F492902

General Info

Members Datasets Scaffolds Average Seq Length
1314 592 2628 128

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0637847|Ga0453684_0637847_661_1065
Length 125
Sequence MGTPTKRPGPTRPSKKEGKGVAQGLACIQATFNNTIVTITDPTGNVVTWASAGSVGFKGSRKSTPFAAQMIAQGMKEVKVFVKGPGAGREAAIRSLQAAGLEITAIKDVTPIPHNGCRPRKRRRV

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
32 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
97 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
187 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
188 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
196 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
197 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
198 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
199 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
200 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
201 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
205 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
206 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
207 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
208 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
209 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
217 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
218 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
219 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
220 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
233 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
234 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
235 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
237 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
238 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
247 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
254 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
257 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
258 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
259 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
260 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
261 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
262 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
263 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
264 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
265 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
266 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
267 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
268 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
269 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
270 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
271 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
272 3300041500 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT Metatranscriptome Unclassified
273 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
274 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
275 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
276 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
277 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
278 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
279 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
280 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
281 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
282 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
283 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
284 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
285 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
286 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
290 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
300 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
301 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
302 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
303 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
306 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
307 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
308 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
309 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
310 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
311 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
316 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
317 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
321 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
322 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
329 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
330 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
333 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
336 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
351 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
352 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
367 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
368 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
408 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
409 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
410 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
411 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
412 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
413 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
414 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
415 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
416 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
417 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
418 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
419 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
420 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
421 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
422 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
423 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
428 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
429 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
430 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
431 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
432 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
433 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
434 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
435 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
436 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
437 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
438 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
439 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
440 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
441 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
442 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
443 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
444 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
445 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
446 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
447 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
448 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
449 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
