 | |||
| 1797 | Ga0307413_10008368 | |||
| 1798 | Ga0307413_10010474 | |||
| 1799 | Ga0307413_10019834 | |||
| 1800 | Ga0307413_10022551 | |||
| 1801 | Ga0307413_10027919 | |||
| 1802 | Ga0307413_10043051 | |||
| 1803 | Ga0307413_10098545 | |||
| 1804 | Ga0307413_10111022 | |||
| 1805 | Ga0307413_10138431 | |||
| 1806 | Ga0307413_10178685 | |||
| 1807 | Ga0307413_10286121 | |||
| 1808 | Ga0307413_10316911 | |||
| 1809 | Ga0307413_10329468 | |||
| 1810 | Ga0307413_10370861 | |||
| 1811 | Ga0307413_10560691 | |||
| 1812 | Ga0307413_10728860 | |||
| 1813 | Ga0307413_11162028 | |||
| 1814 | Ga0307413_11438799 | |||
| 1815 | Ga0307413_11877905 | |||
| 1816 | Ga0307410_10001306 | |||
| 1817 | Ga0307410_10002517 | |||
| 1818 | Ga0307410_10006279 | |||
| 1819 | Ga0307410_10016162 | |||
| 1820 | Ga0307410_10023487 | |||
| 1821 | Ga0307410_10025207 | |||
| 1822 | Ga0307410_10026018 | |||
| 1823 | Ga0307410_10073764 | |||
| 1824 | Ga0307410_10074789 | |||
| 1825 | Ga0307410_10075397 | |||
| 1826 | Ga0307410_10084136 | |||
| 1827 | Ga0307410_10085590 | |||
| 1828 | Ga0307410_10096733 | |||
| 1829 | Ga0307410_10127116 | |||
| 1830 | Ga0307410_10140780 | |||
| 1831 | Ga0307410_10187292 | |||
| 1832 | Ga0307410_10392738 | |||
| 1833 | Ga0307410_10422442 | |||
| 1834 | Ga0307410_10499925 | |||
| 1835 | Ga0307410_10557598 | |||
| 1836 | Ga0307410_10672132 | |||
| 1837 | Ga0307410_10710187 | |||
| 1838 | Ga0307410_10781805 | |||
| 1839 | Ga0307410_11357223 | |||
| 1840 | Ga0307410_11860803 | |||
| 1841 | Ga0307406_10042227 | |||
| 1842 | Ga0307406_10042588 | |||
| 1843 | Ga0307406_10056261 | |||
| 1844 | Ga0307406_10099950 | |||
| 1845 | Ga0307406_10198552 | |||
| 1846 | Ga0307406_10284792 | |||
| 1847 | Ga0307406_10310536 | |||
| 1848 | Ga0307406_10359750 | |||
| 1849 | Ga0307406_10404327 | |||
| 1850 | Ga0307406_10405980 | |||
| 1851 | Ga0307406_10451414 | |||
| 1852 | Ga0307406_10544977 | |||
| 1853 | Ga0307406_10793946 | |||
| 1854 | Ga0307406_10951626 | |||
| 1855 | Ga0307406_11047220 | |||
| 1856 | Ga0307406_11144917 | |||
| 1857 | Ga0307406_11200408 | |||
| 1858 | Ga0307406_11201478 | |||
| 1859 | Ga0307407_10002403 | |||
| 1860 | Ga0307407_10030175 | |||
| 1861 | Ga0307407_10284270 | |||
| 1862 | Ga0307407_10329137 | |||
| 1863 | Ga0307407_10333136 | |||
| 1864 | Ga0307407_10339967 | |||
| 1865 | Ga0307407_10342885 | |||
| 1866 | Ga0307407_10384831 | |||
| 1867 | Ga0307407_10557376 | |||
| 1868 | Ga0307407_10594231 | |||
| 1869 | Ga0307407_10758836 | |||
| 1870 | Ga0307407_10923648 | |||
| 1871 | Ga0307407_10948066 | |||
| 1872 | Ga0307412_10019162 | |||
| 1873 | Ga0307412_10030284 | |||
| 1874 | Ga0307412_10046470 | |||
| 1875 | Ga0307412_10046997 | |||
| 1876 | Ga0307412_10053016 | |||
| 1877 | Ga0307412_10159729 | |||
| 1878 | Ga0307412_10308610 | |||
| 1879 | Ga0307412_10342024 | |||
| 1880 | Ga0307412_10382225 | |||
| 1881 | Ga0307412_10434754 | |||
| 1882 | Ga0307412_10483313 | |||
| 1883 | Ga0307412_10580729 | |||
| 1884 | Ga0307412_10771205 | |||
| 1885 | Ga0307412_10863175 | |||
| 1886 | Ga0307412_11060993 | |||
| 1887 | Ga0307412_11220739 | |||
| 1888 | Ga0307412_11442023 | |||
| 1889 | Ga0307412_11501969 | |||
| 1890 | Ga0307412_11557808 | |||
| 1891 | Ga0315914_1000006 | |||
| 1892 | Ga0307409_100000217 | |||
| 1893 | Ga0307409_100004848 | |||
| 1894 | Ga0307409_100035151 | |||
| 1895 | Ga0307409_100036117 | |||
