F492883

General Info

Members Datasets Scaffolds Average Seq Length
1312 673 2624 110

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100365714|Ga0068858_1003657143
Length 128
Sequence MAPDMLYFYNMSNPENVPPNAISEQQDRVFRALASHHRRAILDVLRDQPLTTGALCAQFLELDRCTVMQHLKVLEAADLIIAERKGRERWNHLNPLPIHAIHERWIGPHAERAVAMLARLKHDLEKSG

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
111 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
114 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
115 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
116 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
117 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
118 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
173 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
180 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
197 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
207 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
210 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
211 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
212 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
213 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
216 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
219 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
220 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
223 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
224 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
225 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
226 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
227 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
228 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
229 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
233 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
240 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
241 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
242 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
243 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
264 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
265 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
266 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
285 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
308 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
309 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
310 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
313 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
314 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
315 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
316 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
330 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
331 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
332 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
333 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
334 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
335 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
336 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
337 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
338 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
339 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
340 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
341 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
342 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
343 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
344 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
345 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
346 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
347 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
348 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
349 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
353 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
354 2509276019 Ensifer aridi TW10 Isolate Nodule
355 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
356 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
357 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
358 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
359 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
360 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
361 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
362 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
363 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
364 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
365 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
366 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
367 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
368 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
369 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
370 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
371 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
372 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
373 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
374 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
375 2516143018 Ensifer sp. BR816 Isolate Nodule
376 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
377 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
378 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
379 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
380 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
381 2519899620 Rhizobium sp. Pop5 Isolate Nodule
382 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
383 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
384 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
385 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
386 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
387 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
388 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
389 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
390 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
391 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
392 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
393 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
394 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
395 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
396 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
397 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
398 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
399 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
400 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
401 2643221580 Devosia sp. Root635 Isolate Unclassified
402 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
403 2643221618 Ensifer sp. Root231 Isolate Unclassified
404 2643221626 Ensifer sp. Root31 Isolate Unclassified
405 2643221640 Caulobacter sp. Root342 Isolate Unclassified
406 2643221642 Caulobacter sp. Root343 Isolate Unclassified
407 2643221655 Ensifer sp. Root1252 Isolate Unclassified
408 2643221659 Ensifer sp. Root127 Isolate Unclassified
409 2643221688 Rhizobium sp. Root482 Isolate Unclassified
410 2643221698 Ensifer sp. Root142 Isolate Unclassified
411 2643221712 Ensifer sp. Root258 Isolate Unclassified
412 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
413 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
414 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
415 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
416 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
417 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
418 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
419 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
420 2791355260 Rhizobium sp. L9 Isolate Nodule
421 2791355261 Rhizobium sp. J15 Isolate Nodule
422 2791355266 Rhizobium sp. L43 Isolate Nodule
423 2791355267 Rhizobium sp. L18 Isolate Nodule
424 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
425 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
426 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
427 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
428 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
429 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
430 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
431 2802429633 Rhizobium anhuiense J3 Isolate Nodule
432 2802429634 Rhizobium anhuiense S10 Isolate Nodule
433 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
434 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
435 2802429637 Rhizobium anhuiense C15 Isolate Nodule
436 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
437 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
438 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
439 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
440 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
441 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
442 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
443 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
444 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
445 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
446 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
447 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
448 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
449 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
450 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
451 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
452 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
453 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
454 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
455 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
456 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
457 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
458 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
459 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
460 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
461 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
462 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
463 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
464 2844163670 Ensifer sp. 1H6 Isolate Unclassified
465 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
466 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
467 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
468 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
469 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
470 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
471 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
472 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
473 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
474 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
475 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
476 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
477 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
478 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
479 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
480 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
481 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
482 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
483 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
484 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
485 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
486 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
487 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
488 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
489 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
490 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
491 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
492 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
493 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
494 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
495 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
496 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
497 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
498 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
499 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
500 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
501 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
502 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
503 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
504 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
505 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
506 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
507 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
508 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
509 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
510 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
511 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
512 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
513 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
514 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
515 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
516 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
517 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
518 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
519 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
520 2932401849 Devosia sp. 2618 Isolate Rhizosphere
521 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
522 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
523 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
524 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
525 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
526 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
527 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
528 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
529 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
530 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
531 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
532 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
533 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