450 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
451 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
452 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
453 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
454 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
455 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
480 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
481 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
482 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
483 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
484 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
485 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
486 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
487 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
488 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
489 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
490 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
491 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
492 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
493 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
494 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
495 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
496 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
497 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
498 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
499 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
500 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
501 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
502 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
503 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
504 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
505 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
506 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
507 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
508 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
509 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
510 2738541283 Pedobacter sp. OK701 Isolate Unclassified
511 2738541284 Pedobacter sp. YR016 Isolate Unclassified
512 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
513 2738541302 Pedobacter sp. CF074 Isolate Unclassified
514 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
515 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
516 2738543023 Pedobacter sp. OK628 Isolate Unclassified
517 2739367651 Pedobacter sp. OK291 Isolate Unclassified
518 2739367656 Pedobacter sp. CF523 Isolate Unclassified
519 2739367663 Pedobacter sp. YR510 Isolate Unclassified
520 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
521 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
522 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
523 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
524 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
525 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
526 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
527 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
528 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
529 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
530 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
531 2818991437 Pedobacter terrae 518 Isolate Unclassified
532 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
533 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
534 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
535 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
536 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
537 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
538 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
539 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
540 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
541 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
542 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
543 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
544 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
545 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
546 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
547 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
548 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
549 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
550 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
551 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
552 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
553 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
554 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
555 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
556 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
557 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
558 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
559 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
560 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
561 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
562 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
563 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
564 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
565 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
566 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
567 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
568 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
569 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
570 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
571 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
572 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
573 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
574 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
575 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
576 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
577 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
578 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
579 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
580 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
581 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
582 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
583 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
584 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
585 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
586 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
587 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
588 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
589 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
590 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
591 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
592 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.66
Metatranscriptomes 16.67
Isolates 8.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 4.87
Nodule 0.53
Rhizoplane 2.44
Rhizosphere 83.41
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0637847 3300044712 Bacteria 1164
2 MRS2a_Contig_24813 2124908027 Bacteria 958
3 SwRhRL2b_contig_156102 2162886007 Bacteria 1577
4 SwRhRL2b_contig_1853401 2162886007 Bacteria 2479