| 1896 | Ga0307409_100082523 | |||
| 1897 | Ga0307409_100108162 | |||
| 1898 | Ga0307409_100135464 | |||
| 1899 | Ga0307409_100154764 | |||
| 1900 | Ga0307409_100154851 | |||
| 1901 | Ga0307409_100191360 | |||
| 1902 | Ga0307409_100224574 | |||
| 1903 | Ga0307409_100281961 | |||
| 1904 | Ga0307409_100405469 | |||
| 1905 | Ga0307409_100453122 | |||
| 1906 | Ga0307409_100454096 | |||
| 1907 | Ga0307409_100524748 | |||
| 1908 | Ga0307409_100569832 | |||
| 1909 | Ga0307409_100650992 | |||
| 1910 | Ga0307409_100656591 | |||
| 1911 | Ga0307409_100693902 | |||
| 1912 | Ga0307409_100823870 | |||
| 1913 | Ga0307409_100888193 | |||
| 1914 | Ga0307409_101019133 | |||
| 1915 | Ga0307409_101619202 | |||
| 1916 | Ga0307409_102702423 | |||
| 1917 | Ga0307416_100008213 | |||
| 1918 | Ga0307416_100014578 | |||
| 1919 | Ga0307416_100027573 | |||
| 1920 | Ga0307416_100053742 | |||
| 1921 | Ga0307416_100136130 | |||
| 1922 | Ga0307416_100278501 | |||
| 1923 | Ga0307416_100321447 | |||
| 1924 | Ga0307416_100342349 | |||
| 1925 | Ga0307416_100359682 | |||
| 1926 | Ga0307416_100431452 | |||
| 1927 | Ga0307416_100432819 | |||
| 1928 | Ga0307416_100458297 | |||
| 1929 | Ga0307416_100460002 | |||
| 1930 | Ga0307416_100739987 | |||
| 1931 | Ga0307416_100755504 | |||
| 1932 | Ga0307416_100895295 | |||
| 1933 | Ga0307416_100960212 | |||
| 1934 | Ga0307416_101623611 | |||
| 1935 | Ga0307416_101918966 | |||
| 1936 | Ga0307416_102131873 | |||
| 1937 | Ga0307416_102508581 | |||
| 1938 | Ga0307416_103151597 | |||
| 1939 | Ga0307416_103752870 | |||
| 1940 | Ga0307414_10000346 | |||
| 1941 | Ga0307414_10000797 | |||
| 1942 | Ga0307414_10001040 | |||
| 1943 | Ga0307414_10006477 | |||
| 1944 | Ga0307414_10009428 | |||
| 1945 | Ga0307414_10012420 | |||
| 1946 | Ga0307414_10036346 | |||
| 1947 | Ga0307414_10055229 | |||
| 1948 | Ga0307414_10058244 | |||
| 1949 | Ga0307414_10085171 | |||
| 1950 | Ga0307414_10133550 | |||
| 1951 | Ga0307414_10190603 | |||
| 1952 | Ga0307414_10194198 | |||
| 1953 | Ga0307414_10224063 | |||
| 1954 | Ga0307414_10544913 | |||
| 1955 | Ga0307414_10605597 | |||
| 1956 | Ga0307414_10829788 | |||
| 1957 | Ga0307414_10998148 | |||
| 1958 | Ga0307414_11092276 | |||
| 1959 | Ga0307414_11232535 | |||
| 1960 | Ga0307414_12134026 | |||
| 1961 | Ga0307414_12168157 | |||
| 1962 | Ga0307411_10000748 | |||
| 1963 | Ga0307411_10001464 | |||
| 1964 | Ga0307411_10003067 | |||
| 1965 | Ga0307411_10006109 | |||
| 1966 | Ga0307411_10009598 | |||
| 1967 | Ga0307411_10027126 | |||
| 1968 | Ga0307411_10029138 | |||
| 1969 | Ga0307411_10044982 | |||
| 1970 | Ga0307411_10108630 | |||
| 1971 | Ga0307411_10135937 | |||
| 1972 | Ga0307411_10138660 | |||
| 1973 | Ga0307411_10191879 | |||
| 1974 | Ga0307411_10222851 | |||
| 1975 | Ga0307411_10244720 | |||
| 1976 | Ga0307411_10256430 | |||
| 1977 | Ga0307411_10409819 | |||
| 1978 | Ga0307411_10480958 | |||
| 1979 | Ga0307411_10484507 | |||
| 1980 | Ga0307411_10500253 | |||
| 1981 | Ga0307411_10536708 | |||
| 1982 | Ga0307411_10560322 | |||
| 1983 | Ga0307411_10578869 | |||
| 1984 | Ga0307411_10671252 | |||
| 1985 | Ga0307411_10991978 | |||
| 1986 | Ga0307411_11187869 | |||
| 1987 | Ga0307411_11263107 | |||
| 1988 | Ga0307411_11331501 | |||
| 1989 | Ga0307411_11593361 | |||
| 1990 | Ga0307411_11645092 | |||
| 1991 | Ga0307411_11878271 | |||
| 1992 | Ga0307415_100002106 | |||
