F492898

General Info

Members Datasets Scaffolds Average Seq Length
1313 591 1208 102

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0003210|Ga0466962_0003210_1505_1846
Length 113
Sequence VIAVLGLVVGVVAGVAGLLVRPEVPAVVEPYLPIAVVAALDAVFGGLRAMLDGIFDDKVFVVSFLSNVVVAALIVFLGDKLGVGAQLSTGVVVVLGIRIFSNAAAIRRHVFRA

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221647 Streptomyces sp. Root369 Isolate Unclassified
11 2643221670 Streptomyces sp. Root431 Isolate Unclassified
12 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
13 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
14 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
15 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
16 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
17 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
18 2643221714 Streptomyces sp. Root264 Isolate Unclassified
19 2643221721 Oerskovia sp. Root918 Isolate Unclassified
20 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
21 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
22 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
23 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
24 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
25 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
26 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
27 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
28 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
29 2808606448 Streptomyces sp. 193411 Isolate Unclassified
30 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
31 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
32 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
33 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
34 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
35 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
36 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
37 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
38 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
39 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
40 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
41 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
42 2862574272 Streptomyces sp. AcE210 Isolate Nodule
43 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
44 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
45 2867369537 Streptomyces sp. Z26 Isolate Unclassified
46 2867428634 Streptomyces sp. RP5T Isolate Unclassified
47 2867475112 Streptomyces sp. TM32 Isolate Unclassified
48 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
49 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
50 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
51 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
52 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
53 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
54 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
55 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
56 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
57 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
58 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
59 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
60 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
61 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
62 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
63 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
64 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
65 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
66 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
67 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
68 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
69 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
70 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
71 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
72 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
73 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
74 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
75 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
76 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
77 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
78 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
79 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
80 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
81 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
82 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
83 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
84 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
85 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
86 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
87 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
88 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
89 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
90 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
91 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
93 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
94 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
96 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
97 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
98 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
99 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
100 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
101 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
102 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
103 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
104 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
105 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
106 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
107 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
108 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
109 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
110 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
111 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
112 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
113 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
114 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
115 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
116 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
117 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
118 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
119 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
120 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
121 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
122 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
123 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
124 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
125 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
126 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
127 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
128 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
129 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
130 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
131 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
132 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
133 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
134 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
135 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
136 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
137 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
138 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
139 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
140 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
141 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
142 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
143 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
144 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
145 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
146 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
147 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
148 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
149 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
150 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
151 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
152 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
153 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
154 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
155 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
156 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
157 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
158 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
159 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
160 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
161 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
162 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
163 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
164 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
165 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
166 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
167 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
168 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
169 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
170 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
171 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
172 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
173 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
174 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
175 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
176 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
177 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
178 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
179 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
180 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
181 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
182 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
183 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
184 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
185 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
186 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
187 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
188 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
189 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
190 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
191 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
192 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
193 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
194 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
195 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
196 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
197 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
198 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
199 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
200 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
201 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
202 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
203 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
204 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
205 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
206 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
207 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
208 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
209 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
210 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
211 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
212 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
213 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
214 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
215 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
216 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
217 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
218 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
219 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
220 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
221 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
222 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
223 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
224 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
226 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
227 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
228 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
229 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
230 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
231 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
295 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
299 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
300 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
301 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
302 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
303 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
304 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
305 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
306 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
307 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
308 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
309 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
310 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
311 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
312 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
313 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
314 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
315 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
316 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
317 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
318 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
319 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
320 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
321 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
322 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
323 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
324 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
325 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
326 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
327 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
328 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
329 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
330 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
331 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
332 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
333 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
334 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
335 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
336 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
337 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
338 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
339 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
340 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
341 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
342 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
343 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
344 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
345 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
346 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
347 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
348 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
349 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
350 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
351 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
352 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
353 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
354 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
355 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
356 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
357 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
358 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
359 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
360 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
361 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
362 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
363 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
364 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
365 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
366 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
367 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
368 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
369 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
370 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
371 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
372 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
373 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
374 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
375 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
376 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
377 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
378 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
379 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
380 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
381 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
382 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
383 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
384 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
385 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
386 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
387 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
388 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
389 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
390 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
391 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
392 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
393 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
394 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
395 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
396 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
397 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
398 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
399 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
400 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
401 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
402 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
403 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
404 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
405 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
406 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
407 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
408 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
409 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
410 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
411 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
412 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
413 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
414 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
415 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
416 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
417 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
418 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
419 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
420 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
421 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
422 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
423 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
424 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
425 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
426 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
427 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
428 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
429 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
430 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