5 SwRhRL2b_contig_2489919 2162886007 Bacteria 1072
6 SwRhRL2b_contig_3583939 2162886007 Bacteria 2057
7 MRS1b_contig_1810326 2162886011 Bacteria 979
8 2214800779 2209111006 Bacteria 2080
9 JGI24741J21665_1003251 3300001915 Bacteria 3929
10 JGI24740J21852_10008913 3300001979 Bacteria 3965
11 JGI24740J21852_10033543 3300001979 Bacteria 1628
12 JGI24737J22298_10001860 3300001990 Bacteria 7545
13 JGI24735J21928_10000003 3300002067 Bacteria 385983
14 JGI24735J21928_10005021 3300002067 Bacteria 4405
15 JGI24744J21845_10001128 3300002077 Bacteria 5201
16 JGI25162J39368_1000039 3300002737 Bacteria 175976
17 JGI25162J39368_1001202 3300002737 Bacteria 15113
18 JGI25164J39214_1001166 3300002772 Bacteria 7290
19 JGI25152J39213_1000006 3300002773 Bacteria 158516
20 JGI25150J39212_1000005 3300002774 Bacteria 311800
21 JGI25151J46595_10000004 3300003187 Bacteria 494006
22 JGI25165J46597_1000678 3300003214 Bacteria 27401
23 JGI25153J46596_10000004 3300003215 Bacteria 494006
24 Ga0006758J48902_1029451 3300003300 Bacteria 891
25 rootH1_10024556 3300003316 Bacteria 3314
26 rootH1_10160693 3300003316 Bacteria 1292
27 rootH2_10056635 3300003320 Bacteria 7076
28 rootL2_10101710 3300003322 Bacteria 4114
29 rootH1_10045781 3300003323 Bacteria 11513
30 rootH1_10193341 3300003323 Bacteria 1500
31 Ga0007409J51694_1063312 3300003575 Bacteria 2513
32 Ga0006562J51391_1003423 3300003578 Bacteria 13910
33 Ga0006562J51391_1007655 3300003578 Bacteria 3240
34 Ga0055536_1000004 3300003781 Bacteria 411108
35 Ga0055530_10000817 3300003791 Bacteria 25836
36 Ga0058863_10111335 3300004799 Bacteria 3480
37 Ga0058861_10176091 3300004800 Bacteria 3494
38 Ga0058860_10114316 3300004801 Bacteria 13584
39 Ga0058860_10142251 3300004801 Bacteria 2938
40 Ga0058862_10102512 3300004803 Bacteria 4102
41 Ga0065717_1001968 3300005276 Bacteria 4650
42 Ga0065716_1002480 3300005277 Bacteria 1749
43 Ga0065714_10002624 3300005288 Bacteria 24311
44 Ga0065714_10005956 3300005288 Bacteria 4227
45 Ga0065714_10009786 3300005288 Bacteria 2823
46 Ga0065714_10013697 3300005288 Bacteria 1653
47 Ga0065714_10022334 3300005288 Bacteria 1051
48 Ga0065714_10045584 3300005288 Bacteria 720
49 Ga0065714_10047236 3300005288 Bacteria 915
50 Ga0065714_10079789 3300005288 Bacteria 2486
51 Ga0065714_10102584 3300005288 Bacteria 1620
52 Ga0065714_10160851 3300005288 Bacteria 1052
53 Ga0065714_10163029 3300005288 Bacteria 1034
54 Ga0065714_10250665 3300005288 Bacteria 775
55 Ga0065704_10000307 3300005289 Bacteria 35767
56 Ga0065704_10004597 3300005289 Bacteria 3633
57 Ga0065704_10073035 3300005289 Bacteria 7653
58 Ga0065704_10078273 3300005289 Bacteria 4471
59 Ga0065704_10082398 3300005289 Bacteria 3606
60 Ga0065704_10096211 3300005289 Bacteria 2436
61 Ga0065704_10102101 3300005289 Bacteria 2215
62 Ga0065704_10177771 3300005289 Bacteria 1220
63 Ga0065704_10269193 3300005289 Bacteria 947
64 Ga0065704_10346795 3300005289 Bacteria 810
65 Ga0065704_10399407 3300005289 Bacteria 753
66 Ga0065704_10458670 3300005289 Bacteria 699
67 Ga0065715_10036832 3300005293 Bacteria 2618
68 Ga0065715_10521621 3300005293 Bacteria 763
69 Ga0065715_10569858 3300005293 Bacteria 699
70 Ga0065715_10866960 3300005293 Bacteria 584
71 Ga0065715_10927087 3300005293 Bacteria 561
72 Ga0070658_10000153 3300005327 Bacteria 60625
73 Ga0070658_10120312 3300005327 Bacteria 2181
74 Ga0070658_10244897 3300005327 Bacteria 1520
75 Ga0070676_10000312 3300005328 Bacteria 21945
76 Ga0070683_100018688 3300005329 Bacteria 6143
77 Ga0070683_100032136 3300005329 Bacteria 4777
78 Ga0070690_100580742 3300005330 Bacteria 848
79 Ga0070670_100135400 3300005331 Bacteria 2129
80 Ga0070680_100005676 3300005336 Bacteria 9464
81 Ga0070682_100000768 3300005337 Bacteria 18980
82 Ga0068868_100104416 3300005338 Bacteria 2296
83 Ga0068868_100118877 3300005338 Bacteria 2154
84 Ga0070660_100043744 3300005339 Bacteria 3423
85 Ga0070660_100057675 3300005339 Bacteria 3009
86 Ga0070691_10252658 3300005341 Bacteria 946
87 Ga0070668_100276810 3300005347 Bacteria 1400
88 Ga0070669_100349495 3300005353 Bacteria 1200
89 Ga0070671_100045958 3300005355 Bacteria 3631
90 Ga0070671_101121230 3300005355 Bacteria 691
91 Ga0070674_100123468 3300005356 Bacteria 1920
92 Ga0070673_100043212 3300005364 Bacteria 3480
93 Ga0070659_100000375 3300005366 Bacteria 33764
94 Ga0070659_101692991 3300005366 Bacteria 566
95 Ga0070667_101647679 3300005367 Bacteria 603
96 Ga0070678_100032095 3300005456 Bacteria 3631
97 Ga0070678_100234064 3300005456 Bacteria 1533
98 Ga0070662_100000074 3300005457 Bacteria 54943
99 Ga0070662_100794941 3300005457 Bacteria 804
100 Ga0070681_10002985 3300005458 Bacteria 15692
101 Ga0068867_100010877 3300005459 Bacteria 6418
102 Ga0068867_100970210 3300005459 Bacteria 769
103 Ga0074259_10883899 3300005507 Bacteria 545
104 Ga0070679_100006255 3300005530 Bacteria 11090
105 Ga0070679_100727393 3300005530 Bacteria 935
106 Ga0070684_100006351 3300005535 Bacteria 9136
107 Ga0070684_100723154 3300005535 Bacteria 929
108 Ga0068853_100150954 3300005539 Bacteria 2092
109 Ga0068853_100167326 3300005539 Bacteria 1987
110 Ga0070693_101517646 3300005547 Bacteria 524
111 Ga0070665_100000372 3300005548 Bacteria 66748
112 Ga0070704_101084299 3300005549 Bacteria 727
113 Ga0068855_100000360 3300005563 Bacteria 56448
114 Ga0068855_100012268 3300005563 Bacteria 10356
115 Ga0068855_100025831 3300005563 Bacteria 7023
116 Ga0068855_100061070 3300005563 Bacteria 4405
117 Ga0068855_100071470 3300005563 Bacteria 4035
118 Ga0068855_100279474 3300005563 Bacteria 1854
119 Ga0068855_100524481 3300005563 Bacteria 1285
120 Ga0068855_100671044 3300005563 Bacteria 1112
121 Ga0068855_100814966 3300005563 Bacteria 991
122 Ga0068855_100859569 3300005563 Bacteria 961
123 Ga0068855_102101977 3300005563 Bacteria 569
124 Ga0068857_100489716 3300005577 Bacteria 1153
125 Ga0068854_100266832 3300005578 Bacteria 1373
126 Ga0068854_100936506 3300005578 Bacteria 763
127 Ga0068856_100016148 3300005614 Bacteria 7219
128 Ga0068856_100058008 3300005614 Bacteria 3823
129 Ga0068856_100147792 3300005614 Bacteria 2358
130 Ga0068856_100153582 3300005614 Bacteria 2312
131 Ga0068856_100340133 3300005614 Bacteria 1519
132 Ga0068856_100423074 3300005614 Bacteria 1352
133 Ga0068856_100667106 3300005614 Bacteria 1060
134 Ga0068852_100010466 3300005616 Bacteria 6935
135 Ga0068852_100268045 3300005616 Bacteria 1642
136 Ga0068852_100411938 3300005616 Bacteria 1332
137 Ga0068852_100462537 3300005616 Bacteria 1258
138 Ga0068852_101512163 3300005616 Bacteria 694
139 Ga0068859_102399722 3300005617 Bacteria 581
140 Ga0068859_102708143 3300005617 Bacteria 545
141 Ga0068866_10152156 3300005718 Bacteria 1341
142 Ga0068863_100897056 3300005841 Bacteria 887
143 Ga0068863_101631036 3300005841 Unclassified 654
144 Ga0068863_101913908 3300005841 Bacteria 603
145 Ga0068860_100562306 3300005843 Bacteria 1143
146 Ga0070716_100062251 3300006173 Bacteria 2163
147 Ga0075362_10012264 3300006177 Bacteria 3401
148 Ga0075369_10350950 3300006186 Bacteria 692
149 Ga0075366_10089546 3300006195 Bacteria 1843
150 Ga0075366_10252599 3300006195 Bacteria 1076
151 Ga0097621_100007799 3300006237 Bacteria 7678
152 Ga0097621_100200943 3300006237 Bacteria 1730
153 Ga0075370_10177105 3300006353 Bacteria 1254