| 1993 | Ga0307415_100006836 | |||
| 1994 | Ga0307415_100064731 | |||
| 1995 | Ga0307415_100067602 | |||
| 1996 | Ga0307415_100107648 | |||
| 1997 | Ga0307415_100163828 | |||
| 1998 | Ga0307415_100164200 | |||
| 1999 | Ga0307415_100211123 | |||
| 2000 | Ga0307415_100299510 | |||
| 2001 | Ga0307415_100600128 | |||
| 2002 | Ga0307415_101131026 | |||
| 2003 | Ga0307415_101624711 | |||
| 2004 | Ga0307415_101686709 | |||
| 2005 | Ga0315913_1000002 | |||
| 2006 | Ga0315915_1000001 | |||
| 2007 | Ga0373941_0270863 | |||
| 2008 | Ga0373931_0370185 | |||
| 2009 | Ga0395899_0000124 | |||
| 2010 | Ga0395900_0000086 | |||
| 2011 | Ga0395900_0542594 | |||
| 2012 | Ga0395898_0000285 | |||
| 2013 | Ga0395905_0000133 | |||
| 2014 | Ga0395905_0357035 | |||
| 2015 | Ga0395905_0448397 | |||
| 2016 | Ga0395905_0734928 | |||
| 2017 | Ga0395905_0738849 | |||
| 2018 | Ga0395905_0844519 | |||
| 2019 | Ga0395905_0966085 | |||
| 2020 | Ga0395901_0000092 | |||
| 2021 | Ga0395901_0623049 | |||
| 2022 | Ga0395901_0996682 | |||
| 2023 | Ga0436365_0105016 | |||
| 2024 | Ga0439436_0030162 | |||
| 2025 | Ga0439438_024814 | |||
| 2026 | Ga0439465_0011348 | |||
| 2027 | Ga0439465_0053742 | |||
| 2028 | Ga0451791_0343439 | |||
| 2029 | Ga0451791_0456541 | |||
| 2030 | Ga0451793_0443755 | |||
| 2031 | Ga0451807_0663369 | |||
| 2032 | Ga0451807_2638188 | |||
| 2033 | Ga0451807_2716419 | |||
| 2034 | Ga0451835_0321473 | |||
| 2035 | Ga0451837_0281783 | |||
| 2036 | Ga0451837_0877181 | |||
| 2037 | Ga0451837_1015036 | |||
| 2038 | Ga0451839_1273499 | |||
| 2039 | Ga0451841_0095796 | |||
| 2040 | Ga0451841_0230948 | |||
| 2041 | Ga0451845_0468910 | |||
| 2042 | Ga0451853_3825811 | |||
| 2043 | Ga0439431_0272600 | |||
| 2044 | Ga0439445_0000389 | |||
| 2045 | Ga0439432_098194 | |||
| 2046 | Ga0439432_204285 | |||
| 2047 | Ga0439449_0004505 | |||
| 2048 | Ga0439449_0078415 | |||
| 2049 | Ga0439449_0124791 | |||
| 2050 | Ga0439449_0125927 | |||
| 2051 | Ga0439449_0161858 | |||
| 2052 | Ga0439452_055554 | |||
| 2053 | Ga0439457_039816 | |||
| 2054 | Ga0439462_0071060 | |||
| 2055 | Ga0439462_0074065 | |||
| 2056 | Ga0439462_0242360 | |||
| 2057 | Ga0450912_024682 | |||
| 2058 | Ga0450920_029182 | |||
| 2059 | Ga0450894_079262 | |||
| 2060 | Ga0450907_020776 | |||
| 2061 | Ga0439446_0038165 | |||
| 2062 | Ga0439434_0033026 | |||
| 2063 | Ga0439434_0220219 | |||
| 2064 | Ga0439434_0266696 | |||
| 2065 | Ga0439464_0315881 | |||
| 2066 | Ga0450918_077345 | |||
| 2067 | Ga0450901_011938 | |||
| 2068 | Ga0451577_0507762 | |||
| 2069 | Ga0453684_0203560 | |||
| 2070 | Ga0466967_1187677 | |||
| 2071 | Ga0495617_129242 | |||
| 2072 | Ga0495638_0010960 | |||
| 2073 | Ga0495638_0014449 | |||
| 2074 | Ga0495638_0034944 | |||
| 2075 | Ga0495638_0549108 | |||
| 2076 | Ga0495596_0264005 | |||
| 2077 | Ga0495607_0009645 | |||
| 2078 | Ga0495583_0046142 | |||
| 2079 | Ga0495606_0080835 | |||
| 2080 | Ga0495606_0566136 | |||
| 2081 | Ga0495606_0589518 | |||
| 2082 | Ga0495610_0084939 | |||
| 2083 | Ga0495610_0209922 | |||
| 2084 | Ga0495620_0300627 | |||
| 2085 | Ga0495632_0012798 | |||
| 2086 | Ga0495643_0019902 | |||
| 2087 | Ga0495648_0103025 | |||
| 2088 | Ga0495663_0001773 | |||
| 2089 | Ga0495663_0022610 | |||
| 2090 | Ga0495663_0035591 | |||
| 2091 | Ga0495663_0102981 | |||
| 2092 | Ga0495663_0270116 | |||
| 2093 | Ga0495642_0182352 | |||
| 2094 | Ga0495654_0010554 | |||