431 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
432 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
433 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
434 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
435 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
436 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
437 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
438 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
439 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
440 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
441 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
442 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
443 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
444 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
445 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
446 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
447 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
448 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
449 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
450 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
451 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
452 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
453 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
454 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
455 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
456 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
457 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
458 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
459 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
460 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
461 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
462 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
463 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
464 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
465 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
466 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
467 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
468 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
469 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
470 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
471 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
472 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
473 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
474 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
475 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
476 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
477 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
478 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
479 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
480 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
481 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
482 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
483 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
484 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
485 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
486 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
487 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
488 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
489 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
490 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
491 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
492 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
493 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
494 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
495 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
496 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
497 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
498 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
499 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
500 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
501 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
502 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
503 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
504 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
505 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
506 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
507 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
508 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
509 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
510 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
511 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
512 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
514 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
519 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
520 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
521 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
522 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
523 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
524 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
525 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
526 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
527 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
528 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
529 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
530 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
531 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
532 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
533 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
534 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
535 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
536 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
537 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
538 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
539 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
542 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
543 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
544 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
545 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
546 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
547 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
548 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
549 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
550 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
551 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
552 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
553 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
554 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
555 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
556 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
557 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
558 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
559 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
560 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
561 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
562 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
563 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
564 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
565 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
566 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
567 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
568 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
569 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
570 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
571 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
572 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
573 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
574 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
575 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
576 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
577 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
578 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
579 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
580 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
581 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
582 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
583 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
584 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
585 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
586 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
587 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
588 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
589 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
590 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
591 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.71
Metatranscriptomes 1.29
Isolates 8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0.3
Rhizoplane 7.84
Rhizosphere 81.95
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1022420 3300000549 Bacteria 733
2 JGI24737J22298_10241717 3300001990 Bacteria 533
3 JGI24738J21930_10047848 3300002075 Bacteria 870
4 JGI24744J21845_10012255 3300002077 Bacteria 1743
5 JGI25406J46586_10004005 3300003203 Bacteria 6891
6 rootH2_10017275 3300003320 Bacteria 4833
7 rootH1_10088192 3300003323 Bacteria 2175
8 JGI25407J50210_10065969 3300003373 Bacteria 906
9 Ga0070658_10416434 3300005327 Bacteria 1155
10 Ga0070658_10951039 3300005327 Bacteria 747
11 Ga0070658_11399344 3300005327 Bacteria 607
12 Ga0070676_11176609 3300005328 Bacteria 582
13 Ga0070676_11240252 3300005328 Bacteria 568
14 Ga0070683_100057355 3300005329 Bacteria 3618
15 Ga0070683_100079089 3300005329 Bacteria 3077
16 Ga0070683_100099266 3300005329 Bacteria 2740
17 Ga0070683_100692307 3300005329 Bacteria 976
18 Ga0070683_101004593 3300005329 Bacteria 801
19 Ga0070683_101371616 3300005329 Bacteria 679
20 Ga0070670_101796132 3300005331 Bacteria 564
21 Ga0068869_100237561 3300005334 Bacteria 1451
22 Ga0070666_10003317 3300005335 Bacteria 9754
23 Ga0070666_10064975 3300005335 Bacteria 2475
24 Ga0070680_100363401 3300005336 Bacteria 1231
25 Ga0070680_100375671 3300005336 Bacteria 1210
26 Ga0070680_100466470 3300005336 Bacteria 1079
27 Ga0070680_100624983 3300005336 Bacteria 925
28 Ga0070680_101019198 3300005336 Bacteria 715
29 Ga0070680_101137063 3300005336 Bacteria 675
30 Ga0070682_100031446 3300005337 Bacteria 3210
31 Ga0070682_100347102 3300005337 Bacteria 1105
32 Ga0070682_101123379 3300005337 Bacteria 659
33 Ga0068868_100488411 3300005338 Bacteria 1077
34 Ga0070660_100087316 3300005339 Bacteria 2455
35 Ga0070660_100322337 3300005339 Bacteria 1269
36 Ga0070660_100583841 3300005339 Bacteria 933
37 Ga0070660_101506886 3300005339 Bacteria 572
38 Ga0070689_100098074 3300005340 Bacteria 2318
39 Ga0070689_100320167 3300005340 Bacteria 1295
40 Ga0070691_10178261 3300005341 Bacteria 1105
41 Ga0070687_100202557 3300005343 Bacteria 1203
42 Ga0070661_100103154 3300005344 Bacteria 2124
43 Ga0070661_100241199 3300005344 Bacteria 1392
44 Ga0070692_10027073 3300005345 Bacteria 2839
45 Ga0070692_10491384 3300005345 Bacteria 793
46 Ga0070668_100002900 3300005347 Bacteria 12663
47 Ga0070668_100369390 3300005347 Bacteria 1218
48 Ga0070669_100030781 3300005353 Bacteria 3874
49 Ga0070669_101798354 3300005353 Bacteria 535
50 Ga0070675_101509305 3300005354 Bacteria 620
51 Ga0070671_100021033 3300005355 Bacteria 5325
52 Ga0070674_100136314 3300005356 Bacteria 1836
53 Ga0070674_100313986 3300005356 Bacteria 1254
54 Ga0070674_100352446 3300005356 Bacteria 1189
55 Ga0070674_100767046 3300005356 Bacteria 830
56 Ga0070673_100005872 3300005364 Bacteria 7916
57 Ga0070688_100721125 3300005365 Bacteria 774
58 Ga0070659_100015723 3300005366 Bacteria 5670
59 Ga0070659_100333228 3300005366 Bacteria 1270
60 Ga0070659_100386821 3300005366 Bacteria 1179
61 Ga0070659_101817722 3300005366 Bacteria 546
62 Ga0070667_100006026 3300005367 Bacteria 10075
63 Ga0070667_100021661 3300005367 Bacteria 5334
64 Ga0070703_10015033 3300005406 Bacteria 2212
65 Ga0070714_100498172 3300005435 Bacteria 1161
66 Ga0070714_101104250 3300005435 Bacteria 773
67 Ga0070713_100063224 3300005436 Bacteria 3102
68 Ga0070710_10318990 3300005437 Bacteria 1019
69 Ga0070701_10004746 3300005438 Bacteria 5548
70 Ga0070701_10047674 3300005438 Bacteria 2207
71 Ga0070711_100007302 3300005439 Bacteria 6720
72 Ga0070705_100009475 3300005440 Bacteria 4843
73 Ga0070705_101231193 3300005440 Bacteria 618
74 Ga0070700_100000406 3300005441 Bacteria 22003
75 Ga0070700_100779527 3300005441 Bacteria 768
76 Ga0070694_100993214 3300005444 Bacteria 696
77 Ga0070663_100033790 3300005455 Bacteria 3536
78 Ga0070663_100260717 3300005455 Bacteria 1375
79 Ga0070663_100522872 3300005455 Bacteria 988
80 Ga0070678_100025304 3300005456 Bacteria 3990
81 Ga0070662_100033899 3300005457 Bacteria 3598
82 Ga0070681_10005943 3300005458 Bacteria 11814
83 Ga0070681_10136451 3300005458 Bacteria 2384
84 Ga0070681_10466558 3300005458 Bacteria 1175
85 Ga0068867_100087869 3300005459 Bacteria 2354
86 Ga0070685_10903264 3300005466 Bacteria 657
87 Ga0070698_101341055 3300005471 Bacteria 666
88 Ga0070679_100003650 3300005530 Bacteria 14087
89 Ga0070679_100638187 3300005530 Bacteria 1008
90 Ga0070684_100144067 3300005535 Bacteria 2156
91 Ga0070684_100177198 3300005535 Bacteria 1938
92 Ga0070684_101048408 3300005535 Bacteria 766
93 Ga0070684_102035952 3300005535 Bacteria 542
94 Ga0070697_101314041 3300005536 Bacteria 645
95 Ga0068853_100135581 3300005539 Bacteria 2206
96 Ga0068853_100138197 3300005539 Bacteria 2186
97 Ga0068853_100661340 3300005539 Bacteria 995
98 Ga0070672_100115779 3300005543 Bacteria 2189
99 Ga0070672_100239782 3300005543 Bacteria 1525
100 Ga0070672_100518096 3300005543 Bacteria 1033
101 Ga0070672_102006595 3300005543 Bacteria 521
102 Ga0070686_100492382 3300005544 Bacteria 950
103 Ga0070695_100446010 3300005545 Bacteria 990
104 Ga0070696_100311025 3300005546 Bacteria 1209
105 Ga0070693_100118389 3300005547 Bacteria 1639
106 Ga0070693_100369792 3300005547 Bacteria 986
107 Ga0070665_100003227 3300005548 Bacteria 17526
108 Ga0070665_100055978 3300005548 Bacteria 3955
109 Ga0070665_100620528 3300005548 Bacteria 1094
110 Ga0070665_100785740 3300005548 Bacteria 965
111 Ga0070704_100037730 3300005549 Bacteria 3304
112 Ga0068855_100021450 3300005563 Bacteria 7745
113 Ga0068855_100057120 3300005563 Bacteria 4576
114 Ga0068855_100059143 3300005563 Bacteria 4485
115 Ga0068855_100424958 3300005563 Bacteria 1453
116 Ga0068855_100835986 3300005563 Bacteria 976
117 Ga0070664_100178256 3300005564 Bacteria 1888
118 Ga0070664_100999770 3300005564 Bacteria 786
119 Ga0068857_100452244 3300005577 Bacteria 1201
120 Ga0068857_101249726 3300005577 Bacteria 720
121 Ga0068854_100306816 3300005578 Bacteria 1286
122 Ga0068854_101810675 3300005578 Bacteria 560
123 Ga0068856_100088421 3300005614 Bacteria 3080
124 Ga0068856_100147033 3300005614 Bacteria 2364
125 Ga0068856_100174480 3300005614 Bacteria 2162
126 Ga0068856_100651890 3300005614 Bacteria 1073
127 Ga0068856_101404496 3300005614 Bacteria 712
128 Ga0070702_100033494 3300005615 Bacteria 2826
129 Ga0070702_100253317 3300005615 Bacteria 1194
130 Ga0068852_100020158 3300005616 Bacteria 5297
131 Ga0068852_100111044 3300005616 Bacteria 2492
132 Ga0068852_100674790 3300005616 Bacteria 1042
133 Ga0068859_100002361 3300005617 Bacteria 19217
134 Ga0068859_100221522 3300005617 Bacteria 1980
135 Ga0068859_100809523 3300005617 Bacteria 1024
136 Ga0068864_100041671 3300005618 Bacteria 3927
137 Ga0068866_10203000 3300005718 Bacteria 1186
138 Ga0068861_100048872 3300005719 Bacteria 3200
139 Ga0068861_100126857 3300005719 Bacteria 2066
140 Ga0068861_101266966 3300005719 Bacteria 716
141 Ga0068851_10058629 3300005834 Bacteria 1968
142 Ga0068851_10619920 3300005834 Bacteria 660
143 Ga0068870_10001067 3300005840 Bacteria 10886
144 Ga0068870_10083920 3300005840 Bacteria 1767
145 Ga0068863_100004882 3300005841 Bacteria 13214
146 Ga0068863_100073740 3300005841 Bacteria 3229
147 Ga0068858_100013689 3300005842 Bacteria 7655
148 Ga0068858_100039448 3300005842 Bacteria 4379
149 Ga0068858_102578238 3300005842 Bacteria 502
150 Ga0068860_100000035 3300005843 Bacteria 238993
151 Ga0068860_100042424 3300005843 Bacteria 4344
152 Ga0068860_101758013 3300005843 Bacteria 642
153 Ga0068862_100067953 3300005844 Bacteria 3074
154 Ga0068862_101820475 3300005844 Bacteria 618
155 Ga0081455_10002276 3300005937 Bacteria 22904
156 Ga0081455_10025771 3300005937 Bacteria 5422
157 Ga0081455_10041731 3300005937 Bacteria 4031
158 Ga0081455_10583797 3300005937 Bacteria 732
159 Ga0081538_10000036 3300005981 Bacteria 119944
160 Ga0081538_10056572 3300005981 Bacteria 2296
161 Ga0081538_10097228 3300005981 Bacteria 1497
162 Ga0081540_1010407 3300005983 Bacteria 6304
163 Ga0081539_10000643 3300005985 Bacteria 70438
164 Ga0070717_10034948 3300006028 Bacteria 4065
165 Ga0070717_11384185 3300006028 Bacteria 639
166 Ga0075365_10024472 3300006038 Bacteria 3810
167 Ga0075365_10060650 3300006038 Bacteria 2524
168 Ga0075365_10431348 3300006038 Bacteria 931
169 Ga0075365_10989443 3300006038 Bacteria 593
170 Ga0075368_10205485 3300006042 Bacteria 834
171 Ga0075363_100052481 3300006048 Bacteria 2176
172 Ga0075363_100297682 3300006048 Bacteria 936
173 Ga0075432_10063772 3300006058 Bacteria 1316
174 Ga0070715_10817501 3300006163 Bacteria 567
175 Ga0070712_100052549 3300006175 Bacteria 2842
176 Ga0070712_100945669 3300006175 Bacteria 744
177 Ga0075362_10726223 3300006177 Bacteria 519
178 Ga0075367_10007402 3300006178 Bacteria 5617
179 Ga0097621_100363228 3300006237 Bacteria 1290
180 Ga0097621_100371584 3300006237 Bacteria 1276
181 Ga0068871_100009798 3300006358 Bacteria 6951
182 Ga0068871_100446913 3300006358 Bacteria 1158
183 Ga0075428_100001304 3300006844 Bacteria 26458
184 Ga0075428_100089562 3300006844 Bacteria 3356
185 Ga0075428_100274270 3300006844 Bacteria 1815
186 Ga0075430_100006263 3300006846 Bacteria 10034
187 Ga0075430_100026196 3300006846 Bacteria 4962
188 Ga0075431_100002908 3300006847 Bacteria 16573
189 Ga0075431_100008250 3300006847 Bacteria 10415
190 Ga0075431_100012439 3300006847 Bacteria 8590
191 Ga0075433_10006767 3300006852 Bacteria 9086
192 Ga0075433_10291184 3300006852 Bacteria 1446
193 Ga0075434_100051928 3300006871 Bacteria 4073
194 Ga0075434_100511789 3300006871 Bacteria 1221
195 Ga0075429_100001324 3300006880 Bacteria 20208
196 Ga0075429_100005562 3300006880 Bacteria 10857
197 Ga0068865_100022810 3300006881 Bacteria 4090
198 Ga0068865_100039489 3300006881 Bacteria 3201
199 Ga0068865_101485019 3300006881 Bacteria 607
200 Ga0068865_101684194 3300006881 Bacteria 571
201 Ga0075436_100030843 3300006914 Bacteria 3689
202 Ga0097620_100002361 3300006931 Bacteria 19217
203 Ga0097620_100221504 3300006931 Bacteria 1980
204 Ga0097620_100809550 3300006931 Bacteria 1024
205 Ga0099826_10058874 3300006948 Bacteria 2516
206 Ga0075435_100250842 3300007076 Bacteria 1506
207 Ga0105251_10088971 3300009011 Bacteria 1420
208 Ga0105240_10012487 3300009093 Bacteria 11721
209 Ga0105240_10066086 3300009093 Bacteria 4488
210 Ga0105240_10138708 3300009093 Bacteria 2910
211 Ga0111539_10038306 3300009094 Bacteria 5783
212 Ga0111539_10564347 3300009094 Bacteria 1326
213 Ga0111539_11990147 3300009094 Bacteria 674
214 Ga0105245_10034424 3300009098 Bacteria 4493
215 Ga0105245_10066039 3300009098 Bacteria 3273
216 Ga0105245_10907041 3300009098 Bacteria 923
217 Ga0105245_11219824 3300009098 Bacteria 800
218 Ga0105247_10003264 3300009101 Bacteria 10634
219 Ga0105247_10013085 3300009101 Bacteria 4976
220 Ga0105247_10110891 3300009101 Bacteria 1766
221 Ga0114129_10026601 3300009147 Bacteria 8194
222 Ga0114129_10080508 3300009147 Bacteria 4527
223 Ga0105243_10017305 3300009148 Bacteria 5450
224 Ga0105243_10029336 3300009148 Bacteria 4229
225 Ga0105243_10421646 3300009148 Bacteria 1245
226 Ga0105243_11390273 3300009148 Bacteria 722
227 Ga0105241_10016040 3300009174 Bacteria 5491
228 Ga0105241_10092112 3300009174 Bacteria 2393
229 Ga0105241_10313472 3300009174 Bacteria 1350
230 Ga0105241_10818451 3300009174 Bacteria 859
231 Ga0105242_10090413 3300009176 Bacteria 2575
232 Ga0105242_10411505 3300009176 Bacteria 1265
233 Ga0105242_10534754 3300009176 Bacteria 1121
234 Ga0105242_10704143 3300009176 Bacteria 988
235 Ga0105248_10028128 3300009177 Bacteria 6262
236 Ga0105248_10094722 3300009177 Bacteria 3362
237 Ga0105248_11657239 3300009177 Bacteria 725
238 Ga0105237_10091480 3300009545 Bacteria 3032
239 Ga0105237_10261480 3300009545 Bacteria 1733
240 Ga0105237_10935616 3300009545 Bacteria 874
241 Ga0105237_11198280 3300009545 Bacteria 766