534 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
535 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
536 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
537 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
538 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
539 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
540 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
541 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
542 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
543 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
544 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
545 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
546 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
547 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
548 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
549 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
550 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
551 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
552 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
553 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
554 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
555 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
556 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
557 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
558 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
559 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
560 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
561 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
562 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
563 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
564 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
565 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
566 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
567 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
568 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
569 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
570 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
571 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
572 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
573 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
574 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
575 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
576 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
577 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
578 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
579 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
580 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
581 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
582 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
583 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
584 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
585 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
586 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
587 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
588 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
589 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
590 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
591 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
592 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
593 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
594 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
595 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
596 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
597 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
598 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
599 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
600 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
601 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
602 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
603 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
604 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
605 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
606 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
607 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
608 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
609 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
610 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
611 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
612 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
613 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
614 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
615 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
616 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
617 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
618 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
619 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
620 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
621 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
622 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
623 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
624 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
625 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
626 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
627 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
628 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
629 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
630 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
631 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
632 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
633 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
634 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
635 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
636 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
637 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
638 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
639 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
640 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
641 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
642 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
643 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
644 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
645 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
646 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
647 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
648 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
649 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
650 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
651 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
652 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
653 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
654 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
655 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
656 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
657 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
658 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
659 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
660 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
661 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
662 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
663 8005382845 Rhizobium sp. R634 Isolate Nodule
664 8005395548 Rhizobium sp. R339 Isolate Nodule
665 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
666 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
667 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
668 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
669 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
670 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
671 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
672 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
673 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.46
Metatranscriptomes 0
Isolates 24.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.82
Nodule 22.33
Rhizoplane 1.52
Rhizosphere 60.06
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100365714 3300005842 Bacteria 1383
2 MBSR1b_contig_10712157 2162886012 Bacteria 939
3 LJQas_1038148 3300000549 Unclassified 567
4 JGI24740J21852_10001351 3300001979 Bacteria 11185
5 JGI24034J26672_10118856 3300002239 Unclassified 510
6 JGI24751J29686_10031269 3300002459 Bacteria 1104
7 JGI24751J29686_10090805 3300002459 Bacteria 635
8 JGI25159J45721_1000002 3300002987 Bacteria 289163
9 JGI25151J46595_10161566 3300003187 Bacteria 526
10 JGI25165J46597_1000947 3300003214 Bacteria 19871
11 JGI25153J46596_10100412 3300003215 Bacteria 681
12 rootL2_10188392 3300003322 Bacteria 2058
13 rootH1_10287281 3300003323 Bacteria 2386
14 JGI25160J50197_1000008 3300003354 Bacteria 289163
15 JGI25161J50226_1000380 3300003374 Bacteria 22370
16 Ga0055526_1001532 3300003771 Bacteria 16363
17 Ga0055526_1020128 3300003771 Bacteria 2393
18 Ga0055524_1012523 3300003775 Bacteria 3252
19 Ga0055536_1002254 3300003781 Bacteria 10976
20 Ga0055536_1006080 3300003781 Bacteria 5721
21 Ga0055536_1009138 3300003781 Bacteria 4149
22 Ga0055528_1000695 3300003790 Bacteria 23949
23 Ga0055530_10001655 3300003791 Bacteria 15864
24 Ga0055530_10028298 3300003791 Bacteria 1515
25 Ga0055540_1000752 3300003792 Bacteria 21989
26 Ga0055531_10000858 3300003794 Bacteria 24934
27 Ga0055531_10001722 3300003794 Bacteria 15672
28 Ga0055531_10021163 3300003794 Bacteria 2537
29 Ga0055531_10026168 3300003794 Bacteria 2090
30 Ga0055531_10042449 3300003794 Bacteria 1300
31 Ga0055543_1001421 3300004625 Bacteria 9510
32 Ga0065165_1000015 3300005262 Bacteria 289201
33 Ga0065704_10095207 3300005289 Unclassified 2500
34 Ga0065704_10290897 3300005289 Bacteria 904
35 Ga0065712_10072765 3300005290 Bacteria 4625
36 Ga0065715_10070852 3300005293 Bacteria 735
37 Ga0065715_10115519 3300005293 Bacteria 2412
38 Ga0065715_10233704 3300005293 Bacteria 1224
39 Ga0065715_10448940 3300005293 Bacteria 821
40 Ga0065707_10190157 3300005295 Bacteria 1366
41 Ga0070658_10024500 3300005327 Bacteria 4840
42 Ga0070658_10031287 3300005327 Bacteria 4273
43 Ga0070676_10064522 3300005328 Bacteria 2184
44 Ga0070676_10119508 3300005328 Bacteria 1652
45 Ga0070676_10748776 3300005328 Bacteria 717
46 Ga0070683_102442811 3300005329 Bacteria 501
47 Ga0070670_100000350 3300005331 Bacteria 38698
48 Ga0070670_100010030 3300005331 Bacteria 8084
49 Ga0070670_100021035 3300005331 Bacteria 5610
50 Ga0070670_100039511 3300005331 Bacteria 4057
51 Ga0070670_100087996 3300005331 Bacteria 2670
52 Ga0070670_100380736 3300005331 Bacteria 1243
53 Ga0070670_100508862 3300005331 Bacteria 1071
54 Ga0070677_10000600 3300005333 Bacteria 12160
55 Ga0070677_10037260 3300005333 Bacteria 1896
56 Ga0070677_10039893 3300005333 Bacteria 1845
57 Ga0070677_10333296 3300005333 Bacteria 781
58 Ga0070677_10788663 3300005333 Bacteria 542
59 Ga0068869_100300833 3300005334 Unclassified 1295
60 Ga0068869_100626883 3300005334 Bacteria 911
61 Ga0068869_100856082 3300005334 Bacteria 784
62 Ga0068869_100898790 3300005334 Bacteria 766
63 Ga0068869_101021888 3300005334 Bacteria 720
64 Ga0068868_100698703 3300005338 Bacteria 907
65 Ga0068868_101436812 3300005338 Bacteria 644
66 Ga0070660_100060990 3300005339 Bacteria 2928
67 Ga0070660_100121687 3300005339 Bacteria 2083
68 Ga0070660_100535787 3300005339 Bacteria 976
69 Ga0070660_100935085 3300005339 Bacteria 732
70 Ga0070660_101513291 3300005339 Bacteria 571
71 Ga0070689_101453634 3300005340 Bacteria 620
72 Ga0070689_101510986 3300005340 Bacteria 608
73 Ga0070691_10664597 3300005341 Bacteria 622
74 Ga0070687_100858606 3300005343 Bacteria 648
75 Ga0070661_100120387 3300005344 Bacteria 1966
76 Ga0070661_100123269 3300005344 Bacteria 1942
77 Ga0070668_100024369 3300005347 Bacteria 4584
78 Ga0070668_100027061 3300005347 Bacteria 4352
79 Ga0070668_100029010 3300005347 Bacteria 4200
80 Ga0070668_100038020 3300005347 Bacteria 3677
81 Ga0070669_100009774 3300005353 Bacteria 6832
82 Ga0070669_100044937 3300005353 Bacteria 3218
83 Ga0070669_100173670 3300005353 Bacteria 1682
84 Ga0070669_100307933 3300005353 Bacteria 1276
85 Ga0070675_100001857 3300005354 Bacteria 15581
86 Ga0070675_100002352 3300005354 Bacteria 14063
87 Ga0070675_100078800 3300005354 Bacteria 2744
88 Ga0070675_100107929 3300005354 Bacteria 2351
89 Ga0070671_100001032 3300005355 Bacteria 20490
90 Ga0070671_100164090 3300005355 Bacteria 1878
91 Ga0070671_100715480 3300005355 Bacteria 869
92 Ga0070671_100923306 3300005355 Bacteria 763
93 Ga0070674_100003913 3300005356 Bacteria 8432
94 Ga0070674_100020755 3300005356 Bacteria 4205
95 Ga0070674_100027251 3300005356 Bacteria 3743
96 Ga0070674_100073539 3300005356 Bacteria 2423
97 Ga0070674_100701752 3300005356 Bacteria 865
98 Ga0070673_100051731 3300005364 Bacteria 3219
99 Ga0070673_100517358 3300005364 Bacteria 1081
100 Ga0070673_101017085 3300005364 Bacteria 772
101 Ga0070659_100064992 3300005366 Bacteria 2889
102 Ga0070659_100071386 3300005366 Bacteria 2761
103 Ga0070659_100146835 3300005366 Bacteria 1922
104 Ga0070659_100607835 3300005366 Bacteria 940
105 Ga0070659_100849206 3300005366 Bacteria 796
106 Ga0070659_102143984 3300005366 Bacteria 503
107 Ga0070667_100065993 3300005367 Bacteria 3074
108 Ga0070667_100236010 3300005367 Bacteria 1632
109 Ga0070700_100088525 3300005441 Bacteria 2015
110 Ga0070663_100020031 3300005455 Bacteria 4421
111 Ga0070663_100224813 3300005455 Bacteria 1475
112 Ga0070663_100338937 3300005455 Bacteria 1214
113 Ga0070678_101486152 3300005456 Bacteria 634
114 Ga0070678_101636009 3300005456 Bacteria 605
115 Ga0070678_102173511 3300005456 Bacteria 526
116 Ga0070662_100002989 3300005457 Bacteria 10511
117 Ga0070662_100019821 3300005457 Bacteria 4573
118 Ga0070662_100027985 3300005457 Bacteria 3919
119 Ga0070662_100366589 3300005457 Bacteria 1183
120 Ga0070662_100374457 3300005457 Bacteria 1171
121 Ga0070662_100529236 3300005457 Bacteria 986
122 Ga0070662_100875549 3300005457 Bacteria 766
123 Ga0070662_101641616 3300005457 Bacteria 555
124 Ga0068867_100374909 3300005459 Bacteria 1194
125 Ga0068867_100433368 3300005459 Bacteria 1116