| 2095 | Ga0495654_0360229 | |||
| 2096 | Ga0495598_0016102 | |||
| 2097 | Ga0495598_0081258 | |||
| 2098 | Ga0495598_0084910 | |||
| 2099 | Ga0495621_0001191 | |||
| 2100 | Ga0495621_0001733 | |||
| 2101 | Ga0495621_0039729 | |||
| 2102 | Ga0495597_0037563 | |||
| 2103 | Ga0495622_0220692 | |||
| 2104 | Ga0495633_0359128 | |||
| 2105 | Ga0495668_0000004 | |||
| 2106 | Ga0495668_0648659 | |||
| 2107 | Ga0495625_0000553 | |||
| 2108 | Ga0495625_0016088 | |||
| 2109 | Ga0495625_0035484 | |||
| 2110 | Ga0495625_0159861 | |||
| 2111 | Ga0495625_0382484 | |||
| 2112 | Ga0495659_0086772 | |||
| 2113 | Ga0495659_0156568 | |||
| 2114 | Ga0495659_0528271 | |||
| 2115 | Ga0495588_0101380 | |||
| 2116 | Ga0495669_0000602 | |||
| 2117 | Ga0495669_0077318 | |||
| 2118 | Ga0495670_0004937 | |||
| 2119 | Ga0495670_0009300 | |||
| 2120 | Ga0495670_0052728 | |||
| 2121 | Ga0495670_0123687 | |||
| 2122 | Ga0495670_0248402 | |||
| 2123 | Ga0495670_0349574 | |||
| 2124 | Ga0495670_0501266 | |||
| 2125 | Ga0495671_0017144 | |||
| 2126 | Ga0495671_0030512 | |||
| 2127 | Ga0495671_0038954 | |||
| 2128 | Ga0495589_0276032 | |||
| 2129 | Ga0495660_0023484 | |||
| 2130 | Ga0495677_0024775 | |||
| 2131 | Ga0495677_0027004 | |||
| 2132 | Ga0495677_0208479 | |||
| 2133 | Ga0495681_0082006 | |||
| 2134 | Ga0495681_0118381 | |||
| 2135 | Ga0495686_0012540 | |||
| 2136 | Ga0495686_0067518 | |||
| 2137 | Ga0495686_0259720 | |||
| 2138 | Ga0496100_0613825 | |||
| 2139 | Ga0496101_0748635 | |||
| 2140 | Ga0496102_0250891 | |||
| 2141 | Ga0496106_0973151 | |||
| 2142 | Ga0496107_0386275 | |||
| 2143 | Ga0496108_0067853 | |||
| 2144 | Ga0496109_0485983 | |||
| 2145 | Ga0496109_0513593 | |||
| 2146 | Ga0496109_0528814 | |||
| 2147 | Ga0496110_0001413 | |||
| 2148 | Ga0496111_0368954 | |||
| 2149 | Ga0496114_0391067 | |||
| 2150 | Ga0496115_0010329 | |||
| 2151 | Ga0496115_1372783 | |||
| 2152 | Ga0496117_0205089 | |||
| 2153 | Ga0496118_0019743 | |||
| 2154 | Ga0496119_0088685 | |||
| 2155 | Ga0496120_0366153 | |||
| 2156 | Ga0496121_0220606 | |||
| 2157 | Ga0496121_0448158 | |||
| 2158 | Ga0496122_0000416 | |||
| 2159 | Ga0496123_0000460 | |||
| 2160 | Ga0496123_0002043 | |||
| 2161 | Ga0496124_0066588 | |||
| 2162 | Ga0496124_0125990 | |||
| 2163 | Ga0496124_0212210 | |||
| 2164 | Ga0496125_0006717 | |||
| 2165 | Ga0496125_0222569 | |||
| 2166 | Ga0496126_0310346 | |||
| 2167 | Ga0496126_0316405 | |||
| 2168 | Ga0496126_0618377 | |||
| 2169 | Ga0496126_0635387 | |||
| 2170 | Ga0496126_1149026 | |||
| 2171 | Ga0501031_0000016 | |||
| 2172 | Ga0501031_0027499 | |||
| 2173 | Ga0501031_0099578 | |||
| 2174 | Ga0501031_0102979 | |||
| 2175 | Ga0501032_0000044 | |||
| 2176 | Ga0501032_0094726 | |||
| 2177 | Ga0501032_0182038 | |||
| 2178 | Ga0501032_0326164 | |||
| 2179 | Ga0501033_0000052 | |||
| 2180 | Ga0501033_0050698 | |||
| 2181 | Ga0501033_0081474 | |||
| 2182 | Ga0501033_0336342 | |||
| 2183 | Ga0501033_0435063 | |||
| 2184 | Ga0501034_0000212 | |||
| 2185 | Ga0501034_0069338 | |||
| 2186 | Ga0501034_0106196 | |||
| 2187 | Ga0501034_0488781 | |||
| 2188 | Ga0501034_0827334 | |||
| 2189 | Ga0501036_0000022 | |||
| 2190 | Ga0501036_0025253 | |||
| 2191 | Ga0501036_0153146 | |||
| 2192 | Ga0501036_0859510 | |||
| 2193 | Ga0501037_0000052 | |||
| 2194 | Ga0501037_0045871 | |||
| 2195 | Ga0501037_0238039 | |||