154 Ga0068871_100000141 3300006358 Bacteria 46656
155 Ga0068871_100350639 3300006358 Bacteria 1305
156 Ga0068865_100000917 3300006881 Bacteria 16715
157 Ga0097620_102399396 3300006931 Bacteria 581
158 Ga0097620_102707874 3300006931 Bacteria 545
159 Ga0099824_1003374 3300006942 Bacteria 23361
160 Ga0079104_1000280 3300006946 Bacteria 65859
161 Ga0099826_10000125 3300006948 Bacteria 34471
162 Ga0105251_10038077 3300009011 Bacteria 2357
163 Ga0105251_10057935 3300009011 Bacteria 1830
164 Ga0105251_10498151 3300009011 Bacteria 569
165 Ga0105244_10000027 3300009036 Bacteria 207569
166 Ga0105244_10000160 3300009036 Bacteria 69914
167 Ga0105244_10015827 3300009036 Bacteria 4315
168 Ga0105240_10000082 3300009093 Bacteria 195184
169 Ga0105240_10073384 3300009093 Bacteria 4225
170 Ga0105240_10204993 3300009093 Bacteria 2309
171 Ga0105240_10432476 3300009093 Bacteria 1476
172 Ga0105240_10481262 3300009093 Bacteria 1384
173 Ga0105240_10924097 3300009093 Bacteria 937
174 Ga0105240_10971270 3300009093 Bacteria 910
175 Ga0105240_11222634 3300009093 Bacteria 795
176 Ga0111539_11039008 3300009094 Bacteria 952
177 Ga0105245_10144700 3300009098 Bacteria 2242
178 Ga0105245_10812450 3300009098 Bacteria 973
179 Ga0105245_11624337 3300009098 Bacteria 698
180 Ga0105243_10000009 3300009148 Bacteria 354419
181 Ga0105243_10003612 3300009148 Bacteria 12456
182 Ga0105243_10014278 3300009148 Bacteria 6010
183 Ga0105241_10111599 3300009174 Bacteria 2189
184 Ga0105241_10177460 3300009174 Bacteria 1764
185 Ga0105241_10191865 3300009174 Bacteria 1701
186 Ga0105241_10555896 3300009174 Bacteria 1031
187 Ga0105241_11121315 3300009174 Bacteria 742
188 Ga0105241_11613001 3300009174 Bacteria 628
189 Ga0105242_10053982 3300009176 Bacteria 3283
190 Ga0105242_10227333 3300009176 Bacteria 1670
191 Ga0105242_10279101 3300009176 Bacteria 1517
192 Ga0105242_10692446 3300009176 Bacteria 996
193 Ga0105242_10847467 3300009176 Bacteria 909
194 Ga0105237_10000794 3300009545 Bacteria 43200
195 Ga0105237_10002553 3300009545 Bacteria 22488
196 Ga0105237_10006510 3300009545 Bacteria 12935
197 Ga0105237_10015313 3300009545 Bacteria 7986
198 Ga0105237_10015662 3300009545 Bacteria 7882
199 Ga0105237_10047854 3300009545 Bacteria 4300
200 Ga0105237_10071252 3300009545 Bacteria 3471
201 Ga0105237_10083942 3300009545 Bacteria 3175
202 Ga0105237_10185132 3300009545 Bacteria 2083
203 Ga0105237_11452365 3300009545 Bacteria 692
204 Ga0105238_10017754 3300009551 Bacteria 7234
205 Ga0105238_10194984 3300009551 Bacteria 2001
206 Ga0105249_10092720 3300009553 Bacteria 2828
207 Ga0105249_10192006 3300009553 Bacteria 1994
208 Ga0130086_1024805 3300009829 Bacteria 618
209 Ga0130085_1035330 3300009850 Bacteria 618
210 Ga0105239_10000011 3300010375 Bacteria 337500
211 Ga0105239_10005378 3300010375 Bacteria 15038
212 Ga0105239_10015682 3300010375 Bacteria 8387
213 Ga0105239_10248837 3300010375 Bacteria 1996
214 Ga0105239_10262733 3300010375 Bacteria 1940
215 Ga0105239_10429598 3300010375 Bacteria 1497
216 Ga0105239_12090703 3300010375 Bacteria 658
217 Ga0157327_1007676 3300012512 Bacteria 946
218 Ga0157373_10000006 3300013100 Bacteria 261768
219 Ga0157373_10001033 3300013100 Bacteria 21448
220 Ga0157373_10001369 3300013100 Bacteria 18710
221 Ga0157373_10002831 3300013100 Bacteria 13113
222 Ga0157373_10009996 3300013100 Bacteria 6992
223 Ga0157373_10028999 3300013100 Bacteria 3989
224 Ga0157373_10059430 3300013100 Bacteria 2709
225 Ga0157373_11166423 3300013100 Bacteria 580
226 Ga0157371_10000041 3300013102 Bacteria 203957
227 Ga0157371_10000091 3300013102 Bacteria 144664
228 Ga0157371_10001553 3300013102 Bacteria 23609
229 Ga0157371_10001678 3300013102 Bacteria 22612
230 Ga0157371_10013476 3300013102 Bacteria 6207
231 Ga0157371_10021684 3300013102 Bacteria 4713
232 Ga0157371_10033811 3300013102 Bacteria 3672
233 Ga0157370_10012207 3300013104 Bacteria 8929
234 Ga0157370_10014051 3300013104 Bacteria 8215
235 Ga0157370_10019740 3300013104 Bacteria 6747
236 Ga0157370_10041216 3300013104 Bacteria 4457
237 Ga0157370_10042074 3300013104 Bacteria 4404
238 Ga0157370_10073063 3300013104 Bacteria 3236
239 Ga0157370_10106885 3300013104 Bacteria 2618
240 Ga0157370_10327925 3300013104 Bacteria 1412
241 Ga0157370_10553788 3300013104 Bacteria 1054
242 Ga0157370_10693077 3300013104 Bacteria 930
243 Ga0157370_10856639 3300013104 Bacteria 826
244 Ga0157370_11487469 3300013104 Bacteria 609
245 Ga0157369_10000016 3300013105 Bacteria 257827
246 Ga0157369_10000613 3300013105 Bacteria 46357
247 Ga0157369_10008868 3300013105 Bacteria 11520
248 Ga0157369_10010007 3300013105 Bacteria 10831
249 Ga0157369_10030357 3300013105 Bacteria 5962
250 Ga0157369_10080886 3300013105 Bacteria 3478
251 Ga0157369_10408180 3300013105 Bacteria 1409
252 Ga0157369_11507817 3300013105 Bacteria 684
253 Ga0157374_10030641 3300013296 Bacteria 4886
254 Ga0157374_10077301 3300013296 Bacteria 3150
255 Ga0157374_10104516 3300013296 Bacteria 2719
256 Ga0157374_10208307 3300013296 Bacteria 1916
257 Ga0157374_10210459 3300013296 Bacteria 1906
258 Ga0157374_10371931 3300013296 Bacteria 1423
259 Ga0157374_10454107 3300013296 Bacteria 1283
260 Ga0157374_10986484 3300013296 Bacteria 861
261 Ga0157374_11416639 3300013296 Bacteria 718
262 Ga0157374_11420827 3300013296 Bacteria 717
263 Ga0157378_10008303 3300013297 Bacteria 9048
264 Ga0157378_10060889 3300013297 Bacteria 3368
265 Ga0157378_10378236 3300013297 Bacteria 1390
266 Ga0163162_10003331 3300013306 Bacteria 15374
267 Ga0163162_10033491 3300013306 Bacteria 5107
268 Ga0163162_10047580 3300013306 Bacteria 4298
269 Ga0163162_10068714 3300013306 Bacteria 3595
270 Ga0163162_10106514 3300013306 Bacteria 2899
271 Ga0163162_10278112 3300013306 Bacteria 1806
272 Ga0163162_11176876 3300013306 Bacteria 870
273 Ga0163162_11396126 3300013306 Bacteria 797
274 Ga0157372_10000030 3300013307 Bacteria 179925
275 Ga0157372_10000332 3300013307 Bacteria 51907
276 Ga0157372_10003430 3300013307 Bacteria 17111
277 Ga0157372_10011651 3300013307 Bacteria 9360
278 Ga0157372_10037880 3300013307 Bacteria 5321
279 Ga0157372_10129288 3300013307 Bacteria 2905
280 Ga0157372_10157361 3300013307 Bacteria 2625
281 Ga0157372_10903284 3300013307 Bacteria 1025
282 Ga0157375_10099030 3300013308 Bacteria 2993
283 Ga0157375_10904988 3300013308 Bacteria 1026
284 Ga0157375_11032639 3300013308 Bacteria 960
285 Ga0157375_11275906 3300013308 Bacteria 863
286 Ga0157375_11403714 3300013308 Bacteria 823
287 Ga0157375_11429406 3300013308 Bacteria 815
288 Ga0157375_11618320 3300013308 Bacteria 766
289 Ga0157375_13212846 3300013308 Bacteria 545
290 Ga0163163_10980641 3300014325 Bacteria 908
291 Ga0163163_11138066 3300014325 Bacteria 843
292 Ga0163163_11580757 3300014325 Bacteria 717
293 Ga0163163_12203559 3300014325 Bacteria 610
294 Ga0157380_10000051 3300014326 Bacteria 68466
295 Ga0157380_10946651 3300014326 Bacteria 891
296 Ga0182008_10000003 3300014497 Bacteria 456880
297 Ga0182008_10000034 3300014497 Bacteria 138235
298 Ga0182008_10001770 3300014497 Bacteria 14147
299 Ga0182008_10003643 3300014497 Bacteria 9192
300 Ga0182008_10111138 3300014497 Bacteria 1358
301 Ga0182008_10345321 3300014497 Bacteria 788
302 Ga0182008_10716442 3300014497 Bacteria 573
303 Ga0157377_10009989 3300014745 Bacteria 4682
304 Ga0157379_11114424 3300014968 Bacteria 756