242 Ga0105237_11547122 3300009545 Bacteria 670
243 Ga0105237_12773299 3300009545 Bacteria 501
244 Ga0105238_10130917 3300009551 Bacteria 2487
245 Ga0105238_10413460 3300009551 Bacteria 1343
246 Ga0105238_10433003 3300009551 Bacteria 1311
247 Ga0105238_12241857 3300009551 Bacteria 581
248 Ga0105249_10135602 3300009553 Bacteria 2355
249 Ga0105249_10688100 3300009553 Bacteria 1082
250 Ga0105249_11302646 3300009553 Bacteria 798
251 Ga0105249_12470749 3300009553 Bacteria 592
252 Ga0105239_10362082 3300010375 Bacteria 1638
253 Ga0105239_10393835 3300010375 Bacteria 1567
254 Ga0105239_10589429 3300010375 Bacteria 1268
255 Ga0105239_10803279 3300010375 Bacteria 1078
256 Ga0105239_10871389 3300010375 Bacteria 1033
257 Ga0105246_10003223 3300011119 Bacteria 9905
258 Ga0105246_10383410 3300011119 Bacteria 1162
259 Ga0105246_10772831 3300011119 Bacteria 849
260 Ga0157373_10168923 3300013100 Bacteria 1539
261 Ga0157371_10365025 3300013102 Bacteria 1053
262 Ga0157371_10604129 3300013102 Bacteria 816
263 Ga0157370_10045502 3300013104 Bacteria 4210
264 Ga0157370_10194714 3300013104 Bacteria 1881
265 Ga0157370_10351827 3300013104 Bacteria 1358
266 Ga0157370_10717088 3300013104 Bacteria 912
267 Ga0157370_11449549 3300013104 Bacteria 617
268 Ga0157370_11781084 3300013104 Bacteria 553
269 Ga0157369_10018735 3300013105 Bacteria 7760
270 Ga0157369_10040889 3300013105 Bacteria 5060
271 Ga0157369_10087776 3300013105 Bacteria 3321
272 Ga0157369_10137846 3300013105 Bacteria 2582
273 Ga0157369_10174224 3300013105 Bacteria 2265
274 Ga0157369_10220041 3300013105 Bacteria 1988
275 Ga0157369_11059610 3300013105 Bacteria 829
276 Ga0157369_11539011 3300013105 Bacteria 676
277 Ga0157374_10567314 3300013296 Bacteria 1143
278 Ga0157374_11311054 3300013296 Bacteria 746
279 Ga0157374_11977993 3300013296 Bacteria 609
280 Ga0157374_12555383 3300013296 Bacteria 538
281 Ga0157378_10271920 3300013297 Bacteria 1630
282 Ga0163162_10014032 3300013306 Bacteria 7830
283 Ga0163162_11056109 3300013306 Bacteria 919
284 Ga0163162_11310563 3300013306 Bacteria 823
285 Ga0157372_10045237 3300013307 Bacteria 4882
286 Ga0157372_10055403 3300013307 Bacteria 4428
287 Ga0157372_10060103 3300013307 Bacteria 4252
288 Ga0157372_10111409 3300013307 Bacteria 3135
289 Ga0157372_10202728 3300013307 Bacteria 2298
290 Ga0157372_10240579 3300013307 Bacteria 2100
291 Ga0157372_11867886 3300013307 Bacteria 691
292 Ga0157375_10323885 3300013308 Bacteria 1706
293 Ga0157375_10418780 3300013308 Bacteria 1505
294 Ga0157375_10628424 3300013308 Bacteria 1231
295 Ga0157375_11907443 3300013308 Bacteria 705
296 Ga0163163_10068051 3300014325 Bacteria 3543
297 Ga0163163_10647185 3300014325 Bacteria 1120
298 Ga0163163_12596318 3300014325 Bacteria 564
299 Ga0157380_10002480 3300014326 Bacteria 12441
300 Ga0157380_10374551 3300014326 Bacteria 1341
301 Ga0157380_11026518 3300014326 Bacteria 860
302 Ga0182008_10003052 3300014497 Bacteria 10279
303 Ga0182008_10093452 3300014497 Bacteria 1484
304 Ga0182008_10153283 3300014497 Bacteria 1156
305 Ga0157379_10023014 3300014968 Bacteria 5523
306 Ga0157379_10276379 3300014968 Bacteria 1528
307 Ga0157379_10932075 3300014968 Bacteria 825
308 Ga0157379_11657985 3300014968 Bacteria 625
309 Ga0157376_10113096 3300014969 Bacteria 2393
310 Ga0157376_10413661 3300014969 Bacteria 1307
311 Ga0157376_11070113 3300014969 Bacteria 831
312 Ga0182006_1018487 3300015261 Bacteria 2944
313 Ga0182007_10002246 3300015262 Bacteria 9746
314 Ga0182005_1036209 3300015265 Bacteria 1342
315 Ga0183367_1003 3300015688 Bacteria 814276
316 Ga0163161_10023316 3300017792 Bacteria 4366
317 Ga0163161_10268867 3300017792 Bacteria 1333
318 Ga0163161_10745113 3300017792 Bacteria 819
319 Ga0163161_11008509 3300017792 Bacteria 711
320 Ga0163161_11566421 3300017792 Bacteria 580
321 Ga0197907_10033713 3300020069 Bacteria 675
322 Ga0206356_10468274 3300020070 Bacteria 1190
323 Ga0206356_11002279 3300020070 Bacteria 889
324 Ga0206356_11595527 3300020070 Bacteria 809
325 Ga0206352_10982403 3300020078 Bacteria 716
326 Ga0206352_11358692 3300020078 Bacteria 640
327 Ga0206354_11337459 3300020081 Bacteria 1608
328 Ga0206354_11619843 3300020081 Bacteria 2555
329 Ga0206353_10029995 3300020082 Bacteria 774
330 Ga0206353_10259526 3300020082 Bacteria 2005
331 Ga0206353_10358891 3300020082 Bacteria 1278
332 Ga0206353_10968491 3300020082 Bacteria 2139
333 Ga0206353_11192181 3300020082 Bacteria 845
334 Ga0206353_11246040 3300020082 Bacteria 1286
335 Ga0206353_11341543 3300020082 Bacteria 1131
336 Ga0213875_10122117 3300021388 Bacteria 1217
337 Ga0213875_10399456 3300021388 Bacteria 655
338 Ga0224712_10526188 3300022467 Bacteria 573
339 Ga0209758_1011831 3300025297 Bacteria 4983
340 Ga0207656_10203249 3300025321 Bacteria 957
341 Ga0207655_1230742 3300025728 Bacteria 534
342 Ga0207653_10013683 3300025885 Bacteria 2541
343 Ga0207682_10089490 3300025893 Bacteria 1332
344 Ga0207692_10071362 3300025898 Bacteria 1831
345 Ga0207642_10020485 3300025899 Bacteria 2583
346 Ga0207642_10207100 3300025899 Bacteria 1087
347 Ga0207710_10018543 3300025900 Bacteria 2961
348 Ga0207688_10005436 3300025901 Bacteria 6925
349 Ga0207688_10022147 3300025901 Bacteria 3476
350 Ga0207680_10007745 3300025903 Bacteria 5248
351 Ga0207680_10013189 3300025903 Bacteria 4236
352 Ga0207647_10075726 3300025904 Bacteria 2025
353 Ga0207685_10154324 3300025905 Bacteria 1042
354 Ga0207685_10617342 3300025905 Bacteria 583
355 Ga0207699_10521729 3300025906 Bacteria 859
356 Ga0207643_10001879 3300025908 Bacteria 11602
357 Ga0207643_10071311 3300025908 Bacteria 2000
358 Ga0207705_10008652 3300025909 Bacteria 7418
359 Ga0207705_10126804 3300025909 Bacteria 1898
360 Ga0207705_10212246 3300025909 Bacteria 1468
361 Ga0207705_10337834 3300025909 Bacteria 1159
362 Ga0207705_10417605 3300025909 Bacteria 1038
363 Ga0207654_10015189 3300025911 Bacteria 3991
364 Ga0207654_10328826 3300025911 Bacteria 1047
365 Ga0207654_10331453 3300025911 Bacteria 1043
366 Ga0207707_10106548 3300025912 Bacteria 2450
367 Ga0207707_10276080 3300025912 Bacteria 1456
368 Ga0207695_10048226 3300025913 Bacteria 4500
369 Ga0207671_10513993 3300025914 Bacteria 955
370 Ga0207671_10637901 3300025914 Bacteria 848
371 Ga0207671_11121285 3300025914 Bacteria 617
372 Ga0207693_10000761 3300025915 Bacteria 28954
373 Ga0207693_10565252 3300025915 Bacteria 886
374 Ga0207663_10359681 3300025916 Bacteria 1104
375 Ga0207660_10189323 3300025917 Bacteria 1601
376 Ga0207660_10596487 3300025917 Bacteria 899
377 Ga0207660_10777114 3300025917 Bacteria 781
378 Ga0207660_10974121 3300025917 Bacteria 692
379 Ga0207662_10019622 3300025918 Bacteria 3850
380 Ga0207662_10947410 3300025918 Bacteria 610
381 Ga0207657_10030578 3300025919 Bacteria 4886
382 Ga0207657_10072328 3300025919 Bacteria 2917
383 Ga0207657_10148879 3300025919 Bacteria 1908
384 Ga0207657_10265778 3300025919 Bacteria 1364
385 Ga0207657_10352389 3300025919 Bacteria 1161
386 Ga0207649_10213247 3300025920 Bacteria 1371
387 Ga0207652_10014337 3300025921 Bacteria 6419
388 Ga0207652_10191667 3300025921 Bacteria 1839
389 Ga0207652_11691103 3300025921 Bacteria 537
390 Ga0207681_10461190 3300025923 Bacteria 1035
391 Ga0207650_10473129 3300025925 Bacteria 1045
392 Ga0207659_10298618 3300025926 Bacteria 1322
393 Ga0207659_11030345 3300025926 Bacteria 708
394 Ga0207687_10057785 3300025927 Bacteria 2727
395 Ga0207687_10435958 3300025927 Bacteria 1084
396 Ga0207687_10889889 3300025927 Bacteria 762
397 Ga0207687_10973556 3300025927 Bacteria 727
398 Ga0207664_10004124 3300025929 Bacteria 9806
399 Ga0207664_10275579 3300025929 Bacteria 1475
400 Ga0207664_11673943 3300025929 Bacteria 558
401 Ga0207644_10054720 3300025931 Bacteria 2875
402 Ga0207690_10041933 3300025932 Bacteria 3002
403 Ga0207690_10054124 3300025932 Bacteria 2697
404 Ga0207706_10006255 3300025933 Bacteria 11067
405 Ga0207686_10040933 3300025934 Bacteria 2821
406 Ga0207686_10050863 3300025934 Bacteria 2579
407 Ga0207709_10466789 3300025935 Bacteria 979
408 Ga0207709_10593398 3300025935 Bacteria 876
409 Ga0207709_10825308 3300025935 Bacteria 750
410 Ga0207670_10253513 3300025936 Bacteria 1361
411 Ga0207670_10357041 3300025936 Bacteria 1159
412 Ga0207669_10089674 3300025937 Bacteria 1997
413 Ga0207704_10041136 3300025938 Bacteria 2707
414 Ga0207704_10107073 3300025938 Bacteria 1880
415 Ga0207704_11595553 3300025938 Bacteria 560
416 Ga0207665_10000422 3300025939 Bacteria 29175
417 Ga0207691_10027476 3300025940 Bacteria 5334
418 Ga0207691_10142229 3300025940 Bacteria 2114
419 Ga0207691_10322125 3300025940 Bacteria 1325
420 Ga0207691_10787429 3300025940 Bacteria 799
421 Ga0207711_10102174 3300025941 Bacteria 2537
422 Ga0207689_10008948 3300025942 Bacteria 8680
423 Ga0207689_10367736 3300025942 Bacteria 1196
424 Ga0207689_10939378 3300025942 Bacteria 730
425 Ga0207661_10085644 3300025944 Bacteria 2613
426 Ga0207661_10423064 3300025944 Bacteria 1210
427 Ga0207661_10626118 3300025944 Bacteria 988
428 Ga0207661_11530451 3300025944 Bacteria 611
429 Ga0207661_12127299 3300025944 Bacteria 507
430 Ga0207679_10437057 3300025945 Bacteria 1158
431 Ga0207679_10826774 3300025945 Bacteria 845
432 Ga0207667_10016618 3300025949 Bacteria 8307
433 Ga0207667_10086751 3300025949 Bacteria 3238
434 Ga0207667_11786271 3300025949 Bacteria 579
435 Ga0207651_10161527 3300025960 Bacteria 1757
436 Ga0207712_10021402 3300025961 Bacteria 4246
437 Ga0207712_10027364 3300025961 Bacteria 3807
438 Ga0207668_10034693 3300025972 Bacteria 3352
439 Ga0207668_10168949 3300025972 Bacteria 1713
440 Ga0207668_10436276 3300025972 Bacteria 1115
441 Ga0207640_10084665 3300025981 Bacteria 2178
442 Ga0207640_10461976 3300025981 Bacteria 1049
443 Ga0207640_10734821 3300025981 Bacteria 849
444 Ga0207658_10085070 3300025986 Bacteria 2435
445 Ga0207658_10490683 3300025986 Bacteria 1093
446 Ga0207677_10029126 3300026023 Bacteria 3504
447 Ga0207677_12017061 3300026023 Bacteria 536
448 Ga0207703_10026842 3300026035 Bacteria 4536
449 Ga0207703_10132231 3300026035 Bacteria 2156
450 Ga0207639_10152740 3300026041 Bacteria 1936
451 Ga0207639_10799056 3300026041 Bacteria 879
452 Ga0207639_10819544 3300026041 Bacteria 868
453 Ga0207639_11695635 3300026041 Bacteria 592
454 Ga0207678_10001278 3300026067 Bacteria 23260
455 Ga0207678_10152307 3300026067 Bacteria 1975
456 Ga0207678_10459733 3300026067 Bacteria 1107
457 Ga0207678_10501361 3300026067 Bacteria 1058
458 Ga0207678_10766732 3300026067 Bacteria 851
459 Ga0207708_10011571 3300026075 Bacteria 6575
460 Ga0207708_10064908 3300026075 Bacteria 2790
461 Ga0207702_10186047 3300026078 Bacteria 1915
462 Ga0207702_10485092 3300026078 Bacteria 1203
463 Ga0207702_10531607 3300026078 Bacteria 1149
464 Ga0207702_10547838 3300026078 Bacteria 1131
465 Ga0207702_10750895 3300026078 Bacteria 963
466 Ga0207641_10047443 3300026088 Bacteria 3622
467 Ga0207641_10720561 3300026088 Bacteria 983
468 Ga0207648_10010968 3300026089 Bacteria 8561
469 Ga0207648_11959471 3300026089 Bacteria 547
470 Ga0207676_10249253 3300026095 Bacteria 1598
471 Ga0207676_10297790 3300026095 Bacteria 1472
472 Ga0207676_10695211 3300026095 Bacteria 985
473 Ga0207676_11082651 3300026095 Bacteria 792
474 Ga0207674_10395498 3300026116 Bacteria 1336
475 Ga0207674_10656676 3300026116 Bacteria 1013
476 Ga0207675_100000862 3300026118 Bacteria 30299
477 Ga0207675_100020738 3300026118 Bacteria 6127
478 Ga0207675_100315973 3300026118 Bacteria 1524
479 Ga0207683_10004856 3300026121 Bacteria 11575
480 Ga0207683_11000267 3300026121 Bacteria 776
481 Ga0207698_10251581 3300026142 Bacteria 1617
482 Ga0207698_10265222 3300026142 Bacteria 1580
483 Ga0207698_10433076 3300026142 Bacteria 1265
484 Ga0207698_12274804 3300026142 Bacteria 554
485 Ga0207428_10026948 3300027907 Bacteria 4788
486 Ga0207428_10039472 3300027907 Bacteria 3834
487 Ga0268266_10001967 3300028379 Bacteria 23057
488 Ga0268266_10091476 3300028379 Bacteria 2668
489 Ga0268265_11154206 3300028380 Bacteria 771
490 Ga0268264_10000031 3300028381 Bacteria 409525
491 Ga0307517_10019375 3300028786 Bacteria 8734
492 Ga0307515_10123150 3300028794 Bacteria 2919
493 Ga0307515_10291706 3300028794 Bacteria 1326
494 Ga0307515_10377507 3300028794 Bacteria 1051
495 Ga0307515_10778599 3300028794 Bacteria 578
496 Ga0307511_10170176 3300030521 Bacteria 1199
497 Ga0307512_10002110 3300030522 Bacteria 26116
498 Ga0307512_10060866 3300030522 Bacteria 2914
499 Ga0307512_10432447 3300030522 Bacteria 539
500 Ga0307513_10007381 3300031456 Bacteria 14266
501 Ga0307513_10010672 3300031456 Bacteria 11494
502 Ga0307513_10032151 3300031456 Bacteria 5922
503 Ga0307513_10340187 3300031456 Bacteria 1251
504 Ga0307513_10738580 3300031456 Bacteria 690
505 Ga0307408_101994187 3300031548 Bacteria 558
506 Ga0307508_10027978 3300031616 Bacteria 5100
507 Ga0307508_10239572 3300031616 Bacteria 1411
508 Ga0307514_10023923 3300031649 Bacteria 4949
509 Ga0307514_10143365 3300031649 Bacteria 1619
510 Ga0316575_10100952 3300031665 Bacteria 1173
511 Ga0316579_10044004 3300031691 Bacteria 2078
512 Ga0316579_10207008 3300031691 Bacteria 949
513 Ga0316576_10024631 3300031727 Bacteria 4203
514 Ga0316576_10025917 3300031727 Bacteria 4108
515 Ga0316576_10117753 3300031727 Bacteria 1993
516 Ga0316576_10281019 3300031727 Bacteria 1246
517 Ga0316578_10001886 3300031728 Bacteria 8849
518 Ga0316578_10015230 3300031728 Bacteria 4131
519 Ga0316578_10018168 3300031728 Bacteria 3846
520 Ga0316578_10181487 3300031728 Bacteria 1268
521 Ga0316578_10614932 3300031728 Bacteria 636
522 Ga0307516_10009713 3300031730 Bacteria 10685
523 Ga0307516_10068201 3300031730 Bacteria 3426
524 Ga0307516_10234914 3300031730 Bacteria 1535
525 Ga0307516_10456332 3300031730 Bacteria 934
526 Ga0316577_10021049 3300031733 Bacteria 3616
527 Ga0316577_10075467 3300031733 Bacteria 1882
528 Ga0307413_10048253 3300031824 Bacteria 2544
529 Ga0307413_10669635 3300031824 Bacteria 858
530 Ga0307413_10831896 3300031824 Bacteria 778
531 Ga0307410_10206833 3300031852 Bacteria 1502
532 Ga0307410_10362754 3300031852 Bacteria 1161
533 Ga0307410_10707731 3300031852 Bacteria 850
534 Ga0307406_10072872 3300031901 Bacteria 2256
535 Ga0307406_10285993 3300031901 Bacteria 1260
536 Ga0307406_11131994 3300031901 Bacteria 677
537 Ga0307407_10884813 3300031903 Bacteria 684
538 Ga0307412_10583789 3300031911 Bacteria 944
539 Ga0307409_100037961 3300031995 Bacteria 3557
540 Ga0307409_100200923 3300031995 Bacteria 1783
541 Ga0307409_100206187 3300031995 Bacteria 1763
542 Ga0307409_101095167 3300031995 Bacteria 818
543 Ga0307409_101670739 3300031995 Bacteria 665
544 Ga0307409_101907747 3300031995 Bacteria 623
545 Ga0307409_102207635 3300031995 Bacteria 580
546 Ga0307416_100133084 3300032002 Bacteria 2243
547 Ga0307416_100168408 3300032002 Bacteria 2036
548 Ga0307414_10246508 3300032004 Bacteria 1482
549 Ga0307411_10313990 3300032005 Bacteria 1263
550 Ga0307411_10812345 3300032005 Bacteria 824
551 Ga0307415_100006661 3300032126 Bacteria 6252
552 Ga0307415_100622755 3300032126 Bacteria 963
553 Ga0316583_10023364 3300032133 Bacteria 2210
554 Ga0316583_10027161 3300032133 Bacteria 2043
555 Ga0316585_10022745 3300032137 Bacteria 1930
556 Ga0316585_10100688 3300032137 Bacteria 948
557 Ga0316580_10034779 3300032139 Bacteria 1559
558 Ga0316580_10038366 3300032139 Bacteria 1481
559 Ga0316580_10121598 3300032139 Bacteria 799
560 Ga0316580_10206343 3300032139 Bacteria 606
561 Ga0373930_0048644 3300034816 Bacteria 921
562 Ga0373958_0055269 3300034819 Bacteria 848
563 Ga0373959_0032445 3300034820 Bacteria 1061
564 Ga0373938_0016011 3300034957 Bacteria 1460
565 Ga0373928_0008878 3300035084 Bacteria 1960
566 Ga0373934_0372565 3300035086 Bacteria 595
567 Ga0373932_0084710 3300035112 Bacteria 1007
568 Ga0373941_0120182 3300035115 Bacteria 936
569 Ga0373960_0004260 3300035121 Bacteria 3268
570 Ga0373942_0075556 3300035207 Bacteria 992
571 Ga0373962_0263856 3300035242 Bacteria 601
572 Ga0316574_0002927 3300035398 Bacteria 8687
573 Ga0316574_0006864 3300035398 Bacteria 6191
574 Ga0316574_0028324 3300035398 Bacteria 3378
575 Ga0316574_0039475 3300035398 Bacteria 2903
576 Ga0316574_0181112 3300035398 Bacteria 1356
577 Ga0373931_0396935 3300035691 Bacteria 872
578 Ga0373935_0652500 3300035692 Bacteria 772
579 Ga0373927_0769922 3300035695 Bacteria 636
580 Ga0373947_0630113 3300035725 Bacteria 731
581 Ga0373937_0104761 3300036401 Bacteria 2628
582 Ga0316582_0004636 3300036647 Bacteria 6979
583 Ga0316582_0005574 3300036647 Bacteria 6504
584 Ga0316582_0228293 3300036647 Bacteria 1274
585 Ga0316582_0950418 3300036647 Bacteria 587
586 Ga0316584_0001080 3300036712 Bacteria 15945
587 Ga0316584_0002346 3300036712 Bacteria 11933
588 Ga0316584_0006442 3300036712 Bacteria 7945
589 Ga0316584_0024754 3300036712 Bacteria 4397
590 Ga0316584_0071727 3300036712 Bacteria 2595
591 Ga0316584_0146750 3300036712 Bacteria 1757
592 Ga0373925_0761311 3300037068 Bacteria 798
593 Ga0373925_0974753 3300037068 Bacteria 698
594 Ga0373925_1060720 3300037068 Bacteria 667
595 Ga0373925_1444953 3300037068 Bacteria 563
596 Ga0395899_0014945 3300037312 Bacteria 5921
597 Ga0395899_0239675 3300037312 Bacteria 1249
598 Ga0395900_0144673 3300037418 Bacteria 2432
599 Ga0395900_0244171 3300037418 Bacteria 1800
600 Ga0395900_0309186 3300037418 Bacteria 1564
601 Ga0395898_0002926 3300037466 Bacteria 19415
602 Ga0395898_0008650 3300037466 Bacteria 10739
603 Ga0395898_0023615 3300037466 Bacteria 6210
604 Ga0395898_0094206 3300037466 Bacteria 2878
605 Ga0395898_0584518 3300037466 Bacteria 1059
606 Ga0395898_0910125 3300037466 Bacteria 818
607 Ga0395905_0012794 3300037471 Bacteria 8072
608 Ga0395905_0307721 3300037471 Bacteria 1473
609 Ga0395905_0355771 3300037471 Bacteria 1357
610 Ga0436364_0312246 3300037853 Bacteria 1261
611 Ga0436364_0487929 3300037853 Bacteria 785
612 Ga0436364_0747706 3300037853 Bacteria 1285
613 Ga0395901_0021839 3300038443 Bacteria 6559
614 Ga0395901_0070161 3300038443 Bacteria 3650
615 Ga0395901_0220702 3300038443 Bacteria 1982
616 Ga0395901_1705059 3300038443 Bacteria 581
617 Ga0439436_0004809 3300041404 Bacteria 4141
618 Ga0439436_0035109 3300041404 Bacteria 1449
619 Ga0439438_110365 3300041405 Bacteria 664
620 Ga0439439_0002892 3300041406 Bacteria 3727
621 Ga0439461_0179366 3300041410 Bacteria 560
622 Ga0439466_0057028 3300041411 Bacteria 1266
623 Ga0451787_443561 3300041441 Bacteria 513
624 Ga0451789_0357655 3300041443 Bacteria 629
625 Ga0451789_0403977 3300041443 Bacteria 700
626 Ga0451791_1032014 3300041451 Bacteria 1910
627 Ga0451793_1705097 3300041452 Bacteria 823
628 Ga0451797_0119615 3300041453 Bacteria 1491
629 Ga0451797_0425520 3300041453 Bacteria 1317
630 Ga0451797_0900995 3300041453 Bacteria 739
631 Ga0451795_1315360 3300041456 Bacteria 901
632 Ga0451795_1425503 3300041456 Bacteria 656
633 Ga0451795_1527499 3300041456 Bacteria 827
634 Ga0451800_0913216 3300041459 Bacteria 882
635 Ga0451800_1276582 3300041459 Bacteria 673
636 Ga0451804_0978374 3300041463 Bacteria 1394
637 Ga0451837_0844599 3300041494 Bacteria 1222
638 Ga0451839_0451422 3300041496 Bacteria 522
639 Ga0451839_0878520 3300041496 Bacteria 528
640 Ga0451845_0934553 3300041501 Bacteria 522
641 Ga0451847_0328072 3300041503 Bacteria 956
642 Ga0451851_0409766 3300041507 Bacteria 564
643 Ga0451843_1398884 3300041509 Bacteria 618
644 Ga0451855_0876493 3300041511 Bacteria 609
645 Ga0451853_0925178 3300041512 Bacteria 851
646 Ga0451853_1111976 3300041512 Bacteria 523
647 Ga0451853_1397591 3300041512 Bacteria 647
648 Ga0451853_2120126 3300041512 Bacteria 1234
649 Ga0451853_3106522 3300041512 Bacteria 514
650 Ga0451853_3509953 3300041512 Bacteria 547
651 Ga0439433_0001111 3300041999 Bacteria 5488
652 Ga0439442_013843 3300042002 Bacteria 1657
653 Ga0439448_0052233 3300042005 Bacteria 1339
654 Ga0439448_0365740 3300042005 Bacteria 515
655 Ga0439449_0019483 3300042007 Bacteria 2543
656 Ga0439449_0091794 3300042007 Bacteria 1121
657 Ga0439455_0010486 3300042012 Bacteria 2039
658 Ga0439455_0025944 3300042012 Bacteria 1428
659 Ga0439457_000050 3300042014 Bacteria 24506
660 Ga0439457_001276 3300042014 Bacteria 7557
661 Ga0439457_008844 3300042014 Bacteria 2362
662 Ga0439462_0005042 3300042015 Bacteria 3240
663 Ga0450894_000402 3300042131 Bacteria 7411
664 Ga0450899_000036 3300042135 Bacteria 9998
665 Ga0450900_042940 3300042136 Bacteria 680
666 Ga0450903_000797 3300042138 Bacteria 6152
667 Ga0450906_101925 3300042145 Bacteria 524
668 Ga0439458_0006796 3300042157 Bacteria 2547
669 Ga0466969_0010992 3300044656 Bacteria 4793
670 Ga0466969_0013005 3300044656 Bacteria 4383
671 Ga0466969_0030942 3300044656 Bacteria 2725
672 Ga0466969_0110907 3300044656 Bacteria 1284
673 Ga0466969_0220074 3300044656 Bacteria 864
674 Ga0466972_0007258 3300044658 Bacteria 5565
675 Ga0466972_0009587 3300044658 Bacteria 4860
676 Ga0466972_0072859 3300044658 Bacteria 1638
677 Ga0466972_0088945 3300044658 Bacteria 1466