126 Ga0068867_101915762 3300005459 Bacteria 559
127 Ga0070685_11056339 3300005466 Bacteria 612
128 Ga0070679_100252500 3300005530 Bacteria 1719
129 Ga0070679_100981335 3300005530 Bacteria 789
130 Ga0068853_100046888 3300005539 Bacteria 3708
131 Ga0068853_100458275 3300005539 Bacteria 1200
132 Ga0068853_100851270 3300005539 Bacteria 875
133 Ga0070672_100005437 3300005543 Bacteria 8443
134 Ga0070672_100017512 3300005543 Bacteria 5160
135 Ga0070672_100098073 3300005543 Bacteria 2373
136 Ga0070672_100169097 3300005543 Bacteria 1817
137 Ga0070672_100371321 3300005543 Bacteria 1222
138 Ga0070672_101968869 3300005543 Bacteria 526
139 Ga0070696_101123912 3300005546 Bacteria 661
140 Ga0070665_100132453 3300005548 Bacteria 2495
141 Ga0068855_100103093 3300005563 Bacteria 3283
142 Ga0068855_100174964 3300005563 Bacteria 2429
143 Ga0068855_100270918 3300005563 Bacteria 1888
144 Ga0070664_100004435 3300005564 Bacteria 11273
145 Ga0070664_100094460 3300005564 Bacteria 2593
146 Ga0070664_101054141 3300005564 Bacteria 765
147 Ga0068857_100045180 3300005577 Bacteria 3907
148 Ga0068854_100199288 3300005578 Bacteria 1573
149 Ga0068854_100225001 3300005578 Bacteria 1486
150 Ga0068856_100103731 3300005614 Bacteria 2837
151 Ga0068859_100523410 3300005617 Bacteria 1281
152 Ga0068864_100035579 3300005618 Bacteria 4240
153 Ga0068864_100545028 3300005618 Bacteria 1120
154 Ga0068864_101211167 3300005618 Bacteria 754
155 Ga0068864_101612833 3300005618 Bacteria 653
156 Ga0068866_10391222 3300005718 Bacteria 894
157 Ga0068861_100231708 3300005719 Bacteria 1567
158 Ga0068861_100847870 3300005719 Bacteria 861
159 Ga0068851_10099229 3300005834 Bacteria 1543
160 Ga0068863_102369896 3300005841 Bacteria 540
161 Ga0068863_102433682 3300005841 Bacteria 533
162 Ga0068858_100747326 3300005842 Bacteria 953
163 Ga0068862_100016627 3300005844 Bacteria 6125
164 Ga0068862_100092388 3300005844 Bacteria 2638
165 Ga0068862_100322624 3300005844 Bacteria 1426
166 Ga0068862_100978530 3300005844 Bacteria 836
167 Ga0068862_101064551 3300005844 Bacteria 802
168 Ga0081455_10244360 3300005937 Bacteria 1317
169 Ga0075365_10001615 3300006038 Bacteria 10391
170 Ga0075365_10006228 3300006038 Bacteria 6542
171 Ga0075365_11007149 3300006038 Bacteria 587
172 Ga0075368_10000318 3300006042 Bacteria 14124
173 Ga0075363_100004443 3300006048 Bacteria 6138
174 Ga0075363_100153476 3300006048 Bacteria 1301
175 Ga0075363_100562892 3300006048 Bacteria 681
176 Ga0075364_10015285 3300006051 Bacteria 4759
177 Ga0075362_10003383 3300006177 Bacteria 5563
178 Ga0075367_10002472 3300006178 Bacteria 8461
179 Ga0075369_10019278 3300006186 Bacteria 2784
180 Ga0075369_10196062 3300006186 Bacteria 931
181 Ga0075369_10389580 3300006186 Bacteria 656
182 Ga0075369_10390163 3300006186 Bacteria 656
183 Ga0075369_10391814 3300006186 Bacteria 654
184 Ga0075366_10153572 3300006195 Bacteria 1394
185 Ga0075366_10809815 3300006195 Bacteria 583
186 Ga0075370_10018867 3300006353 Bacteria 3746
187 Ga0075370_10048468 3300006353 Bacteria 2407
188 Ga0075370_10052920 3300006353 Bacteria 2304
189 Ga0075370_10272970 3300006353 Bacteria 1004
190 Ga0075370_10276764 3300006353 Bacteria 997
191 Ga0075370_10501920 3300006353 Bacteria 732
192 Ga0075428_100676383 3300006844 Bacteria 1100
193 Ga0075431_101097603 3300006847 Bacteria 760
194 Ga0075429_100705294 3300006880 Bacteria 884
195 Ga0075429_101612913 3300006880 Bacteria 564
196 Ga0068865_101821536 3300006881 Bacteria 550
197 Ga0097620_100523434 3300006931 Bacteria 1281
198 Ga0079104_1035919 3300006946 Bacteria 1193
199 Ga0079104_1061617 3300006946 Bacteria 807
200 Ga0111539_10176032 3300009094 Bacteria 2499
201 Ga0111539_10568661 3300009094 Bacteria 1320
202 Ga0111539_10870883 3300009094 Bacteria 1048
203 Ga0111539_11142217 3300009094 Unclassified 905
204 Ga0105245_11074055 3300009098 Bacteria 851
205 Ga0105245_12896207 3300009098 Bacteria 532
206 Ga0114129_12047192 3300009147 Bacteria 692
207 Ga0105243_10129286 3300009148 Bacteria 2141
208 Ga0105243_11069571 3300009148 Bacteria 813
209 Ga0105241_10437784 3300009174 Bacteria 1154
210 Ga0105248_10043271 3300009177 Bacteria 5050
211 Ga0105237_10141188 3300009545 Bacteria 2403
212 Ga0105237_10259227 3300009545 Bacteria 1741
213 Ga0105238_10022705 3300009551 Bacteria 6395
214 Ga0105238_10089554 3300009551 Bacteria 3064
215 Ga0105249_10073177 3300009553 Bacteria 3170
216 Ga0105239_10122221 3300010375 Bacteria 2893
217 Ga0105239_10257858 3300010375 Bacteria 1959
218 Ga0105239_10539227 3300010375 Bacteria 1328
219 Ga0105239_11332316 3300010375 Bacteria 828
220 Ga0105246_10794202 3300011119 Bacteria 839
221 Ga0105246_11870196 3300011119 Bacteria 575
222 Ga0157319_1000957 3300012497 Bacteria 1397
223 Ga0157371_10354253 3300013102 Bacteria 1069
224 Ga0157370_10124553 3300013104 Bacteria 2406
225 Ga0157370_10920463 3300013104 Bacteria 793
226 Ga0157369_10021987 3300013105 Bacteria 7128
227 Ga0171463_1001 3300013249 Bacteria 1406070
228 Ga0157374_10234791 3300013296 Bacteria 1802
229 Ga0157374_10382641 3300013296 Bacteria 1402
230 Ga0157378_10517297 3300013297 Bacteria 1194
231 Ga0157378_10668493 3300013297 Bacteria 1056
232 Ga0157378_11457143 3300013297 Bacteria 728
233 Ga0163162_10108677 3300013306 Bacteria 2870
234 Ga0163162_10413313 3300013306 Bacteria 1481
235 Ga0157372_10044754 3300013307 Bacteria 4906
236 Ga0157372_10154906 3300013307 Bacteria 2646
237 Ga0157375_10036695 3300013308 Bacteria 4690
238 Ga0157375_10067258 3300013308 Bacteria 3580
239 Ga0157375_10978857 3300013308 Bacteria 986
240 Ga0157375_11129954 3300013308 Bacteria 918
241 Ga0157375_11835192 3300013308 Bacteria 719
242 Ga0163163_10671575 3300014325 Bacteria 1100
243 Ga0163163_10795752 3300014325 Bacteria 1009
244 Ga0163163_10956203 3300014325 Bacteria 920
245 Ga0157380_10022038 3300014326 Bacteria 4787
246 Ga0157380_10033633 3300014326 Bacteria 3949
247 Ga0157380_10036570 3300014326 Bacteria 3800
248 Ga0157380_10568009 3300014326 Bacteria 1116
249 Ga0157380_10628741 3300014326 Bacteria 1067
250 Ga0157380_10632682 3300014326 Bacteria 1064
251 Ga0157380_11382439 3300014326 Bacteria 754
252 Ga0157380_11660983 3300014326 Bacteria 696
253 Ga0157380_12094252 3300014326 Bacteria 629
254 Ga0183365_12031 3300015684 Bacteria 729
255 Ga0183363_1371 3300015690 Bacteria 4706
256 Ga0163161_10049520 3300017792 Bacteria 3036
257 Ga0163161_10086971 3300017792 Bacteria 2308
258 Ga0163161_10120473 3300017792 Bacteria 1971
259 Ga0163161_11524446 3300017792 Bacteria 587
260 Ga0214544_1009397 3300021320 Bacteria 15366
261 Ga0214542_1000006 3300021321 Bacteria 345164
262 Ga0214542_1016019 3300021321 Bacteria 7491
263 Ga0214543_1000003 3300021327 Bacteria 692327
264 Ga0214543_1000014 3300021327 Bacteria 324986
265 Ga0228711_1000001 3300022739 Bacteria 357377
266 Ga0228710_1000001 3300022740 Bacteria 314328
267 Ga0209436_103040 3300025208 Bacteria 4638
268 Ga0207427_109513 3300025231 Bacteria 1042
269 Ga0209437_100197 3300025233 Bacteria 120813
270 Ga0209233_1000199 3300025261 Bacteria 123684
271 Ga0209673_1000060 3300025273 Bacteria 263602
272 Ga0209673_1001334 3300025273 Bacteria 24685
273 Ga0209130_1000007 3300025284 Bacteria 591584
274 Ga0209130_1020116 3300025284 Bacteria 1533
275 Ga0209675_1000196 3300025291 Bacteria 65422
276 Ga0209676_1000518 3300025292 Bacteria 60512
277 Ga0209676_1000554 3300025292 Bacteria 56925
278 Ga0209676_1000901 3300025292 Bacteria 37489
279 Ga0209676_1000929 3300025292 Bacteria 36184
280 Ga0209676_1020890 3300025292 Bacteria 2210
281 Ga0209676_1030163 3300025292 Bacteria 1662
282 Ga0209025_1000100 3300025294 Bacteria 229182
283 Ga0209025_1006572 3300025294 Bacteria 8964
284 Ga0209025_1030058 3300025294 Bacteria 2610
285 Ga0209025_1059964 3300025294 Bacteria 1432
286 Ga0209564_1000116 3300025295 Bacteria 207889
287 Ga0209564_1000439 3300025295 Bacteria 71637
288 Ga0209758_1002301 3300025297 Bacteria 19751
289 Ga0209758_1025297 3300025297 Bacteria 2609
290 Ga0209758_1033930 3300025297 Bacteria 2040
291 Ga0209050_1000017 3300025298 Bacteria 728928
292 Ga0209050_1001222 3300025298 Bacteria 29857
293 Ga0209050_1008085 3300025298 Bacteria 5710
294 Ga0209050_1009017 3300025298 Bacteria 5194
295 Ga0209050_1021935 3300025298 Bacteria 2307
296 Ga0209050_1029701 3300025298 Bacteria 1741
297 Ga0209050_1067080 3300025298 Bacteria 819
298 Ga0209256_1000302 3300025299 Bacteria 86634
299 Ga0209256_1001410 3300025299 Bacteria 24985
300 Ga0209256_1001505 3300025299 Bacteria 23627
301 Ga0207426_1000064 3300025302 Bacteria 358276
302 Ga0209051_1000217 3300025303 Bacteria 97218
303 Ga0209051_1001024 3300025303 Bacteria 26621
304 Ga0209051_1002714 3300025303 Bacteria 12314
305 Ga0209257_1001405 3300025304 Bacteria 28723
306 Ga0209257_1002894 3300025304 Bacteria 15934
307 Ga0209257_1004371 3300025304 Bacteria 10994
308 Ga0209257_1005509 3300025304 Bacteria 8841
309 Ga0209257_1006913 3300025304 Bacteria 7096
310 Ga0209257_1032597 3300025304 Bacteria 1649
311 Ga0209257_1069401 3300025304 Bacteria 933
312 Ga0209257_1104677 3300025304 Bacteria 684
313 Ga0207697_10003012 3300025315 Bacteria 8476
314 Ga0207697_10181534 3300025315 Bacteria 922
315 Ga0207697_10193631 3300025315 Bacteria 893
316 Ga0207682_10002530 3300025893 Bacteria 8177
317 Ga0207682_10059152 3300025893 Bacteria 1601
318 Ga0207682_10425647 3300025893 Bacteria 628
319 Ga0207688_10050599 3300025901 Bacteria 2326
320 Ga0207688_10372485 3300025901 Bacteria 882
321 Ga0207645_10005867 3300025907 Bacteria 8845
322 Ga0207645_10100033 3300025907 Bacteria 1870
323 Ga0207645_10381462 3300025907 Bacteria 946
324 Ga0207645_10896506 3300025907 Bacteria 602
325 Ga0207705_10001064 3300025909 Bacteria 22327
326 Ga0207705_10067557 3300025909 Bacteria 2587
327 Ga0207705_10073195 3300025909 Bacteria 2486
328 Ga0207695_10157189 3300025913 Bacteria 2208
329 Ga0207671_10589513 3300025914 Bacteria 886
330 Ga0207657_10015490 3300025919 Bacteria 7386
331 Ga0207657_10123293 3300025919 Bacteria 2130
332 Ga0207657_10237211 3300025919 Bacteria 1457
333 Ga0207657_10359041 3300025919 Bacteria 1149
334 Ga0207657_10580238 3300025919 Bacteria 876
335 Ga0207649_10007890 3300025920 Bacteria 5792
336 Ga0207649_10105896 3300025920 Bacteria 1870
337 Ga0207649_10631175 3300025920 Bacteria 826
338 Ga0207649_10854948 3300025920 Bacteria 712
339 Ga0207652_10006724 3300025921 Bacteria 9266
340 Ga0207652_10068552 3300025921 Bacteria 3078
341 Ga0207681_10005401 3300025923 Bacteria 7849
342 Ga0207681_10114929 3300025923 Bacteria 1964
343 Ga0207681_10191695 3300025923 Bacteria 1564
344 Ga0207681_10437430 3300025923 Bacteria 1062
345 Ga0207681_10475544 3300025923 Bacteria 1020
346 Ga0207681_10906585 3300025923 Bacteria 738
347 Ga0207681_11481303 3300025923 Bacteria 569
348 Ga0207650_10000916 3300025925 Bacteria 22264
349 Ga0207650_10004697 3300025925 Bacteria 9334
350 Ga0207650_10017569 3300025925 Bacteria 5009
351 Ga0207650_10041076 3300025925 Bacteria 3387
352 Ga0207650_10141041 3300025925 Bacteria 1894
353 Ga0207650_10164481 3300025925 Bacteria 1760
354 Ga0207650_10251599 3300025925 Bacteria 1431
355 Ga0207659_10002256 3300025926 Bacteria 11474
356 Ga0207659_10005898 3300025926 Bacteria 7478
357 Ga0207659_10049103 3300025926 Bacteria 2991
358 Ga0207659_10085347 3300025926 Bacteria 2345
359 Ga0207687_11196681 3300025927 Bacteria 653
360 Ga0207644_10009825 3300025931 Bacteria 6293
361 Ga0207644_10604869 3300025931 Bacteria 910
362 Ga0207644_11117396 3300025931 Bacteria 662
363 Ga0207644_11681229 3300025931 Bacteria 532
364 Ga0207690_10037801 3300025932 Bacteria 3137
365 Ga0207690_10198044 3300025932 Bacteria 1523
366 Ga0207690_10215011 3300025932 Bacteria 1468
367 Ga0207690_11229462 3300025932 Bacteria 626
368 Ga0207706_10045319 3300025933 Bacteria 3897
369 Ga0207706_10088024 3300025933 Bacteria 2731
370 Ga0207706_10247681 3300025933 Bacteria 1557
371 Ga0207706_10311009 3300025933 Bacteria 1372
372 Ga0207706_10323824 3300025933 Bacteria 1341
373 Ga0207706_10501988 3300025933 Bacteria 1047
374 Ga0207706_10599913 3300025933 Bacteria 946
375 Ga0207706_10746090 3300025933 Bacteria 834
376 Ga0207706_10776213 3300025933 Bacteria 815
377 Ga0207709_10154504 3300025935 Bacteria 1593
378 Ga0207669_10036896 3300025937 Bacteria 2798
379 Ga0207669_10037527 3300025937 Bacteria 2781
380 Ga0207669_10075641 3300025937 Bacteria 2134
381 Ga0207669_10344178 3300025937 Bacteria 1149
382 Ga0207669_10516271 3300025937 Bacteria 959
383 Ga0207669_10578841 3300025937 Bacteria 910
384 Ga0207669_10645267 3300025937 Bacteria 865
385 Ga0207691_10006503 3300025940 Bacteria 11284
386 Ga0207691_10015470 3300025940 Bacteria 7253
387 Ga0207691_10146413 3300025940 Bacteria 2079
388 Ga0207691_11546050 3300025940 Bacteria 541
389 Ga0207711_10101908 3300025941 Bacteria 2541
390 Ga0207661_11566308 3300025944 Bacteria 603
391 Ga0207679_10015840 3300025945 Bacteria 4995
392 Ga0207679_10047566 3300025945 Bacteria 3117
393 Ga0207679_10137679 3300025945 Bacteria 1968
394 Ga0207679_10257464 3300025945 Bacteria 1487
395 Ga0207679_10916415 3300025945 Bacteria 802
396 Ga0207667_10004509 3300025949 Bacteria 17062
397 Ga0207667_10068990 3300025949 Bacteria 3680
398 Ga0207651_10040548 3300025960 Bacteria 3082
399 Ga0207651_10372654 3300025960 Bacteria 1208
400 Ga0207651_10706277 3300025960 Bacteria 889
401 Ga0207651_10782897 3300025960 Bacteria 845
402 Ga0207712_10026570 3300025961 Bacteria 3858
403 Ga0207712_10317656 3300025961 Bacteria 1284
404 Ga0207668_10019850 3300025972 Bacteria 4258
405 Ga0207668_10051999 3300025972 Bacteria 2833
406 Ga0207668_10053537 3300025972 Bacteria 2797
407 Ga0207668_10126134 3300025972 Bacteria 1947
408 Ga0207640_10130945 3300025981 Bacteria 1813
409 Ga0207640_10216336 3300025981 Bacteria 1464
410 Ga0207658_10065281 3300025986 Bacteria 2733
411 Ga0207658_10082351 3300025986 Bacteria 2471
412 Ga0207658_10088112 3300025986 Bacteria 2399
413 Ga0207639_10228607 3300026041 Bacteria 1611
414 Ga0207639_10326200 3300026041 Bacteria 1364
415 Ga0207639_11254500 3300026041 Bacteria 696
416 Ga0207678_10080942 3300026067 Bacteria 2780
417 Ga0207678_10112545 3300026067 Bacteria 2322
418 Ga0207678_10164279 3300026067 Bacteria 1896
419 Ga0207678_10298226 3300026067 Bacteria 1385
420 Ga0207678_10598340 3300026067 Bacteria 967
421 Ga0207678_10616878 3300026067 Bacteria 951
422 Ga0207708_10149073 3300026075 Bacteria 1840
423 Ga0207708_10494553 3300026075 Bacteria 1024