| 2196 | Ga0501037_0301995 | |||
| 2197 | Ga0501037_0392552 | |||
| 2198 | Ga0501037_0564047 | |||
| 2199 | Ga0501038_0000044 | |||
| 2200 | Ga0501038_0030959 | |||
| 2201 | Ga0501038_0155608 | |||
| 2202 | Ga0501038_0276789 | |||
| 2203 | Ga0501039_0000042 | |||
| 2204 | Ga0501039_0007777 | |||
| 2205 | Ga0501039_0323905 | |||
| 2206 | Ga0501040_0057517 | |||
| 2207 | Ga0501040_0118622 | |||
| 2208 | Ga0501043_0000054 | |||
| 2209 | Ga0501043_0016295 | |||
| 2210 | Ga0501043_0137547 | |||
| 2211 | Ga0501046_0147468 | |||
| 2212 | Ga0501046_0519621 | |||
| 2213 | Ga0501047_0000247 | |||
| 2214 | Ga0501047_0172411 | |||
| 2215 | Ga0501068_0189543 | |||
| 2216 | Ga0501068_0629984 | |||
| 2217 | Ga0501070_0363765 | |||
| 2218 | Ga0501072_0015756 | |||
| 2219 | Ga0501072_0108654 | |||
| 2220 | Ga0501073_0216155 | |||
| 2221 | Ga0501073_0496014 | |||
| 2222 | Ga0501074_0385756 | |||
| 2223 | Ga0501074_1311875 | |||
| 2224 | Ga0501075_0194058 | |||
| 2225 | Ga0501202_113772 | |||
| 2226 | Ga0501224_005346 | |||
| 2227 | Ga0501238_027115 | |||
| 2228 | Ga0501249_038320 | |||
| 2229 | Ga0501079_0724422 | |||
| 2230 | Ga0501081_0012442 | |||
| 2231 | Ga0501262_013742 | |||
| 2232 | Ga0501262_065171 | |||
| 2233 | Ga0501268_086003 | |||
| 2234 | Ga0501269_005517 | |||
| 2235 | Ga0501279_066484 | |||
| 2236 | Ga0501035_0000095 | |||
| 2237 | Ga0501035_0023615 | |||
| 2238 | Ga0501035_0297143 | |||
| 2239 | Ga0501035_0363431 | |||
| 2240 | Ga0501044_0000091 | |||
| 2241 | Ga0501044_0000280 | |||
| 2242 | Ga0501044_0027138 | |||
| 2243 | Ga0501044_0172718 | |||
| 2244 | Ga0501045_0024385 | |||
| 2245 | Ga0501045_0651172 | |||
| 2246 | nmdc:mga03683_721_c1 | |||
| 2247 | nmdc:mga03n38_59950_c1 | |||
| 2248 | nmdc:mga0yw44_31385_c1 | |||
| 2249 | nmdc:mga0yw44_81252_c1 | |||
| 2250 | nmdc:mga0k408_104336_c1 | |||
| 2251 | nmdc:mga0k408_323284_c1 | |||
| 2252 | nmdc:mga0k408_492351_c1 | |||
| 2253 | nmdc:mga06z11_388_c1 | |||
| 2254 | nmdc:mga04h51_73_c1 | |||
| 2255 | nmdc:mga07m45_251251_c1 | |||
| 2256 | nmdc:mga07m45_330852_c1 | |||
| 2257 | nmdc:mga07m45_47316_c1 | |||
| 2258 | nmdc:mga07m45_5_c2 | |||
| 2259 | nmdc:mga07m45_979_c1 | |||
| 2260 | nmdc:mga09592_1279878_c1 | |||
| 2261 | nmdc:mga08y16_1245842_c1 | |||
| 2262 | nmdc:mga08y16_406877_c1 | |||
| 2263 | nmdc:mga0sz30_209_c1 | |||
| 2264 | nmdc:mga0sz30_351964_c1 | |||
| 2265 | nmdc:mga0sz30_382860_c1 | |||
| 2266 | nmdc:mga0sz30_9804_c1 | |||
| 2267 | Ga0500643_002982 | |||
| 2268 | Ga0500643_030835 | |||
| 2269 | Ga0500643_218016 | |||
| 2270 | Ga0500651_0336984 | |||
| 2271 | Ga0500650_0054600 | |||
| 2272 | Ga0500555_059803 | |||
| 2273 | Ga0500556_0000339 | |||
| 2274 | Ga0500562_025902 | |||
| 2275 | Ga0500569_009439 | |||
| 2276 | Ga0500592_020911 | |||
| 2277 | Ga0500592_027000 | |||
| 2278 | Ga0500595_023762 | |||
| 2279 | Ga0500608_000105 | |||
| 2280 | Ga0500608_000764 | |||
| 2281 | Ga0500642_0000001 | |||
| 2282 | Ga0500658_0000769 | |||
| 2283 | Ga0500658_0358583 | |||
| 2284 | Ga0500559_0312546 | |||
| 2285 | Ga0500568_0001734 | |||
| 2286 | Ga0500568_0051944 | |||
| 2287 | Ga0500568_0081725 | |||
| 2288 | Ga0500573_0006606 | |||
| 2289 | Ga0500573_0285408 | |||
| 2290 | Ga0500616_0000421 | |||
| 2291 | Ga0500616_0039441 | |||
| 2292 | Ga0500616_0318064 | |||
| 2293 | Ga0500622_0030266 | |||
| 2294 | Ga0500627_0000049 | |||
| 2295 | Ga0500627_0479965 | |||