678 Ga0466972_0162133 3300044658 Bacteria 1050
679 Ga0466972_0236880 3300044658 Bacteria 854
680 Ga0466972_0532276 3300044658 Bacteria 554
681 Ga0466972_0536432 3300044658 Bacteria 552
682 Ga0466965_0001744 3300044683 Bacteria 8971
683 Ga0466965_0010965 3300044683 Bacteria 4239
684 Ga0466965_0043535 3300044683 Bacteria 2217
685 Ga0466965_0057857 3300044683 Bacteria 1933
686 Ga0466965_0169242 3300044683 Bacteria 1149
687 Ga0466965_0282760 3300044683 Bacteria 896
688 Ga0466966_0002073 3300044684 Bacteria 12998
689 Ga0466966_0005617 3300044684 Bacteria 8244
690 Ga0466966_0025000 3300044684 Bacteria 3904
691 Ga0466966_0028829 3300044684 Bacteria 3614
692 Ga0466966_0142757 3300044684 Bacteria 1463
693 Ga0466966_0165133 3300044684 Bacteria 1347
694 Ga0466966_0230017 3300044684 Bacteria 1119
695 Ga0466966_0260620 3300044684 Bacteria 1044
696 Ga0466966_0453423 3300044684 Bacteria 771
697 Ga0466961_0008931 3300044693 Bacteria 6395
698 Ga0466961_0014704 3300044693 Bacteria 5029
699 Ga0466961_0014898 3300044693 Bacteria 4994
700 Ga0466961_0045254 3300044693 Bacteria 2816
701 Ga0466961_0053016 3300044693 Bacteria 2589
702 Ga0466961_0132317 3300044693 Bacteria 1563
703 Ga0466961_0202977 3300044693 Bacteria 1225
704 Ga0466961_0247600 3300044693 Bacteria 1095
705 Ga0466961_0262829 3300044693 Bacteria 1058
706 Ga0466961_0366455 3300044693 Bacteria 876
707 Ga0466961_0509618 3300044693 Bacteria 726
708 Ga0466963_0000954 3300044694 Bacteria 14852
709 Ga0466963_0001197 3300044694 Bacteria 13660
710 Ga0466963_0002952 3300044694 Bacteria 9611
711 Ga0466963_0027689 3300044694 Bacteria 3632
712 Ga0466963_0036308 3300044694 Bacteria 3213
713 Ga0466963_0042041 3300044694 Bacteria 2999
714 Ga0466963_0083036 3300044694 Bacteria 2172
715 Ga0466963_0172772 3300044694 Bacteria 1507
716 Ga0466963_0207778 3300044694 Bacteria 1370
717 Ga0466963_0784525 3300044694 Bacteria 672
718 Ga0466963_0920574 3300044694 Bacteria 616
719 Ga0466964_0033613 3300044706 Bacteria 2043
720 Ga0466964_0050199 3300044706 Bacteria 1710
721 Ga0466964_0059076 3300044706 Bacteria 1591
722 Ga0466964_0155505 3300044706 Bacteria 1064
723 Ga0466964_0559184 3300044706 Bacteria 622
724 Ga0466971_0002834 3300044719 Bacteria 7346
725 Ga0466971_0005350 3300044719 Bacteria 5565
726 Ga0466971_0009159 3300044719 Bacteria 4329
727 Ga0466971_0462942 3300044719 Bacteria 623
728 Ga0466968_0130881 3300044735 Bacteria 1141
729 Ga0466968_0299683 3300044735 Bacteria 773
730 Ga0466968_0338362 3300044735 Bacteria 729
731 Ga0466970_0002112 3300044765 Bacteria 9598
732 Ga0466970_0006676 3300044765 Bacteria 5770
733 Ga0466970_0056600 3300044765 Bacteria 2096
734 Ga0466970_0139243 3300044765 Bacteria 1336
735 Ga0466970_0216939 3300044765 Bacteria 1067
736 Ga0466970_0318905 3300044765 Bacteria 878
737 Ga0466970_0322202 3300044765 Bacteria 874
738 Ga0466970_0586225 3300044765 Bacteria 646
739 Ga0466957_0002224 3300044842 Bacteria 10399
740 Ga0466957_0017495 3300044842 Bacteria 4199
741 Ga0466957_0033658 3300044842 Bacteria 3075
742 Ga0466957_0054096 3300044842 Bacteria 2449
743 Ga0466957_0074321 3300044842 Bacteria 2107
744 Ga0466957_0250016 3300044842 Bacteria 1179
745 Ga0466960_0006393 3300044901 Bacteria 4726
746 Ga0466960_0009062 3300044901 Bacteria 4093
747 Ga0466960_0017315 3300044901 Bacteria 3140
748 Ga0466960_0171892 3300044901 Bacteria 1170
749 Ga0466960_0357114 3300044901 Bacteria 834
750 Ga0466960_0750356 3300044901 Bacteria 588
751 Ga0466959_0001862 3300045049 Bacteria 13254
752 Ga0466959_0004316 3300045049 Bacteria 9490
753 Ga0466959_0035444 3300045049 Bacteria 3689
754 Ga0466959_0113081 3300045049 Bacteria 1936
755 Ga0466959_0127788 3300045049 Bacteria 1803
756 Ga0466959_0190193 3300045049 Bacteria 1433
757 Ga0466959_0224473 3300045049 Bacteria 1302
758 Ga0466959_0571240 3300045049 Bacteria 762
759 Ga0466959_0922226 3300045049 Bacteria 582
760 Ga0466959_1192868 3300045049 Bacteria 506
761 Ga0466958_0002184 3300045836 Bacteria 9743
762 Ga0466958_0005815 3300045836 Bacteria 6672
763 Ga0466958_0008194 3300045836 Bacteria 5788
764 Ga0466958_0015510 3300045836 Bacteria 4367
765 Ga0466958_0037010 3300045836 Bacteria 2923
766 Ga0466958_0139625 3300045836 Bacteria 1525
767 Ga0466958_0243493 3300045836 Bacteria 1149
768 Ga0466958_0245045 3300045836 Bacteria 1146
769 Ga0466958_0353297 3300045836 Bacteria 946
770 Ga0466958_0451233 3300045836 Bacteria 832
771 Ga0466958_0576267 3300045836 Bacteria 732
772 Ga0466958_0857445 3300045836 Bacteria 592
773 Ga0466958_1031491 3300045836 Bacteria 537
774 Ga0466967_0000613 3300045976 Bacteria 17801
775 Ga0466967_0004827 3300045976 Bacteria 9193
776 Ga0466967_0012903 3300045976 Bacteria 6424
777 Ga0466967_0024495 3300045976 Bacteria 4963
778 Ga0466967_0026875 3300045976 Bacteria 4777
779 Ga0466967_0033125 3300045976 Bacteria 4372
780 Ga0466967_0038602 3300045976 Bacteria 4097
781 Ga0466967_0077677 3300045976 Bacteria 2989
782 Ga0466967_0198330 3300045976 Bacteria 1900
783 Ga0466967_0236726 3300045976 Bacteria 1740
784 Ga0466967_0282112 3300045976 Bacteria 1594
785 Ga0466967_0282536 3300045976 Bacteria 1593
786 Ga0466967_0305088 3300045976 Bacteria 1532
787 Ga0466967_0347908 3300045976 Bacteria 1434
788 Ga0466967_0931016 3300045976 Bacteria 864
789 Ga0466967_1209721 3300045976 Bacteria 753
790 Ga0466967_1299476 3300045976 Bacteria 724
791 Ga0495617_064030 3300046452 Bacteria 1213
792 Ga0495592_0010796 3300046454 Bacteria 6886
793 Ga0495592_0022400 3300046454 Bacteria 4806
794 Ga0495603_0006734 3300046455 Bacteria 6897
795 Ga0495603_0008687 3300046455 Bacteria 6139
796 Ga0495603_0111508 3300046455 Bacteria 1595
797 Ga0495603_0236865 3300046455 Bacteria 1052
798 Ga0495603_0743027 3300046455 Bacteria 560
799 Ga0495629_0020481 3300046459 Bacteria 4722
800 Ga0495629_0020977 3300046459 Bacteria 4663
801 Ga0495629_0128249 3300046459 Bacteria 1767
802 Ga0495629_0661569 3300046459 Bacteria 695
803 Ga0495638_0062171 3300046460 Bacteria 2305
804 Ga0495638_0298820 3300046460 Bacteria 868
805 Ga0495641_0369414 3300046461 Unclassified 650
806 Ga0495651_0017662 3300046462 Bacteria 5521
807 Ga0495651_0513645 3300046462 Bacteria 765
808 Ga0495651_0677473 3300046462 Bacteria 644
809 Ga0495653_0017407 3300046463 Bacteria 5845
810 Ga0495653_0191944 3300046463 Bacteria 1393
811 Ga0495653_0692253 3300046463 Bacteria 620
812 Ga0495580_0055417 3300046472 Bacteria 2794
813 Ga0495582_0027862 3300046473 Bacteria 3099
814 Ga0495605_0016124 3300046474 Bacteria 4049
815 Ga0495639_0175425 3300046475 Bacteria 1042
816 Ga0495662_0002146 3300046476 Bacteria 9900
817 Ga0495662_0118393 3300046476 Bacteria 1299
818 Ga0495662_0231207 3300046476 Bacteria 911
819 Ga0495664_0000797 3300046477 Bacteria 16119
820 Ga0495664_0195125 3300046477 Bacteria 1227
821 Ga0495584_0057438 3300046491 Bacteria 1958
822 Ga0495585_0117481 3300046492 Bacteria 1409
823 Ga0495594_0020149 3300046499 Bacteria 3551
824 Ga0495594_0069701 3300046499 Bacteria 1953
825 Ga0495596_0076928 3300046500 Bacteria 1296
826 Ga0495607_0165712 3300046501 Bacteria 1119
827 Ga0495583_0066760 3300046506 Bacteria 1590
828 Ga0495606_0017777 3300046507 Bacteria 5359
829 Ga0495608_0055393 3300046511 Bacteria 2621
830 Ga0495608_0140376 3300046511 Bacteria 1542
831 Ga0495608_0352408 3300046511 Bacteria 906
832 Ga0495610_0031610 3300046512 Bacteria 2760
833 Ga0495616_0007914 3300046513 Bacteria 6338
834 Ga0495618_0491756 3300046514 Bacteria 740
835 Ga0495620_0050229 3300046515 Bacteria 1780
836 Ga0495628_0020754 3300046516 Bacteria 5413
837 Ga0495628_0106468 3300046516 Bacteria 2159
838 Ga0495630_0020398 3300046517 Bacteria 4886
839 Ga0495630_0394161 3300046517 Bacteria 1061
840 Ga0495630_0568009 3300046517 Bacteria 870
841 Ga0495630_1284813 3300046517 Bacteria 552
842 Ga0495631_0007885 3300046518 Bacteria 5391
843 Ga0495632_0132140 3300046519 Bacteria 1161
844 Ga0495637_0046159 3300046520 Bacteria 1844
845 Ga0495643_0003665 3300046522 Bacteria 11147
846 Ga0495644_0394714 3300046523 Bacteria 547
847 Ga0495648_0087820 3300046524 Bacteria 1749
848 Ga0495648_0093943 3300046524 Bacteria 1671
849 Ga0495666_0008690 3300046526 Bacteria 5090
850 Ga0495666_0159991 3300046526 Bacteria 1044
851 Ga0495642_0471103 3300046528 Bacteria 555
852 Ga0495652_0019363 3300046529 Bacteria 6063
853 Ga0495652_0054085 3300046529 Bacteria 3420
854 Ga0495654_0051187 3300046530 Bacteria 2016
855 Ga0495665_0010157 3300046531 Bacteria 5102
856 Ga0495665_0500699 3300046531 Bacteria 612
857 Ga0495640_0007906 3300046533 Bacteria 8361
858 Ga0495640_0015041 3300046533 Bacteria 5830
859 Ga0495586_0013757 3300046535 Bacteria 4294
860 Ga0495586_0112687 3300046535 Bacteria 1515
861 Ga0495587_0021595 3300046536 Bacteria 3970
862 Ga0495587_0716083 3300046536 Bacteria 548
863 Ga0495609_0008304 3300046538 Bacteria 5091
864 Ga0495645_0007617 3300046543 Bacteria 7534
865 Ga0495622_0004638 3300046557 Bacteria 6365
866 Ga0495622_0149761 3300046557 Bacteria 1056
867 Ga0495633_0007859 3300046558 Bacteria 6086
868 Ga0495667_0442200 3300046559 Bacteria 817
869 Ga0495667_0593051 3300046559 Bacteria 690
870 Ga0495656_0225063 3300046615 Bacteria 939
871 Ga0495668_0020084 3300046616 Bacteria 3842
872 Ga0495634_0039030 3300046642 Bacteria 3235
873 Ga0495634_0055224 3300046642 Bacteria 2656
874 Ga0495625_0069468 3300046660 Bacteria 2475
875 Ga0495625_0289440 3300046660 Bacteria 1051
876 Ga0495625_0358849 3300046660 Bacteria 919
877 Ga0495635_0038785 3300046663 Bacteria 3297
878 Ga0495635_0411275 3300046663 Bacteria 897
879 Ga0495635_0530260 3300046663 Bacteria 773
880 Ga0495635_1035433 3300046663 Bacteria 521
881 Ga0495661_0017676 3300046665 Bacteria 4704
882 Ga0495588_0017413 3300046674 Bacteria 3489
883 Ga0495588_0229898 3300046674 Bacteria 978
884 Ga0495588_0249148 3300046674 Bacteria 936
885 Ga0495657_0007696 3300046675 Bacteria 8293
886 Ga0495657_0058682 3300046675 Bacteria 2554
887 Ga0495657_0069403 3300046675 Bacteria 2306
888 Ga0495657_0456715 3300046675 Bacteria 747
889 Ga0495657_0734274 3300046675 Bacteria 566
890 Ga0495599_0030957 3300046678 Bacteria 3358
891 Ga0495599_0045948 3300046678 Bacteria 2739
892 Ga0495623_0023639 3300046679 Bacteria 3964
893 Ga0495623_0381190 3300046679 Bacteria 762
894 Ga0495646_0022524 3300046680 Bacteria 3972
895 Ga0495646_0143203 3300046680 Bacteria 1335
896 Ga0495658_0144532 3300046683 Bacteria 1457
897 Ga0495613_0001133 3300046689 Bacteria 20309
898 Ga0495613_0044814 3300046689 Bacteria 3271
899 Ga0495613_0066530 3300046689 Bacteria 2631
900 Ga0495613_0117244 3300046689 Bacteria 1914
901 Ga0495613_0124595 3300046689 Bacteria 1848
902 Ga0495613_0445479 3300046689 Bacteria 878
903 Ga0495613_0800271 3300046689 Bacteria 615
904 Ga0495613_0988979 3300046689 Bacteria 541
905 Ga0495624_0063855 3300046690 Bacteria 2301
906 Ga0495624_0262369 3300046690 Bacteria 1044
907 Ga0495670_0029319 3300046691 Bacteria 2731
908 Ga0495671_0496321 3300046692 Bacteria 582
909 Ga0495649_0009731 3300046694 Bacteria 5695
910 Ga0495649_0050327 3300046694 Bacteria 2261
911 Ga0495649_0058537 3300046694 Bacteria 2076
912 Ga0495589_0002834 3300046794 Bacteria 9592
913 Ga0495589_0140770 3300046794 Bacteria 1155
914 Ga0495600_0051183 3300046809 Bacteria 2696
915 Ga0495600_0085607 3300046809 Bacteria 2057
916 Ga0495600_0429984 3300046809 Bacteria 818
917 Ga0495600_0455125 3300046809 Bacteria 791
918 Ga0495660_0512680 3300046810 Bacteria 511
919 Ga0495581_0131487 3300047315 Bacteria 1458
920 Ga0495581_0271904 3300047315 Bacteria 991
921 Ga0495581_0435886 3300047315 Bacteria 763
922 Ga0495604_0000717 3300047317 Bacteria 28071
923 Ga0495636_0005011 3300047318 Bacteria 5198
924 Ga0495636_0008796 3300047318 Bacteria 3979
925 Ga0495636_0011721 3300047318 Bacteria 3473
926 Ga0495636_0294265 3300047318 Bacteria 758
927 Ga0495636_0481507 3300047318 Bacteria 598
928 Ga0495674_0020148 3300047319 Bacteria 6179
929 Ga0495674_0194464 3300047319 Bacteria 1685
930 Ga0495674_0208180 3300047319 Bacteria 1621
931 Ga0495674_0401256 3300047319 Bacteria 1107
932 Ga0495674_0498450 3300047319 Bacteria 974
933 Ga0495672_0470974 3300047320 Bacteria 563
934 Ga0495676_0018902 3300047321 Bacteria 6071
935 Ga0495676_0032816 3300047321 Bacteria 4379
936 Ga0495676_0272373 3300047321 Bacteria 1148
937 Ga0495680_0015876 3300047322 Bacteria 6482
938 Ga0495683_0272494 3300047323 Bacteria 735
939 Ga0495683_0444811 3300047323 Bacteria 532
940 Ga0495687_001837 3300047443 Bacteria 18639
941 Ga0495687_124828 3300047443 Bacteria 922
942 Ga0495687_134558 3300047443 Bacteria 869
943 Ga0495687_163189 3300047443 Bacteria 746
944 Ga0495675_0012537 3300047444 Bacteria 5335
945 Ga0495675_0033528 3300047444 Bacteria 3277
946 Ga0495677_0060572 3300047445 Bacteria 1403
947 Ga0495677_0347946 3300047445 Bacteria 585
948 Ga0495685_006732 3300047447 Bacteria 3774
949 Ga0495685_031531 3300047447 Bacteria 1821
950 Ga0495685_071599 3300047447 Bacteria 1160
951 Ga0495685_109534 3300047447 Bacteria 909
952 Ga0495685_130021 3300047447 Bacteria 824
953 Ga0495685_147366 3300047447 Bacteria 765
954 Ga0495681_0038064 3300047470 Bacteria 2362
955 Ga0495681_0246781 3300047470 Bacteria 706
956 Ga0495684_0051912 3300047471 Bacteria 3128
957 Ga0495684_0219199 3300047471 Bacteria 1396
958 Ga0495686_0073074 3300047472 Bacteria 2107
959 Ga0495686_0215328 3300047472 Bacteria 1095
960 Ga0495593_0018986 3300047673 Bacteria 3858
961 Ga0495593_0053424 3300047673 Bacteria 2132
962 Ga0495602_0481595 3300048088 Bacteria 870
963 Ga0495602_1125161 3300048088 Bacteria 514
964 Ga0495614_0009183 3300048089 Bacteria 4380
965 Ga0495614_0116815 3300048089 Bacteria 1174
966 Ga0495614_0516140 3300048089 Bacteria 569
967 Ga0495626_0013567 3300048091 Bacteria 4232
968 Ga0495626_0249104 3300048091 Bacteria 713
969 Ga0496100_0089905 3300048903 Bacteria 2093
970 Ga0496100_0375421 3300048903 Bacteria 1079
971 Ga0496100_0469993 3300048903 Bacteria 966
972 Ga0496101_0104740 3300048904 Bacteria 2122
973 Ga0496101_0395556 3300048904 Bacteria 1088
974 Ga0496102_0000474 3300048905 Bacteria 44502
975 Ga0496102_0052146 3300048905 Bacteria 3726
976 Ga0496102_0079919 3300048905 Bacteria 3012
977 Ga0496102_0094978 3300048905 Bacteria 2763
978 Ga0496102_0382362 3300048905 Bacteria 1325
979 Ga0496102_0415930 3300048905 Bacteria 1263
980 Ga0496102_0701748 3300048905 Bacteria 935
981 Ga0496102_1218214 3300048905 Bacteria 672
982 Ga0496102_1302500 3300048905 Bacteria 646
983 Ga0496102_1520970 3300048905 Bacteria 588
984 Ga0496103_0000746 3300048906 Bacteria 24024
985 Ga0496103_0057727 3300048906 Bacteria 2410
986 Ga0496103_0109647 3300048906 Bacteria 1753
987 Ga0496103_0129399 3300048906 Bacteria 1612
988 Ga0496104_0004536 3300048907 Bacteria 12100
989 Ga0496104_0004679 3300048907 Bacteria 11913
990 Ga0496104_0088701 3300048907 Bacteria 2955
991 Ga0496104_0191015 3300048907 Bacteria 1959
992 Ga0496104_0328473 3300048907 Bacteria 1442
993 Ga0496104_0403330 3300048907 Bacteria 1279
994 Ga0496104_1596743 3300048907 Bacteria 555
995 Ga0496105_0074948 3300048908 Bacteria 2795
996 Ga0496105_0327804 3300048908 Bacteria 1226
997 Ga0496105_0343704 3300048908 Bacteria 1193
998 Ga0496105_0370273 3300048908 Bacteria 1141
999 Ga0496105_0678064 3300048908 Bacteria 793
1000 Ga0496106_0100021 3300048909 Bacteria 2248
1001 Ga0496106_0142541 3300048909 Bacteria 1886
1002 Ga0496107_0048969 3300048910 Bacteria 3045
1003 Ga0496107_0650679 3300048910 Bacteria 777
1004 Ga0496107_0679550 3300048910 Bacteria 758
1005 Ga0496107_0684246 3300048910 Bacteria 755
1006 Ga0496107_0741838 3300048910 Bacteria 721
1007 Ga0496108_0007637 3300048911 Bacteria 8755
1008 Ga0496108_0016478 3300048911 Bacteria 6031
1009 Ga0496108_0043231 3300048911 Bacteria 3764
1010 Ga0496108_0079265 3300048911 Bacteria 2780
1011 Ga0496108_0079926 3300048911 Bacteria 2769
1012 Ga0496108_0106569 3300048911 Bacteria 2393
1013 Ga0496108_0260215 3300048911 Bacteria 1510
1014 Ga0496109_0014032 3300048912 Bacteria 6965
1015 Ga0496109_0080432 3300048912 Bacteria 3002
1016 Ga0496109_0094738 3300048912 Bacteria 2763
1017 Ga0496109_0193109 3300048912 Bacteria 1913
1018 Ga0496109_0202587 3300048912 Bacteria 1866
1019 Ga0496109_0238702 3300048912 Bacteria 1710
1020 Ga0496109_0725810 3300048912 Bacteria 931
1021 Ga0496109_0968468 3300048912 Bacteria 788
1022 Ga0496110_0004391 3300048913 Bacteria 10921
1023 Ga0496110_0011291 3300048913 Bacteria 7303
1024 Ga0496110_0023092 3300048913 Bacteria 5290
1025 Ga0496110_0253267 3300048913 Bacteria 1602
1026 Ga0496110_0325865 3300048913 Bacteria 1399
1027 Ga0496110_0411533 3300048913 Bacteria 1233
1028 Ga0496110_0568193 3300048913 Bacteria 1030
1029 Ga0496110_0977177 3300048913 Bacteria 754
1030 Ga0496111_0027325 3300048914 Bacteria 4035
1031 Ga0496111_0067648 3300048914 Bacteria 2595
1032 Ga0496111_0086817 3300048914 Bacteria 2289
1033 Ga0496111_0124914 3300048914 Bacteria 1902
1034 Ga0496111_0491673 3300048914 Bacteria 903
1035 Ga0496111_0513307 3300048914 Bacteria 882
1036 Ga0496111_0677513 3300048914 Bacteria 751
1037 Ga0496112_0049608 3300048915 Bacteria 4115
1038 Ga0496112_0557159 3300048915 Bacteria 1080
1039 Ga0496113_0036651 3300048916 Bacteria 3595
1040 Ga0496113_0148211 3300048916 Bacteria 1850
1041 Ga0496113_0238090 3300048916 Bacteria 1452
1042 Ga0496113_0307134 3300048916 Bacteria 1270
1043 Ga0496113_1032153 3300048916 Bacteria 647
1044 Ga0496114_0002482 3300048917 Bacteria 14092
1045 Ga0496114_0016483 3300048917 Bacteria 5956
1046 Ga0496114_0143077 3300048917 Bacteria 2072
1047 Ga0496114_0143609 3300048917 Bacteria 2068
1048 Ga0496114_0164995 3300048917 Bacteria 1928
1049 Ga0496114_0223148 3300048917 Bacteria 1654
1050 Ga0496114_0235128 3300048917 Bacteria 1610
1051 Ga0496114_0267192 3300048917 Bacteria 1507
1052 Ga0496114_0296399 3300048917 Bacteria 1427
1053 Ga0496114_1173759 3300048917 Bacteria 653
1054 Ga0496115_0007736 3300048918 Bacteria 7925
1055 Ga0496115_0357708 3300048918 Bacteria 1190
1056 Ga0496115_0586262 3300048918 Bacteria 888
1057 Ga0496117_0094345 3300048920 Bacteria 1915
1058 Ga0496117_0202037 3300048920 Bacteria 1122
1059 Ga0496118_0059415 3300048921 Bacteria 2847
1060 Ga0496118_0094560 3300048921 Bacteria 2043
1061 Ga0496118_0627843 3300048921 Bacteria 509
1062 Ga0496119_0025963 3300048922 Bacteria 4076
1063 Ga0496119_0055002 3300048922 Bacteria 2420
1064 Ga0496120_0367002 3300048923 Bacteria 643
1065 Ga0496121_0017831 3300048924 Bacteria 7211
1066 Ga0496121_0315754 3300048924 Bacteria 1054
1067 Ga0496122_0001555 3300048925 Bacteria 36330
1068 Ga0496123_0400097 3300048926 Bacteria 625
1069 Ga0496124_0655792 3300048927 Bacteria 673
1070 Ga0496125_0000025 3300048928 Bacteria 440074
1071 Ga0496126_0000036 3300048929 Bacteria 354901
1072 Ga0501306_018232 3300049127 Bacteria 958
1073 Ga0495682_0170173 3300049460 Bacteria 775
1074 Ga0501031_0246011 3300049568 Bacteria 1162
1075 Ga0501032_0009780 3300049569 Bacteria 6938
1076 Ga0501032_0015007 3300049569 Bacteria 5477
1077 Ga0501032_0019341 3300049569 Bacteria 4765
1078 Ga0501032_0098368 3300049569 Bacteria 1939
1079 Ga0501033_0033436 3300049570 Bacteria 3859
1080 Ga0501033_0089909 3300049570 Bacteria 2246
1081 Ga0501033_0100027 3300049570 Bacteria 2116
1082 Ga0501033_0177710 3300049570 Bacteria 1527
1083 Ga0501034_0027557 3300049571 Bacteria 5779
1084 Ga0501034_0063804 3300049571 Bacteria 3698
1085 Ga0501034_0145647 3300049571 Bacteria 2346
1086 Ga0501034_0192787 3300049571 Bacteria 1999
1087 Ga0501034_0472586 3300049571 Bacteria 1170
1088 Ga0501034_1439012 3300049571 Bacteria 564
1089 Ga0501036_0032656 3300049572 Bacteria 4400
1090 Ga0501036_0592988 3300049572 Bacteria 919
1091 Ga0501036_1465239 3300049572 Bacteria 553
1092 Ga0501037_0105593 3300049573 Bacteria 2030
1093 Ga0501037_0383282 3300049573 Bacteria 966
1094 Ga0501037_0399266 3300049573 Bacteria 943
1095 Ga0501037_0876991 3300049573 Bacteria 589
1096 Ga0501038_0003594 3300049574 Bacteria 14429
1097 Ga0501038_0007999 3300049574 Bacteria 9745
1098 Ga0501038_0058002 3300049574 Bacteria 3321
1099 Ga0501038_0067229 3300049574 Bacteria 3049
1100 Ga0501039_0027902 3300049575 Bacteria 4342
1101 Ga0501039_0430332 3300049575 Bacteria 1036
1102 Ga0501039_0468282 3300049575 Bacteria 989
1103 Ga0501040_0241799 3300049576 Bacteria 1287
1104 Ga0501040_0292869 3300049576 Bacteria 1163
1105 Ga0501042_0594422 3300049578 Bacteria 805
1106 Ga0501043_0094641 3300049579 Bacteria 2348
1107 Ga0501043_0209419 3300049579 Bacteria 1511
1108 Ga0501043_0410947 3300049579 Bacteria 1021
1109 Ga0501046_0023316 3300049580 Bacteria 5093
1110 Ga0501047_0000191 3300049581 Bacteria 74396
1111 Ga0501047_0005402 3300049581 Bacteria 12015
1112 Ga0501047_0037162 3300049581 Bacteria 4708
1113 Ga0501047_0049715 3300049581 Bacteria 4048
1114 Ga0501047_0056593 3300049581 Bacteria 3792
1115 Ga0501047_0074133 3300049581 Bacteria 3276
1116 Ga0501047_0523684 3300049581 Bacteria 1011
1117 Ga0501048_0000405 3300049582 Bacteria 30043