424 Ga0207702_10489169 3300026078 Bacteria 1198
425 Ga0207702_11310573 3300026078 Bacteria 718
426 Ga0207648_10223064 3300026089 Bacteria 1675
427 Ga0207676_10037982 3300026095 Bacteria 3674
428 Ga0207676_10084122 3300026095 Bacteria 2593
429 Ga0207676_10909574 3300026095 Bacteria 863
430 Ga0207674_10155258 3300026116 Bacteria 2244
431 Ga0207674_10317937 3300026116 Bacteria 1506
432 Ga0207674_10354615 3300026116 Bacteria 1418
433 Ga0207675_100036255 3300026118 Bacteria 4601
434 Ga0207675_100913085 3300026118 Bacteria 895
435 Ga0207698_10172821 3300026142 Bacteria 1905
436 Ga0207698_11035642 3300026142 Bacteria 832
437 Ga0209281_1000164 3300027111 Bacteria 157372
438 Ga0209281_1000332 3300027111 Bacteria 81534
439 Ga0209281_1026144 3300027111 Bacteria 1082
440 Ga0209282_1000007 3300027666 Bacteria 254917
441 Ga0209813_10000060 3300027866 Bacteria 44068
442 Ga0207428_10893559 3300027907 Bacteria 628
443 Ga0268266_10137298 3300028379 Bacteria 2191
444 Ga0268266_10291785 3300028379 Bacteria 1519
445 Ga0268266_10615116 3300028379 Bacteria 1044
446 Ga0268265_10003419 3300028380 Bacteria 11426
447 Ga0268265_10029713 3300028380 Bacteria 3928
448 Ga0268265_10088850 3300028380 Bacteria 2463
449 Ga0268265_10211716 3300028380 Bacteria 1689
450 Ga0268265_10337359 3300028380 Bacteria 1371
451 Ga0268265_10988257 3300028380 Bacteria 831
452 Ga0268265_11027405 3300028380 Bacteria 815
453 Ga0307517_10663691 3300028786 Bacteria 506
454 Ga0316183_1130216 3300030742 Bacteria 1152
455 Ga0316182_1057985 3300030745 Bacteria 1542
456 Ga0316182_1346917 3300030745 Bacteria 545
457 Ga0265327_10205876 3300031251 Bacteria 889
458 Ga0307408_100014062 3300031548 Bacteria 5316
459 Ga0307408_100014343 3300031548 Bacteria 5264
460 Ga0307408_100051353 3300031548 Bacteria 2970
461 Ga0307408_100205582 3300031548 Bacteria 1597
462 Ga0307408_100284185 3300031548 Bacteria 1379
463 Ga0307408_100506918 3300031548 Bacteria 1057
464 Ga0307408_100940828 3300031548 Bacteria 793
465 Ga0307408_100978124 3300031548 Bacteria 779
466 Ga0307408_101310604 3300031548 Unclassified 679
467 Ga0307508_10617556 3300031616 Bacteria 687
468 Ga0307405_10028431 3300031731 Bacteria 3256
469 Ga0307405_10150063 3300031731 Bacteria 1637
470 Ga0307405_10171440 3300031731 Bacteria 1548
471 Ga0307405_10175716 3300031731 Bacteria 1532
472 Ga0307405_10218556 3300031731 Bacteria 1396
473 Ga0307405_10237047 3300031731 Bacteria 1349
474 Ga0307405_10450756 3300031731 Bacteria 1020
475 Ga0307405_10478248 3300031731 Bacteria 994
476 Ga0307405_10532523 3300031731 Bacteria 947
477 Ga0307405_10552705 3300031731 Bacteria 932
478 Ga0307405_10654518 3300031731 Bacteria 864
479 Ga0307405_10991783 3300031731 Bacteria 716
480 Ga0307405_11077023 3300031731 Bacteria 690
481 Ga0307405_11159996 3300031731 Bacteria 666
482 Ga0307405_11937040 3300031731 Bacteria 526
483 Ga0307405_11973666 3300031731 Bacteria 522
484 Ga0307413_10007256 3300031824 Bacteria 5130
485 Ga0307413_10008368 3300031824 Bacteria 4880
486 Ga0307413_10010474 3300031824 Bacteria 4500
487 Ga0307413_10019834 3300031824 Bacteria 3562
488 Ga0307413_10022551 3300031824 Bacteria 3395
489 Ga0307413_10027919 3300031824 Bacteria 3135
490 Ga0307413_10043051 3300031824 Bacteria 2658
491 Ga0307413_10098545 3300031824 Bacteria 1925
492 Ga0307413_10111022 3300031824 Bacteria 1835
493 Ga0307413_10138431 3300031824 Bacteria 1678
494 Ga0307413_10178685 3300031824 Bacteria 1510
495 Ga0307413_10286121 3300031824 Bacteria 1242
496 Ga0307413_10316911 3300031824 Bacteria 1190
497 Ga0307413_10329468 3300031824 Bacteria 1170
498 Ga0307413_10370861 3300031824 Bacteria 1112
499 Ga0307413_10560691 3300031824 Bacteria 928
500 Ga0307413_10728860 3300031824 Bacteria 826
501 Ga0307413_11162028 3300031824 Bacteria 669
502 Ga0307413_11438799 3300031824 Bacteria 607
503 Ga0307413_11877905 3300031824 Bacteria 538
504 Ga0307410_10001306 3300031852 Bacteria 11134
505 Ga0307410_10002517 3300031852 Bacteria 8864
506 Ga0307410_10006279 3300031852 Bacteria 6401
507 Ga0307410_10016162 3300031852 Bacteria 4444
508 Ga0307410_10023487 3300031852 Bacteria 3834
509 Ga0307410_10025207 3300031852 Bacteria 3727
510 Ga0307410_10026018 3300031852 Bacteria 3678
511 Ga0307410_10073764 3300031852 Bacteria 2374
512 Ga0307410_10074789 3300031852 Bacteria 2360
513 Ga0307410_10075397 3300031852 Bacteria 2351
514 Ga0307410_10084136 3300031852 Bacteria 2242
515 Ga0307410_10085590 3300031852 Bacteria 2225
516 Ga0307410_10096733 3300031852 Bacteria 2108
517 Ga0307410_10127116 3300031852 Bacteria 1867
518 Ga0307410_10140780 3300031852 Bacteria 1784
519 Ga0307410_10187292 3300031852 Bacteria 1571
520 Ga0307410_10392738 3300031852 Bacteria 1119
521 Ga0307410_10422442 3300031852 Bacteria 1081
522 Ga0307410_10499925 3300031852 Bacteria 1000
523 Ga0307410_10557598 3300031852 Bacteria 950
524 Ga0307410_10672132 3300031852 Bacteria 870
525 Ga0307410_10710187 3300031852 Bacteria 848
526 Ga0307410_10781805 3300031852 Bacteria 810
527 Ga0307410_11357223 3300031852 Bacteria 623
528 Ga0307410_11860803 3300031852 Bacteria 535
529 Ga0307406_10042227 3300031901 Bacteria 2846
530 Ga0307406_10042588 3300031901 Bacteria 2835
531 Ga0307406_10056261 3300031901 Bacteria 2518
532 Ga0307406_10099950 3300031901 Bacteria 1973
533 Ga0307406_10198552 3300031901 Bacteria 1474
534 Ga0307406_10284792 3300031901 Bacteria 1262
535 Ga0307406_10310536 3300031901 Unclassified 1215
536 Ga0307406_10359750 3300031901 Bacteria 1140
537 Ga0307406_10404327 3300031901 Bacteria 1083
538 Ga0307406_10405980 3300031901 Bacteria 1081
539 Ga0307406_10451414 3300031901 Bacteria 1031
540 Ga0307406_10544977 3300031901 Bacteria 948
541 Ga0307406_10793946 3300031901 Bacteria 798
542 Ga0307406_10951626 3300031901 Bacteria 734
543 Ga0307406_11047220 3300031901 Bacteria 702
544 Ga0307406_11144917 3300031901 Bacteria 673
545 Ga0307406_11200408 3300031901 Bacteria 659
546 Ga0307406_11201478 3300031901 Bacteria 658
547 Ga0307407_10002403 3300031903 Bacteria 7314
548 Ga0307407_10030175 3300031903 Bacteria 2922
549 Ga0307407_10284270 3300031903 Bacteria 1147
550 Ga0307407_10329137 3300031903 Bacteria 1075
551 Ga0307407_10333136 3300031903 Bacteria 1069
552 Ga0307407_10339967 3300031903 Bacteria 1059
553 Ga0307407_10342885 3300031903 Bacteria 1055
554 Ga0307407_10384831 3300031903 Bacteria 1002
555 Ga0307407_10557376 3300031903 Bacteria 848
556 Ga0307407_10594231 3300031903 Bacteria 823
557 Ga0307407_10758836 3300031903 Bacteria 735
558 Ga0307407_10923648 3300031903 Bacteria 671
559 Ga0307407_10948066 3300031903 Bacteria 662
560 Ga0307412_10019162 3300031911 Bacteria 4136
561 Ga0307412_10030284 3300031911 Bacteria 3406
562 Ga0307412_10046470 3300031911 Bacteria 2845
563 Ga0307412_10046997 3300031911 Bacteria 2832
564 Ga0307412_10053016 3300031911 Bacteria 2688
565 Ga0307412_10159729 3300031911 Bacteria 1673
566 Ga0307412_10308610 3300031911 Bacteria 1253
567 Ga0307412_10342024 3300031911 Bacteria 1198
568 Ga0307412_10382225 3300031911 Bacteria 1140
569 Ga0307412_10434754 3300031911 Bacteria 1077
570 Ga0307412_10483313 3300031911 Bacteria 1027
571 Ga0307412_10580729 3300031911 Bacteria 946
572 Ga0307412_10771205 3300031911 Bacteria 832
573 Ga0307412_10863175 3300031911 Bacteria 790
574 Ga0307412_11060993 3300031911 Bacteria 719
575 Ga0307412_11220739 3300031911 Bacteria 674
576 Ga0307412_11442023 3300031911 Bacteria 624
577 Ga0307412_11501969 3300031911 Unclassified 612
578 Ga0307412_11557808 3300031911 Bacteria 602
579 Ga0315914_1000006 3300031967 Bacteria 239817
580 Ga0307409_100000217 3300031995 Bacteria 22986
581 Ga0307409_100004848 3300031995 Bacteria 7639
582 Ga0307409_100035151 3300031995 Bacteria 3668
583 Ga0307409_100036117 3300031995 Bacteria 3628
584 Ga0307409_100082523 3300031995 Bacteria 2602
585 Ga0307409_100108162 3300031995 Bacteria 2325
586 Ga0307409_100135464 3300031995 Bacteria 2113
587 Ga0307409_100154764 3300031995 Bacteria 1996
588 Ga0307409_100154851 3300031995 Bacteria 1995
589 Ga0307409_100191360 3300031995 Bacteria 1821
590 Ga0307409_100224574 3300031995 Bacteria 1698
591 Ga0307409_100281961 3300031995 Bacteria 1536
592 Ga0307409_100405469 3300031995 Bacteria 1303
593 Ga0307409_100453122 3300031995 Bacteria 1239
594 Ga0307409_100454096 3300031995 Bacteria 1237
595 Ga0307409_100524748 3300031995 Bacteria 1157
596 Ga0307409_100569832 3300031995 Bacteria 1114
597 Ga0307409_100650992 3300031995 Bacteria 1047
598 Ga0307409_100656591 3300031995 Bacteria 1043
599 Ga0307409_100693902 3300031995 Bacteria 1016
600 Ga0307409_100823870 3300031995 Bacteria 937
601 Ga0307409_100888193 3300031995 Bacteria 904
602 Ga0307409_101019133 3300031995 Bacteria 846
603 Ga0307409_101619202 3300031995 Unclassified 676
604 Ga0307409_102702423 3300031995 Bacteria 524
605 Ga0307416_100008213 3300032002 Bacteria 6713
606 Ga0307416_100014578 3300032002 Bacteria 5395
607 Ga0307416_100027573 3300032002 Bacteria 4209
608 Ga0307416_100053742 3300032002 Bacteria 3233
609 Ga0307416_100136130 3300032002 Bacteria 2222
610 Ga0307416_100278501 3300032002 Bacteria 1647
611 Ga0307416_100321447 3300032002 Bacteria 1550
612 Ga0307416_100342349 3300032002 Bacteria 1509
613 Ga0307416_100359682 3300032002 Bacteria 1477
614 Ga0307416_100431452 3300032002 Bacteria 1365
615 Ga0307416_100432819 3300032002 Bacteria 1363
616 Ga0307416_100458297 3300032002 Bacteria 1329
617 Ga0307416_100460002 3300032002 Bacteria 1327
618 Ga0307416_100739987 3300032002 Bacteria 1075
619 Ga0307416_100755504 3300032002 Unclassified 1065
620 Ga0307416_100895295 3300032002 Bacteria 987
621 Ga0307416_100960212 3300032002 Bacteria 957
622 Ga0307416_101623611 3300032002 Bacteria 752
623 Ga0307416_101918966 3300032002 Unclassified 695
624 Ga0307416_102131873 3300032002 Bacteria 662
625 Ga0307416_102508581 3300032002 Bacteria 614
626 Ga0307416_103151597 3300032002 Bacteria 552
627 Ga0307416_103752870 3300032002 Bacteria 508
628 Ga0307414_10000346 3300032004 Bacteria 26022
629 Ga0307414_10000797 3300032004 Bacteria 16139
630 Ga0307414_10001040 3300032004 Bacteria 14198
631 Ga0307414_10006477 3300032004 Bacteria 6528
632 Ga0307414_10009428 3300032004 Bacteria 5608
633 Ga0307414_10012420 3300032004 Bacteria 5034
634 Ga0307414_10036346 3300032004 Bacteria 3288
635 Ga0307414_10055229 3300032004 Bacteria 2780
636 Ga0307414_10058244 3300032004 Bacteria 2721
637 Ga0307414_10085171 3300032004 Bacteria 2327
638 Ga0307414_10133550 3300032004 Bacteria 1931
639 Ga0307414_10190603 3300032004 Bacteria 1658
640 Ga0307414_10194198 3300032004 Bacteria 1645
641 Ga0307414_10224063 3300032004 Bacteria 1545
642 Ga0307414_10544913 3300032004 Bacteria 1033
643 Ga0307414_10605597 3300032004 Unclassified 983
644 Ga0307414_10829788 3300032004 Bacteria 844
645 Ga0307414_10998148 3300032004 Bacteria 770
646 Ga0307414_11092276 3300032004 Bacteria 736
647 Ga0307414_11232535 3300032004 Bacteria 693
648 Ga0307414_12134026 3300032004 Bacteria 523
649 Ga0307414_12168157 3300032004 Bacteria 519
650 Ga0307411_10000748 3300032005 Bacteria 11981
651 Ga0307411_10001464 3300032005 Bacteria 9682
652 Ga0307411_10003067 3300032005 Bacteria 7633
653 Ga0307411_10006109 3300032005 Bacteria 5991
654 Ga0307411_10009598 3300032005 Bacteria 5102
655 Ga0307411_10027126 3300032005 Bacteria 3460
656 Ga0307411_10029138 3300032005 Bacteria 3367
657 Ga0307411_10044982 3300032005 Bacteria 2836
658 Ga0307411_10108630 3300032005 Bacteria 1979
659 Ga0307411_10135937 3300032005 Bacteria 1805
660 Ga0307411_10138660 3300032005 Bacteria 1790
661 Ga0307411_10191879 3300032005 Bacteria 1561
662 Ga0307411_10222851 3300032005 Bacteria 1464
663 Ga0307411_10244720 3300032005 Bacteria 1406
664 Ga0307411_10256430 3300032005 Bacteria 1378
665 Ga0307411_10409819 3300032005 Bacteria 1123
666 Ga0307411_10480958 3300032005 Bacteria 1046
667 Ga0307411_10484507 3300032005 Bacteria 1042
668 Ga0307411_10500253 3300032005 Bacteria 1027
669 Ga0307411_10536708 3300032005 Bacteria 996
670 Ga0307411_10560322 3300032005 Bacteria 976
671 Ga0307411_10578869 3300032005 Bacteria 962
672 Ga0307411_10671252 3300032005 Bacteria 899
673 Ga0307411_10991978 3300032005 Bacteria 751
674 Ga0307411_11187869 3300032005 Bacteria 691
675 Ga0307411_11263107 3300032005 Bacteria 671
676 Ga0307411_11331501 3300032005 Unclassified 655
677 Ga0307411_11593361 3300032005 Bacteria 602
678 Ga0307411_11645092 3300032005 Bacteria 593
679 Ga0307411_11878271 3300032005 Bacteria 557
680 Ga0307415_100002106 3300032126 Bacteria 9844
681 Ga0307415_100006836 3300032126 Bacteria 6191
682 Ga0307415_100064731 3300032126 Bacteria 2545
683 Ga0307415_100067602 3300032126 Bacteria 2498
684 Ga0307415_100107648 3300032126 Bacteria 2060
685 Ga0307415_100163828 3300032126 Bacteria 1727
686 Ga0307415_100164200 3300032126 Unclassified 1725
687 Ga0307415_100211123 3300032126 Bacteria 1549
688 Ga0307415_100299510 3300032126 Bacteria 1331
689 Ga0307415_100600128 3300032126 Bacteria 980
690 Ga0307415_101131026 3300032126 Bacteria 734
691 Ga0307415_101624711 3300032126 Bacteria 621
692 Ga0307415_101686709 3300032126 Bacteria 611
693 Ga0315913_1000002 3300033430 Bacteria 241452
694 Ga0315915_1000001 3300033464 Bacteria 481518
695 Ga0373941_0270863 3300035115 Bacteria 669
696 Ga0373931_0370185 3300035691 Bacteria 901
697 Ga0395899_0000124 3300037312 Bacteria 122011
698 Ga0395900_0000086 3300037418 Bacteria 171749
699 Ga0395900_0542594 3300037418 Bacteria 1108
700 Ga0395898_0000285 3300037466 Bacteria 122279
701 Ga0395905_0000133 3300037471 Bacteria 123500
702 Ga0395905_0357035 3300037471 Bacteria 1354
703 Ga0395905_0448397 3300037471 Bacteria 1188
704 Ga0395905_0734928 3300037471 Bacteria 889
705 Ga0395905_0738849 3300037471 Bacteria 886
706 Ga0395905_0844519 3300037471 Bacteria 819
707 Ga0395905_0966085 3300037471 Bacteria 755
708 Ga0395901_0000092 3300038443 Bacteria 121976
709 Ga0395901_0623049 3300038443 Bacteria 1085
710 Ga0395901_0996682 3300038443 Bacteria 814
711 Ga0436365_0105016 3300039437 Bacteria 679
712 Ga0439436_0030162 3300041404 Bacteria 1576
713 Ga0439438_024814 3300041405 Bacteria 1639
714 Ga0439465_0011348 3300041413 Bacteria 2796
715 Ga0439465_0053742 3300041413 Bacteria 1324
716 Ga0451791_0343439 3300041451 Bacteria 630
717 Ga0451791_0456541 3300041451 Bacteria 554
718 Ga0451793_0443755 3300041452 Bacteria 517
719 Ga0451807_0663369 3300041486 Bacteria 647
720 Ga0451807_2638188 3300041486 Bacteria 896