| 2296 | Ga0500636_0000156 | |||
| 2297 | Ga0500645_000312 | |||
| 2298 | Ga0501084_0819463 | |||
| 2299 | Ga0501084_1141472 | |||
| 2300 | Ga0501082_0275088 | |||
| 2301 | Ga0501082_1747598 | |||
| 2302 | Ga0501082_2037177 | |||
| 2303 | 2509079156 | |||
| 2304 | 2509108476 | |||
| 2305 | 2509374497 | |||
| 2306 | 2510134718 | |||
| 2307 | 2510306608 | |||
| 2308 | 2510896067 | |||
| 2309 | 2511500971 | |||
| 2310 | 2512972287 | |||
| 2311 | 2513583491 | |||
| 2312 | 2513603366 | |||
| 2313 | 2513620774 | |||
| 2314 | 2513631444 | |||
| 2315 | 2513710622 | |||
| 2316 | 2513881140 | |||
| 2317 | 2513907125 | |||
| 2318 | 2513983971 | |||
| 2319 | 2514004821 | |||
| 2320 | 2514023732 | |||
| 2321 | 2515608086 | |||
| 2322 | 2515634671 | |||
| 2323 | 2515646027 | |||
| 2324 | 2515656906 | |||
| 2325 | 2515743529 | |||
| 2326 | 2516208840 | |||
| 2327 | 2516892252 | |||
| 2328 | 2517037420 | |||
| 2329 | 2517077717 | |||
| 2330 | 2517410616 | |||
| 2331 | 2517569048 | |||
| 2332 | 2520377860 | |||
| 2333 | 2524451186 | |||
| 2334 | 2551676431 | |||
| 2335 | 2551687212 | |||
| 2336 | 2551692941 | |||
| 2337 | 2551703186 | |||
| 2338 | 2551712353 | |||
| 2339 | 2551720674 | |||
| 2340 | 2551731098 | |||
| 2341 | 2551731976 | |||
| 2342 | 2551740402 | |||
| 2343 | 2558863524 | |||
| 2344 | 2585270292 | |||
| 2345 | 2585388731 | |||
| 2346 | 2585541139 | |||
| 2347 | 2585839902 | |||
| 2348 | 2587919815 | |||
| 2349 | 2616295438 | |||
| 2350 | 2643820086 | |||
| 2351 | 2643836387 | |||
| 2352 | 2643910490 | |||
| 2353 | 2644052863 | |||
| 2354 | 2644109039 | |||
| 2355 | 2644151560 | |||
| 2356 | 2644223557 | |||
| 2357 | 2644236353 | |||
| 2358 | 2644311695 | |||
| 2359 | 2644329952 | |||
| 2360 | 2644494368 | |||
| 2361 | 2644546626 | |||
| 2362 | 2644617494 | |||
| 2363 | 2657683308 | |||
| 2364 | 2692316866 | |||
| 2365 | 2725947705 | |||
| 2366 | 2739035691 | |||
| 2367 | 2753460768 | |||
| 2368 | 2766065449 | |||
| 2369 | 2792622724 | |||
| 2370 | 2792628355 | |||
| 2371 | 2793319840 | |||
| 2372 | 2793328156 | |||
| 2373 | 2793362933 | |||
| 2374 | 2793370041 | |||
| 2375 | 2802717691 | |||
| 2376 | 2802723381 | |||
| 2377 | 2802731168 | |||
| 2378 | 2802736175 | |||
| 2379 | 2802743615 | |||
| 2380 | 2802750673 | |||
| 2381 | 2804751302 | |||
| 2382 | 2806044678 | |||
| 2383 | 2806052878 | |||
| 2384 | 2806059178 | |||
| 2385 | 2806068159 | |||
| 2386 | 2806074279 | |||
| 2387 | 2838046371 | |||
| 2388 | 2838076400 | |||
| 2389 | 2838685079 | |||
| 2390 | 2838691449 | |||
| 2391 | 2838699084 | |||
| 2392 | 2838712565 | |||
| 2393 | 2838733408 | |||
| 2394 | 2838746020 | |||
| 2395 | 2841853732 | |||
| 2396 | 2842082042 | |||
| 2397 | 2842113565 | |||
| 2398 | 2842122964 | |||
| 2399 | 2842162261 | |||
| 2400 | 2842169816 | |||
| 2401 | 2842185187 | |||
| 2402 | 2842208184 | |||
| 2403 | 2842220204 | |||
| 2404 | 2842233674 | |||
| 2405 | 2842242133 | |||
| 2406 | 2842247718 | |||
| 2407 | 2842262014 | |||
| 2408 | 2842275923 | |||
| 2409 | 2842281807 | |||
| 2410 | 2842296042 | |||
| 2411 | 2842308093 | |||
| 2412 | 2842375757 | |||
| 2413 | 2842382441 | |||
| 2414 | 2842389842 | |||
| 2415 | 2844168563 | |||
| 2416 | 2844457623 | |||
| 2417 | 2847418068 | |||
| 2418 | 2848993042 | |||
| 2419 | 2850080437 | |||
| 2420 | 2852653987 | |||
| 2421 | 2855831322 | |||
| 2422 | 2855840447 | |||