1118 Ga0501048_0087368 3300049582 Bacteria 2200
1119 Ga0501048_0157469 3300049582 Bacteria 1607
1120 Ga0501048_0401781 3300049582 Bacteria 979
1121 Ga0501067_0041498 3300049583 Bacteria 2555
1122 Ga0501067_0144006 3300049583 Bacteria 1328
1123 Ga0501067_0781863 3300049583 Bacteria 537
1124 Ga0501069_0012307 3300049585 Bacteria 4548
1125 Ga0501069_0136480 3300049585 Bacteria 1406
1126 Ga0501069_0539436 3300049585 Bacteria 697
1127 Ga0501070_0108433 3300049586 Bacteria 2294
1128 Ga0501070_0241375 3300049586 Bacteria 1479
1129 Ga0501070_0790646 3300049586 Bacteria 746
1130 Ga0501070_1041937 3300049586 Bacteria 633
1131 Ga0501070_1380007 3300049586 Bacteria 536
1132 Ga0501071_0550997 3300049587 Bacteria 886
1133 Ga0501072_0508384 3300049588 Bacteria 953
1134 Ga0501074_0101418 3300049590 Bacteria 2060
1135 Ga0501075_0715309 3300049591 Bacteria 763
1136 Ga0501235_031949 3300049669 Bacteria 1190
1137 Ga0501080_0031855 3300049742 Bacteria 4913
1138 Ga0501080_0617989 3300049742 Bacteria 961
1139 Ga0501083_0024967 3300049744 Bacteria 4139
1140 Ga0501083_0980639 3300049744 Bacteria 550
1141 Ga0501282_002540 3300049778 Bacteria 1978
1142 Ga0501035_0034700 3300049822 Bacteria 4582
1143 Ga0501035_0089814 3300049822 Bacteria 2705
1144 Ga0501035_0097433 3300049822 Bacteria 2583
1145 Ga0501035_0210569 3300049822 Bacteria 1663
1146 Ga0501035_0227026 3300049822 Bacteria 1592
1147 Ga0501035_1023312 3300049822 Bacteria 648
1148 Ga0501044_0011203 3300049823 Bacteria 9724
1149 Ga0501044_0024862 3300049823 Bacteria 6353
1150 Ga0501044_0097788 3300049823 Bacteria 2956
1151 Ga0501044_0106072 3300049823 Bacteria 2822
1152 Ga0501044_0217659 3300049823 Bacteria 1861
1153 Ga0501044_0222055 3300049823 Bacteria 1840
1154 Ga0501044_0901185 3300049823 Bacteria 759
1155 Ga0501045_0032328 3300049824 Bacteria 3792
1156 Ga0501045_0581642 3300049824 Bacteria 830
1157 nmdc:mga03n38_36630_c1 3300050490 Bacteria 2110
1158 nmdc:mga03n38_477_c1 3300050490 Bacteria 10014
1159 nmdc:mga0yw44_1049157_c1 3300050492 Bacteria 551
1160 nmdc:mga0yw44_130712_c1 3300050492 Bacteria 1625
1161 nmdc:mga0yw44_187909_c1 3300050492 Bacteria 1362
1162 nmdc:mga06z11_11001_c1 3300050494 Bacteria 3881
1163 nmdc:mga04h51_203941_c1 3300050495 Bacteria 778
1164 nmdc:mga07m45_451589_c1 3300050496 Bacteria 745
1165 nmdc:mga05p37_24408_c1 3300050507 Bacteria 7347
1166 nmdc:mga05p37_440_c1 3300050507 Bacteria 45174
1167 nmdc:mga09592_278_c1 3300050508 Bacteria 37149
1168 nmdc:mga09592_281623_c1 3300050508 Bacteria 1442
1169 nmdc:mga09592_7319_c1 3300050508 Bacteria 8974
1170 nmdc:mga0qj67_20014_c1 3300050509 Bacteria 5121
1171 nmdc:mga0qj67_2876_c1 3300050509 Bacteria 12357
1172 nmdc:mga0qj67_79740_c1 3300050509 Bacteria 2622
1173 nmdc:mga06r32_29384_c1 3300050510 Bacteria 5151
1174 nmdc:mga06r32_4205_c1 3300050510 Bacteria 12899
1175 nmdc:mga06r32_434_c1 3300050510 Bacteria 35341
1176 nmdc:mga08y16_14165_c1 3300050511 Bacteria 8391
1177 nmdc:mga08y16_9696_c1 3300050511 Bacteria 10110
1178 nmdc:mga0n895_502919_c1 3300050512 Bacteria 1221
1179 nmdc:mga0n895_707851_c1 3300050512 Bacteria 1003
1180 nmdc:mga08x19_284937_c1 3300050514 Bacteria 1145
1181 nmdc:mga0a205_137541_c1 3300050515 Bacteria 2343
1182 Ga0495601_0011311 3300053077 Bacteria 5333
1183 Ga0495612_0494029 3300053078 Bacteria 561
1184 Ga0495655_0003679 3300053083 Bacteria 2552
1185 Ga0495655_0040412 3300053083 Bacteria 1187
1186 Ga0495595_0049668 3300053084 Bacteria 1941
1187 Ga0495595_0208890 3300053084 Bacteria 973
1188 Ga0495619_0021775 3300053085 Bacteria 4095
1189 Ga0500578_0176366 3300053086 Bacteria 1319
1190 Ga0500553_158493 3300053101 Bacteria 856
1191 Ga0500593_171213 3300053117 Bacteria 818
1192 Ga0500652_171790 3300053131 Bacteria 892
1193 Ga0500573_0175236 3300053140 Bacteria 1157
1194 Ga0500604_0022630 3300053151 Bacteria 1786
1195 Ga0500616_0012396 3300053153 Bacteria 4989
1196 Ga0501084_0706142 3300054114 Bacteria 850
1197 Ga0501084_0771280 3300054114 Bacteria 810
1198 Ga0590075_069645 3300059424 Bacteria 908
1199 Ga0590077_056836 3300059426 Bacteria 884
1200 Ga0501082_0001608 3300060353 Bacteria 19895
1201 Ga0501082_0866832 3300060353 Bacteria 790
1202 Ga0501082_0867170 3300060353 Bacteria 790
1203 Ga0466962_0002858 3300061719 Bacteria 8229
1204 Ga0466962_0003210 3300061719 Bacteria 7767
1205 Ga0466962_0017111 3300061719 Bacteria 3493
1206 Ga0466962_0092535 3300061719 Bacteria 1449
1207 Ga0466962_0291938 3300061719 Bacteria 806
1208 Ga0530510_0458111 3300061734 Bacteria 965

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0144673 Ga0395900_0144673_959_1291 78
2 3300037466 Ga0395898_0094206 Ga0395898_0094206_1491_1823 78
3 3300037471 Ga0395905_0012794 Ga0395905_0012794_3456_3788 78
4 3300038443 Ga0395901_0021839 Ga0395901_0021839_6150_6482 78
5 3300048903 Ga0496100_0089905 Ga0496100_0089905_1008_1340 79
6 3300048904 Ga0496101_0104740 Ga0496101_0104740_350_682 79
7 3300048916 Ga0496113_0036651 Ga0496113_0036651_1383_1715 79
8 3300013104 Ga0157370_10717088 Ga0157370_107170882 81
9 3300013306 Ga0163162_11310563 Ga0163162_113105632 81
10 3300017792 Ga0163161_11566421 Ga0163161_115664212 81
11 3300020070 Ga0206356_11002279 Ga0206356_110022792 81
12 3300025728 Ga0207655_1230742 Ga0207655_12307421 81
13 3300025944 Ga0207661_11530451 Ga0207661_115304512 81
14 3300046463 Ga0495653_0191944 Ga0495653_0191944_218_550 81
15 3300046809 Ga0495600_0455125 Ga0495600_0455125_105_437 81
16 3300048903 Ga0496100_0469993 Ga0496100_0469993_306_638 81
17 3300048905 Ga0496102_0094978 Ga0496102_0094978_940_1272 81
18 3300048905 Ga0496102_1218214 Ga0496102_1218214_159_491 81
19 3300048906 Ga0496103_0057727 Ga0496103_0057727_1927_2223 81
20 3300048907 Ga0496104_0328473 Ga0496104_0328473_702_1034 81
21 3300048907 Ga0496104_0403330 Ga0496104_0403330_749_1081 81
22 3300048908 Ga0496105_0074948 Ga0496105_0074948_1598_1930 81
23 3300048909 Ga0496106_0142541 Ga0496106_0142541_1142_1474 81
24 3300048910 Ga0496107_0679550 Ga0496107_0679550_376_708 81
25 3300048911 Ga0496108_0260215 Ga0496108_0260215_856_1188 81
26 3300048912 Ga0496109_0080432 Ga0496109_0080432_864_1196 81
27 3300048913 Ga0496110_0253267 Ga0496110_0253267_674_1006 81
28 3300048913 Ga0496110_0568193 Ga0496110_0568193_670_1002 81
29 3300048914 Ga0496111_0086817 Ga0496111_0086817_1785_2117 81
30 3300048914 Ga0496111_0124914 Ga0496111_0124914_766_1098 81
31 3300048915 Ga0496112_0557159 Ga0496112_0557159_71_403 81
32 3300048916 Ga0496113_0238090 Ga0496113_0238090_897_1229 81
33 3300048917 Ga0496114_0296399 Ga0496114_0296399_962_1294 81
34 3300005337 Ga0070682_100347102 Ga0070682_1003471022 83
35 3300049585 Ga0501069_0136480 Ga0501069_0136480_1018_1350 83
36 3300005327 Ga0070658_11399344 Ga0070658_113993442 84
37 3300005329 Ga0070683_101004593 Ga0070683_1010045932 84
38 3300005336 Ga0070680_100375671 Ga0070680_1003756712 84
39 3300005336 Ga0070680_101019198 Ga0070680_1010191981 84
40 3300005356 Ga0070674_100352446 Ga0070674_1003524462 84
41 3300005366 Ga0070659_100333228 Ga0070659_1003332282 84
42 3300005458 Ga0070681_10136451 Ga0070681_101364513 84
43 3300005535 Ga0070684_101048408 Ga0070684_1010484082 84
44 3300005543 Ga0070672_100518096 Ga0070672_1005180961 84
45 3300005547 Ga0070693_100369792 Ga0070693_1003697922 84
46 3300009148 Ga0105243_10421646 Ga0105243_104216462 84
47 3300009148 Ga0105243_11390273 Ga0105243_113902732 84
48 3300009551 Ga0105238_12241857 Ga0105238_122418571 84
49 3300010375 Ga0105239_10589429 Ga0105239_105894292 84
50 3300013102 Ga0157371_10365025 Ga0157371_103650252 84
51 3300013104 Ga0157370_10194714 Ga0157370_101947142 84
52 3300013104 Ga0157370_11781084 Ga0157370_117810842 84
53 3300013105 Ga0157369_10018735 Ga0157369_100187358 84
54 3300013306 Ga0163162_11056109 Ga0163162_110561092 84
55 3300013307 Ga0157372_10045237 Ga0157372_100452378 84
56 3300013307 Ga0157372_10055403 Ga0157372_100554033 84
57 3300013307 Ga0157372_10202728 Ga0157372_102027282 84
58 3300013308 Ga0157375_10418780 Ga0157375_104187802 84
59 3300014326 Ga0157380_10374551 Ga0157380_103745512 84
60 3300014969 Ga0157376_11070113 Ga0157376_110701131 84
61 3300017792 Ga0163161_10268867 Ga0163161_102688672 84
62 3300020081 Ga0206354_11337459 Ga0206354_113374592 84
63 3300020082 Ga0206353_11192181 Ga0206353_111921812 84
64 3300025321 Ga0207656_10203249 Ga0207656_102032492 84
65 3300025919 Ga0207657_10072328 Ga0207657_100723283 84
66 3300025926 Ga0207659_10298618 Ga0207659_102986182 84
67 3300025929 Ga0207664_10004124 Ga0207664_100041248 84
68 3300025932 Ga0207690_10054124 Ga0207690_100541244 84
69 3300025935 Ga0207709_10593398 Ga0207709_105933981 84
70 3300025944 Ga0207661_12127299 Ga0207661_121272991 84
71 3300026067 Ga0207678_10766732 Ga0207678_107667322 84
72 3300028794 Ga0307515_10778599 Ga0307515_107785991 84
73 3300030522 Ga0307512_10432447 Ga0307512_104324472 84
74 3300031456 Ga0307513_10007381 Ga0307513_100073815 84
75 3300031456 Ga0307513_10738580 Ga0307513_107385802 84
76 3300031730 Ga0307516_10234914 Ga0307516_102349142 84
77 3300038443 Ga0395901_0220702 Ga0395901_0220702_235_567 84
78 3300041453 Ga0451797_0425520 Ga0451797_0425520_176_508 84
79 3300041453 Ga0451797_0900995 Ga0451797_0900995_69_401 84
80 3300041456 Ga0451795_1315360 Ga0451795_1315360_348_680 84
81 3300041494 Ga0451837_0844599 Ga0451837_0844599_624_956 84
82 3300041496 Ga0451839_0878520 Ga0451839_0878520_113_445 84
83 3300041501 Ga0451845_0934553 Ga0451845_0934553_59_391 84
84 3300041507 Ga0451851_0409766 Ga0451851_0409766_118_450 84
85 3300041509 Ga0451843_1398884 Ga0451843_1398884_92_424 84
86 3300041511 Ga0451855_0876493 Ga0451855_0876493_89_421 84
87 3300041512 Ga0451853_0925178 Ga0451853_0925178_384_716 84
88 3300041512 Ga0451853_1111976 Ga0451853_1111976_34_366 84
89 3300042014 Ga0439457_008844 Ga0439457_008844_729_1061 84
90 3300042015 Ga0439462_0005042 Ga0439462_0005042_525_857 84
91 3300042145 Ga0450906_101925 Ga0450906_101925_88_420 84
92 3300044656 Ga0466969_0030942 Ga0466969_0030942_834_1166 84
93 3300044683 Ga0466965_0057857 Ga0466965_0057857_839_1171 84
94 3300044684 Ga0466966_0260620 Ga0466966_0260620_317_649 84
95 3300044684 Ga0466966_0453423 Ga0466966_0453423_218_550 84
96 3300044693 Ga0466961_0008931 Ga0466961_0008931_5703_6035 84
97 3300044693 Ga0466961_0509618 Ga0466961_0509618_36_368 84
98 3300044842 Ga0466957_0250016 Ga0466957_0250016_55_387 84
99 3300045049 Ga0466959_0224473 Ga0466959_0224473_618_950 84
100 3300046460 Ga0495638_0298820 Ga0495638_0298820_107_439 84
101 3300046511 Ga0495608_0352408 Ga0495608_0352408_368_700 84
102 3300048907 Ga0496104_0004679 Ga0496104_0004679_6607_6939 84
103 3300048908 Ga0496105_0327804 Ga0496105_0327804_16_348 84
104 3300048910 Ga0496107_0650679 Ga0496107_0650679_46_378 84
105 3300048911 Ga0496108_0079265 Ga0496108_0079265_912_1244 84
106 3300048912 Ga0496109_0968468 Ga0496109_0968468_166_498 84
107 3300048913 Ga0496110_0004391 Ga0496110_0004391_6834_7166 84
108 3300048914 Ga0496111_0067648 Ga0496111_0067648_405_737 84
109 3300048916 Ga0496113_0148211 Ga0496113_0148211_78_410 84
110 3300048917 Ga0496114_0002482 Ga0496114_0002482_7958_8290 84
111 3300048917 Ga0496114_1173759 Ga0496114_1173759_56_388 84
112 3300049568 Ga0501031_0246011 Ga0501031_0246011_300_632 84
113 3300049573 Ga0501037_0876991 Ga0501037_0876991_115_447 84
114 3300049576 Ga0501040_0241799 Ga0501040_0241799_826_1158 84
115 3300049576 Ga0501040_0292869 Ga0501040_0292869_342_674 84
116 3300049582 Ga0501048_0087368 Ga0501048_0087368_499_831 84
117 3300049582 Ga0501048_0157469 Ga0501048_0157469_515_847 84
118 3300049587 Ga0501071_0550997 Ga0501071_0550997_183_515 84
119 3300049588 Ga0501072_0508384 Ga0501072_0508384_362_694 84
120 3300049591 Ga0501075_0715309 Ga0501075_0715309_261_593 84
121 3300049824 Ga0501045_0581642 Ga0501045_0581642_437_769 84
122 3300053117 Ga0500593_171213 Ga0500593_171213_415_747 84
123 3300053151 Ga0500604_0022630 Ga0500604_0022630_1040_1372 84
124 3300053153 Ga0500616_0012396 Ga0500616_0012396_960_1292 84
125 3300054114 Ga0501084_0771280 Ga0501084_0771280_382_714 84
126 3300059424 Ga0590075_069645 Ga0590075_069645_91_423 84
127 3300059426 Ga0590077_056836 Ga0590077_056836_504_836 84
128 3300060353 Ga0501082_0866832 Ga0501082_0866832_206_538 84
129 3300060353 Ga0501082_0867170 Ga0501082_0867170_121_453 84
130 3300041453 Ga0451797_0119615 Ga0451797_0119615_986_1318 85
131 3300046454 Ga0495592_0022400 Ga0495592_0022400_1966_2298 85
132 3300046462 Ga0495651_0017662 Ga0495651_0017662_4990_5322 85
133 3300046463 Ga0495653_0017407 Ga0495653_0017407_366_698 85
134 3300046472 Ga0495580_0055417 Ga0495580_0055417_2037_2369 85
135 3300046475 Ga0495639_0175425 Ga0495639_0175425_178_510 85
136 3300046476 Ga0495662_0002146 Ga0495662_0002146_4418_4750 85
137 3300046477 Ga0495664_0000797 Ga0495664_0000797_4621_4953 85
138 3300046511 Ga0495608_0140376 Ga0495608_0140376_651_983 85
139 3300046516 Ga0495628_0020754 Ga0495628_0020754_866_1198 85
140 3300046517 Ga0495630_0020398 Ga0495630_0020398_2127_2459 85
141 3300046526 Ga0495666_0008690 Ga0495666_0008690_1986_2318 85
142 3300046529 Ga0495652_0019363 Ga0495652_0019363_2509_2841 85
143 3300046531 Ga0495665_0010157 Ga0495665_0010157_365_697 85
144 3300046533 Ga0495640_0015041 Ga0495640_0015041_286_618 85
145 3300046535 Ga0495586_0013757 Ga0495586_0013757_388_720 85
146 3300046536 Ga0495587_0021595 Ga0495587_0021595_3439_3771 85
147 3300046543 Ga0495645_0007617 Ga0495645_0007617_4632_4964 85
148 3300046559 Ga0495667_0593051 Ga0495667_0593051_200_532 85
149 3300046642 Ga0495634_0039030 Ga0495634_0039030_2617_2949 85
150 3300046663 Ga0495635_0411275 Ga0495635_0411275_366_698 85
151 3300046675 Ga0495657_0058682 Ga0495657_0058682_1966_2298 85
152 3300046678 Ga0495599_0030957 Ga0495599_0030957_2740_3072 85
153 3300046679 Ga0495623_0023639 Ga0495623_0023639_3073_3405 85
154 3300046680 Ga0495646_0022524 Ga0495646_0022524_773_1105 85
155 3300046689 Ga0495613_0001133 Ga0495613_0001133_4486_4818 85
156 3300046809 Ga0495600_0429984 Ga0495600_0429984_287_619 85
157 3300047315 Ga0495581_0435886 Ga0495581_0435886_380_712 85
158 3300047317 Ga0495604_0000717 Ga0495604_0000717_23340_23672 85
159 3300047319 Ga0495674_0020148 Ga0495674_0020148_728_1060 85
160 3300047444 Ga0495675_0012537 Ga0495675_0012537_2127_2459 85
161 3300047471 Ga0495684_0051912 Ga0495684_0051912_159_491 85
162 3300047673 Ga0495593_0018986 Ga0495593_0018986_660_992 85
163 3300048088 Ga0495602_0481595 Ga0495602_0481595_366_698 85
164 3300053077 Ga0495601_0011311 Ga0495601_0011311_2876_3208 85
165 3300053078 Ga0495612_0494029 Ga0495612_0494029_146_478 85
166 3300002075 JGI24738J21930_10047848 JGI24738J21930_100478482 86
167 3300003323 rootH1_10088192 rootH1_100881921 86
168 3300005336 Ga0070680_101137063 Ga0070680_1011370631 86
169 3300005366 Ga0070659_101817722 Ga0070659_1018177222 86
170 3300005539 Ga0068853_100138197 Ga0068853_1001381972 86
171 3300005548 Ga0070665_100785740 Ga0070665_1007857402 86
172 3300005577 Ga0068857_100452244 Ga0068857_1004522442 86
173 3300005614 Ga0068856_100088421 Ga0068856_1000884212 86
174 3300005614 Ga0068856_101404496 Ga0068856_1014044962 86
175 3300006038 Ga0075365_10431348 Ga0075365_104313482 86
176 3300006048 Ga0075363_100052481 Ga0075363_1000524813 86
177 3300006048 Ga0075363_100297682 Ga0075363_1002976821 86
178 3300006163 Ga0070715_10817501 Ga0070715_108175012 86
179 3300006178 Ga0075367_10007402 Ga0075367_100074025 86
180 3300006948 Ga0099826_10058874 Ga0099826_100588743 86
181 3300009011 Ga0105251_10088971 Ga0105251_100889712 86
182 3300009098 Ga0105245_11219824 Ga0105245_112198242 86
183 3300009176 Ga0105242_10411505 Ga0105242_104115052 86
184 3300009177 Ga0105248_11657239 Ga0105248_116572392 86
185 3300010375 Ga0105239_10803279 Ga0105239_108032792 86
186 3300013105 Ga0157369_10087776 Ga0157369_100877767 86
187 3300013307 Ga0157372_10240579 Ga0157372_102405792 86
188 3300014497 Ga0182008_10003052 Ga0182008_100030528 86
189 3300015261 Ga0182006_1018487 Ga0182006_10184875 86
190 3300015262 Ga0182007_10002246 Ga0182007_100022468 86
191 3300015265 Ga0182005_1036209 Ga0182005_10362092 86
192 3300015688 Ga0183367_1003 Ga0183367_10035 86
193 3300017792 Ga0163161_10745113 Ga0163161_107451132 86
194 3300020078 Ga0206352_11358692 Ga0206352_113586922 86
195 3300025905 Ga0207685_10617342 Ga0207685_106173421 86
196 3300025917 Ga0207660_10974121 Ga0207660_109741211 86
197 3300025927 Ga0207687_10973556 Ga0207687_109735562 86
198 3300025949 Ga0207667_11786271 Ga0207667_117862712 86
199 3300025981 Ga0207640_10084665 Ga0207640_100846653 86
200 3300026041 Ga0207639_10152740 Ga0207639_101527403 86
201 3300026078 Ga0207702_10547838 Ga0207702_105478382 86
202 3300026116 Ga0207674_10395498 Ga0207674_103954982 86
203 3300028794 Ga0307515_10123150 Ga0307515_101231502 86
204 3300028794 Ga0307515_10377507 Ga0307515_103775072 86
205 3300030521 Ga0307511_10170176 Ga0307511_101701762 86
206 3300030522 Ga0307512_10002110 Ga0307512_100021104 86
207 3300030522 Ga0307512_10060866 Ga0307512_100608663 86
208 3300031456 Ga0307513_10010672 Ga0307513_100106729 86
209 3300031456 Ga0307513_10032151 Ga0307513_100321513 86
210 3300031456 Ga0307513_10340187 Ga0307513_103401872 86
211 3300031616 Ga0307508_10239572 Ga0307508_102395722 86
212 3300031649 Ga0307514_10023923 Ga0307514_100239232 86
213 3300031649 Ga0307514_10143365 Ga0307514_101433651 86
214 3300031730 Ga0307516_10009713 Ga0307516_100097135 86
215 3300031730 Ga0307516_10456332 Ga0307516_104563322 86
216 3300031824 Ga0307413_10831896 Ga0307413_108318961 86
217 3300031852 Ga0307410_10362754 Ga0307410_103627542 86
218 3300037312 Ga0395899_0239675 Ga0395899_0239675_642_974 86
219 3300037418 Ga0395900_0309186 Ga0395900_0309186_137_469 86
220 3300037466 Ga0395898_0002926 Ga0395898_0002926_14568_14900 86
221 3300037466 Ga0395898_0008650 Ga0395898_0008650_861_1193 86
222 3300037471 Ga0395905_0307721 Ga0395905_0307721_1024_1356 86
223 3300041406 Ga0439439_0002892 Ga0439439_0002892_88_420 86
224 3300041443 Ga0451789_0357655 Ga0451789_0357655_99_431 86
225 3300041443 Ga0451789_0403977 Ga0451789_0403977_250_582 86
226 3300041459 Ga0451800_0913216 Ga0451800_0913216_146_478 86
227 3300041503 Ga0451847_0328072 Ga0451847_0328072_266_598 86
228 3300041512 Ga0451853_2120126 Ga0451853_2120126_243_575 86
229 3300041999 Ga0439433_0001111 Ga0439433_0001111_4603_4935 86
230 3300042002 Ga0439442_013843 Ga0439442_013843_517_849 86
231 3300042005 Ga0439448_0052233 Ga0439448_0052233_336_668 86
232 3300042007 Ga0439449_0019483 Ga0439449_0019483_926_1258 86
233 3300042012 Ga0439455_0010486 Ga0439455_0010486_1039_1371 86
234 3300042012 Ga0439455_0025944 Ga0439455_0025944_16_348 86
235 3300042014 Ga0439457_000050 Ga0439457_000050_19711_20043 86
236 3300042136 Ga0450900_042940 Ga0450900_042940_308_640 86
237 3300042138 Ga0450903_000797 Ga0450903_000797_2019_2351 86
238 3300042157 Ga0439458_0006796 Ga0439458_0006796_1136_1468 86
239 3300044658 Ga0466972_0007258 Ga0466972_0007258_774_1106 86
240 3300044658 Ga0466972_0088945 Ga0466972_0088945_614_946 86
241 3300044683 Ga0466965_0001744 Ga0466965_0001744_4209_4541 86
242 3300044684 Ga0466966_0005617 Ga0466966_0005617_6018_6350 86
243 3300044693 Ga0466961_0014898 Ga0466961_0014898_209_541 86
244 3300044693 Ga0466961_0053016 Ga0466961_0053016_1001_1333 86
245 3300044694 Ga0466963_0002952 Ga0466963_0002952_4833_5165 86
246 3300044706 Ga0466964_0059076 Ga0466964_0059076_247_579 86
247 3300044719 Ga0466971_0002834 Ga0466971_0002834_2200_2532 86
248 3300044765 Ga0466970_0002112 Ga0466970_0002112_4971_5303 86
249 3300044842 Ga0466957_0002224 Ga0466957_0002224_4458_4790 86
250 3300044901 Ga0466960_0009062 Ga0466960_0009062_1443_1775 86
251 3300045049 Ga0466959_0004316 Ga0466959_0004316_4472_4804 86
252 3300045836 Ga0466958_0002184 Ga0466958_0002184_4459_4791 86
253 3300045836 Ga0466958_0015510 Ga0466958_0015510_3839_4171 86
254 3300045976 Ga0466967_0024495 Ga0466967_0024495_1994_2326 86
255 3300045976 Ga0466967_0038602 Ga0466967_0038602_886_1218 86
256 3300046452 Ga0495617_064030 Ga0495617_064030_786_1118 86
257 3300046454 Ga0495592_0010796 Ga0495592_0010796_1200_1532 86
258 3300046455 Ga0495603_0006734 Ga0495603_0006734_2543_2875 86
259 3300046455 Ga0495603_0008687 Ga0495603_0008687_2471_2803 86
260 3300046455 Ga0495603_0236865 Ga0495603_0236865_631_963 86
261 3300046455 Ga0495603_0743027 Ga0495603_0743027_97_429 86
262 3300046459 Ga0495629_0020481 Ga0495629_0020481_241_573 86
263 3300046459 Ga0495629_0020977 Ga0495629_0020977_3137_3469 86
264 3300046459 Ga0495629_0128249 Ga0495629_0128249_18_350 86
265 3300046459 Ga0495629_0661569 Ga0495629_0661569_18_350 86
266 3300046460 Ga0495638_0062171 Ga0495638_0062171_558_890 86
267 3300046462 Ga0495651_0513645 Ga0495651_0513645_212_544 86
268 3300046463 Ga0495653_0692253 Ga0495653_0692253_125_457 86
269 3300046473 Ga0495582_0027862 Ga0495582_0027862_703_1035 86