721 Ga0451807_2716419 3300041486 Bacteria 593
722 Ga0451835_0321473 3300041492 Bacteria 637
723 Ga0451837_0281783 3300041494 Bacteria 788
724 Ga0451837_0877181 3300041494 Bacteria 589
725 Ga0451837_1015036 3300041494 Bacteria 579
726 Ga0451839_1273499 3300041496 Bacteria 637
727 Ga0451841_0095796 3300041498 Bacteria 908
728 Ga0451841_0230948 3300041498 Bacteria 703
729 Ga0451845_0468910 3300041501 Bacteria 823
730 Ga0451853_3825811 3300041512 Bacteria 1551
731 Ga0439431_0272600 3300041997 Bacteria 505
732 Ga0439445_0000389 3300042004 Bacteria 8864
733 Ga0439432_098194 3300042006 Bacteria 877
734 Ga0439432_204285 3300042006 Bacteria 572
735 Ga0439449_0004505 3300042007 Bacteria 5381
736 Ga0439449_0078415 3300042007 Bacteria 1218
737 Ga0439449_0124791 3300042007 Bacteria 956
738 Ga0439449_0125927 3300042007 Bacteria 951
739 Ga0439449_0161858 3300042007 Bacteria 836
740 Ga0439452_055554 3300042010 Bacteria 897
741 Ga0439457_039816 3300042014 Bacteria 1047
742 Ga0439462_0071060 3300042015 Bacteria 945
743 Ga0439462_0074065 3300042015 Bacteria 926
744 Ga0439462_0242360 3300042015 Bacteria 518
745 Ga0450912_024682 3300042116 Bacteria 599
746 Ga0450920_029182 3300042122 Bacteria 1082
747 Ga0450894_079262 3300042131 Bacteria 510
748 Ga0450907_020776 3300042146 Bacteria 1103
749 Ga0439446_0038165 3300042156 Bacteria 1408
750 Ga0439434_0033026 3300042435 Bacteria 1576
751 Ga0439434_0220219 3300042435 Bacteria 644
752 Ga0439434_0266696 3300042435 Bacteria 588
753 Ga0439464_0315881 3300042439 Bacteria 512
754 Ga0450918_077345 3300042531 Unclassified 631
755 Ga0450901_011938 3300042533 Bacteria 904
756 Ga0451577_0507762 3300042876 Bacteria 1095
757 Ga0453684_0203560 3300044712 Bacteria 2306
758 Ga0466967_1187677 3300045976 Bacteria 760
759 Ga0495617_129242 3300046452 Bacteria 811
760 Ga0495638_0010960 3300046460 Bacteria 6270
761 Ga0495638_0014449 3300046460 Bacteria 5335
762 Ga0495638_0034944 3300046460 Bacteria 3206
763 Ga0495638_0549108 3300046460 Bacteria 575
764 Ga0495596_0264005 3300046500 Bacteria 668
765 Ga0495607_0009645 3300046501 Bacteria 6523
766 Ga0495583_0046142 3300046506 Bacteria 2011
767 Ga0495606_0080835 3300046507 Bacteria 2021
768 Ga0495606_0566136 3300046507 Bacteria 563
769 Ga0495606_0589518 3300046507 Bacteria 547
770 Ga0495610_0084939 3300046512 Bacteria 1445
771 Ga0495610_0209922 3300046512 Bacteria 792
772 Ga0495620_0300627 3300046515 Bacteria 610
773 Ga0495632_0012798 3300046519 Bacteria 4816
774 Ga0495643_0019902 3300046522 Bacteria 3879
775 Ga0495648_0103025 3300046524 Bacteria 1571
776 Ga0495663_0001773 3300046525 Bacteria 6687
777 Ga0495663_0022610 3300046525 Bacteria 1817
778 Ga0495663_0035591 3300046525 Bacteria 1496
779 Ga0495663_0102981 3300046525 Bacteria 942
780 Ga0495663_0270116 3300046525 Bacteria 607
781 Ga0495642_0182352 3300046528 Bacteria 914
782 Ga0495654_0010554 3300046530 Bacteria 5025
783 Ga0495654_0360229 3300046530 Bacteria 583
784 Ga0495598_0016102 3300046537 Bacteria 1901
785 Ga0495598_0081258 3300046537 Unclassified 1040
786 Ga0495598_0084910 3300046537 Bacteria 1022
787 Ga0495621_0001191 3300046539 Bacteria 6715
788 Ga0495621_0001733 3300046539 Bacteria 5718
789 Ga0495621_0039729 3300046539 Bacteria 1646
790 Ga0495597_0037563 3300046542 Bacteria 2174
791 Ga0495622_0220692 3300046557 Bacteria 840
792 Ga0495633_0359128 3300046558 Bacteria 660
793 Ga0495668_0000004 3300046616 Bacteria 574236
794 Ga0495668_0648659 3300046616 Bacteria 583
795 Ga0495625_0000553 3300046660 Bacteria 54796
796 Ga0495625_0016088 3300046660 Bacteria 5895
797 Ga0495625_0035484 3300046660 Bacteria 3675
798 Ga0495625_0159861 3300046660 Bacteria 1510
799 Ga0495625_0382484 3300046660 Bacteria 883
800 Ga0495659_0086772 3300046664 Bacteria 1196
801 Ga0495659_0156568 3300046664 Bacteria 918
802 Ga0495659_0528271 3300046664 Bacteria 519
803 Ga0495588_0101380 3300046674 Bacteria 1513
804 Ga0495669_0000602 3300046684 Bacteria 15746
805 Ga0495669_0077318 3300046684 Bacteria 1524
806 Ga0495670_0004937 3300046691 Bacteria 6551
807 Ga0495670_0009300 3300046691 Bacteria 4836
808 Ga0495670_0052728 3300046691 Bacteria 2037
809 Ga0495670_0123687 3300046691 Bacteria 1345
810 Ga0495670_0248402 3300046691 Bacteria 948
811 Ga0495670_0349574 3300046691 Bacteria 796
812 Ga0495670_0501266 3300046691 Bacteria 659
813 Ga0495671_0017144 3300046692 Bacteria 3855
814 Ga0495671_0030512 3300046692 Bacteria 2761
815 Ga0495671_0038954 3300046692 Bacteria 2401
816 Ga0495589_0276032 3300046794 Bacteria 782
817 Ga0495660_0023484 3300046810 Bacteria 3516
818 Ga0495677_0024775 3300047445 Bacteria 2177
819 Ga0495677_0027004 3300047445 Bacteria 2083
820 Ga0495677_0208479 3300047445 Bacteria 760
821 Ga0495681_0082006 3300047470 Bacteria 1438
822 Ga0495681_0118381 3300047470 Bacteria 1139
823 Ga0495686_0012540 3300047472 Bacteria 5925
824 Ga0495686_0067518 3300047472 Bacteria 2207
825 Ga0495686_0259720 3300047472 Bacteria 973
826 Ga0496100_0613825 3300048903 Bacteria 845
827 Ga0496101_0748635 3300048904 Bacteria 771
828 Ga0496102_0250891 3300048905 Bacteria 1669
829 Ga0496106_0973151 3300048909 Bacteria 668
830 Ga0496107_0386275 3300048910 Bacteria 1041
831 Ga0496108_0067853 3300048911 Bacteria 3008
832 Ga0496109_0485983 3300048912 Bacteria 1166
833 Ga0496109_0513593 3300048912 Bacteria 1131
834 Ga0496109_0528814 3300048912 Bacteria 1113
835 Ga0496110_0001413 3300048913 Bacteria 17353
836 Ga0496111_0368954 3300048914 Bacteria 1062
837 Ga0496114_0391067 3300048917 Bacteria 1231
838 Ga0496115_0010329 3300048918 Bacteria 6971
839 Ga0496115_1372783 3300048918 Bacteria 523
840 Ga0496117_0205089 3300048920 Bacteria 1111
841 Ga0496118_0019743 3300048921 Bacteria 6009
842 Ga0496119_0088685 3300048922 Bacteria 1763
843 Ga0496120_0366153 3300048923 Bacteria 644
844 Ga0496121_0220606 3300048924 Bacteria 1336
845 Ga0496121_0448158 3300048924 Bacteria 832
846 Ga0496122_0000416 3300048925 Bacteria 90497
847 Ga0496123_0000460 3300048926 Bacteria 71476
848 Ga0496123_0002043 3300048926 Bacteria 26051
849 Ga0496124_0066588 3300048927 Bacteria 2999
850 Ga0496124_0125990 3300048927 Bacteria 2040
851 Ga0496124_0212210 3300048927 Bacteria 1464
852 Ga0496125_0006717 3300048928 Bacteria 12370
853 Ga0496125_0222569 3300048928 Bacteria 1214
854 Ga0496126_0310346 3300048929 Bacteria 1299
855 Ga0496126_0316405 3300048929 Bacteria 1284
856 Ga0496126_0618377 3300048929 Bacteria 851
857 Ga0496126_0635387 3300048929 Bacteria 837
858 Ga0496126_1149026 3300048929 Bacteria 574
859 Ga0501031_0000016 3300049568 Bacteria 110858
860 Ga0501031_0027499 3300049568 Bacteria 3708
861 Ga0501031_0099578 3300049568 Bacteria 1897
862 Ga0501031_0102979 3300049568 Bacteria 1863
863 Ga0501032_0000044 3300049569 Bacteria 110899
864 Ga0501032_0094726 3300049569 Bacteria 1979
865 Ga0501032_0182038 3300049569 Bacteria 1375
866 Ga0501032_0326164 3300049569 Bacteria 990
867 Ga0501033_0000052 3300049570 Bacteria 110545
868 Ga0501033_0050698 3300049570 Bacteria 3078
869 Ga0501033_0081474 3300049570 Bacteria 2373
870 Ga0501033_0336342 3300049570 Bacteria 1059
871 Ga0501033_0435063 3300049570 Bacteria 912
872 Ga0501034_0000212 3300049571 Bacteria 110795
873 Ga0501034_0069338 3300049571 Bacteria 3537
874 Ga0501034_0106196 3300049571 Bacteria 2801
875 Ga0501034_0488781 3300049571 Bacteria 1145
876 Ga0501034_0827334 3300049571 Bacteria 817
877 Ga0501036_0000022 3300049572 Bacteria 111251
878 Ga0501036_0025253 3300049572 Bacteria 5013
879 Ga0501036_0153146 3300049572 Bacteria 1944
880 Ga0501036_0859510 3300049572 Bacteria 745
881 Ga0501037_0000052 3300049573 Bacteria 110932
882 Ga0501037_0045871 3300049573 Bacteria 3207
883 Ga0501037_0238039 3300049573 Bacteria 1276
884 Ga0501037_0301995 3300049573 Bacteria 1111
885 Ga0501037_0392552 3300049573 Bacteria 952
886 Ga0501037_0564047 3300049573 Bacteria 767
887 Ga0501038_0000044 3300049574 Bacteria 110876
888 Ga0501038_0030959 3300049574 Bacteria 4731
889 Ga0501038_0155608 3300049574 Bacteria 1861
890 Ga0501038_0276789 3300049574 Bacteria 1322
891 Ga0501039_0000042 3300049575 Bacteria 113008
892 Ga0501039_0007777 3300049575 Bacteria 8176
893 Ga0501039_0323905 3300049575 Bacteria 1211
894 Ga0501040_0057517 3300049576 Bacteria 2670
895 Ga0501040_0118622 3300049576 Bacteria 1855
896 Ga0501043_0000054 3300049579 Bacteria 105924
897 Ga0501043_0016295 3300049579 Bacteria 5828
898 Ga0501043_0137547 3300049579 Bacteria 1913
899 Ga0501046_0147468 3300049580 Bacteria 1776
900 Ga0501046_0519621 3300049580 Bacteria 851
901 Ga0501047_0000247 3300049581 Bacteria 64318
902 Ga0501047_0172411 3300049581 Bacteria 2032
903 Ga0501068_0189543 3300049584 Bacteria 1302
904 Ga0501068_0629984 3300049584 Bacteria 700
905 Ga0501070_0363765 3300049586 Bacteria 1173
906 Ga0501072_0015756 3300049588 Bacteria 5795
907 Ga0501072_0108654 3300049588 Bacteria 2207
908 Ga0501073_0216155 3300049589 Unclassified 1325
909 Ga0501073_0496014 3300049589 Bacteria 844
910 Ga0501074_0385756 3300049590 Bacteria 994
911 Ga0501074_1311875 3300049590 Bacteria 507
912 Ga0501075_0194058 3300049591 Bacteria 1549
913 Ga0501202_113772 3300049652 Bacteria 673
914 Ga0501224_005346 3300049664 Bacteria 1837
915 Ga0501238_027115 3300049671 Bacteria 823
916 Ga0501249_038320 3300049679 Bacteria 1082
917 Ga0501079_0724422 3300049741 Bacteria 783
918 Ga0501081_0012442 3300049743 Bacteria 5593
919 Ga0501262_013742 3300049759 Bacteria 1047
920 Ga0501262_065171 3300049759 Bacteria 588
921 Ga0501268_086003 3300049765 Bacteria 656
922 Ga0501269_005517 3300049766 Bacteria 1521
923 Ga0501279_066484 3300049775 Bacteria 599
924 Ga0501035_0000095 3300049822 Bacteria 110735
925 Ga0501035_0023615 3300049822 Bacteria 5641
926 Ga0501035_0297143 3300049822 Bacteria 1361
927 Ga0501035_0363431 3300049822 Bacteria 1209
928 Ga0501044_0000091 3300049823 Bacteria 111251
929 Ga0501044_0000280 3300049823 Bacteria 64928
930 Ga0501044_0027138 3300049823 Bacteria 6056
931 Ga0501044_0172718 3300049823 Bacteria 2131
932 Ga0501045_0024385 3300049824 Bacteria 4343
933 Ga0501045_0651172 3300049824 Bacteria 779
934 nmdc:mga03683_721_c1 3300050489 Bacteria 9466
935 nmdc:mga03n38_59950_c1 3300050490 Bacteria 1729
936 nmdc:mga0yw44_31385_c1 3300050492 Bacteria 3089
937 nmdc:mga0yw44_81252_c1 3300050492 Bacteria 2032
938 nmdc:mga0k408_104336_c1 3300050493 Bacteria 1673
939 nmdc:mga0k408_323284_c1 3300050493 Bacteria 920
940 nmdc:mga0k408_492351_c1 3300050493 Bacteria 727
941 nmdc:mga06z11_388_c1 3300050494 Bacteria 16612
942 nmdc:mga04h51_73_c1 3300050495 Bacteria 32039
943 nmdc:mga07m45_251251_c1 3300050496 Bacteria 1029
944 nmdc:mga07m45_330852_c1 3300050496 Bacteria 885
945 nmdc:mga07m45_47316_c1 3300050496 Bacteria 2418
946 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
947 nmdc:mga07m45_979_c1 3300050496 Bacteria 11290
948 nmdc:mga09592_1279878_c1 3300050508 Bacteria 603
949 nmdc:mga08y16_1245842_c1 3300050511 Bacteria 713
950 nmdc:mga08y16_406877_c1 3300050511 Bacteria 1392
951 nmdc:mga0sz30_209_c1 3300050516 Bacteria 21984
952 nmdc:mga0sz30_351964_c1 3300050516 Bacteria 658
953 nmdc:mga0sz30_382860_c1 3300050516 Bacteria 630
954 nmdc:mga0sz30_9804_c1 3300050516 Bacteria 3653
955 Ga0500643_002982 3300053087 Bacteria 8386
956 Ga0500643_030835 3300053087 Bacteria 1639
957 Ga0500643_218016 3300053087 Bacteria 512
958 Ga0500651_0336984 3300053093 Bacteria 858
959 Ga0500650_0054600 3300053098 Bacteria 1860
960 Ga0500555_059803 3300053103 Bacteria 1027
961 Ga0500556_0000339 3300053104 Bacteria 34934
962 Ga0500562_025902 3300053108 Bacteria 1536
963 Ga0500569_009439 3300053109 Bacteria 2267
964 Ga0500592_020911 3300053116 Bacteria 1053
965 Ga0500592_027000 3300053116 Bacteria 926
966 Ga0500595_023762 3300053119 Bacteria 2150
967 Ga0500608_000105 3300053122 Bacteria 34366
968 Ga0500608_000764 3300053122 Bacteria 11718
969 Ga0500642_0000001 3300053130 Bacteria 1468402
970 Ga0500658_0000769 3300053134 Bacteria 13202
971 Ga0500658_0358583 3300053134 Bacteria 669
972 Ga0500559_0312546 3300053136 Bacteria 737
973 Ga0500568_0001734 3300053139 Bacteria 13523
974 Ga0500568_0051944 3300053139 Bacteria 1611
975 Ga0500568_0081725 3300053139 Bacteria 1226
976 Ga0500573_0006606 3300053140 Bacteria 6291
977 Ga0500573_0285408 3300053140 Bacteria 833
978 Ga0500616_0000421 3300053153 Bacteria 56739
979 Ga0500616_0039441 3300053153 Bacteria 2546
980 Ga0500616_0318064 3300053153 Bacteria 641
981 Ga0500622_0030266 3300053156 Bacteria 2843
982 Ga0500627_0000049 3300053158 Bacteria 58947
983 Ga0500627_0479965 3300053158 Bacteria 520
984 Ga0500636_0000156 3300053177 Bacteria 35625
985 Ga0500645_000312 3300053730 Bacteria 34754
986 Ga0501084_0819463 3300054114 Bacteria 784
987 Ga0501084_1141472 3300054114 Bacteria 654
988 Ga0501082_0275088 3300060353 Bacteria 1466
989 Ga0501082_1747598 3300060353 Bacteria 543
990 Ga0501082_2037177 3300060353 Bacteria 500
991 2509079156 2508501114 Bacteria 7082538
992 2509108476 2508501122 Bacteria 6292184
993 2509374497 2509276019 Bacteria 6802256
994 2510134718 2510065019 Bacteria 6903379
995 2510306608 2510065057 Bacteria 6649661
996 2510896067 2510461076 Bacteria 8618824
997 2511500971 2511231052 Bacteria 6974333
998 2512972287 2512875026 Bacteria 6861065
999 2513583491 2513237086 Bacteria 7265287
1000 2513603366 2513237089 Bacteria 6553624
1001 2513620774 2513237091 Bacteria 6900273
1002 2513631444 2513237093 Bacteria 7545552
1003 2513710622 2513237103 Bacteria 7647401
1004 2513881140 2513237140 Bacteria 7076289
1005 2513907125 2513237143 Bacteria 6664116
1006 2513983971 2513237156 Bacteria 6402557
1007 2514004821 2513237160 Bacteria 6650282
1008 2514023732 2513237162 Bacteria 7468464
1009 2515608086 2515154107 Bacteria 6795637
1010 2515634671 2515154113 Bacteria 7807172
1011 2515646027 2515154114 Bacteria 7848616
1012 2515656906 2515154116 Bacteria 7552979
1013 2515743529 2515154134 Bacteria 7220242
1014 2516208840 2516143018 Bacteria 6951533
1015 2516892252 2516653046 Bacteria 6989037
1016 2517037420 2516653077 Bacteria 7555578
1017 2517077717 2516653085 Bacteria 7346596
1018 2517410616 2517287029 Bacteria 6905599
1019 2517569048 2517487022 Bacteria 7227575
1020 2520377860 2519899620 Bacteria 6499161
1021 2524451186 2524023207 Bacteria 6813453
1022 2551676431 2551306084 Bacteria 8942552
1023 2551687212 2551306085 Bacteria 7347181
1024 2551692941 2551306086 Bacteria 6843938
1025 2551703186 2551306087 Bacteria 7351905