305 Ga0157376_10125737 3300014969 Bacteria 2280
306 Ga0157376_10271219 3300014969 Bacteria 1594
307 Ga0182006_1000001 3300015261 Bacteria 1091090
308 Ga0182006_1000103 3300015261 Bacteria 93638
309 Ga0182006_1006389 3300015261 Bacteria 5486
310 Ga0182006_1008481 3300015261 Bacteria 4656
311 Ga0182006_1009290 3300015261 Bacteria 4412
312 Ga0182006_1062134 3300015261 Bacteria 1406
313 Ga0182006_1068748 3300015261 Bacteria 1318
314 Ga0182007_10000002 3300015262 Bacteria 564661
315 Ga0182007_10005771 3300015262 Bacteria 5382
316 Ga0182007_10015899 3300015262 Bacteria 2792
317 Ga0183373_1004 3300015682 Bacteria 537398
318 Ga0163161_10000039 3300017792 Bacteria 148130
319 Ga0163161_10000207 3300017792 Bacteria 53913
320 Ga0163161_10009312 3300017792 Bacteria 6794
321 Ga0163161_10039425 3300017792 Bacteria 3391
322 Ga0163161_10054256 3300017792 Bacteria 2908
323 Ga0163161_10097976 3300017792 Bacteria 2178
324 Ga0163161_10125798 3300017792 Bacteria 1930
325 Ga0163161_10317631 3300017792 Bacteria 1230
326 Ga0163161_10554453 3300017792 Bacteria 942
327 Ga0163161_10628450 3300017792 Bacteria 888
328 Ga0163161_10709095 3300017792 Bacteria 838
329 Ga0163161_10739282 3300017792 Bacteria 822
330 Ga0163161_11250984 3300017792 Bacteria 643
331 Ga0197907_10757494 3300020069 Bacteria 1550
332 Ga0197907_11138220 3300020069 Bacteria 1021
333 Ga0206356_10991038 3300020070 Bacteria 2728
334 Ga0206356_11209637 3300020070 Bacteria 1368
335 Ga0206356_11535795 3300020070 Bacteria 1012
336 Ga0206349_1692805 3300020075 Bacteria 840
337 Ga0206351_10267476 3300020077 Bacteria 15418
338 Ga0206351_10387294 3300020077 Bacteria 4610
339 Ga0206351_10512829 3300020077 Bacteria 15076
340 Ga0206351_10991482 3300020077 Bacteria 3143
341 Ga0206352_10226992 3300020078 Bacteria 1800
342 Ga0206352_10382572 3300020078 Bacteria 889
343 Ga0206352_10622029 3300020078 Bacteria 2482
344 Ga0206352_10835038 3300020078 Bacteria 2111
345 Ga0206350_10018304 3300020080 Bacteria 4056
346 Ga0206350_11221028 3300020080 Bacteria 1722
347 Ga0206354_10248047 3300020081 Bacteria 1770
348 Ga0206354_10263498 3300020081 Bacteria 1624
349 Ga0206354_11507030 3300020081 Bacteria 837
350 Ga0206353_10159245 3300020082 Bacteria 898
351 Ga0206353_10736142 3300020082 Bacteria 1941
352 Ga0154015_1024308 3300020610 Bacteria 3636
353 Ga0154015_1037437 3300020610 Bacteria 13281
354 Ga0154015_1309672 3300020610 Bacteria 3231
355 Ga0213872_10051000 3300021361 Bacteria 1878
356 Ga0224712_10004189 3300022467 Bacteria 3860
357 Ga0224712_10045345 3300022467 Bacteria 1682
358 Ga0224712_10082607 3300022467 Bacteria 1329
359 Ga0209563_127189 3300025230 Bacteria 575
360 Ga0207427_100025 3300025231 Bacteria 433726
361 Ga0209437_100010 3300025233 Bacteria 838447
362 Ga0209437_100135 3300025233 Bacteria 176455
363 Ga0207425_1000008 3300025245 Bacteria 618024
364 Ga0209026_1000610 3300025250 Bacteria 22917
365 Ga0209026_1004574 3300025250 Bacteria 4059
366 Ga0209148_1033295 3300025254 Bacteria 753
367 Ga0209148_1037006 3300025254 Bacteria 694
368 Ga0209129_1000040 3300025258 Bacteria 313043
369 Ga0209129_1049492 3300025258 Bacteria 645
370 Ga0209233_1000017 3300025261 Bacteria 898076
371 Ga0209233_1032971 3300025261 Bacteria 1192
372 Ga0209675_1000200 3300025291 Bacteria 63684
373 Ga0209676_1000009 3300025292 Bacteria 981719
374 Ga0209025_1000020 3300025294 Bacteria 618024
375 Ga0209758_1000022 3300025297 Bacteria 618024
376 Ga0209050_1000048 3300025298 Bacteria 371553
377 Ga0207655_1000016 3300025728 Bacteria 551476
378 Ga0207655_1000038 3300025728 Bacteria 348340
379 Ga0207655_1062533 3300025728 Bacteria 1431
380 Ga0207713_1057298 3300025735 Bacteria 1507
381 Ga0207642_10051496 3300025899 Bacteria 1863
382 Ga0207642_10122961 3300025899 Bacteria 1342
383 Ga0207647_10000303 3300025904 Bacteria 40536
384 Ga0207647_10032931 3300025904 Bacteria 3324
385 Ga0207647_10036461 3300025904 Bacteria 3124
386 Ga0207645_10000035 3300025907 Bacteria 89345
387 Ga0207705_10000108 3300025909 Bacteria 93501
388 Ga0207705_10328136 3300025909 Bacteria 1176
389 Ga0207654_10023808 3300025911 Bacteria 3286
390 Ga0207654_10124200 3300025911 Bacteria 1625
391 Ga0207654_10648325 3300025911 Bacteria 756
392 Ga0207654_10982565 3300025911 Bacteria 614
393 Ga0207707_10032972 3300025912 Bacteria 4534
394 Ga0207695_10000053 3300025913 Bacteria 396740
395 Ga0207695_10039657 3300025913 Bacteria 5060
396 Ga0207695_10062421 3300025913 Bacteria 3847
397 Ga0207695_10080728 3300025913 Bacteria 3293
398 Ga0207695_10085252 3300025913 Bacteria 3188
399 Ga0207695_10288044 3300025913 Bacteria 1535
400 Ga0207671_10005849 3300025914 Bacteria 11173
401 Ga0207671_10011776 3300025914 Bacteria 7082
402 Ga0207671_10013363 3300025914 Bacteria 6541
403 Ga0207671_10018120 3300025914 Bacteria 5410
404 Ga0207671_10020602 3300025914 Bacteria 5016
405 Ga0207671_10034795 3300025914 Bacteria 3742
406 Ga0207671_10072375 3300025914 Bacteria 2573
407 Ga0207671_10722220 3300025914 Bacteria 792
408 Ga0207671_10847229 3300025914 Bacteria 724
409 Ga0207660_10360566 3300025917 Bacteria 1166
410 Ga0207657_10055251 3300025919 Bacteria 3431
411 Ga0207657_10111319 3300025919 Bacteria 2261
412 Ga0207657_10231799 3300025919 Bacteria 1476
413 Ga0207657_10398871 3300025919 Bacteria 1082
414 Ga0207649_10253338 3300025920 Bacteria 1269
415 Ga0207652_10002419 3300025921 Bacteria 15754
416 Ga0207652_10095693 3300025921 Bacteria 2616
417 Ga0207652_11552987 3300025921 Bacteria 566
418 Ga0207681_10486661 3300025923 Bacteria 1008
419 Ga0207694_10009649 3300025924 Bacteria 7276
420 Ga0207694_10042226 3300025924 Bacteria 3517
421 Ga0207650_10136672 3300025925 Bacteria 1923
422 Ga0207687_10126670 3300025927 Bacteria 1918
423 Ga0207687_11130250 3300025927 Bacteria 673
424 Ga0207664_10602438 3300025929 Bacteria 987
425 Ga0207644_11375596 3300025931 Bacteria 593
426 Ga0207690_10000936 3300025932 Bacteria 18684
427 Ga0207690_10069096 3300025932 Bacteria 2429
428 Ga0207706_10019009 3300025933 Bacteria 6180
429 Ga0207706_10854126 3300025933 Bacteria 771
430 Ga0207686_10059526 3300025934 Bacteria 2414
431 Ga0207686_10187305 3300025934 Bacteria 1472
432 Ga0207709_10000026 3300025935 Bacteria 354467
433 Ga0207709_10000084 3300025935 Bacteria 161002
434 Ga0207709_10020248 3300025935 Bacteria 3750
435 Ga0207709_11582225 3300025935 Bacteria 544
436 Ga0207704_10000036 3300025938 Bacteria 94574
437 Ga0207665_10034201 3300025939 Bacteria 3373
438 Ga0207691_10186142 3300025940 Bacteria 1812
439 Ga0207691_10275349 3300025940 Bacteria 1449
440 Ga0207689_10558361 3300025942 Bacteria 962
441 Ga0207661_10013292 3300025944 Bacteria 6012
442 Ga0207661_10014621 3300025944 Bacteria 5756
443 Ga0207667_10000430 3300025949 Bacteria 56466
444 Ga0207667_10022849 3300025949 Bacteria 6898
445 Ga0207667_10023666 3300025949 Bacteria 6761
446 Ga0207667_10041900 3300025949 Bacteria 4869
447 Ga0207667_10093127 3300025949 Bacteria 3112
448 Ga0207667_10242746 3300025949 Bacteria 1843
449 Ga0207667_10265903 3300025949 Bacteria 1753
450 Ga0207651_10009416 3300025960 Bacteria 5347
451 Ga0207712_10542484 3300025961 Bacteria 999
452 Ga0207668_10020698 3300025972 Bacteria 4186
453 Ga0207668_11671342 3300025972 Bacteria 575
454 Ga0207640_10192986 3300025981 Bacteria 1537
455 Ga0207640_10666795 3300025981 Bacteria 888