270 3300046474 Ga0495605_0016124 Ga0495605_0016124_1320_1652 86
271 3300046476 Ga0495662_0118393 Ga0495662_0118393_103_435 86
272 3300046476 Ga0495662_0231207 Ga0495662_0231207_185_517 86
273 3300046477 Ga0495664_0195125 Ga0495664_0195125_182_514 86
274 3300046491 Ga0495584_0057438 Ga0495584_0057438_987_1319 86
275 3300046492 Ga0495585_0117481 Ga0495585_0117481_322_654 86
276 3300046499 Ga0495594_0020149 Ga0495594_0020149_734_1066 86
277 3300046499 Ga0495594_0069701 Ga0495594_0069701_660_992 86
278 3300046500 Ga0495596_0076928 Ga0495596_0076928_946_1278 86
279 3300046501 Ga0495607_0165712 Ga0495607_0165712_399_731 86
280 3300046506 Ga0495583_0066760 Ga0495583_0066760_1206_1538 86
281 3300046507 Ga0495606_0017777 Ga0495606_0017777_573_905 86
282 3300046511 Ga0495608_0055393 Ga0495608_0055393_1364_1696 86
283 3300046513 Ga0495616_0007914 Ga0495616_0007914_1105_1437 86
284 3300046514 Ga0495618_0491756 Ga0495618_0491756_283_615 86
285 3300046515 Ga0495620_0050229 Ga0495620_0050229_1422_1754 86
286 3300046516 Ga0495628_0106468 Ga0495628_0106468_1326_1658 86
287 3300046517 Ga0495630_0394161 Ga0495630_0394161_263_595 86
288 3300046518 Ga0495631_0007885 Ga0495631_0007885_5030_5362 86
289 3300046519 Ga0495632_0132140 Ga0495632_0132140_337_669 86
290 3300046520 Ga0495637_0046159 Ga0495637_0046159_546_878 86
291 3300046522 Ga0495643_0003665 Ga0495643_0003665_4456_4788 86
292 3300046523 Ga0495644_0394714 Ga0495644_0394714_17_349 86
293 3300046524 Ga0495648_0087820 Ga0495648_0087820_420_752 86
294 3300046524 Ga0495648_0093943 Ga0495648_0093943_947_1279 86
295 3300046526 Ga0495666_0159991 Ga0495666_0159991_335_667 86
296 3300046528 Ga0495642_0471103 Ga0495642_0471103_36_368 86
297 3300046529 Ga0495652_0054085 Ga0495652_0054085_1607_1939 86
298 3300046530 Ga0495654_0051187 Ga0495654_0051187_657_989 86
299 3300046533 Ga0495640_0007906 Ga0495640_0007906_848_1180 86
300 3300046535 Ga0495586_0112687 Ga0495586_0112687_58_390 86
301 3300046536 Ga0495587_0716083 Ga0495587_0716083_15_347 86
302 3300046538 Ga0495609_0008304 Ga0495609_0008304_2581_2913 86
303 3300046557 Ga0495622_0004638 Ga0495622_0004638_3491_3823 86
304 3300046558 Ga0495633_0007859 Ga0495633_0007859_2351_2683 86
305 3300046559 Ga0495667_0442200 Ga0495667_0442200_414_746 86
306 3300046615 Ga0495656_0225063 Ga0495656_0225063_296_628 86
307 3300046616 Ga0495668_0020084 Ga0495668_0020084_3404_3736 86
308 3300046642 Ga0495634_0055224 Ga0495634_0055224_1448_1780 86
309 3300046660 Ga0495625_0069468 Ga0495625_0069468_1499_1831 86
310 3300046660 Ga0495625_0289440 Ga0495625_0289440_368_700 86
311 3300046663 Ga0495635_0038785 Ga0495635_0038785_1585_1917 86
312 3300046663 Ga0495635_0530260 Ga0495635_0530260_17_349 86
313 3300046665 Ga0495661_0017676 Ga0495661_0017676_3929_4261 86
314 3300046674 Ga0495588_0017413 Ga0495588_0017413_2437_2769 86
315 3300046674 Ga0495588_0249148 Ga0495588_0249148_552_884 86
316 3300046675 Ga0495657_0007696 Ga0495657_0007696_3453_3785 86
317 3300046675 Ga0495657_0069403 Ga0495657_0069403_1070_1402 86
318 3300046675 Ga0495657_0734274 Ga0495657_0734274_76_408 86
319 3300046678 Ga0495599_0045948 Ga0495599_0045948_820_1152 86
320 3300046679 Ga0495623_0381190 Ga0495623_0381190_179_511 86
321 3300046680 Ga0495646_0143203 Ga0495646_0143203_720_1052 86
322 3300046689 Ga0495613_0044814 Ga0495613_0044814_1830_2162 86
323 3300046689 Ga0495613_0066530 Ga0495613_0066530_718_1050 86
324 3300046689 Ga0495613_0117244 Ga0495613_0117244_718_1050 86
325 3300046689 Ga0495613_0124595 Ga0495613_0124595_774_1106 86
326 3300046689 Ga0495613_0445479 Ga0495613_0445479_341_673 86
327 3300046690 Ga0495624_0063855 Ga0495624_0063855_1137_1469 86
328 3300046691 Ga0495670_0029319 Ga0495670_0029319_995_1327 86
329 3300046692 Ga0495671_0496321 Ga0495671_0496321_17_349 86
330 3300046694 Ga0495649_0050327 Ga0495649_0050327_1007_1339 86
331 3300046694 Ga0495649_0058537 Ga0495649_0058537_1591_1923 86
332 3300046794 Ga0495589_0002834 Ga0495589_0002834_5232_5564 86
333 3300046794 Ga0495589_0140770 Ga0495589_0140770_767_1099 86
334 3300046809 Ga0495600_0051183 Ga0495600_0051183_1827_2159 86
335 3300046809 Ga0495600_0085607 Ga0495600_0085607_1310_1642 86
336 3300046810 Ga0495660_0512680 Ga0495660_0512680_80_412 86
337 3300047315 Ga0495581_0131487 Ga0495581_0131487_259_591 86
338 3300047318 Ga0495636_0005011 Ga0495636_0005011_2134_2466 86
339 3300047318 Ga0495636_0008796 Ga0495636_0008796_703_1035 86
340 3300047318 Ga0495636_0011721 Ga0495636_0011721_2159_2491 86
341 3300047318 Ga0495636_0481507 Ga0495636_0481507_231_563 86
342 3300047319 Ga0495674_0498450 Ga0495674_0498450_273_605 86
343 3300047320 Ga0495672_0470974 Ga0495672_0470974_191_523 86
344 3300047321 Ga0495676_0018902 Ga0495676_0018902_1279_1611 86
345 3300047321 Ga0495676_0032816 Ga0495676_0032816_872_1204 86
346 3300047322 Ga0495680_0015876 Ga0495680_0015876_241_573 86
347 3300047323 Ga0495683_0272494 Ga0495683_0272494_135_467 86
348 3300047323 Ga0495683_0444811 Ga0495683_0444811_74_406 86
349 3300047443 Ga0495687_001837 Ga0495687_001837_13821_14153 86
350 3300047443 Ga0495687_124828 Ga0495687_124828_188_520 86
351 3300047443 Ga0495687_134558 Ga0495687_134558_131_463 86
352 3300047443 Ga0495687_163189 Ga0495687_163189_42_374 86
353 3300047444 Ga0495675_0033528 Ga0495675_0033528_1797_2129 86
354 3300047445 Ga0495677_0060572 Ga0495677_0060572_290_622 86
355 3300047447 Ga0495685_006732 Ga0495685_006732_1320_1652 86
356 3300047447 Ga0495685_031531 Ga0495685_031531_571_903 86
357 3300047447 Ga0495685_071599 Ga0495685_071599_808_1140 86
358 3300047470 Ga0495681_0038064 Ga0495681_0038064_1046_1378 86
359 3300047471 Ga0495684_0219199 Ga0495684_0219199_928_1260 86
360 3300047472 Ga0495686_0073074 Ga0495686_0073074_1434_1766 86
361 3300047472 Ga0495686_0215328 Ga0495686_0215328_677_1009 86
362 3300047673 Ga0495593_0053424 Ga0495593_0053424_1727_2059 86
363 3300048089 Ga0495614_0009183 Ga0495614_0009183_2010_2342 86
364 3300048089 Ga0495614_0116815 Ga0495614_0116815_546_878 86
365 3300048089 Ga0495614_0516140 Ga0495614_0516140_91_423 86
366 3300048091 Ga0495626_0013567 Ga0495626_0013567_2728_3060 86
367 3300048091 Ga0495626_0249104 Ga0495626_0249104_285_617 86
368 3300048908 Ga0496105_0678064 Ga0496105_0678064_403_735 86
369 3300048911 Ga0496108_0079926 Ga0496108_0079926_1449_1781 86
370 3300048912 Ga0496109_0014032 Ga0496109_0014032_2166_2498 86
371 3300048917 Ga0496114_0267192 Ga0496114_0267192_570_902 86
372 3300048924 Ga0496121_0315754 Ga0496121_0315754_547_879 86
373 3300048927 Ga0496124_0655792 Ga0496124_0655792_30_362 86
374 3300049127 Ga0501306_018232 Ga0501306_018232_62_394 86
375 3300049569 Ga0501032_0098368 Ga0501032_0098368_1421_1753 86
376 3300049570 Ga0501033_0033436 Ga0501033_0033436_3374_3706 86
377 3300049571 Ga0501034_0192787 Ga0501034_0192787_1557_1889 86
378 3300049571 Ga0501034_1439012 Ga0501034_1439012_214_546 86
379 3300049574 Ga0501038_0067229 Ga0501038_0067229_2328_2660 86
380 3300049575 Ga0501039_0430332 Ga0501039_0430332_422_754 86
381 3300049579 Ga0501043_0094641 Ga0501043_0094641_319_651 86
382 3300049581 Ga0501047_0074133 Ga0501047_0074133_2348_2680 86
383 3300049590 Ga0501074_0101418 Ga0501074_0101418_26_358 86
384 3300049669 Ga0501235_031949 Ga0501235_031949_137_469 86
385 3300049742 Ga0501080_0031855 Ga0501080_0031855_2970_3302 86
386 3300049742 Ga0501080_0617989 Ga0501080_0617989_47_379 86
387 3300049778 Ga0501282_002540 Ga0501282_002540_102_434 86
388 3300049822 Ga0501035_0227026 Ga0501035_0227026_802_1134 86
389 3300049823 Ga0501044_0011203 Ga0501044_0011203_5799_6131 86
390 3300050490 nmdc:mga03n38_36630_c1 nmdc:mga03n38_36630_c1_1618_1950 86
391 3300050490 nmdc:mga03n38_477_c1 nmdc:mga03n38_477_c1_4578_4910 86
392 3300050492 nmdc:mga0yw44_130712_c1 nmdc:mga0yw44_130712_c1_1136_1468 86
393 3300050494 nmdc:mga06z11_11001_c1 nmdc:mga06z11_11001_c1_2689_3021 86
394 3300050496 nmdc:mga07m45_451589_c1 nmdc:mga07m45_451589_c1_37_369 86
395 3300053086 Ga0500578_0176366 Ga0500578_0176366_47_379 86
396 3300061719 Ga0466962_0092535 Ga0466962_0092535_468_800 86
397 3300031852 Ga0307410_10707731 Ga0307410_107077311 87
398 3300031995 Ga0307409_101095167 Ga0307409_1010951672 87
399 3300032005 Ga0307411_10313990 Ga0307411_103139902 87
400 3300009545 Ga0105237_12773299 Ga0105237_127732992 88
401 3300020078 Ga0206352_10982403 Ga0206352_109824032 88
402 3300025297 Ga0209758_1011831 Ga0209758_10118314 88
403 3300026121 Ga0207683_11000267 Ga0207683_110002672 88
404 3300028786 Ga0307517_10019375 Ga0307517_100193756 88
405 3300031616 Ga0307508_10027978 Ga0307508_100279782 88
406 3300031727 Ga0316576_10024631 Ga0316576_100246314 88
407 3300031728 Ga0316578_10015230 Ga0316578_100152302 88
408 3300031730 Ga0307516_10068201 Ga0307516_100682013 88
409 3300032139 Ga0316580_10206343 Ga0316580_102063432 88
410 3300036647 Ga0316582_0228293 Ga0316582_0228293_814_1146 88
411 3300036712 Ga0316584_0002346 Ga0316584_0002346_1956_2288 88
412 3300041411 Ga0439466_0057028 Ga0439466_0057028_160_480 88
413 3300042005 Ga0439448_0365740 Ga0439448_0365740_13_300 88
414 3300042007 Ga0439449_0091794 Ga0439449_0091794_17_337 88
415 3300044683 Ga0466965_0043535 Ga0466965_0043535_375_707 88
416 3300046512 Ga0495610_0031610 Ga0495610_0031610_25_312 88
417 3300046531 Ga0495665_0500699 Ga0495665_0500699_288_575 88
418 3300046557 Ga0495622_0149761 Ga0495622_0149761_39_326 88
419 3300046660 Ga0495625_0358849 Ga0495625_0358849_35_322 88
420 3300046675 Ga0495657_0456715 Ga0495657_0456715_420_707 88
421 3300046694 Ga0495649_0009731 Ga0495649_0009731_5388_5675 88
422 3300047318 Ga0495636_0294265 Ga0495636_0294265_31_318 88
423 3300047447 Ga0495685_109534 Ga0495685_109534_597_884 88
424 3300047447 Ga0495685_130021 Ga0495685_130021_11_310 88
425 3300047470 Ga0495681_0246781 Ga0495681_0246781_387_674 88
426 3300048905 Ga0496102_1520970 Ga0496102_1520970_41_328 88
427 3300048914 Ga0496111_0491673 Ga0496111_0491673_576_890 88
428 3300049460 Ga0495682_0170173 Ga0495682_0170173_17_304 88
429 3300049578 Ga0501042_0594422 Ga0501042_0594422_504_791 88
430 3300049823 Ga0501044_0024862 Ga0501044_0024862_6041_6340 88
431 3300049823 Ga0501044_0901185 Ga0501044_0901185_26_325 88
432 3300053083 Ga0495655_0003679 Ga0495655_0003679_2240_2539 88
433 3300053101 Ga0500553_158493 Ga0500553_158493_22_324 88
434 3300003320 rootH2_10017275 rootH2_100172755 89
435 3300005440 Ga0070705_101231193 Ga0070705_1012311931 89
436 3300009545 Ga0105237_11198280 Ga0105237_111982802 89
437 3300025925 Ga0207650_10473129 Ga0207650_104731292 89
438 3300026023 Ga0207677_12017061 Ga0207677_120170611 89
439 3300044683 Ga0466965_0169242 Ga0466965_0169242_607_939 89
440 3300044842 Ga0466957_0074321 Ga0466957_0074321_164_496 89
441 3300045049 Ga0466959_0571240 Ga0466959_0571240_342_674 89
442 3300045836 Ga0466958_0857445 Ga0466958_0857445_157_489 89
443 3300047447 Ga0495685_147366 Ga0495685_147366_121_453 89
444 3300049569 Ga0501032_0015007 Ga0501032_0015007_2710_3042 89
445 3300049570 Ga0501033_0100027 Ga0501033_0100027_1730_2062 89
446 3300049571 Ga0501034_0027557 Ga0501034_0027557_2388_2720 89
447 3300049572 Ga0501036_0032656 Ga0501036_0032656_3956_4288 89
448 3300049574 Ga0501038_0058002 Ga0501038_0058002_65_397 89
449 3300049575 Ga0501039_0027902 Ga0501039_0027902_911_1243 89
450 3300049579 Ga0501043_0209419 Ga0501043_0209419_240_572 89
451 3300049581 Ga0501047_0056593 Ga0501047_0056593_2674_3006 89
452 3300049586 Ga0501070_0241375 Ga0501070_0241375_203_535 89
453 3300049822 Ga0501035_1023312 Ga0501035_1023312_78_410 89
454 3300049824 Ga0501045_0032328 Ga0501045_0032328_3249_3581 89
455 3300053083 Ga0495655_0040412 Ga0495655_0040412_686_1018 89
456 3300053131 Ga0500652_171790 Ga0500652_171790_451_783 89
457 3300053140 Ga0500573_0175236 Ga0500573_0175236_125_457 89
458 3300013308 Ga0157375_11907443 Ga0157375_119074431 90
459 3300014325 Ga0163163_12596318 Ga0163163_125963182 90
460 3300020070 Ga0206356_11595527 Ga0206356_115955271 90
461 3300031548 Ga0307408_101994187 Ga0307408_1019941872 90
462 3300031824 Ga0307413_10669635 Ga0307413_106696352 90
463 3300031901 Ga0307406_10072872 Ga0307406_100728723 90
464 3300031911 Ga0307412_10583789 Ga0307412_105837892 90
465 3300031995 Ga0307409_101670739 Ga0307409_1016707392 90
466 3300031995 Ga0307409_101907747 Ga0307409_1019077471 90
467 3300032002 Ga0307416_100133084 Ga0307416_1001330843 90
468 3300032004 Ga0307414_10246508 Ga0307414_102465082 90
469 3300032126 Ga0307415_100622755 Ga0307415_1006227552 90
470 3300037853 Ga0436364_0487929 Ga0436364_0487929_228_536 90
471 3300041410 Ga0439461_0179366 Ga0439461_0179366_216_548 90
472 3300041451 Ga0451791_1032014 Ga0451791_1032014_786_1118 90
473 3300041456 Ga0451795_1425503 Ga0451795_1425503_272_604 90
474 3300041512 Ga0451853_1397591 Ga0451853_1397591_104_436 90
475 3300041512 Ga0451853_3509953 Ga0451853_3509953_37_369 90
476 3300047445 Ga0495677_0347946 Ga0495677_0347946_155_487 90
477 3300049573 Ga0501037_0383282 Ga0501037_0383282_166_498 90
478 3300049581 Ga0501047_0000191 Ga0501047_0000191_69711_70043 90
479 3300049823 Ga0501044_0106072 Ga0501044_0106072_1973_2305 90
480 iso_pu_bacteria 2554235005 2554259658 90
481 iso_pu_bacteria 2582581312 2585297862 90
482 iso_pu_bacteria 2582581313 2585310920 90
483 iso_pu_bacteria 2582581314 2585316071 90
484 iso_pu_bacteria 2616644814 2616703006 90
485 iso_pu_bacteria 2616644941 2616905332 90
486 iso_pu_bacteria 2643221548 2643764564 90
487 iso_pu_bacteria 2643221578 2643905221 90
488 iso_pu_bacteria 2643221587 2643942720 90
489 iso_pu_bacteria 2643221647 2644264156 90
490 iso_pu_bacteria 2643221670 2644385888 90
491 iso_pu_bacteria 2643221673 2644403279 90
492 iso_pu_bacteria 2643221677 2644430179 90
493 iso_pu_bacteria 2643221678 2644438173 90
494 iso_pu_bacteria 2643221682 2644458377 90
495 iso_pu_bacteria 2643221690 2644503901 90
496 iso_pu_bacteria 2643221694 2644527036 90
497 iso_pu_bacteria 2643221714 2644629905 90
498 iso_pu_bacteria 2643221721 2644666359 90
499 iso_pu_bacteria 2643221722 2644670231 90
500 iso_pu_bacteria 2734482000 2734976218 90
501 iso_pu_bacteria 2784132148 2784586633 90
502 iso_pu_bacteria 2784746763 2785345865 90
503 iso_pu_bacteria 2784746768 2785367024 90
504 iso_pu_bacteria 2786546132 2786668061 90
505 iso_pu_bacteria 2802429296 2804843616 90
506 iso_pu_bacteria 2808606359 2808847527 90
507 iso_pu_bacteria 2808606375 2808918259 90
508 iso_pu_bacteria 2808606448 2809230160 90
509 iso_pu_bacteria 2808606982 2811846850 90
510 iso_pu_bacteria 2811994879 2812360441 90
511 iso_pu_bacteria 2811994880 2812365145 90
512 iso_pu_bacteria 2811994917 2812482534 90
513 iso_pu_bacteria 2818991463 2819699773 90
514 iso_pu_bacteria 2839986021 2839988550 90
515 iso_pu_bacteria 2852635781 2852643300 90
516 iso_pu_bacteria 2862178590 2862181425 90
517 iso_pu_bacteria 2862281513 2862289786 90
518 iso_pu_bacteria 2862290372 2862294123 90
519 iso_pu_bacteria 2862382967 2862392545 90
520 iso_pu_bacteria 2862507626 2862508466 90
521 iso_pu_bacteria 2862574272 2862580102 90
522 iso_pu_bacteria 2862705112 2862709638 90
523 iso_pu_bacteria 2863404153 2863407096 90
524 iso_pu_bacteria 2867369537 2867375225 90
525 iso_pu_bacteria 2867428634 2867435054 90
526 iso_pu_bacteria 2867475112 2867475993 90
527 iso_pu_bacteria 2873151551 2873157803 90
528 iso_pu_bacteria 2875391855 2875392585 90
529 iso_pu_bacteria 2877676314 2877683519 90
530 iso_pu_bacteria 2884994152 2884995474 90
531 iso_pu_bacteria 2912715099 2912722629 90
532 iso_pu_bacteria 2912723979 2912726311 90
533 iso_pu_bacteria 2912757875 2912758726 90
534 iso_pu_bacteria 2918501144 2918502395 90
535 iso_pu_bacteria 2919468124 2919474483 90
536 iso_pu_bacteria 2935390628 2935394170 90
537 iso_pu_bacteria 2935890801 2935891050 90
538 iso_pu_bacteria 2946045630 2946052131 90
539 iso_pu_bacteria 2946064051 2946065448 90
540 iso_pu_bacteria 2946072368 2946073811 90
541 iso_pu_bacteria 2947224130 2947231959 90
542 iso_pu_bacteria 2954002825 2954008974 90
543 iso_pu_bacteria 2954380949 2954388775 90
544 iso_pu_bacteria 2954673503 2954674349 90
545 iso_pu_bacteria 2954682443 2954689782 90
546 iso_pu_bacteria 2954691527 2954699566 90
547 iso_pu_bacteria 2954701450 2954702651 90
548 iso_pu_bacteria 2954711539 2954718504 90
549 iso_pu_bacteria 2954721474 2954728475 90
550 iso_pu_bacteria 2954731030 2954733335 90
551 iso_pu_bacteria 2954740390 2954747371 90
552 iso_pu_bacteria 2954749733 2954752218 90
553 iso_pu_bacteria 2954759201 2954766485 90
554 iso_pu_bacteria 2966598605 2966604546 90
555 iso_pu_bacteria 2990044586 2990045457 90
556 iso_pu_bacteria 2990059506 2990060260 90
557 iso_pu_bacteria 2990088156 2990093382 90
558 iso_pu_bacteria 2997451912 2997451917 90
559 iso_pu_bacteria 2997600082 2997603425 90
560 iso_pu_bacteria 3006321560 3006327560 90
561 iso_pu_bacteria 3006393351 3006399457 90
562 iso_pu_bacteria 3006425503 3006430708 90
563 iso_pu_bacteria 3006486233 3006489357 90
564 iso_pu_bacteria 3006493962 3006498345 90
565 iso_pu_bacteria 8008485437 8008486931 90
566 iso_pu_bacteria 8008558824 8008561185 90
567 iso_pu_bacteria 8008574985 8008580869 90
568 iso_pu_bacteria 8023623736 8023630936 90
569 iso_pu_bacteria 8025413630 8025418331 90
570 iso_pu_bacteria 8025478263 8025482366 90
571 iso_pu_bacteria 8025524527 8025526188 90
572 iso_pu_bacteria 8025530807 8025533894 90
573 iso_pu_bacteria 8033684223 8033686646 90
574 iso_pu_bacteria 8047893842 8047901208 90
575 iso_pu_bacteria 8048127548 8048135610 90
576 iso_pu_bacteria 8048356638 8048357693 90
577 iso_pu_bacteria 8048369669 8048378148 90
578 iso_pu_bacteria 8048379754 8048387246 90
579 iso_pu_bacteria 8048406513 8048409970 90
580 iso_pu_bacteria 8054160619 8054166910 90
581 iso_pu_bacteria 8056447290 8056454226 90
582 iso_pu_bacteria 8056667051 8056670094 90
583 iso_pu_bacteria 8056829672 8056832440 90
584 3300003203 JGI25406J46586_10004005 JGI25406J46586_100040054 91
585 3300005985 Ga0081539_10000643 Ga0081539_1000064329 91
586 3300031665 Ga0316575_10100952 Ga0316575_101009522 91
587 3300031691 Ga0316579_10044004 Ga0316579_100440043 91
588 3300031727 Ga0316576_10117753 Ga0316576_101177532 91
589 3300031728 Ga0316578_10001886 Ga0316578_100018862 91
590 3300031733 Ga0316577_10075467 Ga0316577_100754674 91
591 3300032133 Ga0316583_10027161 Ga0316583_100271612 91
592 3300032137 Ga0316585_10100688 Ga0316585_101006882 91
593 3300032139 Ga0316580_10121598 Ga0316580_101215982 91
594 3300035086 Ga0373934_0372565 Ga0373934_0372565_35_391 91
595 3300035398 Ga0316574_0028324 Ga0316574_0028324_590_922 91
596 3300035692 Ga0373935_0652500 Ga0373935_0652500_12_368 91
597 3300036401 Ga0373937_0104761 Ga0373937_0104761_1905_2261 91
598 3300036647 Ga0316582_0005574 Ga0316582_0005574_6135_6467 91
599 3300036712 Ga0316584_0006442 Ga0316584_0006442_1702_2034 91
600 3300037068 Ga0373925_0761311 Ga0373925_0761311_108_464 91
601 3300046517 Ga0495630_0568009 Ga0495630_0568009_127_483 91
602 3300047319 Ga0495674_0208180 Ga0495674_0208180_504_860 91
603 3300053085 Ga0495619_0021775 Ga0495619_0021775_1604_1960 91
604 3300006844 Ga0075428_100089562 Ga0075428_1000895624 92
605 3300006846 Ga0075430_100006263 Ga0075430_1000062638 92
606 3300006847 Ga0075431_100008250 Ga0075431_1000082504 92
607 3300006880 Ga0075429_100005562 Ga0075429_1000055624 92
608 3300009147 Ga0114129_10026601 Ga0114129_100266016 92
609 3300014497 Ga0182008_10093452 Ga0182008_100934522 92
610 3300014497 Ga0182008_10153283 Ga0182008_101532832 92
611 3300021388 Ga0213875_10399456 Ga0213875_103994562 92
612 3300025940 Ga0207691_10142229 Ga0207691_101422293 92
613 3300037853 Ga0436364_0312246 Ga0436364_0312246_136_468 92
614 3300041459 Ga0451800_1276582 Ga0451800_1276582_258_590 92
615 3300044694 Ga0466963_0207778 Ga0466963_0207778_961_1293 92
616 3300044842 Ga0466957_0033658 Ga0466957_0033658_555_887 92
617 3300045836 Ga0466958_0139625 Ga0466958_0139625_847_1179 92
618 3300050507 nmdc:mga05p37_24408_c1 nmdc:mga05p37_24408_c1_5009_5341 92
619 3300050508 nmdc:mga09592_7319_c1 nmdc:mga09592_7319_c1_3640_3972 92
620 3300050509 nmdc:mga0qj67_2876_c1 nmdc:mga0qj67_2876_c1_5059_5391 92
621 3300050510 nmdc:mga06r32_29384_c1 nmdc:mga06r32_29384_c1_1901_2233 92
622 3300005336 Ga0070680_100624983 Ga0070680_1006249832 93
623 3300005535 Ga0070684_100177198 Ga0070684_1001771982 93
624 3300005844 Ga0068862_101820475 Ga0068862_1018204752 93
625 3300006175 Ga0070712_100945669 Ga0070712_1009456692 93
626 3300020082 Ga0206353_10968491 Ga0206353_109684912 93
627 3300021388 Ga0213875_10122117 Ga0213875_101221172 93
628 3300025915 Ga0207693_10565252 Ga0207693_105652521 93
629 3300026089 Ga0207648_11959471 Ga0207648_119594712 93
630 3300037853 Ga0436364_0747706 Ga0436364_0747706_671_1003 93
631 3300044901 Ga0466960_0017315 Ga0466960_0017315_1280_1612 93
632 3300044901 Ga0466960_0357114 Ga0466960_0357114_454_786 93