1026 2551712353 2551306089 Bacteria 7162724
1027 2551720674 2551306090 Bacteria 7953713
1028 2551731098 2551306091 Bacteria 7086830
1029 2551731976 2551306092 Bacteria 6992595
1030 2551740402 2551306093 Bacteria 7064773
1031 2558863524 2558860100 Bacteria 8458965
1032 2585270292 2582581306 Bacteria 6450535
1033 2585388731 2582581865 Bacteria 6644329
1034 2585541139 2585427528 Bacteria 6842387
1035 2585839902 2585427593 Bacteria 7141551
1036 2587919815 2585428106 Bacteria 5179711
1037 2616295438 2615840624 Bacteria 6557588
1038 2643820086 2643221560 Bacteria 4801179
1039 2643836387 2643221563 Bacteria 4726935
1040 2643910490 2643221580 Bacteria 3816678
1041 2644052863 2643221608 Bacteria 4724829
1042 2644109039 2643221618 Bacteria 7717186
1043 2644151560 2643221626 Bacteria 8069654
1044 2644223557 2643221640 Bacteria 5258820
1045 2644236353 2643221642 Bacteria 5357871
1046 2644311695 2643221655 Bacteria 7722067
1047 2644329952 2643221659 Bacteria 7890716
1048 2644494368 2643221688 Bacteria 5260751
1049 2644546626 2643221698 Bacteria 7756764
1050 2644617494 2643221712 Bacteria 7729434
1051 2657683308 2657244999 Bacteria 5946535
1052 2692316866 2690316117 Bacteria 6800650
1053 2725947705 2724679232 Bacteria 7646494
1054 2739035691 2738541333 Bacteria 7106503
1055 2753460768 2751185821 Bacteria 6189929
1056 2766065449 2765235942 Bacteria 7445910
1057 2792622724 2791355091 Bacteria 6135441
1058 2792628355 2791355092 Bacteria 6248105
1059 2793319840 2791355260 Bacteria 6598818
1060 2793328156 2791355261 Bacteria 6661293
1061 2793362933 2791355266 Bacteria 7116587
1062 2793370041 2791355267 Bacteria 7222458
1063 2802717691 2802428858 Bacteria 6636079
1064 2802723381 2802428859 Bacteria 6667919
1065 2802731168 2802428860 Bacteria 6525526
1066 2802736175 2802428861 Bacteria 6534206
1067 2802743615 2802428862 Bacteria 6633353
1068 2802750673 2802428863 Bacteria 6410669
1069 2804751302 2802429268 Bacteria 6094027
1070 2806044678 2802429633 Bacteria 7341974
1071 2806052878 2802429634 Bacteria 7083200
1072 2806059178 2802429635 Bacteria 7650140
1073 2806068159 2802429636 Bacteria 7597525
1074 2806074279 2802429637 Bacteria 7067217
1075 2838046371 2838042994 Bacteria 6046894
1076 2838076400 2838074704 Bacteria 6785777
1077 2838685079 2838680041 Bacteria 6545511
1078 2838691449 2838686498 Bacteria 7807632
1079 2838699084 2838694306 Bacteria 6853137
1080 2838712565 2838707686 Bacteria 6619912
1081 2838733408 2838729681 Bacteria 7400765
1082 2838746020 2838742623 Bacteria 7396178
1083 2841853732 2841851746 Bacteria 7532261
1084 2842082042 2842077413 Bacteria 6508645
1085 2842113565 2842110456 Bacteria 7656360
1086 2842122964 2842118031 Bacteria 7033875
1087 2842162261 2842156927 Bacteria 6894975
1088 2842169816 2842163707 Bacteria 6916235
1089 2842185187 2842180545 Bacteria 6888678
1090 2842208184 2842205361 Bacteria 6340321
1091 2842220204 2842217011 Bacteria 7497767
1092 2842233674 2842229732 Bacteria 7475766
1093 2842242133 2842237096 Bacteria 6620661
1094 2842247718 2842243621 Bacteria 7421798
1095 2842262014 2842257432 Bacteria 7401195
1096 2842275923 2842271015 Bacteria 7807131
1097 2842281807 2842278818 Bacteria 6340002
1098 2842296042 2842291075 Bacteria 7076806
1099 2842308093 2842304105 Bacteria 7023636
1100 2842375757 2842370503 Bacteria 7038661
1101 2842382441 2842377471 Bacteria 7140707
1102 2842389842 2842384541 Bacteria 7057858
1103 2844168563 2844163670 Bacteria 7266046
1104 2844457623 2844454524 Bacteria 7952546
1105 2847418068 2847417321 Bacteria 6913799
1106 2848993042 2848992105 Bacteria 6810864
1107 2850080437 2850079185 Bacteria 6848280
1108 2852653987 2852653556 Bacteria 4050083
1109 2855831322 2855825444 Bacteria 6785811
1110 2855840447 2855839649 Bacteria 7135830
1111 2855879180 2855872281 Bacteria 6964271
1112 2857505938 2857504554 Bacteria 5369913
1113 2857519032 2857516855 Bacteria 7787325
1114 2858800976 2858800743 Bacteria 6603254
1115 2867512749 2867507094 Bacteria 6506033
1116 2896386601 2896384573 Bacteria 7700774
1117 2913297483 2913295892 Bacteria 6333755
1118 2915986171 2915980308 Bacteria 6624279
1119 2915990591 2915986958 Bacteria 6739310
1120 2915996261 2915993759 Bacteria 7016183
1121 2916005739 2916000859 Bacteria 6865702
1122 2916010926 2916007675 Bacteria 6898660
1123 2916016563 2916014648 Bacteria 6946486
1124 2916024762 2916021584 Bacteria 6854472
1125 2916032181 2916028427 Bacteria 6748433
1126 2916038164 2916035215 Bacteria 6755766
1127 2916047184 2916041962 Bacteria 6820487
1128 2916053212 2916048683 Bacteria 6543552
1129 2916055358 2916055098 Bacteria 6758838
1130 2916062822 2916061851 Bacteria 6737736
1131 2916074961 2916068649 Bacteria 6943657
1132 2916079315 2916076590 Bacteria 6596108
1133 2920762914 2920760137 Bacteria 7427611
1134 2921205724 2921201388 Bacteria 6926299
1135 2921213530 2921208531 Bacteria 6745326
1136 2921241622 2921237296 Bacteria 6876710
1137 2921247516 2921244191 Bacteria 6568419
1138 2921250953 2921250672 Bacteria 6677771
1139 2921260005 2921257292 Bacteria 6808382
1140 2921264235 2921263974 Bacteria 6864552
1141 2921282768 2921282425 Bacteria 6826397
1142 2921290130 2921289301 Bacteria 7316391
1143 2921299967 2921296804 Bacteria 7176999
1144 2924145600 2924144063 Bacteria 6883928
1145 2924155881 2924150972 Bacteria 7169444
1146 2924160573 2924158325 Bacteria 7188855
1147 2924168151 2924165586 Bacteria 7260590
1148 2924177847 2924172951 Bacteria 6749356
1149 2924186314 2924179722 Bacteria 6843264
1150 2924189512 2924186466 Bacteria 6876637
1151 2924198248 2924193448 Bacteria 6955718
1152 2924204059 2924200457 Bacteria 6757188
1153 2924209909 2924207177 Bacteria 6917007
1154 2924215176 2924214083 Bacteria 7080103
1155 2924226229 2924221636 Bacteria 7113495
1156 2924234934 2924228884 Bacteria 6633132
1157 2928531957 2928531327 Bacteria 5101314
1158 2929202040 2929199973 Bacteria 7260745
1159 2932402362 2932401849 Bacteria 4262978
1160 2933574542 2933570622 Bacteria 7023390
1161 2933589145 2933586486 Bacteria 7667493
1162 2935899854 2935894831 Bacteria 6620579
1163 2935907025 2935901341 Bacteria 7341747
1164 2936374993 2936367885 Bacteria 7324495
1165 2936380684 2936375103 Bacteria 6652732
1166 2937009514 2937002841 Bacteria 6934057
1167 2937010886 2937009748 Bacteria 6746052
1168 2937018984 2937016420 Bacteria 6782579
1169 2937027925 2937023124 Bacteria 6815156
1170 2937029868 2937029754 Bacteria 6424026
1171 2937036894 2937036028 Bacteria 6846469
1172 2937048989 2937042894 Bacteria 6741576
1173 2937056284 2937049772 Bacteria 6757901
1174 2937061298 2937056579 Bacteria 7107896
1175 2937064388 2937063883 Bacteria 7199456
1176 2937072868 2937071275 Bacteria 6984483
1177 2937082975 2937078374 Bacteria 6610289
1178 2937091253 2937084907 Bacteria 6618516
1179 2937095589 2937091812 Bacteria 6979387
1180 2937103635 2937098957 Bacteria 7249374
1181 2937109776 2937106411 Bacteria 6947143
1182 2937118318 2937113482 Bacteria 6505872
1183 2937121185 2937119839 Bacteria 6597547
1184 2937129819 2937126314 Bacteria 6771275
1185 2941500262 2941499720 Bacteria 7599444
1186 2957380027 2957375807 Bacteria 6425588
1187 2957385069 2957382221 Bacteria 6737050
1188 2957389132 2957388812 Bacteria 6778072
1189 2957396752 2957395598 Bacteria 6822399
1190 2957405448 2957402308 Bacteria 6741770
1191 2957413251 2957408893 Bacteria 6558585
1192 2957419199 2957415311 Bacteria 6991633
1193 2957427733 2957422303 Bacteria 7172205
1194 2957431091 2957430029 Bacteria 7022557
1195 2957441965 2957437181 Bacteria 6568994
1196 2957446653 2957443900 Bacteria 6869977
1197 2957454190 2957450854 Bacteria 6765715
1198 2957462450 2957457609 Bacteria 6967680
1199 2957467748 2957464669 Bacteria 6568877
1200 2957477790 2957471148 Bacteria 6797643
1201 2957480628 2957478035 Bacteria 6756658
1202 2957485790 2957484790 Bacteria 6703082
1203 2957495994 2957491536 Bacteria 6695180
1204 2957501036 2957498199 Bacteria 7126688
1205 2957509592 2957505466 Bacteria 7253085
1206 2960586644 2960584000 Bacteria 6864594
1207 2960595571 2960591022 Bacteria 6622873
1208 2960600575 2960597568 Bacteria 6550735
1209 2960609475 2960603979 Bacteria 6898737
1210 2960616786 2960610863 Bacteria 6691244
1211 2960617704 2960617483 Bacteria 6727748
1212 2960625692 2960624210 Bacteria 6875384
1213 2960633228 2960631154 Bacteria 6732508
1214 2960640207 2960637947 Bacteria 7296468
1215 2960648728 2960645483 Bacteria 7211087
1216 2960653707 2960652885 Bacteria 7083688
1217 2960666405 2960660292 Bacteria 7041660
1218 2960673925 2960667422 Bacteria 6763020
1219 2960678832 2960674078 Bacteria 6609048
1220 2960684160 2960680706 Bacteria 6624464
1221 2960692024 2960687367 Bacteria 6535474
1222 2960696371 2960693952 Bacteria 6749742
1223 2964610231 2964607997 Bacteria 7101408
1224 2964620008 2964615318 Bacteria 6809089
1225 2964627807 2964621998 Bacteria 6834995
1226 2964633117 2964628898 Bacteria 7083044
1227 2964641282 2964636051 Bacteria 7091832
1228 2964646161 2964643177 Bacteria 6820887
1229 2964653103 2964649959 Bacteria 6675118
1230 2964661884 2964656573 Bacteria 7100150
1231 2964665972 2964663802 Bacteria 7019362
1232 2964671686 2964670856 Bacteria 6851364
1233 2964681098 2964678106 Bacteria 6792020
1234 2964688108 2964685014 Bacteria 6839111
1235 2964695841 2964691889 Bacteria 6802758
1236 2964703595 2964698721 Bacteria 6765331
1237 2964708094 2964705432 Bacteria 7114648
1238 2964716299 2964712639 Bacteria 6695970
1239 2964726457 2964719344 Bacteria 7286602
1240 2967667371 2967664464 Bacteria 6948836
1241 2967672144 2967671571 Bacteria 7021409
1242 2967681043 2967678726 Bacteria 7264382
1243 2967686413 2967686174 Bacteria 6678622
1244 2967693246 2967693043 Bacteria 6804451
1245 2967704240 2967699805 Bacteria 6854538
1246 2967712948 2967706974 Bacteria 7186053
1247 2967716529 2967714385 Bacteria 7000047
1248 2967724587 2967721400 Bacteria 7073753
1249 2967734737 2967728569 Bacteria 6641507
1250 2967737580 2967735183 Bacteria 6827012
1251 2967747873 2967742019 Bacteria 6794534
1252 2967752105 2967748971 Bacteria 6733771
1253 2967756314 2967755722 Bacteria 6814706
1254 2967764431 2967762386 Bacteria 6923502
1255 2967770792 2967769361 Bacteria 6587838
1256 2967782177 2967775926 Bacteria 6738189
1257 2970026071 2970019648 Bacteria 7072033
1258 2970031791 2970026789 Bacteria 6785236
1259 2970037802 2970033650 Bacteria 7118744
1260 2970043285 2970040964 Bacteria 6731123
1261 2970052887 2970047711 Bacteria 7088379
1262 2970059608 2970054988 Bacteria 6611507
1263 2970065294 2970061556 Bacteria 7099761
1264 2970069514 2970068827 Bacteria 7123112
1265 2970076969 2970076120 Bacteria 6697332
1266 2970085648 2970082768 Bacteria 6183754
1267 2970093308 2970088815 Bacteria 6933825
1268 2970096866 2970095765 Bacteria 6936963
1269 2970106929 2970102677 Bacteria 6812532
1270 2970109819 2970109326 Bacteria 6863976
1271 2970117968 2970116247 Bacteria 6501857
1272 2970124461 2970122695 Bacteria 6625855
1273 2970129518 2970129317 Bacteria 6806560
1274 2970143150 2970136068 Bacteria 7207982
1275 2970148648 2970143518 Bacteria 6446480
1276 2970153814 2970149975 Bacteria 6779706
1277 2970163692 2970156795 Bacteria 7168044
1278 2970167504 2970164137 Bacteria 6861252
1279 2970171794 2970170962 Bacteria 6876229
1280 2970182814 2970177841 Bacteria 6768001
1281 2970188255 2970184632 Bacteria 7054431
1282 2970198324 2970191845 Bacteria 7032787
1283 2977518434 2977516862 Bacteria 6940108
1284 2977527656 2977523885 Bacteria 6960446
1285 2977531897 2977530762 Bacteria 6951399
1286 2977537989 2977537788 Bacteria 6929320
1287 2977544930 2977544691 Bacteria 6875412
1288 2977551987 2977551784 Bacteria 7125765
1289 2977561672 2977558990 Bacteria 6863948
1290 2977568982 2977565890 Bacteria 6901543
1291 2977578961 2977572785 Bacteria 6763888
1292 2977581494 2977579622 Bacteria 6772100
1293 3005415621 3005409236 Bacteria 7188837
1294 639649880 639633055 Bacteria 7751309
1295 643825045 643692032 Bacteria 6891900
1296 648736366 648276728 Bacteria 6968865
1297 8003992945 8003992118 Bacteria 7266902
1298 8004000181 8003999396 Bacteria 7063185
1299 8005294413 8005289223 Bacteria 6634003
1300 8005310832 8005307578 Bacteria 7395396
1301 8005378316 8005376324 Bacteria 6590079
1302 8005383961 8005382845 Bacteria 6732062
1303 8005401289 8005395548 Bacteria 6806915
1304 8005558509 8005556819 Bacteria 6908598
1305 8005566647 8005563573 Bacteria 7153261
1306 8005575064 8005570704 Bacteria 6957481
1307 8018133735 8018127388 Bacteria 7351159
1308 8018170091 8018163183 Bacteria 7277977
1309 8024481658 8024479707 Bacteria 6954785
1310 8055911039 8055909800 Bacteria 7278581
1311 8056381461 8056375014 Bacteria 7006639
1312 8057876697 8057874678 Bacteria 7494653
1313 Ga0068858_100365714
1314 MBSR1b_contig_10712157
1315 LJQas_1038148
1316 JGI24740J21852_10001351
1317 JGI24034J26672_10118856
1318 JGI24751J29686_10031269
1319 JGI24751J29686_10090805
1320 JGI25159J45721_1000002
1321 JGI25151J46595_10161566
1322 JGI25165J46597_1000947
1323 JGI25153J46596_10100412
1324 rootL2_10188392
1325 rootH1_10287281
1326 JGI25160J50197_1000008
1327 JGI25161J50226_1000380
1328 Ga0055526_1001532
1329 Ga0055526_1020128
1330 Ga0055524_1012523
1331 Ga0055536_1002254
1332 Ga0055536_1006080
1333 Ga0055536_1009138
1334 Ga0055528_1000695
1335 Ga0055530_10001655
1336 Ga0055530_10028298
1337 Ga0055540_1000752
1338 Ga0055531_10000858
1339 Ga0055531_10001722
1340 Ga0055531_10021163
1341 Ga0055531_10026168
1342 Ga0055531_10042449
1343 Ga0055543_1001421
1344 Ga0065165_1000015
1345 Ga0065704_10095207
1346 Ga0065704_10290897
1347 Ga0065712_10072765
1348 Ga0065715_10070852
1349 Ga0065715_10115519
1350 Ga0065715_10233704
1351 Ga0065715_10448940
1352 Ga0065707_10190157
1353 Ga0070658_10024500
1354 Ga0070658_10031287
1355 Ga0070676_10064522
1356 Ga0070676_10119508
1357 Ga0070676_10748776
1358 Ga0070683_102442811
1359 Ga0070670_100000350
1360 Ga0070670_100010030
1361 Ga0070670_100021035
1362 Ga0070670_100039511
1363 Ga0070670_100087996
1364 Ga0070670_100380736
1365 Ga0070670_100508862
1366 Ga0070677_10000600
1367 Ga0070677_10037260
1368 Ga0070677_10039893
1369 Ga0070677_10333296
1370 Ga0070677_10788663
1371 Ga0068869_100300833
1372 Ga0068869_100626883
1373 Ga0068869_100856082
1374 Ga0068869_100898790
1375 Ga0068869_101021888
1376 Ga0068868_100698703
1377 Ga0068868_101436812
1378 Ga0070660_100060990