456 Ga0207640_10912444 3300025981 Bacteria 768
457 Ga0207658_10494531 3300025986 Bacteria 1089
458 Ga0207658_10975083 3300025986 Bacteria 773
459 Ga0207677_11055425 3300026023 Bacteria 739
460 Ga0207639_10167234 3300026041 Bacteria 1859
461 Ga0207639_10380458 3300026041 Bacteria 1267
462 Ga0207639_10546031 3300026041 Bacteria 1063
463 Ga0207639_11132541 3300026041 Bacteria 734
464 Ga0207702_10010443 3300026078 Bacteria 7766
465 Ga0207702_10068465 3300026078 Bacteria 3050
466 Ga0207702_10069982 3300026078 Bacteria 3017
467 Ga0207702_10311424 3300026078 Bacteria 1497
468 Ga0207702_10318830 3300026078 Bacteria 1480
469 Ga0207702_10322206 3300026078 Bacteria 1472
470 Ga0207702_10370041 3300026078 Bacteria 1376
471 Ga0207702_10567715 3300026078 Bacteria 1111
472 Ga0207702_12422588 3300026078 Bacteria 512
473 Ga0207648_10000333 3300026089 Bacteria 51656
474 Ga0207648_11039269 3300026089 Bacteria 768
475 Ga0207676_11854756 3300026095 Bacteria 602
476 Ga0207674_10641092 3300026116 Bacteria 1026
477 Ga0207674_10812864 3300026116 Bacteria 902
478 Ga0207674_11110581 3300026116 Bacteria 760
479 Ga0207683_10003418 3300026121 Bacteria 13828
480 Ga0207683_10918146 3300026121 Bacteria 813
481 Ga0207698_10013453 3300026142 Bacteria 5399
482 Ga0207698_10137832 3300026142 Bacteria 2096
483 Ga0207698_10150675 3300026142 Bacteria 2018
484 Ga0207698_10337062 3300026142 Bacteria 1419
485 Ga0207698_10485173 3300026142 Bacteria 1200
486 Ga0209281_1000337 3300027111 Bacteria 79938
487 Ga0209489_111364 3300027361 Bacteria 9138
488 Ga0209995_1079267 3300027471 Bacteria 564
489 Ga0209968_1001995 3300027526 Bacteria 3102
490 Ga0209968_1042388 3300027526 Bacteria 780
491 Ga0209999_1008578 3300027543 Bacteria 1845
492 Ga0210002_1004025 3300027617 Bacteria 2181
493 Ga0209282_1014100 3300027666 Bacteria 5087
494 Ga0268266_10000658 3300028379 Bacteria 46741
495 Ga0268264_10861207 3300028381 Bacteria 908
496 Ga0265337_1069686 3300028556 Bacteria 968
497 Ga0265337_1133038 3300028556 Bacteria 674
498 Ga0265326_10159196 3300028558 Bacteria 645
499 Ga0265334_10025950 3300028573 Bacteria 2369
500 Ga0265334_10102722 3300028573 Bacteria 1033
501 Ga0265318_10048406 3300028577 Bacteria 1601
502 Ga0265323_10000040 3300028653 Bacteria 70373
503 Ga0265336_10018763 3300028666 Bacteria 2237
504 Ga0307517_10012583 3300028786 Bacteria 11593
505 Ga0307517_10233819 3300028786 Bacteria 1099
506 Ga0307517_10295128 3300028786 Bacteria 913
507 Ga0307515_10179470 3300028794 Bacteria 2074
508 Ga0307515_10302211 3300028794 Bacteria 1284
509 Ga0307515_10339301 3300028794 Bacteria 1156
510 Ga0307515_10669408 3300028794 Bacteria 651
511 Ga0265338_10001162 3300028800 Bacteria 43495
512 Ga0265338_10007954 3300028800 Bacteria 12991
513 Ga0265338_10570954 3300028800 Bacteria 790
514 Ga0316177_1073605 3300030731 Bacteria 20644
515 Ga0316176_1042405 3300030732 Bacteria 10258
516 Ga0314311_1036826 3300030733 Bacteria 876
517 Ga0316183_1033300 3300030742 Bacteria 31987
518 Ga0316181_1007760 3300030744 Bacteria 1229
519 Ga0316181_1034557 3300030744 Bacteria 9867
520 Ga0316182_1143329 3300030745 Bacteria 2798
521 Ga0316182_1415427 3300030745 Bacteria 3110
522 Ga0265330_10109929 3300031235 Bacteria 1178
523 Ga0265339_10431907 3300031249 Bacteria 613
524 Ga0265327_10000370 3300031251 Bacteria 84921
525 Ga0265327_10075375 3300031251 Bacteria 1678
526 Ga0265327_10134823 3300031251 Bacteria 1159
527 Ga0265316_10000486 3300031344 Bacteria 45040
528 Ga0265316_10004585 3300031344 Bacteria 13715
529 Ga0265316_10065971 3300031344 Bacteria 2802
530 Ga0265316_10363451 3300031344 Bacteria 1046
531 Ga0307509_10114085 3300031507 Bacteria 2698
532 Ga0307408_100003785 3300031548 Bacteria 10304
533 Ga0307408_100003845 3300031548 Bacteria 10216
534 Ga0307408_100005144 3300031548 Bacteria 8770
535 Ga0307408_100015317 3300031548 Bacteria 5105
536 Ga0307408_100966780 3300031548 Bacteria 783
537 Ga0316575_10072812 3300031665 Bacteria 1382
538 Ga0316579_10126698 3300031691 Bacteria 1229
539 Ga0316579_10303502 3300031691 Bacteria 772
540 Ga0316579_10397442 3300031691 Bacteria 666
541 Ga0265342_10069939 3300031712 Bacteria 2049
542 Ga0265342_10106285 3300031712 Bacteria 1593
543 Ga0265342_10165993 3300031712 Bacteria 1218
544 Ga0265342_10234540 3300031712 Bacteria 984
545 Ga0316576_10017698 3300031727 Bacteria 4849
546 Ga0316576_10018128 3300031727 Bacteria 4799
547 Ga0316576_10021761 3300031727 Bacteria 4440
548 Ga0316576_10027616 3300031727 Bacteria 3992
549 Ga0316576_10039513 3300031727 Bacteria 3387
550 Ga0316576_10044468 3300031727 Bacteria 3208
551 Ga0316576_10060515 3300031727 Bacteria 2774
552 Ga0316576_10106177 3300031727 Bacteria 2102
553 Ga0316576_10141263 3300031727 Bacteria 1813
554 Ga0316576_10208640 3300031727 Bacteria 1471
555 Ga0316576_10452242 3300031727 Bacteria 948
556 Ga0316576_10620299 3300031727 Bacteria 788
557 Ga0316578_10023848 3300031728 Bacteria 3427
558 Ga0316578_10042897 3300031728 Bacteria 2625
559 Ga0316578_10081543 3300031728 Bacteria 1925
560 Ga0316578_10312557 3300031728 Bacteria 939
561 Ga0316578_10334512 3300031728 Bacteria 902
562 Ga0307405_10000005 3300031731 Bacteria 376536
563 Ga0307405_10000006 3300031731 Bacteria 361477
564 Ga0307405_10080775 3300031731 Bacteria 2123
565 Ga0307405_10217445 3300031731 Bacteria 1400
566 Ga0316577_10039011 3300031733 Bacteria 2658
567 Ga0316577_10251991 3300031733 Bacteria 999
568 Ga0307413_10001014 3300031824 Bacteria 10155
569 Ga0307413_10001307 3300031824 Bacteria 9311
570 Ga0307413_10464591 3300031824 Bacteria 1008
571 Ga0307413_10685145 3300031824 Bacteria 850
572 Ga0307410_10000034 3300031852 Bacteria 48449
573 Ga0307410_10428957 3300031852 Bacteria 1074
574 Ga0307406_10000004 3300031901 Bacteria 179772
575 Ga0307407_10000003 3300031903 Bacteria 271723
576 Ga0307407_10000196 3300031903 Bacteria 18233
577 Ga0307412_10002079 3300031911 Bacteria 11112
578 Ga0307412_10003796 3300031911 Bacteria 8399
579 Ga0307412_10012909 3300031911 Bacteria 4881
580 Ga0307412_10014189 3300031911 Bacteria 4692
581 Ga0307412_10014929 3300031911 Bacteria 4592
582 Ga0307412_10041647 3300031911 Bacteria 2978
583 Ga0307412_10248062 3300031911 Bacteria 1381
584 Ga0307412_10465219 3300031911 Bacteria 1045
585 Ga0307412_10932103 3300031911 Bacteria 763
586 Ga0307409_100068515 3300031995 Bacteria 2807
587 Ga0307416_100000002 3300032002 Bacteria 509907
588 Ga0307416_100000006 3300032002 Bacteria 466074
589 Ga0307416_100079899 3300032002 Bacteria 2758
590 Ga0307414_10000011 3300032004 Bacteria 338253
591 Ga0307414_10000030 3300032004 Bacteria 187373
592 Ga0307414_10000527 3300032004 Bacteria 19931
593 Ga0307414_10000673 3300032004 Bacteria 17502
594 Ga0307414_10005329 3300032004 Bacteria 7075
595 Ga0307414_10005856 3300032004 Bacteria 6798
596 Ga0307414_10008647 3300032004 Bacteria 5791
597 Ga0307414_10009488 3300032004 Bacteria 5593
598 Ga0307414_10012166 3300032004 Bacteria 5077
599 Ga0307414_10019816 3300032004 Bacteria 4178
600 Ga0307414_10043096 3300032004 Bacteria 3071
601 Ga0307414_10065136 3300032004 Bacteria 2598
602 Ga0307414_10082843 3300032004 Bacteria 2353
603 Ga0307414_10085579 3300032004 Bacteria 2323
604 Ga0307414_10087301 3300032004 Bacteria 2304
605 Ga0307414_10125747 3300032004 Bacteria 1980