633 3300045976 Ga0466967_0236726 Ga0466967_0236726_576_908 93
634 3300046462 Ga0495651_0677473 Ga0495651_0677473_260_592 93
635 3300046689 Ga0495613_0988979 Ga0495613_0988979_54_386 93
636 3300047315 Ga0495581_0271904 Ga0495581_0271904_604_936 93
637 3300048905 Ga0496102_1302500 Ga0496102_1302500_198_530 93
638 3300048907 Ga0496104_0088701 Ga0496104_0088701_204_536 93
639 3300048907 Ga0496104_1596743 Ga0496104_1596743_73_405 93
640 3300049572 Ga0501036_1465239 Ga0501036_1465239_135_467 93
641 3300053084 Ga0495595_0208890 Ga0495595_0208890_87_419 93
642 3300000549 LJQas_1022420 LJQas_10224202 94
643 3300001990 JGI24737J22298_10241717 JGI24737J22298_102417172 94
644 3300002077 JGI24744J21845_10012255 JGI24744J21845_100122551 94
645 3300003373 JGI25407J50210_10065969 JGI25407J50210_100659692 94
646 3300005327 Ga0070658_10416434 Ga0070658_104164342 94
647 3300005327 Ga0070658_10951039 Ga0070658_109510392 94
648 3300005328 Ga0070676_11176609 Ga0070676_111766091 94
649 3300005328 Ga0070676_11240252 Ga0070676_112402521 94
650 3300005329 Ga0070683_100057355 Ga0070683_1000573553 94
651 3300005329 Ga0070683_100079089 Ga0070683_1000790894 94
652 3300005329 Ga0070683_100099266 Ga0070683_1000992661 94
653 3300005329 Ga0070683_100692307 Ga0070683_1006923072 94
654 3300005329 Ga0070683_101371616 Ga0070683_1013716162 94
655 3300005331 Ga0070670_101796132 Ga0070670_1017961321 94
656 3300005334 Ga0068869_100237561 Ga0068869_1002375612 94
657 3300005335 Ga0070666_10003317 Ga0070666_100033179 94
658 3300005335 Ga0070666_10064975 Ga0070666_100649753 94
659 3300005336 Ga0070680_100363401 Ga0070680_1003634012 94
660 3300005336 Ga0070680_100466470 Ga0070680_1004664702 94
661 3300005337 Ga0070682_100031446 Ga0070682_1000314462 94
662 3300005337 Ga0070682_101123379 Ga0070682_1011233791 94
663 3300005338 Ga0068868_100488411 Ga0068868_1004884112 94
664 3300005339 Ga0070660_100087316 Ga0070660_1000873163 94
665 3300005339 Ga0070660_100322337 Ga0070660_1003223371 94
666 3300005339 Ga0070660_100583841 Ga0070660_1005838411 94
667 3300005339 Ga0070660_101506886 Ga0070660_1015068861 94
668 3300005340 Ga0070689_100098074 Ga0070689_1000980744 94
669 3300005340 Ga0070689_100320167 Ga0070689_1003201672 94
670 3300005341 Ga0070691_10178261 Ga0070691_101782612 94
671 3300005343 Ga0070687_100202557 Ga0070687_1002025572 94
672 3300005344 Ga0070661_100103154 Ga0070661_1001031542 94
673 3300005344 Ga0070661_100241199 Ga0070661_1002411991 94
674 3300005345 Ga0070692_10027073 Ga0070692_100270733 94
675 3300005345 Ga0070692_10491384 Ga0070692_104913842 94
676 3300005347 Ga0070668_100002900 Ga0070668_10000290012 94
677 3300005347 Ga0070668_100369390 Ga0070668_1003693901 94
678 3300005353 Ga0070669_100030781 Ga0070669_1000307815 94
679 3300005353 Ga0070669_101798354 Ga0070669_1017983541 94
680 3300005354 Ga0070675_101509305 Ga0070675_1015093052 94
681 3300005355 Ga0070671_100021033 Ga0070671_1000210333 94
682 3300005356 Ga0070674_100136314 Ga0070674_1001363143 94
683 3300005356 Ga0070674_100313986 Ga0070674_1003139862 94
684 3300005356 Ga0070674_100767046 Ga0070674_1007670462 94
685 3300005364 Ga0070673_100005872 Ga0070673_1000058726 94
686 3300005365 Ga0070688_100721125 Ga0070688_1007211251 94
687 3300005366 Ga0070659_100015723 Ga0070659_1000157237 94
688 3300005366 Ga0070659_100386821 Ga0070659_1003868212 94
689 3300005367 Ga0070667_100006026 Ga0070667_1000060262 94
690 3300005367 Ga0070667_100021661 Ga0070667_1000216613 94
691 3300005406 Ga0070703_10015033 Ga0070703_100150334 94
692 3300005435 Ga0070714_100498172 Ga0070714_1004981722 94
693 3300005435 Ga0070714_101104250 Ga0070714_1011042502 94
694 3300005436 Ga0070713_100063224 Ga0070713_1000632242 94
695 3300005437 Ga0070710_10318990 Ga0070710_103189902 94
696 3300005438 Ga0070701_10004746 Ga0070701_100047462 94
697 3300005438 Ga0070701_10047674 Ga0070701_100476742 94
698 3300005439 Ga0070711_100007302 Ga0070711_1000073025 94
699 3300005440 Ga0070705_100009475 Ga0070705_1000094756 94
700 3300005441 Ga0070700_100000406 Ga0070700_1000004066 94
701 3300005441 Ga0070700_100779527 Ga0070700_1007795272 94
702 3300005444 Ga0070694_100993214 Ga0070694_1009932141 94
703 3300005455 Ga0070663_100033790 Ga0070663_1000337903 94
704 3300005455 Ga0070663_100260717 Ga0070663_1002607172 94
705 3300005455 Ga0070663_100522872 Ga0070663_1005228722 94
706 3300005456 Ga0070678_100025304 Ga0070678_1000253046 94
707 3300005457 Ga0070662_100033899 Ga0070662_1000338991 94
708 3300005458 Ga0070681_10005943 Ga0070681_100059438 94
709 3300005458 Ga0070681_10466558 Ga0070681_104665582 94
710 3300005459 Ga0068867_100087869 Ga0068867_1000878692 94
711 3300005466 Ga0070685_10903264 Ga0070685_109032641 94
712 3300005471 Ga0070698_101341055 Ga0070698_1013410552 94
713 3300005530 Ga0070679_100003650 Ga0070679_10000365016 94
714 3300005530 Ga0070679_100638187 Ga0070679_1006381872 94
715 3300005535 Ga0070684_100144067 Ga0070684_1001440673 94
716 3300005535 Ga0070684_102035952 Ga0070684_1020359522 94
717 3300005536 Ga0070697_101314041 Ga0070697_1013140412 94
718 3300005539 Ga0068853_100135581 Ga0068853_1001355812 94
719 3300005539 Ga0068853_100661340 Ga0068853_1006613402 94
720 3300005543 Ga0070672_100115779 Ga0070672_1001157792 94
721 3300005543 Ga0070672_100239782 Ga0070672_1002397823 94
722 3300005543 Ga0070672_102006595 Ga0070672_1020065952 94
723 3300005544 Ga0070686_100492382 Ga0070686_1004923822 94
724 3300005545 Ga0070695_100446010 Ga0070695_1004460102 94
725 3300005546 Ga0070696_100311025 Ga0070696_1003110252 94
726 3300005547 Ga0070693_100118389 Ga0070693_1001183892 94
727 3300005548 Ga0070665_100003227 Ga0070665_1000032274 94
728 3300005548 Ga0070665_100055978 Ga0070665_1000559784 94
729 3300005548 Ga0070665_100620528 Ga0070665_1006205282 94
730 3300005549 Ga0070704_100037730 Ga0070704_1000377302 94
731 3300005563 Ga0068855_100021450 Ga0068855_1000214508 94
732 3300005563 Ga0068855_100057120 Ga0068855_1000571201 94
733 3300005563 Ga0068855_100059143 Ga0068855_1000591433 94
734 3300005563 Ga0068855_100424958 Ga0068855_1004249582 94
735 3300005563 Ga0068855_100835986 Ga0068855_1008359862 94
736 3300005564 Ga0070664_100178256 Ga0070664_1001782561 94
737 3300005564 Ga0070664_100999770 Ga0070664_1009997702 94
738 3300005577 Ga0068857_101249726 Ga0068857_1012497262 94
739 3300005578 Ga0068854_100306816 Ga0068854_1003068163 94
740 3300005578 Ga0068854_101810675 Ga0068854_1018106752 94
741 3300005614 Ga0068856_100147033 Ga0068856_1001470332 94
742 3300005614 Ga0068856_100174480 Ga0068856_1001744803 94
743 3300005614 Ga0068856_100651890 Ga0068856_1006518902 94
744 3300005615 Ga0070702_100033494 Ga0070702_1000334942 94
745 3300005615 Ga0070702_100253317 Ga0070702_1002533171 94
746 3300005616 Ga0068852_100020158 Ga0068852_1000201582 94
747 3300005616 Ga0068852_100111044 Ga0068852_1001110442 94
748 3300005616 Ga0068852_100674790 Ga0068852_1006747902 94
749 3300005617 Ga0068859_100002361 Ga0068859_10000236113 94
750 3300005617 Ga0068859_100221522 Ga0068859_1002215222 94
751 3300005617 Ga0068859_100809523 Ga0068859_1008095232 94
752 3300005618 Ga0068864_100041671 Ga0068864_1000416712 94
753 3300005718 Ga0068866_10203000 Ga0068866_102030002 94
754 3300005719 Ga0068861_100048872 Ga0068861_1000488724 94
755 3300005719 Ga0068861_100126857 Ga0068861_1001268572 94
756 3300005719 Ga0068861_101266966 Ga0068861_1012669662 94
757 3300005834 Ga0068851_10058629 Ga0068851_100586293 94
758 3300005834 Ga0068851_10619920 Ga0068851_106199202 94
759 3300005840 Ga0068870_10001067 Ga0068870_100010672 94
760 3300005840 Ga0068870_10083920 Ga0068870_100839202 94
761 3300005841 Ga0068863_100004882 Ga0068863_1000048829 94
762 3300005841 Ga0068863_100073740 Ga0068863_1000737402 94
763 3300005842 Ga0068858_100013689 Ga0068858_1000136892 94
764 3300005842 Ga0068858_100039448 Ga0068858_1000394486 94
765 3300005842 Ga0068858_102578238 Ga0068858_1025782382 94
766 3300005843 Ga0068860_100000035 Ga0068860_100000035217 94
767 3300005843 Ga0068860_100042424 Ga0068860_1000424246 94
768 3300005843 Ga0068860_101758013 Ga0068860_1017580132 94
769 3300005844 Ga0068862_100067953 Ga0068862_1000679534 94
770 3300005937 Ga0081455_10002276 Ga0081455_1000227622 94
771 3300005937 Ga0081455_10025771 Ga0081455_100257712 94
772 3300005937 Ga0081455_10041731 Ga0081455_100417315 94
773 3300005937 Ga0081455_10583797 Ga0081455_105837972 94
774 3300005981 Ga0081538_10000036 Ga0081538_1000003630 94
775 3300005981 Ga0081538_10056572 Ga0081538_100565722 94
776 3300005981 Ga0081538_10097228 Ga0081538_100972283 94
777 3300005983 Ga0081540_1010407 Ga0081540_10104077 94
778 3300006028 Ga0070717_10034948 Ga0070717_100349482 94
779 3300006028 Ga0070717_11384185 Ga0070717_113841852 94
780 3300006038 Ga0075365_10024472 Ga0075365_100244722 94
781 3300006038 Ga0075365_10060650 Ga0075365_100606503 94
782 3300006038 Ga0075365_10989443 Ga0075365_109894432 94
783 3300006042 Ga0075368_10205485 Ga0075368_102054852 94
784 3300006058 Ga0075432_10063772 Ga0075432_100637722 94
785 3300006175 Ga0070712_100052549 Ga0070712_1000525492 94
786 3300006177 Ga0075362_10726223 Ga0075362_107262231 94
787 3300006237 Ga0097621_100363228 Ga0097621_1003632282 94
788 3300006237 Ga0097621_100371584 Ga0097621_1003715842 94
789 3300006358 Ga0068871_100009798 Ga0068871_1000097986 94
790 3300006358 Ga0068871_100446913 Ga0068871_1004469132 94
791 3300006844 Ga0075428_100001304 Ga0075428_1000013049 94
792 3300006844 Ga0075428_100274270 Ga0075428_1002742703 94
793 3300006846 Ga0075430_100026196 Ga0075430_1000261962 94
794 3300006847 Ga0075431_100002908 Ga0075431_1000029085 94
795 3300006847 Ga0075431_100012439 Ga0075431_1000124391 94
796 3300006852 Ga0075433_10006767 Ga0075433_1000676710 94
797 3300006852 Ga0075433_10291184 Ga0075433_102911842 94
798 3300006871 Ga0075434_100051928 Ga0075434_1000519287 94
799 3300006871 Ga0075434_100511789 Ga0075434_1005117892 94
800 3300006880 Ga0075429_100001324 Ga0075429_1000013249 94
801 3300006881 Ga0068865_100022810 Ga0068865_1000228103 94
802 3300006881 Ga0068865_100039489 Ga0068865_1000394893 94
803 3300006881 Ga0068865_101485019 Ga0068865_1014850192 94
804 3300006881 Ga0068865_101684194 Ga0068865_1016841942 94
805 3300006914 Ga0075436_100030843 Ga0075436_1000308436 94
806 3300006931 Ga0097620_100002361 Ga0097620_10000236116 94
807 3300006931 Ga0097620_100221504 Ga0097620_1002215042 94
808 3300006931 Ga0097620_100809550 Ga0097620_1008095502 94
809 3300007076 Ga0075435_100250842 Ga0075435_1002508422 94
810 3300009093 Ga0105240_10012487 Ga0105240_1001248712 94
811 3300009093 Ga0105240_10066086 Ga0105240_100660862 94
812 3300009093 Ga0105240_10138708 Ga0105240_101387085 94
813 3300009094 Ga0111539_10038306 Ga0111539_100383063 94
814 3300009094 Ga0111539_10564347 Ga0111539_105643472 94
815 3300009094 Ga0111539_11990147 Ga0111539_119901472 94
816 3300009098 Ga0105245_10034424 Ga0105245_100344245 94
817 3300009098 Ga0105245_10066039 Ga0105245_100660395 94
818 3300009098 Ga0105245_10907041 Ga0105245_109070412 94
819 3300009101 Ga0105247_10003264 Ga0105247_100032642 94
820 3300009101 Ga0105247_10013085 Ga0105247_100130857 94
821 3300009101 Ga0105247_10110891 Ga0105247_101108912 94
822 3300009147 Ga0114129_10080508 Ga0114129_100805083 94
823 3300009148 Ga0105243_10017305 Ga0105243_100173055 94
824 3300009148 Ga0105243_10029336 Ga0105243_100293366 94
825 3300009174 Ga0105241_10016040 Ga0105241_100160405 94
826 3300009174 Ga0105241_10092112 Ga0105241_100921122 94
827 3300009174 Ga0105241_10313472 Ga0105241_103134722 94
828 3300009174 Ga0105241_10818451 Ga0105241_108184512 94
829 3300009176 Ga0105242_10090413 Ga0105242_100904131 94
830 3300009176 Ga0105242_10534754 Ga0105242_105347542 94
831 3300009176 Ga0105242_10704143 Ga0105242_107041432 94
832 3300009177 Ga0105248_10028128 Ga0105248_100281286 94
833 3300009177 Ga0105248_10094722 Ga0105248_100947222 94
834 3300009545 Ga0105237_10091480 Ga0105237_100914803 94
835 3300009545 Ga0105237_10261480 Ga0105237_102614803 94
836 3300009545 Ga0105237_10935616 Ga0105237_109356162 94
837 3300009545 Ga0105237_11547122 Ga0105237_115471222 94
838 3300009551 Ga0105238_10130917 Ga0105238_101309172 94
839 3300009551 Ga0105238_10413460 Ga0105238_104134601 94
840 3300009551 Ga0105238_10433003 Ga0105238_104330031 94
841 3300009553 Ga0105249_10135602 Ga0105249_101356024 94
842 3300009553 Ga0105249_10688100 Ga0105249_106881001 94
843 3300009553 Ga0105249_11302646 Ga0105249_113026462 94
844 3300009553 Ga0105249_12470749 Ga0105249_124707492 94
845 3300010375 Ga0105239_10362082 Ga0105239_103620822 94
846 3300010375 Ga0105239_10393835 Ga0105239_103938352 94
847 3300010375 Ga0105239_10871389 Ga0105239_108713891 94
848 3300011119 Ga0105246_10003223 Ga0105246_100032235 94
849 3300011119 Ga0105246_10383410 Ga0105246_103834102 94
850 3300011119 Ga0105246_10772831 Ga0105246_107728312 94
851 3300013100 Ga0157373_10168923 Ga0157373_101689232 94
852 3300013102 Ga0157371_10604129 Ga0157371_106041292 94
853 3300013104 Ga0157370_10045502 Ga0157370_100455024 94
854 3300013104 Ga0157370_10351827 Ga0157370_103518272 94
855 3300013104 Ga0157370_11449549 Ga0157370_114495492 94
856 3300013105 Ga0157369_10040889 Ga0157369_100408895 94
857 3300013105 Ga0157369_10137846 Ga0157369_101378461 94
858 3300013105 Ga0157369_10174224 Ga0157369_101742244 94
859 3300013105 Ga0157369_10220041 Ga0157369_102200412 94
860 3300013105 Ga0157369_11059610 Ga0157369_110596102 94
861 3300013105 Ga0157369_11539011 Ga0157369_115390112 94
862 3300013296 Ga0157374_10567314 Ga0157374_105673141 94
863 3300013296 Ga0157374_11311054 Ga0157374_113110542 94
864 3300013296 Ga0157374_11977993 Ga0157374_119779932 94
865 3300013296 Ga0157374_12555383 Ga0157374_125553831 94
866 3300013297 Ga0157378_10271920 Ga0157378_102719201 94
867 3300013306 Ga0163162_10014032 Ga0163162_100140328 94
868 3300013307 Ga0157372_10060103 Ga0157372_100601036 94
869 3300013307 Ga0157372_10111409 Ga0157372_101114092 94
870 3300013307 Ga0157372_11867886 Ga0157372_118678862 94
871 3300013308 Ga0157375_10323885 Ga0157375_103238852 94
872 3300013308 Ga0157375_10628424 Ga0157375_106284242 94
873 3300014325 Ga0163163_10068051 Ga0163163_100680513 94
874 3300014325 Ga0163163_10647185 Ga0163163_106471852 94
875 3300014326 Ga0157380_10002480 Ga0157380_100024805 94
876 3300014326 Ga0157380_11026518 Ga0157380_110265182 94
877 3300014968 Ga0157379_10023014 Ga0157379_100230145 94
878 3300014968 Ga0157379_10276379 Ga0157379_102763792 94
879 3300014968 Ga0157379_10932075 Ga0157379_109320752 94
880 3300014968 Ga0157379_11657985 Ga0157379_116579852 94
881 3300014969 Ga0157376_10113096 Ga0157376_101130963 94
882 3300014969 Ga0157376_10413661 Ga0157376_104136612 94
883 3300017792 Ga0163161_10023316 Ga0163161_100233162 94
884 3300017792 Ga0163161_11008509 Ga0163161_110085092 94
885 3300020069 Ga0197907_10033713 Ga0197907_100337131 94
886 3300020070 Ga0206356_10468274 Ga0206356_104682742 94
887 3300020081 Ga0206354_11619843 Ga0206354_116198434 94
888 3300020082 Ga0206353_10029995 Ga0206353_100299952 94
889 3300020082 Ga0206353_10259526 Ga0206353_102595262 94
890 3300020082 Ga0206353_10358891 Ga0206353_103588912 94
891 3300020082 Ga0206353_11246040 Ga0206353_112460402 94
892 3300020082 Ga0206353_11341543 Ga0206353_113415432 94
893 3300022467 Ga0224712_10526188 Ga0224712_105261881 94
894 3300025885 Ga0207653_10013683 Ga0207653_100136833 94
895 3300025893 Ga0207682_10089490 Ga0207682_100894902 94
896 3300025898 Ga0207692_10071362 Ga0207692_100713622 94
897 3300025899 Ga0207642_10020485 Ga0207642_100204854 94
898 3300025899 Ga0207642_10207100 Ga0207642_102071002 94
899 3300025900 Ga0207710_10018543 Ga0207710_100185434 94
900 3300025901 Ga0207688_10005436 Ga0207688_100054367 94
901 3300025901 Ga0207688_10022147 Ga0207688_100221473 94
902 3300025903 Ga0207680_10007745 Ga0207680_100077452 94
903 3300025903 Ga0207680_10013189 Ga0207680_100131892 94
904 3300025904 Ga0207647_10075726 Ga0207647_100757264 94
905 3300025905 Ga0207685_10154324 Ga0207685_101543242 94
906 3300025906 Ga0207699_10521729 Ga0207699_105217292 94
907 3300025908 Ga0207643_10001879 Ga0207643_1000187917 94
908 3300025908 Ga0207643_10071311 Ga0207643_100713113 94
909 3300025909 Ga0207705_10008652 Ga0207705_100086522 94
910 3300025909 Ga0207705_10126804 Ga0207705_101268042 94
911 3300025909 Ga0207705_10212246 Ga0207705_102122462 94
912 3300025909 Ga0207705_10337834 Ga0207705_103378342 94
913 3300025909 Ga0207705_10417605 Ga0207705_104176052 94
914 3300025911 Ga0207654_10015189 Ga0207654_100151894 94
915 3300025911 Ga0207654_10328826 Ga0207654_103288262 94
916 3300025911 Ga0207654_10331453 Ga0207654_103314531 94
917 3300025912 Ga0207707_10106548 Ga0207707_101065483 94
918 3300025912 Ga0207707_10276080 Ga0207707_102760802 94
919 3300025913 Ga0207695_10048226 Ga0207695_100482265 94
920 3300025914 Ga0207671_10513993 Ga0207671_105139932 94
921 3300025914 Ga0207671_10637901 Ga0207671_106379012 94
922 3300025914 Ga0207671_11121285 Ga0207671_111212852 94
923 3300025915 Ga0207693_10000761 Ga0207693_1000076124 94
924 3300025916 Ga0207663_10359681 Ga0207663_103596812 94
925 3300025917 Ga0207660_10189323 Ga0207660_101893232 94
926 3300025917 Ga0207660_10596487 Ga0207660_105964872 94
927 3300025917 Ga0207660_10777114 Ga0207660_107771142 94
928 3300025918 Ga0207662_10019622 Ga0207662_100196224 94
929 3300025918 Ga0207662_10947410 Ga0207662_109474101 94
930 3300025919 Ga0207657_10030578 Ga0207657_100305782 94
931 3300025919 Ga0207657_10148879 Ga0207657_101488792 94
932 3300025919 Ga0207657_10265778 Ga0207657_102657781 94
933 3300025919 Ga0207657_10352389 Ga0207657_103523892 94
934 3300025920 Ga0207649_10213247 Ga0207649_102132472 94
935 3300025921 Ga0207652_10014337 Ga0207652_100143373 94
936 3300025921 Ga0207652_10191667 Ga0207652_101916672 94
937 3300025921 Ga0207652_11691103 Ga0207652_116911032 94
938 3300025923 Ga0207681_10461190 Ga0207681_104611902 94
939 3300025926 Ga0207659_11030345 Ga0207659_110303452 94
940 3300025927 Ga0207687_10057785 Ga0207687_100577852 94
941 3300025927 Ga0207687_10435958 Ga0207687_104359582 94
942 3300025927 Ga0207687_10889889 Ga0207687_108898891 94
943 3300025929 Ga0207664_10275579 Ga0207664_102755792 94
944 3300025929 Ga0207664_11673943 Ga0207664_116739432 94
945 3300025931 Ga0207644_10054720 Ga0207644_100547202 94
946 3300025932 Ga0207690_10041933 Ga0207690_100419334 94
947 3300025933 Ga0207706_10006255 Ga0207706_100062556 94
948 3300025934 Ga0207686_10040933 Ga0207686_100409332 94
949 3300025934 Ga0207686_10050863 Ga0207686_100508634 94
950 3300025935 Ga0207709_10466789 Ga0207709_104667892 94
951 3300025935 Ga0207709_10825308 Ga0207709_108253082 94
952 3300025936 Ga0207670_10253513 Ga0207670_102535131 94
953 3300025936 Ga0207670_10357041 Ga0207670_103570412 94
954 3300025937 Ga0207669_10089674 Ga0207669_100896742 94
955 3300025938 Ga0207704_10041136 Ga0207704_100411364 94
956 3300025938 Ga0207704_10107073 Ga0207704_101070732 94
957 3300025938 Ga0207704_11595553 Ga0207704_115955531 94
958 3300025939 Ga0207665_10000422 Ga0207665_1000042223 94
959 3300025940 Ga0207691_10027476 Ga0207691_100274767 94
960 3300025940 Ga0207691_10322125 Ga0207691_103221252 94
961 3300025940 Ga0207691_10787429 Ga0207691_107874292 94
962 3300025941 Ga0207711_10102174 Ga0207711_101021744 94
963 3300025942 Ga0207689_10008948 Ga0207689_100089484 94
964 3300025942 Ga0207689_10367736 Ga0207689_103677362 94
965 3300025942 Ga0207689_10939378 Ga0207689_109393782 94
966 3300025944 Ga0207661_10085644 Ga0207661_100856443 94
967 3300025944 Ga0207661_10423064 Ga0207661_104230641 94
968 3300025944 Ga0207661_10626118 Ga0207661_106261181 94
969 3300025945 Ga0207679_10437057 Ga0207679_104370572 94
970 3300025945 Ga0207679_10826774 Ga0207679_108267742 94
971 3300025949 Ga0207667_10016618 Ga0207667_100166183 94
972 3300025949 Ga0207667_10086751 Ga0207667_100867512 94
973 3300025960 Ga0207651_10161527 Ga0207651_101615272 94
974 3300025961 Ga0207712_10021402 Ga0207712_100214022 94
975 3300025961 Ga0207712_10027364 Ga0207712_100273643 94
976 3300025972 Ga0207668_10034693 Ga0207668_100346936 94
977 3300025972 Ga0207668_10168949 Ga0207668_101689492 94
978 3300025972 Ga0207668_10436276 Ga0207668_104362762 94
979 3300025981 Ga0207640_10461976 Ga0207640_104619761 94
980 3300025981 Ga0207640_10734821 Ga0207640_107348212 94
981 3300025986 Ga0207658_10085070 Ga0207658_100850702 94
982 3300025986 Ga0207658_10490683 Ga0207658_104906831 94
983 3300026023 Ga0207677_10029126 Ga0207677_100291263 94
984 3300026035 Ga0207703_10026842 Ga0207703_100268422 94
985 3300026035 Ga0207703_10132231 Ga0207703_101322312 94
986 3300026041 Ga0207639_10799056 Ga0207639_107990563 94
987 3300026041 Ga0207639_10819544 Ga0207639_108195442 94
988 3300026041 Ga0207639_11695635 Ga0207639_116956352 94
989 3300026067 Ga0207678_10001278 Ga0207678_1000127816 94