1379 Ga0070660_100121687
1380 Ga0070660_100535787
1381 Ga0070660_100935085
1382 Ga0070660_101513291
1383 Ga0070689_101453634
1384 Ga0070689_101510986
1385 Ga0070691_10664597
1386 Ga0070687_100858606
1387 Ga0070661_100120387
1388 Ga0070661_100123269
1389 Ga0070668_100024369
1390 Ga0070668_100027061
1391 Ga0070668_100029010
1392 Ga0070668_100038020
1393 Ga0070669_100009774
1394 Ga0070669_100044937
1395 Ga0070669_100173670
1396 Ga0070669_100307933
1397 Ga0070675_100001857
1398 Ga0070675_100002352
1399 Ga0070675_100078800
1400 Ga0070675_100107929
1401 Ga0070671_100001032
1402 Ga0070671_100164090
1403 Ga0070671_100715480
1404 Ga0070671_100923306
1405 Ga0070674_100003913
1406 Ga0070674_100020755
1407 Ga0070674_100027251
1408 Ga0070674_100073539
1409 Ga0070674_100701752
1410 Ga0070673_100051731
1411 Ga0070673_100517358
1412 Ga0070673_101017085
1413 Ga0070659_100064992
1414 Ga0070659_100071386
1415 Ga0070659_100146835
1416 Ga0070659_100607835
1417 Ga0070659_100849206
1418 Ga0070659_102143984
1419 Ga0070667_100065993
1420 Ga0070667_100236010
1421 Ga0070700_100088525
1422 Ga0070663_100020031
1423 Ga0070663_100224813
1424 Ga0070663_100338937
1425 Ga0070678_101486152
1426 Ga0070678_101636009
1427 Ga0070678_102173511
1428 Ga0070662_100002989
1429 Ga0070662_100019821
1430 Ga0070662_100027985
1431 Ga0070662_100366589
1432 Ga0070662_100374457
1433 Ga0070662_100529236
1434 Ga0070662_100875549
1435 Ga0070662_101641616
1436 Ga0068867_100374909
1437 Ga0068867_100433368
1438 Ga0068867_101915762
1439 Ga0070685_11056339
1440 Ga0070679_100252500
1441 Ga0070679_100981335
1442 Ga0068853_100046888
1443 Ga0068853_100458275
1444 Ga0068853_100851270
1445 Ga0070672_100005437
1446 Ga0070672_100017512
1447 Ga0070672_100098073
1448 Ga0070672_100169097
1449 Ga0070672_100371321
1450 Ga0070672_101968869
1451 Ga0070696_101123912
1452 Ga0070665_100132453
1453 Ga0068855_100103093
1454 Ga0068855_100174964
1455 Ga0068855_100270918
1456 Ga0070664_100004435
1457 Ga0070664_100094460
1458 Ga0070664_101054141
1459 Ga0068857_100045180
1460 Ga0068854_100199288
1461 Ga0068854_100225001
1462 Ga0068856_100103731
1463 Ga0068859_100523410
1464 Ga0068864_100035579
1465 Ga0068864_100545028
1466 Ga0068864_101211167
1467 Ga0068864_101612833
1468 Ga0068866_10391222
1469 Ga0068861_100231708
1470 Ga0068861_100847870
1471 Ga0068851_10099229
1472 Ga0068863_102369896
1473 Ga0068863_102433682
1474 Ga0068858_100747326
1475 Ga0068862_100016627
1476 Ga0068862_100092388
1477 Ga0068862_100322624
1478 Ga0068862_100978530
1479 Ga0068862_101064551
1480 Ga0081455_10244360
1481 Ga0075365_10001615
1482 Ga0075365_10006228
1483 Ga0075365_11007149
1484 Ga0075368_10000318
1485 Ga0075363_100004443
1486 Ga0075363_100153476
1487 Ga0075363_100562892
1488 Ga0075364_10015285
1489 Ga0075362_10003383
1490 Ga0075367_10002472
1491 Ga0075369_10019278
1492 Ga0075369_10196062
1493 Ga0075369_10389580
1494 Ga0075369_10390163
1495 Ga0075369_10391814
1496 Ga0075366_10153572
1497 Ga0075366_10809815
1498 Ga0075370_10018867
1499 Ga0075370_10048468
1500 Ga0075370_10052920
1501 Ga0075370_10272970
1502 Ga0075370_10276764
1503 Ga0075370_10501920
1504 Ga0075428_100676383
1505 Ga0075431_101097603
1506 Ga0075429_100705294
1507 Ga0075429_101612913
1508 Ga0068865_101821536
1509 Ga0097620_100523434
1510 Ga0079104_1035919
1511 Ga0079104_1061617
1512 Ga0111539_10176032
1513 Ga0111539_10568661
1514 Ga0111539_10870883
1515 Ga0111539_11142217
1516 Ga0105245_11074055
1517 Ga0105245_12896207
1518 Ga0114129_12047192
1519 Ga0105243_10129286
1520 Ga0105243_11069571
1521 Ga0105241_10437784
1522 Ga0105248_10043271
1523 Ga0105237_10141188
1524 Ga0105237_10259227
1525 Ga0105238_10022705
1526 Ga0105238_10089554
1527 Ga0105249_10073177
1528 Ga0105239_10122221
1529 Ga0105239_10257858
1530 Ga0105239_10539227
1531 Ga0105239_11332316
1532 Ga0105246_10794202
1533 Ga0105246_11870196
1534 Ga0157319_1000957
1535 Ga0157371_10354253
1536 Ga0157370_10124553
1537 Ga0157370_10920463
1538 Ga0157369_10021987
1539 Ga0171463_1001
1540 Ga0157374_10234791
1541 Ga0157374_10382641
1542 Ga0157378_10517297
1543 Ga0157378_10668493
1544 Ga0157378_11457143
1545 Ga0163162_10108677
1546 Ga0163162_10413313
1547 Ga0157372_10044754
1548 Ga0157372_10154906
1549 Ga0157375_10036695
1550 Ga0157375_10067258
1551 Ga0157375_10978857
1552 Ga0157375_11129954
1553 Ga0157375_11835192
1554 Ga0163163_10671575
1555 Ga0163163_10795752
1556 Ga0163163_10956203
1557 Ga0157380_10022038
1558 Ga0157380_10033633
1559 Ga0157380_10036570
1560 Ga0157380_10568009
1561 Ga0157380_10628741
1562 Ga0157380_10632682
1563 Ga0157380_11382439
1564 Ga0157380_11660983
1565 Ga0157380_12094252
1566 Ga0183365_12031
1567 Ga0183363_1371
1568 Ga0163161_10049520
1569 Ga0163161_10086971
1570 Ga0163161_10120473
1571 Ga0163161_11524446
1572 Ga0214544_1009397
1573 Ga0214542_1000006
1574 Ga0214542_1016019
1575 Ga0214543_1000003
1576 Ga0214543_1000014
1577 Ga0228711_1000001
1578 Ga0228710_1000001
1579 Ga0209436_103040
1580 Ga0207427_109513
1581 Ga0209437_100197
1582 Ga0209233_1000199
1583 Ga0209673_1000060
1584 Ga0209673_1001334
1585 Ga0209130_1000007
1586 Ga0209130_1020116
1587 Ga0209675_1000196
1588 Ga0209676_1000518
1589 Ga0209676_1000554
1590 Ga0209676_1000901
1591 Ga0209676_1000929
1592 Ga0209676_1020890
1593 Ga0209676_1030163
1594 Ga0209025_1000100
1595 Ga0209025_1006572
1596 Ga0209025_1030058
1597 Ga0209025_1059964
1598 Ga0209564_1000116
1599 Ga0209564_1000439
1600 Ga0209758_1002301
1601 Ga0209758_1025297
1602 Ga0209758_1033930
1603 Ga0209050_1000017
1604 Ga0209050_1001222
1605 Ga0209050_1008085
1606 Ga0209050_1009017
1607 Ga0209050_1021935
1608 Ga0209050_1029701
1609 Ga0209050_1067080
1610 Ga0209256_1000302
1611 Ga0209256_1001410
1612 Ga0209256_1001505
1613 Ga0207426_1000064
1614 Ga0209051_1000217
1615 Ga0209051_1001024
1616 Ga0209051_1002714
1617 Ga0209257_1001405
1618 Ga0209257_1002894
1619 Ga0209257_1004371
1620 Ga0209257_1005509
1621 Ga0209257_1006913
1622 Ga0209257_1032597
1623 Ga0209257_1069401
1624 Ga0209257_1104677
1625 Ga0207697_10003012
1626 Ga0207697_10181534
1627 Ga0207697_10193631
1628 Ga0207682_10002530
1629 Ga0207682_10059152
1630 Ga0207682_10425647
1631 Ga0207688_10050599
1632 Ga0207688_10372485
1633 Ga0207645_10005867
1634 Ga0207645_10100033
1635 Ga0207645_10381462
1636 Ga0207645_10896506
1637 Ga0207705_10001064
1638 Ga0207705_10067557
1639 Ga0207705_10073195
1640 Ga0207695_10157189
1641 Ga0207671_10589513
1642 Ga0207657_10015490
1643 Ga0207657_10123293
1644 Ga0207657_10237211
1645 Ga0207657_10359041
1646 Ga0207657_10580238
1647 Ga0207649_10007890
1648 Ga0207649_10105896
1649 Ga0207649_10631175
1650 Ga0207649_10854948
1651 Ga0207652_10006724
1652 Ga0207652_10068552
1653 Ga0207681_10005401
1654 Ga0207681_10114929
1655 Ga0207681_10191695
1656 Ga0207681_10437430
1657 Ga0207681_10475544
1658 Ga0207681_10906585
1659 Ga0207681_11481303
1660 Ga0207650_10000916
1661 Ga0207650_10004697
1662 Ga0207650_10017569
1663 Ga0207650_10041076
1664 Ga0207650_10141041
1665 Ga0207650_10164481
1666 Ga0207650_10251599
1667 Ga0207659_10002256
1668 Ga0207659_10005898
1669 Ga0207659_10049103
1670 Ga0207659_10085347
1671 Ga0207687_11196681
1672 Ga0207644_10009825
1673 Ga0207644_10604869
1674 Ga0207644_11117396
1675 Ga0207644_11681229
1676 Ga0207690_10037801
1677 Ga0207690_10198044
1678 Ga0207690_10215011
1679 Ga0207690_11229462
1680 Ga0207706_10045319
1681 Ga0207706_10088024
1682 Ga0207706_10247681
1683 Ga0207706_10311009
1684 Ga0207706_10323824
1685 Ga0207706_10501988
1686 Ga0207706_10599913
1687 Ga0207706_10746090
1688 Ga0207706_10776213
1689 Ga0207709_10154504
1690 Ga0207669_10036896
1691 Ga0207669_10037527
1692 Ga0207669_10075641
1693 Ga0207669_10344178
1694 Ga0207669_10516271
1695 Ga0207669_10578841
1696 Ga0207669_10645267
1697 Ga0207691_10006503
1698 Ga0207691_10015470
1699 Ga0207691_10146413
1700 Ga0207691_11546050
1701 Ga0207711_10101908
1702 Ga0207661_11566308
1703 Ga0207679_10015840
1704 Ga0207679_10047566
1705 Ga0207679_10137679
1706 Ga0207679_10257464
1707 Ga0207679_10916415
1708 Ga0207667_10004509
1709 Ga0207667_10068990
1710 Ga0207651_10040548
1711 Ga0207651_10372654
1712 Ga0207651_10706277
1713 Ga0207651_10782897
1714 Ga0207712_10026570
1715 Ga0207712_10317656
1716 Ga0207668_10019850
1717 Ga0207668_10051999
1718 Ga0207668_10053537
1719 Ga0207668_10126134
1720 Ga0207640_10130945
1721 Ga0207640_10216336
1722 Ga0207658_10065281
1723 Ga0207658_10082351
1724 Ga0207658_10088112
1725 Ga0207639_10228607
1726 Ga0207639_10326200
1727 Ga0207639_11254500
1728 Ga0207678_10080942
1729 Ga0207678_10112545
1730 Ga0207678_10164279
1731 Ga0207678_10298226
1732 Ga0207678_10598340
1733 Ga0207678_10616878
1734 Ga0207708_10149073
1735 Ga0207708_10494553
1736 Ga0207702_10489169
1737 Ga0207702_11310573
1738 Ga0207648_10223064
1739 Ga0207676_10037982
1740 Ga0207676_10084122
1741 Ga0207676_10909574
1742 Ga0207674_10155258
1743 Ga0207674_10317937
1744 Ga0207674_10354615
1745 Ga0207675_100036255
1746 Ga0207675_100913085
1747 Ga0207698_10172821
1748 Ga0207698_11035642
1749 Ga0209281_1000164
1750 Ga0209281_1000332
1751 Ga0209281_1026144
1752 Ga0209282_1000007
1753 Ga0209813_10000060
1754 Ga0207428_10893559
1755 Ga0268266_10137298
1756 Ga0268266_10291785
1757 Ga0268266_10615116
1758 Ga0268265_10003419
1759 Ga0268265_10029713
1760 Ga0268265_10088850
1761 Ga0268265_10211716
1762 Ga0268265_10337359
1763 Ga0268265_10988257
1764 Ga0268265_11027405
1765 Ga0307517_10663691
1766 Ga0316183_1130216
1767 Ga0316182_1057985
1768 Ga0316182_1346917
1769 Ga0265327_10205876
1770 Ga0307408_100014062
1771 Ga0307408_100014343
1772 Ga0307408_100051353
1773 Ga0307408_100205582
1774 Ga0307408_100284185
1775 Ga0307408_100506918
1776 Ga0307408_100940828
1777 Ga0307408_100978124
1778 Ga0307408_101310604
1779 Ga0307508_10617556
1780 Ga0307405_10028431
1781 Ga0307405_10150063
1782 Ga0307405_10171440
1783 Ga0307405_10175716
1784 Ga0307405_10218556
1785 Ga0307405_10237047
1786 Ga0307405_10450756
1787 Ga0307405_10478248
1788 Ga0307405_10532523
1789 Ga0307405_10552705
1790 Ga0307405_10654518
1791 Ga0307405_10991783
1792 Ga0307405_11077023
1793 Ga0307405_11159996
1794 Ga0307405_11937040
1795 Ga0307405_11973666
1796 Ga0307413_10007256
1797 Ga0307413_10008368
1798 Ga0307413_10010474
1799 Ga0307413_10019834
1800 Ga0307413_10022551
1801 Ga0307413_10027919
1802 Ga0307413_10043051
1803 Ga0307413_10098545
1804 Ga0307413_10111022
1805 Ga0307413_10138431
1806 Ga0307413_10178685
1807 Ga0307413_10286121
1808 Ga0307413_10316911
1809 Ga0307413_10329468
1810 Ga0307413_10370861
1811 Ga0307413_10560691
1812 Ga0307413_10728860
1813 Ga0307413_11162028
1814 Ga0307413_11438799
1815 Ga0307413_11877905
1816 Ga0307410_10001306
1817 Ga0307410_10002517
1818 Ga0307410_10006279
1819 Ga0307410_10016162
1820 Ga0307410_10023487
1821 Ga0307410_10025207
1822 Ga0307410_10026018
1823 Ga0307410_10073764
1824 Ga0307410_10074789
1825 Ga0307410_10075397
1826 Ga0307410_10084136
1827 Ga0307410_10085590
1828 Ga0307410_10096733
1829 Ga0307410_10127116
1830 Ga0307410_10140780
1831 Ga0307410_10187292
1832 Ga0307410_10392738
1833 Ga0307410_10422442
1834 Ga0307410_10499925
1835 Ga0307410_10557598
1836 Ga0307410_10672132
1837 Ga0307410_10710187
1838 Ga0307410_10781805
1839 Ga0307410_11357223
1840 Ga0307410_11860803
1841 Ga0307406_10042227
1842 Ga0307406_10042588
1843 Ga0307406_10056261
1844 Ga0307406_10099950
1845 Ga0307406_10198552
1846 Ga0307406_10284792
1847 Ga0307406_10310536
1848 Ga0307406_10359750
1849 Ga0307406_10404327
1850 Ga0307406_10405980
1851 Ga0307406_10451414
1852 Ga0307406_10544977
1853 Ga0307406_10793946
1854 Ga0307406_10951626
1855 Ga0307406_11047220
1856 Ga0307406_11144917
1857 Ga0307406_11200408
1858 Ga0307406_11201478
1859 Ga0307407_10002403
1860 Ga0307407_10030175
1861 Ga0307407_10284270
1862 Ga0307407_10329137
1863 Ga0307407_10333136
1864 Ga0307407_10339967
1865 Ga0307407_10342885
1866 Ga0307407_10384831
1867 Ga0307407_10557376
1868 Ga0307407_10594231
1869 Ga0307407_10758836
1870 Ga0307407_10923648
1871 Ga0307407_10948066
1872 Ga0307412_10019162
1873 Ga0307412_10030284
1874 Ga0307412_10046470
1875 Ga0307412_10046997
1876 Ga0307412_10053016
1877 Ga0307412_10159729
1878 Ga0307412_10308610
1879 Ga0307412_10342024
1880 Ga0307412_10382225
1881 Ga0307412_10434754
1882 Ga0307412_10483313
1883 Ga0307412_10580729
1884 Ga0307412_10771205
1885 Ga0307412_10863175
1886 Ga0307412_11060993
1887 Ga0307412_11220739
1888 Ga0307412_11442023
1889 Ga0307412_11501969
1890 Ga0307412_11557808
1891 Ga0315914_1000006
1892 Ga0307409_100000217
1893 Ga0307409_100004848
1894 Ga0307409_100035151
1895 Ga0307409_100036117
1896 Ga0307409_100082523
1897 Ga0307409_100108162
1898 Ga0307409_100135464
1899 Ga0307409_100154764
1900 Ga0307409_100154851
1901 Ga0307409_100191360
1902 Ga0307409_100224574
1903 Ga0307409_100281961
1904 Ga0307409_100405469
1905 Ga0307409_100453122
1906 Ga0307409_100454096
1907 Ga0307409_100524748
1908 Ga0307409_100569832
1909 Ga0307409_100650992
1910 Ga0307409_100656591
1911 Ga0307409_100693902
1912 Ga0307409_100823870
1913 Ga0307409_100888193
1914 Ga0307409_101019133
1915 Ga0307409_101619202
1916 Ga0307409_102702423
1917 Ga0307416_100008213
1918 Ga0307416_100014578
1919 Ga0307416_100027573
1920 Ga0307416_100053742
1921 Ga0307416_100136130
1922 Ga0307416_100278501
1923 Ga0307416_100321447
1924 Ga0307416_100342349
1925 Ga0307416_100359682
1926 Ga0307416_100431452
1927 Ga0307416_100432819
1928 Ga0307416_100458297
1929 Ga0307416_100460002
1930 Ga0307416_100739987
1931 Ga0307416_100755504
1932 Ga0307416_100895295
1933 Ga0307416_100960212
1934 Ga0307416_101623611
1935 Ga0307416_101918966
1936 Ga0307416_102131873
1937 Ga0307416_102508581
1938 Ga0307416_103151597
1939 Ga0307416_103752870
1940 Ga0307414_10000346
1941 Ga0307414_10000797
1942 Ga0307414_10001040
1943 Ga0307414_10006477
1944 Ga0307414_10009428
1945 Ga0307414_10012420
1946 Ga0307414_10036346
1947 Ga0307414_10055229
1948 Ga0307414_10058244
1949 Ga0307414_10085171
1950 Ga0307414_10133550
1951 Ga0307414_10190603
1952 Ga0307414_10194198
1953 Ga0307414_10224063
1954 Ga0307414_10544913
1955 Ga0307414_10605597
1956 Ga0307414_10829788
1957 Ga0307414_10998148
1958 Ga0307414_11092276
1959 Ga0307414_11232535
1960 Ga0307414_12134026
1961 Ga0307414_12168157
1962 Ga0307411_10000748
1963 Ga0307411_10001464
1964 Ga0307411_10003067
1965 Ga0307411_10006109
1966 Ga0307411_10009598
1967 Ga0307411_10027126
1968 Ga0307411_10029138