606 Ga0307414_10126650 3300032004 Bacteria 1974
607 Ga0307414_10198743 3300032004 Bacteria 1629
608 Ga0307414_10457857 3300032004 Bacteria 1120
609 Ga0307414_10606466 3300032004 Bacteria 982
610 Ga0307414_10904314 3300032004 Bacteria 809
611 Ga0307414_11331723 3300032004 Bacteria 666
612 Ga0307414_11349251 3300032004 Bacteria 662
613 Ga0307411_10000004 3300032005 Bacteria 460327
614 Ga0307411_10001861 3300032005 Bacteria 8973
615 Ga0307411_10055855 3300032005 Bacteria 2599
616 Ga0307411_10892300 3300032005 Bacteria 789
617 Ga0307411_11077058 3300032005 Bacteria 723
618 Ga0307411_11551145 3300032005 Bacteria 610
619 Ga0316583_10220733 3300032133 Bacteria 657
620 Ga0316585_10003939 3300032137 Bacteria 4109
621 Ga0316585_10053022 3300032137 Bacteria 1304
622 Ga0316585_10072804 3300032137 Bacteria 1116
623 Ga0316585_10175678 3300032137 Bacteria 708
624 Ga0316580_10075571 3300032139 Bacteria 1031
625 Ga0316580_10095681 3300032139 Bacteria 909
626 Ga0316580_10138765 3300032139 Bacteria 746
627 Ga0316593_10000201 3300032168 Bacteria 9314
628 Ga0316593_10003117 3300032168 Bacteria 4063
629 Ga0316593_10003954 3300032168 Bacteria 3746
630 Ga0316593_10006093 3300032168 Bacteria 3234
631 Ga0316593_10040978 3300032168 Bacteria 1540
632 Ga0316593_10066960 3300032168 Bacteria 1237
633 Ga0316593_10094169 3300032168 Bacteria 1057
634 Ga0316593_10119539 3300032168 Bacteria 945
635 Ga0316593_10157582 3300032168 Bacteria 828
636 Ga0316593_10162772 3300032168 Bacteria 815
637 Ga0316593_10193787 3300032168 Bacteria 750
638 Ga0307507_10000034 3300033179 Bacteria 188697
639 Ga0307510_10003892 3300033180 Bacteria 17498
640 Ga0307510_10030428 3300033180 Bacteria 6119
641 Ga0316592_1000331 3300033524 Bacteria 6138
642 Ga0316592_1000945 3300033524 Bacteria 4451
643 Ga0316592_1001036 3300033524 Bacteria 4325
644 Ga0316592_1014787 3300033524 Bacteria 1621
645 Ga0316592_1015296 3300033524 Bacteria 1597
646 Ga0316592_1015321 3300033524 Bacteria 1596
647 Ga0316592_1080804 3300033524 Bacteria 739
648 Ga0316586_1009678 3300033527 Bacteria 1447
649 Ga0316588_1001461 3300033528 Bacteria 3879
650 Ga0316588_1047427 3300033528 Bacteria 1037
651 Ga0316588_1049774 3300033528 Bacteria 1015
652 Ga0316588_1062965 3300033528 Bacteria 906
653 Ga0316587_1009264 3300033529 Bacteria 1559
654 Ga0316596_1000052 3300033541 Bacteria 12700
655 Ga0316596_1000348 3300033541 Bacteria 7561
656 Ga0316596_1000575 3300033541 Bacteria 6430
657 Ga0316596_1003747 3300033541 Bacteria 3360
658 Ga0316596_1003898 3300033541 Bacteria 3305
659 Ga0316596_1006680 3300033541 Bacteria 2693
660 Ga0316596_1019521 3300033541 Bacteria 1720
661 Ga0316596_1021732 3300033541 Bacteria 1637
662 Ga0316596_1031647 3300033541 Bacteria 1375
663 Ga0316596_1032001 3300033541 Bacteria 1368
664 Ga0316596_1049625 3300033541 Bacteria 1109
665 Ga0316596_1052248 3300033541 Bacteria 1083
666 Ga0316596_1106897 3300033541 Bacteria 758
667 Ga0316596_1119275 3300033541 Bacteria 717
668 Ga0316596_1143532 3300033541 Bacteria 654
669 Ga0316596_1154244 3300033541 Bacteria 631
670 Ga0373955_0376856 3300035172 Bacteria 861
671 Ga0316574_0027184 3300035398 Bacteria 3445
672 Ga0316574_0047218 3300035398 Bacteria 2672
673 Ga0316574_0056124 3300035398 Bacteria 2463
674 Ga0316574_0056810 3300035398 Unclassified 2449
675 Ga0316574_0068566 3300035398 Bacteria 2237
676 Ga0316574_0165017 3300035398 Bacteria 1426
677 Ga0316574_0246045 3300035398 Bacteria 1143
678 Ga0316574_0481877 3300035398 Bacteria 775
679 Ga0316574_0850595 3300035398 Bacteria 554
680 Ga0373937_1708080 3300036401 Bacteria 576
681 Ga0316582_0014930 3300036647 Bacteria 4424
682 Ga0316582_0036309 3300036647 Bacteria 3049
683 Ga0316582_0196506 3300036647 Bacteria 1375
684 Ga0316582_0638495 3300036647 Bacteria 732
685 Ga0316584_0005378 3300036712 Bacteria 8592
686 Ga0316584_0048368 3300036712 Bacteria 3177
687 Ga0316584_0087726 3300036712 Bacteria 2329
688 Ga0316584_0277900 3300036712 Bacteria 1217
689 Ga0316584_0284516 3300036712 Bacteria 1201
690 Ga0316584_0285033 3300036712 Bacteria 1199
691 Ga0316584_0658427 3300036712 Bacteria 721
692 Ga0395899_0000034 3300037312 Bacteria 302623
693 Ga0395899_0000472 3300037312 Bacteria 45477
694 Ga0395899_0000499 3300037312 Bacteria 43572
695 Ga0395899_0000673 3300037312 Bacteria 34566
696 Ga0395900_0000346 3300037418 Bacteria 68020
697 Ga0395900_0000441 3300037418 Bacteria 59413
698 Ga0395900_0169281 3300037418 Bacteria 2225
699 Ga0395900_0208359 3300037418 Bacteria 1975
700 Ga0395900_0827767 3300037418 Bacteria 852
701 Ga0395898_0021701 3300037466 Bacteria 6509
702 Ga0395898_1478469 3300037466 Bacteria 606
703 Ga0395905_0000001 3300037471 Bacteria 2037079
704 Ga0395905_0000376 3300037471 Bacteria 63695
705 Ga0395905_0000528 3300037471 Bacteria 52404
706 Ga0395905_0127136 3300037471 Bacteria 2397
707 Ga0395901_0000351 3300038443 Bacteria 56004
708 Ga0395901_0003122 3300038443 Bacteria 16635
709 Ga0395901_0896929 3300038443 Bacteria 869
710 Ga0400483_035362 3300039062 Bacteria 41412
711 Ga0400483_183866 3300039062 Bacteria 1535
712 Ga0400489_00932 3300039093 Bacteria 9350
713 Ga0400489_18980 3300039093 Bacteria 1041
714 Ga0436361_0433548 3300039447 Bacteria 14679
715 Ga0439447_002479 3300041407 Bacteria 6716
716 Ga0439466_0014751 3300041411 Bacteria 2841
717 Ga0439465_0002928 3300041413 Bacteria 5595
718 Ga0451788_26116 3300041442 Bacteria 548
719 Ga0451789_0913588 3300041443 Bacteria 1260
720 Ga0451790_03894 3300041444 Bacteria 794
721 Ga0451790_15122 3300041444 Bacteria 1162
722 Ga0451790_24363 3300041444 Bacteria 866
723 Ga0451790_25357 3300041444 Bacteria 751
724 Ga0451790_36804 3300041444 Bacteria 515
725 Ga0451792_07354 3300041445 Bacteria 562
726 Ga0451794_08398 3300041446 Bacteria 628
727 Ga0451794_24707 3300041446 Bacteria 871
728 Ga0451794_25189 3300041446 Bacteria 750
729 Ga0451794_39000 3300041446 Bacteria 623
730 Ga0451791_0489072 3300041451 Bacteria 1708
731 Ga0451791_1291585 3300041451 Bacteria 838
732 Ga0451793_0486272 3300041452 Bacteria 869
733 Ga0451795_0972033 3300041456 Bacteria 563
734 Ga0451798_0268261 3300041458 Bacteria 541
735 Ga0451802_1884876 3300041460 Bacteria 1066
736 Ga0451804_0735281 3300041463 Bacteria 857
737 Ga0451804_1059666 3300041463 Bacteria 1135
738 Ga0451807_0242729 3300041486 Bacteria 897
739 Ga0451807_1458215 3300041486 Bacteria 932
740 Ga0451837_0551105 3300041494 Bacteria 627
741 Ga0451844_23593 3300041500 Bacteria 631
742 Ga0451849_1177343 3300041505 Bacteria 865
743 Ga0451851_0089935 3300041507 Bacteria 1105
744 Ga0451843_1098053 3300041509 Bacteria 612
745 Ga0451843_1638388 3300041509 Bacteria 1120
746 Ga0451855_0333792 3300041511 Bacteria 882
747 Ga0451855_0440306 3300041511 Bacteria 509
748 Ga0451855_0497909 3300041511 Bacteria 3019
749 Ga0452271_37402 3300041916 Bacteria 829
750 Ga0452271_80664 3300041916 Bacteria 637
751 Ga0439445_0000090 3300042004 Bacteria 14230
752 Ga0439445_0036329 3300042004 Bacteria 1296
753 Ga0439448_0001990 3300042005 Bacteria 5465
754 Ga0439432_122979 3300042006 Bacteria 768
755 Ga0439457_024112 3300042014 Bacteria 1346
756 Ga0450901_005819 3300042533 Bacteria 1267
757 Ga0451577_0000092 3300042876 Bacteria 198898
758 Ga0451577_0000690 3300042876 Bacteria 52905
759 Ga0451577_0005144 3300042876 Bacteria 13458
760 Ga0451577_0023389 3300042876 Bacteria 5637