990 3300026067 Ga0207678_10152307 Ga0207678_101523071 94
991 3300026067 Ga0207678_10459733 Ga0207678_104597332 94
992 3300026067 Ga0207678_10501361 Ga0207678_105013612 94
993 3300026075 Ga0207708_10011571 Ga0207708_100115711 94
994 3300026075 Ga0207708_10064908 Ga0207708_100649081 94
995 3300026078 Ga0207702_10186047 Ga0207702_101860472 94
996 3300026078 Ga0207702_10485092 Ga0207702_104850922 94
997 3300026078 Ga0207702_10531607 Ga0207702_105316072 94
998 3300026078 Ga0207702_10750895 Ga0207702_107508952 94
999 3300026088 Ga0207641_10047443 Ga0207641_100474435 94
1000 3300026088 Ga0207641_10720561 Ga0207641_107205612 94
1001 3300026089 Ga0207648_10010968 Ga0207648_100109685 94
1002 3300026095 Ga0207676_10249253 Ga0207676_102492532 94
1003 3300026095 Ga0207676_10297790 Ga0207676_102977902 94
1004 3300026095 Ga0207676_10695211 Ga0207676_106952111 94
1005 3300026095 Ga0207676_11082651 Ga0207676_110826512 94
1006 3300026116 Ga0207674_10656676 Ga0207674_106566762 94
1007 3300026118 Ga0207675_100000862 Ga0207675_10000086225 94
1008 3300026118 Ga0207675_100020738 Ga0207675_1000207386 94
1009 3300026118 Ga0207675_100315973 Ga0207675_1003159732 94
1010 3300026121 Ga0207683_10004856 Ga0207683_100048568 94
1011 3300026142 Ga0207698_10251581 Ga0207698_102515812 94
1012 3300026142 Ga0207698_10265222 Ga0207698_102652222 94
1013 3300026142 Ga0207698_10433076 Ga0207698_104330762 94
1014 3300026142 Ga0207698_12274804 Ga0207698_122748041 94
1015 3300027907 Ga0207428_10026948 Ga0207428_100269485 94
1016 3300027907 Ga0207428_10039472 Ga0207428_100394723 94
1017 3300028379 Ga0268266_10001967 Ga0268266_1000196714 94
1018 3300028379 Ga0268266_10091476 Ga0268266_100914763 94
1019 3300028380 Ga0268265_11154206 Ga0268265_111542061 94
1020 3300028381 Ga0268264_10000031 Ga0268264_10000031191 94
1021 3300028794 Ga0307515_10291706 Ga0307515_102917062 94
1022 3300031691 Ga0316579_10207008 Ga0316579_102070082 94
1023 3300031727 Ga0316576_10025917 Ga0316576_100259174 94
1024 3300031727 Ga0316576_10281019 Ga0316576_102810192 94
1025 3300031728 Ga0316578_10018168 Ga0316578_100181686 94
1026 3300031728 Ga0316578_10181487 Ga0316578_101814872 94
1027 3300031728 Ga0316578_10614932 Ga0316578_106149322 94
1028 3300031733 Ga0316577_10021049 Ga0316577_100210496 94
1029 3300031824 Ga0307413_10048253 Ga0307413_100482534 94
1030 3300031852 Ga0307410_10206833 Ga0307410_102068332 94
1031 3300031901 Ga0307406_10285993 Ga0307406_102859932 94
1032 3300031901 Ga0307406_11131994 Ga0307406_111319942 94
1033 3300031903 Ga0307407_10884813 Ga0307407_108848132 94
1034 3300031995 Ga0307409_100037961 Ga0307409_1000379615 94
1035 3300031995 Ga0307409_100200923 Ga0307409_1002009232 94
1036 3300031995 Ga0307409_100206187 Ga0307409_1002061872 94
1037 3300031995 Ga0307409_102207635 Ga0307409_1022076352 94
1038 3300032002 Ga0307416_100168408 Ga0307416_1001684083 94
1039 3300032005 Ga0307411_10812345 Ga0307411_108123451 94
1040 3300032126 Ga0307415_100006661 Ga0307415_1000066617 94
1041 3300032133 Ga0316583_10023364 Ga0316583_100233643 94
1042 3300032137 Ga0316585_10022745 Ga0316585_100227452 94
1043 3300032139 Ga0316580_10034779 Ga0316580_100347792 94
1044 3300032139 Ga0316580_10038366 Ga0316580_100383662 94
1045 3300034816 Ga0373930_0048644 Ga0373930_0048644_495_827 94
1046 3300034819 Ga0373958_0055269 Ga0373958_0055269_283_615 94
1047 3300034820 Ga0373959_0032445 Ga0373959_0032445_634_966 94
1048 3300034957 Ga0373938_0016011 Ga0373938_0016011_478_810 94
1049 3300035084 Ga0373928_0008878 Ga0373928_0008878_1596_1928 94
1050 3300035112 Ga0373932_0084710 Ga0373932_0084710_448_780 94
1051 3300035115 Ga0373941_0120182 Ga0373941_0120182_550_882 94
1052 3300035121 Ga0373960_0004260 Ga0373960_0004260_526_858 94
1053 3300035207 Ga0373942_0075556 Ga0373942_0075556_478_810 94
1054 3300035242 Ga0373962_0263856 Ga0373962_0263856_167_499 94
1055 3300035398 Ga0316574_0002927 Ga0316574_0002927_525_857 94
1056 3300035398 Ga0316574_0006864 Ga0316574_0006864_1155_1487 94
1057 3300035398 Ga0316574_0039475 Ga0316574_0039475_239_571 94
1058 3300035398 Ga0316574_0181112 Ga0316574_0181112_656_988 94
1059 3300035691 Ga0373931_0396935 Ga0373931_0396935_68_400 94
1060 3300035695 Ga0373927_0769922 Ga0373927_0769922_99_431 94
1061 3300035725 Ga0373947_0630113 Ga0373947_0630113_93_425 94
1062 3300036647 Ga0316582_0004636 Ga0316582_0004636_1137_1469 94
1063 3300036647 Ga0316582_0950418 Ga0316582_0950418_147_479 94
1064 3300036712 Ga0316584_0001080 Ga0316584_0001080_9602_9934 94
1065 3300036712 Ga0316584_0024754 Ga0316584_0024754_1361_1693 94
1066 3300036712 Ga0316584_0071727 Ga0316584_0071727_1606_1938 94
1067 3300036712 Ga0316584_0146750 Ga0316584_0146750_702_1034 94
1068 3300037068 Ga0373925_0974753 Ga0373925_0974753_89_421 94
1069 3300037068 Ga0373925_1060720 Ga0373925_1060720_188_520 94
1070 3300037068 Ga0373925_1444953 Ga0373925_1444953_91_423 94
1071 3300037312 Ga0395899_0014945 Ga0395899_0014945_4114_4446 94
1072 3300037418 Ga0395900_0244171 Ga0395900_0244171_515_847 94
1073 3300037466 Ga0395898_0023615 Ga0395898_0023615_3929_4261 94
1074 3300037466 Ga0395898_0584518 Ga0395898_0584518_393_725 94
1075 3300037466 Ga0395898_0910125 Ga0395898_0910125_420_752 94
1076 3300037471 Ga0395905_0355771 Ga0395905_0355771_602_934 94
1077 3300038443 Ga0395901_0070161 Ga0395901_0070161_1044_1376 94
1078 3300038443 Ga0395901_1705059 Ga0395901_1705059_137_469 94
1079 3300041404 Ga0439436_0004809 Ga0439436_0004809_1482_1814 94
1080 3300041404 Ga0439436_0035109 Ga0439436_0035109_889_1221 94
1081 3300041405 Ga0439438_110365 Ga0439438_110365_130_462 94
1082 3300041441 Ga0451787_443561 Ga0451787_443561_89_421 94
1083 3300041452 Ga0451793_1705097 Ga0451793_1705097_127_459 94
1084 3300041456 Ga0451795_1527499 Ga0451795_1527499_406_738 94
1085 3300041463 Ga0451804_0978374 Ga0451804_0978374_110_442 94
1086 3300041496 Ga0451839_0451422 Ga0451839_0451422_57_389 94
1087 3300041512 Ga0451853_3106522 Ga0451853_3106522_166_498 94
1088 3300042014 Ga0439457_001276 Ga0439457_001276_4408_4740 94
1089 3300042131 Ga0450894_000402 Ga0450894_000402_2642_2974 94
1090 3300042135 Ga0450899_000036 Ga0450899_000036_797_1129 94
1091 3300044656 Ga0466969_0010992 Ga0466969_0010992_1824_2156 94
1092 3300044656 Ga0466969_0013005 Ga0466969_0013005_2967_3299 94
1093 3300044656 Ga0466969_0110907 Ga0466969_0110907_290_634 94
1094 3300044656 Ga0466969_0220074 Ga0466969_0220074_329_661 94
1095 3300044658 Ga0466972_0009587 Ga0466972_0009587_2291_2623 94
1096 3300044658 Ga0466972_0072859 Ga0466972_0072859_1081_1413 94
1097 3300044658 Ga0466972_0162133 Ga0466972_0162133_187_519 94
1098 3300044658 Ga0466972_0236880 Ga0466972_0236880_261_593 94
1099 3300044658 Ga0466972_0532276 Ga0466972_0532276_121_453 94
1100 3300044658 Ga0466972_0536432 Ga0466972_0536432_207_539 94
1101 3300044683 Ga0466965_0010965 Ga0466965_0010965_519_851 94
1102 3300044683 Ga0466965_0282760 Ga0466965_0282760_489_821 94
1103 3300044684 Ga0466966_0002073 Ga0466966_0002073_7433_7765 94
1104 3300044684 Ga0466966_0025000 Ga0466966_0025000_439_771 94
1105 3300044684 Ga0466966_0028829 Ga0466966_0028829_2920_3252 94
1106 3300044684 Ga0466966_0142757 Ga0466966_0142757_453_785 94
1107 3300044684 Ga0466966_0165133 Ga0466966_0165133_646_978 94
1108 3300044684 Ga0466966_0230017 Ga0466966_0230017_59_391 94
1109 3300044693 Ga0466961_0014704 Ga0466961_0014704_2624_2956 94
1110 3300044693 Ga0466961_0045254 Ga0466961_0045254_2241_2573 94
1111 3300044693 Ga0466961_0132317 Ga0466961_0132317_784_1116 94
1112 3300044693 Ga0466961_0202977 Ga0466961_0202977_238_570 94
1113 3300044693 Ga0466961_0247600 Ga0466961_0247600_664_996 94
1114 3300044693 Ga0466961_0262829 Ga0466961_0262829_463_795 94
1115 3300044693 Ga0466961_0366455 Ga0466961_0366455_479_811 94
1116 3300044694 Ga0466963_0000954 Ga0466963_0000954_5390_5722 94
1117 3300044694 Ga0466963_0001197 Ga0466963_0001197_6572_6904 94
1118 3300044694 Ga0466963_0027689 Ga0466963_0027689_2823_3155 94
1119 3300044694 Ga0466963_0036308 Ga0466963_0036308_446_778 94
1120 3300044694 Ga0466963_0042041 Ga0466963_0042041_2096_2428 94
1121 3300044694 Ga0466963_0083036 Ga0466963_0083036_453_785 94
1122 3300044694 Ga0466963_0172772 Ga0466963_0172772_363_695 94
1123 3300044694 Ga0466963_0784525 Ga0466963_0784525_68_400 94
1124 3300044694 Ga0466963_0920574 Ga0466963_0920574_136_468 94
1125 3300044706 Ga0466964_0033613 Ga0466964_0033613_1485_1817 94
1126 3300044706 Ga0466964_0050199 Ga0466964_0050199_630_962 94
1127 3300044706 Ga0466964_0155505 Ga0466964_0155505_157_489 94
1128 3300044706 Ga0466964_0559184 Ga0466964_0559184_46_378 94
1129 3300044719 Ga0466971_0005350 Ga0466971_0005350_777_1109 94
1130 3300044719 Ga0466971_0009159 Ga0466971_0009159_1673_2005 94
1131 3300044719 Ga0466971_0462942 Ga0466971_0462942_54_386 94
1132 3300044735 Ga0466968_0130881 Ga0466968_0130881_431_763 94
1133 3300044735 Ga0466968_0299683 Ga0466968_0299683_300_632 94
1134 3300044735 Ga0466968_0338362 Ga0466968_0338362_277_609 94
1135 3300044765 Ga0466970_0006676 Ga0466970_0006676_1012_1344 94
1136 3300044765 Ga0466970_0056600 Ga0466970_0056600_582_914 94
1137 3300044765 Ga0466970_0139243 Ga0466970_0139243_611_943 94
1138 3300044765 Ga0466970_0216939 Ga0466970_0216939_692_1024 94
1139 3300044765 Ga0466970_0318905 Ga0466970_0318905_129_461 94
1140 3300044765 Ga0466970_0322202 Ga0466970_0322202_187_519 94
1141 3300044765 Ga0466970_0586225 Ga0466970_0586225_226_558 94
1142 3300044842 Ga0466957_0017495 Ga0466957_0017495_2900_3232 94
1143 3300044842 Ga0466957_0054096 Ga0466957_0054096_1767_2099 94
1144 3300044901 Ga0466960_0006393 Ga0466960_0006393_524_856 94
1145 3300044901 Ga0466960_0171892 Ga0466960_0171892_119_451 94
1146 3300044901 Ga0466960_0750356 Ga0466960_0750356_237_569 94
1147 3300045049 Ga0466959_0001862 Ga0466959_0001862_683_1015 94
1148 3300045049 Ga0466959_0035444 Ga0466959_0035444_367_699 94
1149 3300045049 Ga0466959_0113081 Ga0466959_0113081_1473_1805 94
1150 3300045049 Ga0466959_0127788 Ga0466959_0127788_459_791 94
1151 3300045049 Ga0466959_0190193 Ga0466959_0190193_474_806 94
1152 3300045049 Ga0466959_0922226 Ga0466959_0922226_59_391 94
1153 3300045049 Ga0466959_1192868 Ga0466959_1192868_97_429 94
1154 3300045836 Ga0466958_0005815 Ga0466958_0005815_547_879 94
1155 3300045836 Ga0466958_0008194 Ga0466958_0008194_559_891 94
1156 3300045836 Ga0466958_0037010 Ga0466958_0037010_995_1327 94
1157 3300045836 Ga0466958_0243493 Ga0466958_0243493_762_1094 94
1158 3300045836 Ga0466958_0245045 Ga0466958_0245045_217_549 94
1159 3300045836 Ga0466958_0353297 Ga0466958_0353297_580_912 94
1160 3300045836 Ga0466958_0451233 Ga0466958_0451233_71_403 94
1161 3300045836 Ga0466958_0576267 Ga0466958_0576267_64_396 94
1162 3300045836 Ga0466958_1031491 Ga0466958_1031491_57_389 94
1163 3300045976 Ga0466967_0000613 Ga0466967_0000613_5539_5871 94
1164 3300045976 Ga0466967_0004827 Ga0466967_0004827_6999_7331 94
1165 3300045976 Ga0466967_0012903 Ga0466967_0012903_3382_3714 94
1166 3300045976 Ga0466967_0026875 Ga0466967_0026875_1975_2307 94
1167 3300045976 Ga0466967_0033125 Ga0466967_0033125_105_437 94
1168 3300045976 Ga0466967_0077677 Ga0466967_0077677_1752_2084 94
1169 3300045976 Ga0466967_0198330 Ga0466967_0198330_297_629 94
1170 3300045976 Ga0466967_0282112 Ga0466967_0282112_434_766 94
1171 3300045976 Ga0466967_0282536 Ga0466967_0282536_919_1251 94
1172 3300045976 Ga0466967_0305088 Ga0466967_0305088_631_963 94
1173 3300045976 Ga0466967_0347908 Ga0466967_0347908_529_861 94
1174 3300045976 Ga0466967_0931016 Ga0466967_0931016_350_682 94
1175 3300045976 Ga0466967_1209721 Ga0466967_1209721_369_701 94
1176 3300045976 Ga0466967_1299476 Ga0466967_1299476_293_625 94
1177 3300046455 Ga0495603_0111508 Ga0495603_0111508_432_764 94
1178 3300046461 Ga0495641_0369414 Ga0495641_0369414_101_433 94
1179 3300046517 Ga0495630_1284813 Ga0495630_1284813_116_448 94
1180 3300046663 Ga0495635_1035433 Ga0495635_1035433_54_386 94
1181 3300046674 Ga0495588_0229898 Ga0495588_0229898_423_755 94
1182 3300046683 Ga0495658_0144532 Ga0495658_0144532_581_913 94
1183 3300046689 Ga0495613_0800271 Ga0495613_0800271_167_499 94
1184 3300046690 Ga0495624_0262369 Ga0495624_0262369_302_634 94
1185 3300047319 Ga0495674_0194464 Ga0495674_0194464_72_404 94
1186 3300047319 Ga0495674_0401256 Ga0495674_0401256_390_722 94
1187 3300047321 Ga0495676_0272373 Ga0495676_0272373_687_1019 94
1188 3300048088 Ga0495602_1125161 Ga0495602_1125161_47_379 94
1189 3300048903 Ga0496100_0375421 Ga0496100_0375421_394_726 94
1190 3300048904 Ga0496101_0395556 Ga0496101_0395556_644_976 94
1191 3300048905 Ga0496102_0000474 Ga0496102_0000474_20996_21328 94
1192 3300048905 Ga0496102_0052146 Ga0496102_0052146_666_998 94
1193 3300048905 Ga0496102_0079919 Ga0496102_0079919_1500_1832 94
1194 3300048905 Ga0496102_0382362 Ga0496102_0382362_852_1184 94
1195 3300048905 Ga0496102_0415930 Ga0496102_0415930_138_470 94
1196 3300048905 Ga0496102_0701748 Ga0496102_0701748_254_586 94
1197 3300048906 Ga0496103_0000746 Ga0496103_0000746_523_855 94
1198 3300048906 Ga0496103_0109647 Ga0496103_0109647_1171_1503 94
1199 3300048906 Ga0496103_0129399 Ga0496103_0129399_910_1242 94
1200 3300048907 Ga0496104_0004536 Ga0496104_0004536_4766_5098 94
1201 3300048907 Ga0496104_0191015 Ga0496104_0191015_971_1303 94
1202 3300048908 Ga0496105_0343704 Ga0496105_0343704_397_729 94
1203 3300048908 Ga0496105_0370273 Ga0496105_0370273_373_705 94
1204 3300048909 Ga0496106_0100021 Ga0496106_0100021_1826_2158 94
1205 3300048910 Ga0496107_0048969 Ga0496107_0048969_2039_2371 94
1206 3300048910 Ga0496107_0684246 Ga0496107_0684246_141_473 94
1207 3300048910 Ga0496107_0741838 Ga0496107_0741838_262_594 94
1208 3300048911 Ga0496108_0007637 Ga0496108_0007637_3518_3850 94
1209 3300048911 Ga0496108_0016478 Ga0496108_0016478_5452_5784 94
1210 3300048911 Ga0496108_0043231 Ga0496108_0043231_1211_1543 94
1211 3300048911 Ga0496108_0106569 Ga0496108_0106569_1846_2178 94
1212 3300048912 Ga0496109_0094738 Ga0496109_0094738_2064_2396 94
1213 3300048912 Ga0496109_0193109 Ga0496109_0193109_119_451 94
1214 3300048912 Ga0496109_0202587 Ga0496109_0202587_567_899 94
1215 3300048912 Ga0496109_0238702 Ga0496109_0238702_1228_1560 94
1216 3300048912 Ga0496109_0725810 Ga0496109_0725810_396_728 94
1217 3300048913 Ga0496110_0011291 Ga0496110_0011291_601_933 94
1218 3300048913 Ga0496110_0023092 Ga0496110_0023092_3353_3685 94
1219 3300048913 Ga0496110_0325865 Ga0496110_0325865_338_670 94
1220 3300048913 Ga0496110_0411533 Ga0496110_0411533_773_1105 94
1221 3300048913 Ga0496110_0977177 Ga0496110_0977177_220_552 94
1222 3300048914 Ga0496111_0027325 Ga0496111_0027325_1743_2075 94
1223 3300048914 Ga0496111_0513307 Ga0496111_0513307_41_373 94
1224 3300048914 Ga0496111_0677513 Ga0496111_0677513_67_399 94
1225 3300048915 Ga0496112_0049608 Ga0496112_0049608_435_767 94
1226 3300048916 Ga0496113_0307134 Ga0496113_0307134_234_566 94
1227 3300048916 Ga0496113_1032153 Ga0496113_1032153_217_549 94
1228 3300048917 Ga0496114_0016483 Ga0496114_0016483_3665_3997 94
1229 3300048917 Ga0496114_0143077 Ga0496114_0143077_1223_1555 94
1230 3300048917 Ga0496114_0143609 Ga0496114_0143609_889_1221 94
1231 3300048917 Ga0496114_0164995 Ga0496114_0164995_479_811 94
1232 3300048917 Ga0496114_0223148 Ga0496114_0223148_1108_1440 94
1233 3300048917 Ga0496114_0235128 Ga0496114_0235128_307_639 94
1234 3300048918 Ga0496115_0007736 Ga0496115_0007736_6443_6775 94
1235 3300048918 Ga0496115_0357708 Ga0496115_0357708_429_761 94
1236 3300048918 Ga0496115_0586262 Ga0496115_0586262_25_357 94
1237 3300048920 Ga0496117_0094345 Ga0496117_0094345_1150_1482 94
1238 3300048920 Ga0496117_0202037 Ga0496117_0202037_19_351 94
1239 3300048921 Ga0496118_0059415 Ga0496118_0059415_1518_1850 94
1240 3300048921 Ga0496118_0094560 Ga0496118_0094560_434_766 94
1241 3300048921 Ga0496118_0627843 Ga0496118_0627843_126_458 94
1242 3300048922 Ga0496119_0025963 Ga0496119_0025963_149_481 94
1243 3300048922 Ga0496119_0055002 Ga0496119_0055002_545_877 94
1244 3300048923 Ga0496120_0367002 Ga0496120_0367002_277_609 94
1245 3300048924 Ga0496121_0017831 Ga0496121_0017831_2533_2865 94
1246 3300048925 Ga0496122_0001555 Ga0496122_0001555_16426_16758 94
1247 3300048926 Ga0496123_0400097 Ga0496123_0400097_182_514 94
1248 3300048928 Ga0496125_0000025 Ga0496125_0000025_270591_270923 94
1249 3300048929 Ga0496126_0000036 Ga0496126_0000036_236537_236869 94
1250 3300049569 Ga0501032_0009780 Ga0501032_0009780_3998_4330 94
1251 3300049569 Ga0501032_0019341 Ga0501032_0019341_4081_4413 94
1252 3300049570 Ga0501033_0089909 Ga0501033_0089909_885_1217 94
1253 3300049570 Ga0501033_0177710 Ga0501033_0177710_962_1294 94
1254 3300049571 Ga0501034_0063804 Ga0501034_0063804_952_1284 94
1255 3300049571 Ga0501034_0145647 Ga0501034_0145647_159_491 94
1256 3300049571 Ga0501034_0472586 Ga0501034_0472586_769_1101 94
1257 3300049572 Ga0501036_0592988 Ga0501036_0592988_346_678 94
1258 3300049573 Ga0501037_0105593 Ga0501037_0105593_1615_1947 94
1259 3300049573 Ga0501037_0399266 Ga0501037_0399266_397_729 94
1260 3300049574 Ga0501038_0003594 Ga0501038_0003594_6929_7261 94
1261 3300049574 Ga0501038_0007999 Ga0501038_0007999_798_1130 94
1262 3300049575 Ga0501039_0468282 Ga0501039_0468282_443_775 94
1263 3300049579 Ga0501043_0410947 Ga0501043_0410947_346_678 94
1264 3300049580 Ga0501046_0023316 Ga0501046_0023316_1166_1498 94
1265 3300049581 Ga0501047_0005402 Ga0501047_0005402_3997_4329 94
1266 3300049581 Ga0501047_0037162 Ga0501047_0037162_3811_4143 94
1267 3300049581 Ga0501047_0049715 Ga0501047_0049715_2900_3232 94
1268 3300049581 Ga0501047_0523684 Ga0501047_0523684_457_789 94
1269 3300049582 Ga0501048_0000405 Ga0501048_0000405_24964_25296 94
1270 3300049582 Ga0501048_0401781 Ga0501048_0401781_568_900 94
1271 3300049583 Ga0501067_0041498 Ga0501067_0041498_1654_1986 94
1272 3300049583 Ga0501067_0144006 Ga0501067_0144006_215_547 94
1273 3300049583 Ga0501067_0781863 Ga0501067_0781863_164_496 94
1274 3300049585 Ga0501069_0012307 Ga0501069_0012307_861_1193 94
1275 3300049585 Ga0501069_0539436 Ga0501069_0539436_42_374 94
1276 3300049586 Ga0501070_0108433 Ga0501070_0108433_1822_2154 94
1277 3300049586 Ga0501070_0790646 Ga0501070_0790646_79_411 94
1278 3300049586 Ga0501070_1041937 Ga0501070_1041937_19_351 94
1279 3300049586 Ga0501070_1380007 Ga0501070_1380007_18_350 94
1280 3300049744 Ga0501083_0024967 Ga0501083_0024967_803_1135 94
1281 3300049744 Ga0501083_0980639 Ga0501083_0980639_26_358 94
1282 3300049822 Ga0501035_0034700 Ga0501035_0034700_4018_4350 94
1283 3300049822 Ga0501035_0089814 Ga0501035_0089814_934_1266 94
1284 3300049822 Ga0501035_0097433 Ga0501035_0097433_1308_1640 94
1285 3300049822 Ga0501035_0210569 Ga0501035_0210569_225_557 94
1286 3300049823 Ga0501044_0097788 Ga0501044_0097788_2075_2407 94
1287 3300049823 Ga0501044_0217659 Ga0501044_0217659_240_572 94
1288 3300049823 Ga0501044_0222055 Ga0501044_0222055_986_1318 94
1289 3300050492 nmdc:mga0yw44_1049157_c1 nmdc:mga0yw44_1049157_c1_197_529 94
1290 3300050492 nmdc:mga0yw44_187909_c1 nmdc:mga0yw44_187909_c1_760_1092 94
1291 3300050495 nmdc:mga04h51_203941_c1 nmdc:mga04h51_203941_c1_236_568 94
1292 3300050507 nmdc:mga05p37_440_c1 nmdc:mga05p37_440_c1_35761_36093 94
1293 3300050508 nmdc:mga09592_278_c1 nmdc:mga09592_278_c1_36622_36954 94
1294 3300050508 nmdc:mga09592_281623_c1 nmdc:mga09592_281623_c1_417_749 94
1295 3300050509 nmdc:mga0qj67_20014_c1 nmdc:mga0qj67_20014_c1_3902_4234 94
1296 3300050509 nmdc:mga0qj67_79740_c1 nmdc:mga0qj67_79740_c1_797_1129 94
1297 3300050510 nmdc:mga06r32_4205_c1 nmdc:mga06r32_4205_c1_7172_7504 94
1298 3300050510 nmdc:mga06r32_434_c1 nmdc:mga06r32_434_c1_26793_27125 94
1299 3300050511 nmdc:mga08y16_14165_c1 nmdc:mga08y16_14165_c1_2621_2953 94
1300 3300050511 nmdc:mga08y16_9696_c1 nmdc:mga08y16_9696_c1_6165_6497 94
1301 3300050512 nmdc:mga0n895_502919_c1 nmdc:mga0n895_502919_c1_394_726 94
1302 3300050512 nmdc:mga0n895_707851_c1 nmdc:mga0n895_707851_c1_308_640 94
1303 3300050514 nmdc:mga08x19_284937_c1 nmdc:mga08x19_284937_c1_372_704 94
1304 3300050515 nmdc:mga0a205_137541_c1 nmdc:mga0a205_137541_c1_1631_1963 94
1305 3300053084 Ga0495595_0049668 Ga0495595_0049668_313_645 94
1306 3300054114 Ga0501084_0706142 Ga0501084_0706142_419_751 94
1307 3300060353 Ga0501082_0001608 Ga0501082_0001608_15962_16294 94
1308 3300061719 Ga0466962_0002858 Ga0466962_0002858_1581_1913 94
1309 3300061719 Ga0466962_0003210 Ga0466962_0003210_1505_1846 94
1310 3300061719 Ga0466962_0017111 Ga0466962_0017111_3005_3337 94
1311 3300061719 Ga0466962_0291938 Ga0466962_0291938_316_648 94
1312 3300061734 Ga0530510_0458111 Ga0530510_0458111_194_526 94
1313 iso_pu_bacteria 3002998708 3003004122 94

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06947

DUF1290

Protein of unknown function (DUF1290)

24

111

0.98

Feature Viewer

pLDDT pTM Quality
69.49 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map