| 2423 | 2855879180 | |||
| 2424 | 2857505938 | |||
| 2425 | 2857519032 | |||
| 2426 | 2858800976 | |||
| 2427 | 2867512749 | |||
| 2428 | 2896386601 | |||
| 2429 | 2913297483 | |||
| 2430 | 2915986171 | |||
| 2431 | 2915990591 | |||
| 2432 | 2915996261 | |||
| 2433 | 2916005739 | |||
| 2434 | 2916010926 | |||
| 2435 | 2916016563 | |||
| 2436 | 2916024762 | |||
| 2437 | 2916032181 | |||
| 2438 | 2916038164 | |||
| 2439 | 2916047184 | |||
| 2440 | 2916053212 | |||
| 2441 | 2916055358 | |||
| 2442 | 2916062822 | |||
| 2443 | 2916074961 | |||
| 2444 | 2916079315 | |||
| 2445 | 2920762914 | |||
| 2446 | 2921205724 | |||
| 2447 | 2921213530 | |||
| 2448 | 2921241622 | |||
| 2449 | 2921247516 | |||
| 2450 | 2921250953 | |||
| 2451 | 2921260005 | |||
| 2452 | 2921264235 | |||
| 2453 | 2921282768 | |||
| 2454 | 2921290130 | |||
| 2455 | 2921299967 | |||
| 2456 | 2924145600 | |||
| 2457 | 2924155881 | |||
| 2458 | 2924160573 | |||
| 2459 | 2924168151 | |||
| 2460 | 2924177847 | |||
| 2461 | 2924186314 | |||
| 2462 | 2924189512 | |||
| 2463 | 2924198248 | |||
| 2464 | 2924204059 | |||
| 2465 | 2924209909 | |||
| 2466 | 2924215176 | |||
| 2467 | 2924226229 | |||
| 2468 | 2924234934 | |||
| 2469 | 2928531957 | |||
| 2470 | 2929202040 | |||
| 2471 | 2932402362 | |||
| 2472 | 2933574542 | |||
| 2473 | 2933589145 | |||
| 2474 | 2935899854 | |||
| 2475 | 2935907025 | |||
| 2476 | 2936374993 | |||
| 2477 | 2936380684 | |||
| 2478 | 2937009514 | |||
| 2479 | 2937010886 | |||
| 2480 | 2937018984 | |||
| 2481 | 2937027925 | |||
| 2482 | 2937029868 | |||
| 2483 | 2937036894 | |||
| 2484 | 2937048989 | |||
| 2485 | 2937056284 | |||
| 2486 | 2937061298 | |||
| 2487 | 2937064388 | |||
| 2488 | 2937072868 | |||
| 2489 | 2937082975 | |||
| 2490 | 2937091253 | |||
| 2491 | 2937095589 | |||
| 2492 | 2937103635 | |||
| 2493 | 2937109776 | |||
| 2494 | 2937118318 | |||
| 2495 | 2937121185 | |||
| 2496 | 2937129819 | |||
| 2497 | 2941500262 | |||
| 2498 | 2957380027 | |||
| 2499 | 2957385069 | |||
| 2500 | 2957389132 | |||
| 2501 | 2957396752 | |||
| 2502 | 2957405448 | |||
| 2503 | 2957413251 | |||
| 2504 | 2957419199 | |||
| 2505 | 2957427733 | |||
| 2506 | 2957431091 | |||
| 2507 | 2957441965 | |||
| 2508 | 2957446653 | |||
| 2509 | 2957454190 | |||
| 2510 | 2957462450 | |||
| 2511 | 2957467748 | |||
| 2512 | 2957477790 | |||
| 2513 | 2957480628 | |||
| 2514 | 2957485790 | |||
| 2515 | 2957495994 | |||
| 2516 | 2957501036 | |||
| 2517 | 2957509592 | |||
| 2518 | 2960586644 | |||
| 2519 | 2960595571 | |||
| 2520 | 2960600575 | |||
| 2521 | 2960609475 | |||
| 2522 | 2960616786 | |||
| 2523 | 2960617704 | |||
| 2524 | 2960625692 | |||
| 2525 | 2960633228 | |||
| 2526 | 2960640207 | |||
| 2527 | 2960648728 | |||
| 2528 | 2960653707 | |||
| 2529 | 2960666405 | |||
| 2530 | 2960673925 | |||
| 2531 | 2960678832 | |||
| 2532 | 2960684160 | |||
| 2533 | 2960692024 | |||
| 2534 | 2960696371 | |||
| 2535 | 2964610231 | |||
| 2536 | 2964620008 | |||
| 2537 | 2964627807 | |||
| 2538 | 2964633117 | |||
| 2539 | 2964641282 | |||
| 2540 | 2964646161 | |||
| 2541 | 2964653103 | |||
| 2542 | 2964661884 | |||
| 2543 | 2964665972 | |||
| 2544 | 2964671686 | |||
| 2545 | 2964681098 | |||
| 2546 | 2964688108 | |||
| 2547 | 2964695841 | |||
| 2548 | 2964703595 | |||
| 2549 | 2964708094 | |||
| 2550 | 2964716299 | |||
| 2551 | 2964726457 | |||