1969 Ga0307411_10044982
1970 Ga0307411_10108630
1971 Ga0307411_10135937
1972 Ga0307411_10138660
1973 Ga0307411_10191879
1974 Ga0307411_10222851
1975 Ga0307411_10244720
1976 Ga0307411_10256430
1977 Ga0307411_10409819
1978 Ga0307411_10480958
1979 Ga0307411_10484507
1980 Ga0307411_10500253
1981 Ga0307411_10536708
1982 Ga0307411_10560322
1983 Ga0307411_10578869
1984 Ga0307411_10671252
1985 Ga0307411_10991978
1986 Ga0307411_11187869
1987 Ga0307411_11263107
1988 Ga0307411_11331501
1989 Ga0307411_11593361
1990 Ga0307411_11645092
1991 Ga0307411_11878271
1992 Ga0307415_100002106
1993 Ga0307415_100006836
1994 Ga0307415_100064731
1995 Ga0307415_100067602
1996 Ga0307415_100107648
1997 Ga0307415_100163828
1998 Ga0307415_100164200
1999 Ga0307415_100211123
2000 Ga0307415_100299510
2001 Ga0307415_100600128
2002 Ga0307415_101131026
2003 Ga0307415_101624711
2004 Ga0307415_101686709
2005 Ga0315913_1000002
2006 Ga0315915_1000001
2007 Ga0373941_0270863
2008 Ga0373931_0370185
2009 Ga0395899_0000124
2010 Ga0395900_0000086
2011 Ga0395900_0542594
2012 Ga0395898_0000285
2013 Ga0395905_0000133
2014 Ga0395905_0357035
2015 Ga0395905_0448397
2016 Ga0395905_0734928
2017 Ga0395905_0738849
2018 Ga0395905_0844519
2019 Ga0395905_0966085
2020 Ga0395901_0000092
2021 Ga0395901_0623049
2022 Ga0395901_0996682
2023 Ga0436365_0105016
2024 Ga0439436_0030162
2025 Ga0439438_024814
2026 Ga0439465_0011348
2027 Ga0439465_0053742
2028 Ga0451791_0343439
2029 Ga0451791_0456541
2030 Ga0451793_0443755
2031 Ga0451807_0663369
2032 Ga0451807_2638188
2033 Ga0451807_2716419
2034 Ga0451835_0321473
2035 Ga0451837_0281783
2036 Ga0451837_0877181
2037 Ga0451837_1015036
2038 Ga0451839_1273499
2039 Ga0451841_0095796
2040 Ga0451841_0230948
2041 Ga0451845_0468910
2042 Ga0451853_3825811
2043 Ga0439431_0272600
2044 Ga0439445_0000389
2045 Ga0439432_098194
2046 Ga0439432_204285
2047 Ga0439449_0004505
2048 Ga0439449_0078415
2049 Ga0439449_0124791
2050 Ga0439449_0125927
2051 Ga0439449_0161858
2052 Ga0439452_055554
2053 Ga0439457_039816
2054 Ga0439462_0071060
2055 Ga0439462_0074065
2056 Ga0439462_0242360
2057 Ga0450912_024682
2058 Ga0450920_029182
2059 Ga0450894_079262
2060 Ga0450907_020776
2061 Ga0439446_0038165
2062 Ga0439434_0033026
2063 Ga0439434_0220219
2064 Ga0439434_0266696
2065 Ga0439464_0315881
2066 Ga0450918_077345
2067 Ga0450901_011938
2068 Ga0451577_0507762
2069 Ga0453684_0203560
2070 Ga0466967_1187677
2071 Ga0495617_129242
2072 Ga0495638_0010960
2073 Ga0495638_0014449
2074 Ga0495638_0034944
2075 Ga0495638_0549108
2076 Ga0495596_0264005
2077 Ga0495607_0009645
2078 Ga0495583_0046142
2079 Ga0495606_0080835
2080 Ga0495606_0566136
2081 Ga0495606_0589518
2082 Ga0495610_0084939
2083 Ga0495610_0209922
2084 Ga0495620_0300627
2085 Ga0495632_0012798
2086 Ga0495643_0019902
2087 Ga0495648_0103025
2088 Ga0495663_0001773
2089 Ga0495663_0022610
2090 Ga0495663_0035591
2091 Ga0495663_0102981
2092 Ga0495663_0270116
2093 Ga0495642_0182352
2094 Ga0495654_0010554
2095 Ga0495654_0360229
2096 Ga0495598_0016102
2097 Ga0495598_0081258
2098 Ga0495598_0084910
2099 Ga0495621_0001191
2100 Ga0495621_0001733
2101 Ga0495621_0039729
2102 Ga0495597_0037563
2103 Ga0495622_0220692
2104 Ga0495633_0359128
2105 Ga0495668_0000004
2106 Ga0495668_0648659
2107 Ga0495625_0000553
2108 Ga0495625_0016088
2109 Ga0495625_0035484
2110 Ga0495625_0159861
2111 Ga0495625_0382484
2112 Ga0495659_0086772
2113 Ga0495659_0156568
2114 Ga0495659_0528271
2115 Ga0495588_0101380
2116 Ga0495669_0000602
2117 Ga0495669_0077318
2118 Ga0495670_0004937
2119 Ga0495670_0009300
2120 Ga0495670_0052728
2121 Ga0495670_0123687
2122 Ga0495670_0248402
2123 Ga0495670_0349574
2124 Ga0495670_0501266
2125 Ga0495671_0017144
2126 Ga0495671_0030512
2127 Ga0495671_0038954
2128 Ga0495589_0276032
2129 Ga0495660_0023484
2130 Ga0495677_0024775
2131 Ga0495677_0027004
2132 Ga0495677_0208479
2133 Ga0495681_0082006
2134 Ga0495681_0118381
2135 Ga0495686_0012540
2136 Ga0495686_0067518
2137 Ga0495686_0259720
2138 Ga0496100_0613825
2139 Ga0496101_0748635
2140 Ga0496102_0250891
2141 Ga0496106_0973151
2142 Ga0496107_0386275
2143 Ga0496108_0067853
2144 Ga0496109_0485983
2145 Ga0496109_0513593
2146 Ga0496109_0528814
2147 Ga0496110_0001413
2148 Ga0496111_0368954
2149 Ga0496114_0391067
2150 Ga0496115_0010329
2151 Ga0496115_1372783
2152 Ga0496117_0205089
2153 Ga0496118_0019743
2154 Ga0496119_0088685
2155 Ga0496120_0366153
2156 Ga0496121_0220606
2157 Ga0496121_0448158
2158 Ga0496122_0000416
2159 Ga0496123_0000460
2160 Ga0496123_0002043
2161 Ga0496124_0066588
2162 Ga0496124_0125990
2163 Ga0496124_0212210
2164 Ga0496125_0006717
2165 Ga0496125_0222569
2166 Ga0496126_0310346
2167 Ga0496126_0316405
2168 Ga0496126_0618377
2169 Ga0496126_0635387
2170 Ga0496126_1149026
2171 Ga0501031_0000016
2172 Ga0501031_0027499
2173 Ga0501031_0099578
2174 Ga0501031_0102979
2175 Ga0501032_0000044
2176 Ga0501032_0094726
2177 Ga0501032_0182038
2178 Ga0501032_0326164
2179 Ga0501033_0000052
2180 Ga0501033_0050698
2181 Ga0501033_0081474
2182 Ga0501033_0336342
2183 Ga0501033_0435063
2184 Ga0501034_0000212
2185 Ga0501034_0069338
2186 Ga0501034_0106196
2187 Ga0501034_0488781
2188 Ga0501034_0827334
2189 Ga0501036_0000022
2190 Ga0501036_0025253
2191 Ga0501036_0153146
2192 Ga0501036_0859510
2193 Ga0501037_0000052
2194 Ga0501037_0045871
2195 Ga0501037_0238039
2196 Ga0501037_0301995
2197 Ga0501037_0392552
2198 Ga0501037_0564047
2199 Ga0501038_0000044
2200 Ga0501038_0030959
2201 Ga0501038_0155608
2202 Ga0501038_0276789
2203 Ga0501039_0000042
2204 Ga0501039_0007777
2205 Ga0501039_0323905
2206 Ga0501040_0057517
2207 Ga0501040_0118622
2208 Ga0501043_0000054
2209 Ga0501043_0016295
2210 Ga0501043_0137547
2211 Ga0501046_0147468
2212 Ga0501046_0519621
2213 Ga0501047_0000247
2214 Ga0501047_0172411
2215 Ga0501068_0189543
2216 Ga0501068_0629984
2217 Ga0501070_0363765
2218 Ga0501072_0015756
2219 Ga0501072_0108654
2220 Ga0501073_0216155
2221 Ga0501073_0496014
2222 Ga0501074_0385756
2223 Ga0501074_1311875
2224 Ga0501075_0194058
2225 Ga0501202_113772
2226 Ga0501224_005346
2227 Ga0501238_027115
2228 Ga0501249_038320
2229 Ga0501079_0724422
2230 Ga0501081_0012442
2231 Ga0501262_013742
2232 Ga0501262_065171
2233 Ga0501268_086003
2234 Ga0501269_005517
2235 Ga0501279_066484
2236 Ga0501035_0000095
2237 Ga0501035_0023615
2238 Ga0501035_0297143
2239 Ga0501035_0363431
2240 Ga0501044_0000091
2241 Ga0501044_0000280
2242 Ga0501044_0027138
2243 Ga0501044_0172718
2244 Ga0501045_0024385
2245 Ga0501045_0651172
2246 nmdc:mga03683_721_c1
2247 nmdc:mga03n38_59950_c1
2248 nmdc:mga0yw44_31385_c1
2249 nmdc:mga0yw44_81252_c1
2250 nmdc:mga0k408_104336_c1
2251 nmdc:mga0k408_323284_c1
2252 nmdc:mga0k408_492351_c1
2253 nmdc:mga06z11_388_c1
2254 nmdc:mga04h51_73_c1
2255 nmdc:mga07m45_251251_c1
2256 nmdc:mga07m45_330852_c1
2257 nmdc:mga07m45_47316_c1
2258 nmdc:mga07m45_5_c2
2259 nmdc:mga07m45_979_c1
2260 nmdc:mga09592_1279878_c1
2261 nmdc:mga08y16_1245842_c1
2262 nmdc:mga08y16_406877_c1
2263 nmdc:mga0sz30_209_c1
2264 nmdc:mga0sz30_351964_c1
2265 nmdc:mga0sz30_382860_c1
2266 nmdc:mga0sz30_9804_c1
2267 Ga0500643_002982
2268 Ga0500643_030835
2269 Ga0500643_218016
2270 Ga0500651_0336984
2271 Ga0500650_0054600
2272 Ga0500555_059803
2273 Ga0500556_0000339
2274 Ga0500562_025902
2275 Ga0500569_009439
2276 Ga0500592_020911
2277 Ga0500592_027000
2278 Ga0500595_023762
2279 Ga0500608_000105
2280 Ga0500608_000764
2281 Ga0500642_0000001
2282 Ga0500658_0000769
2283 Ga0500658_0358583
2284 Ga0500559_0312546
2285 Ga0500568_0001734
2286 Ga0500568_0051944
2287 Ga0500568_0081725
2288 Ga0500573_0006606
2289 Ga0500573_0285408
2290 Ga0500616_0000421
2291 Ga0500616_0039441
2292 Ga0500616_0318064
2293 Ga0500622_0030266
2294 Ga0500627_0000049
2295 Ga0500627_0479965
2296 Ga0500636_0000156
2297 Ga0500645_000312
2298 Ga0501084_0819463
2299 Ga0501084_1141472
2300 Ga0501082_0275088
2301 Ga0501082_1747598
2302 Ga0501082_2037177
2303 2509079156
2304 2509108476
2305 2509374497
2306 2510134718
2307 2510306608
2308 2510896067
2309 2511500971
2310 2512972287
2311 2513583491
2312 2513603366
2313 2513620774
2314 2513631444
2315 2513710622
2316 2513881140
2317 2513907125
2318 2513983971
2319 2514004821
2320 2514023732
2321 2515608086
2322 2515634671
2323 2515646027
2324 2515656906
2325 2515743529
2326 2516208840
2327 2516892252
2328 2517037420
2329 2517077717
2330 2517410616
2331 2517569048
2332 2520377860
2333 2524451186
2334 2551676431
2335 2551687212
2336 2551692941
2337 2551703186
2338 2551712353
2339 2551720674
2340 2551731098
2341 2551731976
2342 2551740402
2343 2558863524
2344 2585270292
2345 2585388731
2346 2585541139
2347 2585839902
2348 2587919815
2349 2616295438
2350 2643820086
2351 2643836387
2352 2643910490
2353 2644052863
2354 2644109039
2355 2644151560
2356 2644223557
2357 2644236353
2358 2644311695
2359 2644329952
2360 2644494368
2361 2644546626
2362 2644617494
2363 2657683308
2364 2692316866
2365 2725947705
2366 2739035691
2367 2753460768
2368 2766065449
2369 2792622724
2370 2792628355
2371 2793319840
2372 2793328156
2373 2793362933
2374 2793370041
2375 2802717691
2376 2802723381
2377 2802731168
2378 2802736175
2379 2802743615
2380 2802750673
2381 2804751302
2382 2806044678
2383 2806052878
2384 2806059178
2385 2806068159
2386 2806074279
2387 2838046371
2388 2838076400
2389 2838685079
2390 2838691449
2391 2838699084
2392 2838712565
2393 2838733408
2394 2838746020
2395 2841853732
2396 2842082042
2397 2842113565
2398 2842122964
2399 2842162261
2400 2842169816
2401 2842185187
2402 2842208184
2403 2842220204
2404 2842233674
2405 2842242133
2406 2842247718
2407 2842262014
2408 2842275923
2409 2842281807
2410 2842296042
2411 2842308093
2412 2842375757
2413 2842382441
2414 2842389842
2415 2844168563
2416 2844457623
2417 2847418068
2418 2848993042
2419 2850080437
2420 2852653987
2421 2855831322
2422 2855840447
2423 2855879180
2424 2857505938
2425 2857519032
2426 2858800976
2427 2867512749
2428 2896386601
2429 2913297483
2430 2915986171
2431 2915990591
2432 2915996261
2433 2916005739
2434 2916010926
2435 2916016563
2436 2916024762
2437 2916032181
2438 2916038164
2439 2916047184
2440 2916053212
2441 2916055358
2442 2916062822
2443 2916074961
2444 2916079315
2445 2920762914
2446 2921205724
2447 2921213530
2448 2921241622
2449 2921247516
2450 2921250953
2451 2921260005
2452 2921264235
2453 2921282768
2454 2921290130
2455 2921299967
2456 2924145600
2457 2924155881
2458 2924160573
2459 2924168151
2460 2924177847
2461 2924186314
2462 2924189512
2463 2924198248
2464 2924204059
2465 2924209909
2466 2924215176
2467 2924226229
2468 2924234934
2469 2928531957
2470 2929202040
2471 2932402362
2472 2933574542
2473 2933589145
2474 2935899854
2475 2935907025
2476 2936374993
2477 2936380684
2478 2937009514
2479 2937010886
2480 2937018984
2481 2937027925
2482 2937029868
2483 2937036894
2484 2937048989
2485 2937056284
2486 2937061298
2487 2937064388
2488 2937072868
2489 2937082975
2490 2937091253
2491 2937095589
2492 2937103635
2493 2937109776
2494 2937118318
2495 2937121185
2496 2937129819
2497 2941500262
2498 2957380027
2499 2957385069
2500 2957389132
2501 2957396752
2502 2957405448
2503 2957413251
2504 2957419199
2505 2957427733
2506 2957431091
2507 2957441965
2508 2957446653
2509 2957454190
2510 2957462450
2511 2957467748
2512 2957477790
2513 2957480628
2514 2957485790
2515 2957495994
2516 2957501036
2517 2957509592
2518 2960586644
2519 2960595571
2520 2960600575
2521 2960609475
2522 2960616786
2523 2960617704
2524 2960625692
2525 2960633228
2526 2960640207
2527 2960648728
2528 2960653707
2529 2960666405
2530 2960673925
2531 2960678832
2532 2960684160
2533 2960692024
2534 2960696371
2535 2964610231
2536 2964620008
2537 2964627807
2538 2964633117
2539 2964641282
2540 2964646161
2541 2964653103
2542 2964661884
2543 2964665972
2544 2964671686
2545 2964681098
2546 2964688108
2547 2964695841
2548 2964703595
2549 2964708094
2550 2964716299
2551 2964726457
2552 2967667371
2553 2967672144
2554 2967681043
2555 2967686413
2556 2967693246
2557 2967704240
2558 2967712948
2559 2967716529
2560 2967724587
2561 2967734737
2562 2967737580
2563 2967747873
2564 2967752105
2565 2967756314
2566 2967764431
2567 2967770792
2568 2967782177
2569 2970026071
2570 2970031791
2571 2970037802
2572 2970043285
2573 2970052887
2574 2970059608
2575 2970065294
2576 2970069514
2577 2970076969
2578 2970085648
2579 2970093308
2580 2970096866
2581 2970106929
2582 2970109819
2583 2970117968
2584 2970124461
2585 2970129518
2586 2970143150
2587 2970148648
2588 2970153814
2589 2970163692
2590 2970167504
2591 2970171794
2592 2970182814
2593 2970188255
2594 2970198324
2595 2977518434
2596 2977527656
2597 2977531897
2598 2977537989
2599 2977544930
2600 2977551987
2601 2977561672
2602 2977568982
2603 2977578961
2604 2977581494
2605 3005415621
2606 639649880
2607 643825045
2608 648736366
2609 8003992945
2610 8004000181
2611 8005294413
2612 8005310832
2613 8005378316
2614 8005383961
2615 8005401289
2616 8005558509
2617 8005566647
2618 8005575064
2619 8018133735
2620 8018170091
2621 8024481658
2622 8055911039
2623 8056381461
2624 8057876697

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

33

82

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

35

82

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9328 5 92
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9266 16 74
8iuh-assembly1.cif.gz_P rna polymerase iii pre-initiation complex open complex 1 0.9228 17 74
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9212 1 93
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9164 6 92
ID Description Score Start End Superfamily
1wq2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9266 16 74 1.10.10.10
af_D3ZQ56_68_132_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9254 17 75 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9164 6 92 1.10.10.10
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9153 16 75 1.10.10.10
af_Q9VD25_2_64_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9126 17 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A532DH07-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9871 1 83 GO:0003700
AF-A0A3S1TWI8-F1-model_v4 deleted 0.9776 1 91
AF-A0A4Q5ZG98-F1-model_v4 deleted 0.9712 1 81
AF-A0A7C3DR54-F1-model_v4 ArsR family transcriptional regulator 0.9676 5 84 GO:0003700
AF-M6KC98-F1-model_v4 DNA-binding helix-turn-helix protein 0.9664 1 75 GO:0003677
GO:0003700

Map