| 2552 | 2967667371 | |||
| 2553 | 2967672144 | |||
| 2554 | 2967681043 | |||
| 2555 | 2967686413 | |||
| 2556 | 2967693246 | |||
| 2557 | 2967704240 | |||
| 2558 | 2967712948 | |||
| 2559 | 2967716529 | |||
| 2560 | 2967724587 | |||
| 2561 | 2967734737 | |||
| 2562 | 2967737580 | |||
| 2563 | 2967747873 | |||
| 2564 | 2967752105 | |||
| 2565 | 2967756314 | |||
| 2566 | 2967764431 | |||
| 2567 | 2967770792 | |||
| 2568 | 2967782177 | |||
| 2569 | 2970026071 | |||
| 2570 | 2970031791 | |||
| 2571 | 2970037802 | |||
| 2572 | 2970043285 | |||
| 2573 | 2970052887 | |||
| 2574 | 2970059608 | |||
| 2575 | 2970065294 | |||
| 2576 | 2970069514 | |||
| 2577 | 2970076969 | |||
| 2578 | 2970085648 | |||
| 2579 | 2970093308 | |||
| 2580 | 2970096866 | |||
| 2581 | 2970106929 | |||
| 2582 | 2970109819 | |||
| 2583 | 2970117968 | |||
| 2584 | 2970124461 | |||
| 2585 | 2970129518 | |||
| 2586 | 2970143150 | |||
| 2587 | 2970148648 | |||
| 2588 | 2970153814 | |||
| 2589 | 2970163692 | |||
| 2590 | 2970167504 | |||
| 2591 | 2970171794 | |||
| 2592 | 2970182814 | |||
| 2593 | 2970188255 | |||
| 2594 | 2970198324 | |||
| 2595 | 2977518434 | |||
| 2596 | 2977527656 | |||
| 2597 | 2977531897 | |||
| 2598 | 2977537989 | |||
| 2599 | 2977544930 | |||
| 2600 | 2977551987 | |||
| 2601 | 2977561672 | |||
| 2602 | 2977568982 | |||
| 2603 | 2977578961 | |||
| 2604 | 2977581494 | |||
| 2605 | 3005415621 | |||
| 2606 | 639649880 | |||
| 2607 | 643825045 | |||
| 2608 | 648736366 | |||
| 2609 | 8003992945 | |||
| 2610 | 8004000181 | |||
| 2611 | 8005294413 | |||
| 2612 | 8005310832 | |||
| 2613 | 8005378316 | |||
| 2614 | 8005383961 | |||
| 2615 | 8005401289 | |||
| 2616 | 8005558509 | |||
| 2617 | 8005566647 | |||
| 2618 | 8005575064 | |||
| 2619 | 8018133735 | |||
| 2620 | 8018170091 | |||
| 2621 | 8024481658 | |||
| 2622 | 8055911039 | |||
| 2623 | 8056381461 | |||
| 2624 | 8057876697 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9328 | 5 | 92 |
| 1wq2-assembly1.cif.gz_A | neutron crystal structure of dissimilatory sulfite reductase d (dsrd) | 0.9266 | 16 | 74 |
| 8iuh-assembly1.cif.gz_P | rna polymerase iii pre-initiation complex open complex 1 | 0.9228 | 17 | 74 |
| 7p6f-assembly2.cif.gz_CCC-2 | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9212 | 1 | 93 |
| 3f6o-assembly1.cif.gz_B | crystal structure of arsr family transcriptional regulator, rha00566 | 0.9164 | 6 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wq2A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9266 | 16 | 74 | 1.10.10.10 |
| af_D3ZQ56_68_132_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9254 | 17 | 75 | 1.10.10.10 |
| 3f6oB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9164 | 6 | 92 | 1.10.10.10 |
| 1sd6A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9153 | 16 | 75 | 1.10.10.10 |
| af_Q9VD25_2_64_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9126 | 17 | 75 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A532DH07-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9871 | 1 | 83 |
GO:0003700
|
| AF-A0A3S1TWI8-F1-model_v4 | deleted | 0.9776 | 1 | 91 |
|
| AF-A0A4Q5ZG98-F1-model_v4 | deleted | 0.9712 | 1 | 81 |
|
| AF-A0A7C3DR54-F1-model_v4 | ArsR family transcriptional regulator | 0.9676 | 5 | 84 |
GO:0003700
|
| AF-M6KC98-F1-model_v4 | DNA-binding helix-turn-helix protein | 0.9664 | 1 | 75 |
GO:0003677
GO:0003700 |