761 Ga0451577_0024955 3300042876 Bacteria 5429
762 Ga0451577_0025303 3300042876 Bacteria 5388
763 Ga0451577_0028546 3300042876 Bacteria 5045
764 Ga0451577_0047949 3300042876 Bacteria 3818
765 Ga0451577_0066417 3300042876 Bacteria 3217
766 Ga0451577_0091067 3300042876 Bacteria 2722
767 Ga0451577_0107299 3300042876 Bacteria 2496
768 Ga0451577_0300325 3300042876 Bacteria 1455
769 Ga0451577_0360457 3300042876 Bacteria 1319
770 Ga0451577_0389652 3300042876 Bacteria 1264
771 Ga0451577_0487687 3300042876 Bacteria 1119
772 Ga0451577_0551316 3300042876 Bacteria 1047
773 Ga0451577_0801834 3300042876 Bacteria 850
774 Ga0451577_1658807 3300042876 Bacteria 563
775 Ga0451577_1721338 3300042876 Bacteria 551
776 Ga0453683_0000066 3300044673 Bacteria 164788
777 Ga0453683_0000522 3300044673 Bacteria 43145
778 Ga0453683_0006727 3300044673 Bacteria 7859
779 Ga0453683_0010256 3300044673 Bacteria 6213
780 Ga0453683_0118753 3300044673 Bacteria 1664
781 Ga0453683_0139064 3300044673 Bacteria 1532
782 Ga0453683_0162196 3300044673 Bacteria 1414
783 Ga0453683_0214162 3300044673 Bacteria 1224
784 Ga0453683_0215687 3300044673 Bacteria 1219
785 Ga0453683_0215753 3300044673 Bacteria 1219
786 Ga0453683_0216051 3300044673 Bacteria 1218
787 Ga0453683_0278281 3300044673 Bacteria 1068
788 Ga0453683_0318967 3300044673 Bacteria 996
789 Ga0453683_0621848 3300044673 Bacteria 705
790 Ga0466966_0001476 3300044684 Bacteria 15131
791 Ga0466961_0182800 3300044693 Bacteria 1301
792 Ga0466961_0863931 3300044693 Bacteria 539
793 Ga0453684_0000440 3300044712 Bacteria 169397
794 Ga0453684_0000506 3300044712 Bacteria 152143
795 Ga0453684_0001121 3300044712 Bacteria 83919
796 Ga0453684_0001382 3300044712 Bacteria 70292
797 Ga0453684_0001549 3300044712 Bacteria 64220
798 Ga0453684_0004131 3300044712 Bacteria 31439
799 Ga0453684_0004169 3300044712 Bacteria 31186
800 Ga0453684_0004492 3300044712 Bacteria 29332
801 Ga0453684_0009769 3300044712 Bacteria 16659
802 Ga0453684_0012437 3300044712 Bacteria 14033
803 Ga0453684_0035092 3300044712 Bacteria 6941
804 Ga0453684_0049674 3300044712 Bacteria 5527
805 Ga0453684_0064505 3300044712 Bacteria 4678
806 Ga0453684_0076172 3300044712 Bacteria 4212
807 Ga0453684_0104626 3300044712 Bacteria 3455
808 Ga0453684_0133450 3300044712 Bacteria 2976
809 Ga0453684_0143337 3300044712 Bacteria 2849
810 Ga0453684_0145941 3300044712 Bacteria 2819
811 Ga0453684_0182883 3300044712 Bacteria 2459
812 Ga0453684_0213872 3300044712 Bacteria 2238
813 Ga0453684_0267728 3300044712 Bacteria 1954
814 Ga0453684_0385184 3300044712 Bacteria 1573
815 Ga0453684_0417493 3300044712 Bacteria 1499
816 Ga0453684_0532547 3300044712 Bacteria 1296
817 Ga0453684_0577897 3300044712 Bacteria 1234
818 Ga0453684_0811243 3300044712 Bacteria 1008
819 Ga0453684_1058534 3300044712 Bacteria 859
820 Ga0453684_1398372 3300044712 Bacteria 726
821 Ga0453684_1490826 3300044712 Bacteria 698
822 Ga0453684_1491245 3300044712 Bacteria 698
823 Ga0466959_0124272 3300045049 Bacteria 1832
824 Ga0451576_0000003 3300045051 Bacteria 1550573
825 Ga0451576_0000113 3300045051 Bacteria 208644
826 Ga0451576_0000204 3300045051 Bacteria 149459
827 Ga0451576_0000783 3300045051 Bacteria 62485
828 Ga0451576_0003652 3300045051 Bacteria 20883
829 Ga0451576_0011102 3300045051 Bacteria 10274
830 Ga0451576_0013908 3300045051 Bacteria 8986
831 Ga0451576_0022652 3300045051 Bacteria 6807
832 Ga0451576_0047948 3300045051 Bacteria 4490
833 Ga0451576_0083654 3300045051 Bacteria 3319
834 Ga0451576_0088919 3300045051 Bacteria 3212
835 Ga0451576_0143234 3300045051 Bacteria 2492
836 Ga0451576_0277421 3300045051 Bacteria 1753
837 Ga0451576_0291923 3300045051 Bacteria 1705
838 Ga0451576_0438926 3300045051 Bacteria 1370
839 Ga0451576_0937455 3300045051 Bacteria 908
840 Ga0451576_0995907 3300045051 Bacteria 878
841 Ga0451576_1846002 3300045051 Bacteria 624
842 Ga0451576_2409690 3300045051 Bacteria 538
843 Ga0466958_0007843 3300045836 Bacteria 5897
844 Ga0495627_000022 3300046453 Bacteria 254672
845 Ga0495627_002474 3300046453 Bacteria 8853
846 Ga0495627_051473 3300046453 Bacteria 1237
847 Ga0495592_0123750 3300046454 Bacteria 1817
848 Ga0495590_0000627 3300046457 Bacteria 16440
849 Ga0495638_0616280 3300046460 Bacteria 531
850 Ga0495651_0082640 3300046462 Bacteria 2423
851 Ga0495650_0000023 3300046471 Bacteria 527763
852 Ga0495650_0122333 3300046471 Bacteria 957
853 Ga0495662_0053308 3300046476 Bacteria 1953
854 Ga0495585_0000476 3300046492 Bacteria 38316
855 Ga0495585_0001907 3300046492 Bacteria 15677
856 Ga0495585_0079477 3300046492 Bacteria 1779
857 Ga0495607_0068813 3300046501 Bacteria 1984
858 Ga0495607_0109464 3300046501 Bacteria 1467
859 Ga0495583_0045267 3300046506 Bacteria 2036
860 Ga0495606_0003554 3300046507 Bacteria 16456
861 Ga0495606_0011558 3300046507 Bacteria 7186
862 Ga0495606_0042764 3300046507 Bacteria 3027
863 Ga0495606_0131694 3300046507 Bacteria 1486
864 Ga0495606_0157197 3300046507 Bacteria 1329
865 Ga0495606_0284996 3300046507 Bacteria 901
866 Ga0495606_0608547 3300046507 Bacteria 535
867 Ga0495610_0000005 3300046512 Bacteria 924111
868 Ga0495610_0020639 3300046512 Bacteria 3652
869 Ga0495610_0033472 3300046512 Bacteria 2656
870 Ga0495610_0155940 3300046512 Bacteria 969
871 Ga0495610_0402938 3300046512 Bacteria 504
872 Ga0495616_0022430 3300046513 Bacteria 3410
873 Ga0495616_0073426 3300046513 Bacteria 1650
874 Ga0495616_0244907 3300046513 Bacteria 772
875 Ga0495628_1034669 3300046516 Bacteria 564
876 Ga0495631_0002385 3300046518 Bacteria 10650
877 Ga0495631_0061979 3300046518 Bacteria 1621
878 Ga0495632_0004162 3300046519 Bacteria 9918
879 Ga0495632_0110742 3300046519 Bacteria 1289
880 Ga0495632_0520565 3300046519 Bacteria 512
881 Ga0495637_0066720 3300046520 Bacteria 1462
882 Ga0495643_0000294 3300046522 Bacteria 70329
883 Ga0495643_0024720 3300046522 Bacteria 3405
884 Ga0495644_0017124 3300046523 Bacteria 2772
885 Ga0495648_0017616 3300046524 Bacteria 5097
886 Ga0495648_0098997 3300046524 Bacteria 1614
887 Ga0495648_0387851 3300046524 Bacteria 628
888 Ga0495663_0000053 3300046525 Bacteria 53554
889 Ga0495663_0019140 3300046525 Bacteria 1956
890 Ga0495663_0081759 3300046525 Bacteria 1041
891 Ga0495642_0031330 3300046528 Bacteria 2132
892 Ga0495652_0033059 3300046529 Bacteria 4519
893 Ga0495654_0000003 3300046530 Bacteria 863485
894 Ga0495654_0070029 3300046530 Bacteria 1664
895 Ga0495587_0586209 3300046536 Bacteria 614
896 Ga0495609_0000003 3300046538 Bacteria 711547
897 Ga0495609_0004523 3300046538 Bacteria 7572
898 Ga0495609_0006730 3300046538 Bacteria 5828
899 Ga0495609_0014049 3300046538 Bacteria 3771
900 Ga0495597_0206106 3300046542 Bacteria 786
901 Ga0495633_0000072 3300046558 Bacteria 131197
902 Ga0495633_0003150 3300046558 Bacteria 11168
903 Ga0495633_0016150 3300046558 Bacteria 3858
904 Ga0495633_0020940 3300046558 Bacteria 3278
905 Ga0495633_0501692 3300046558 Bacteria 547
906 Ga0495668_0000165 3300046616 Bacteria 98016
907 Ga0495668_0069683 3300046616 Bacteria 1934
908 Ga0495634_0138088 3300046642 Bacteria 1549
909 Ga0495634_0610215 3300046642 Bacteria 633
910 Ga0495611_0042182 3300046648 Bacteria 2037
911 Ga0495625_0000096 3300046660 Bacteria 142609
912 Ga0495625_0000308 3300046660 Bacteria 74661
913 Ga0495625_0001933 3300046660 Bacteria 23424
914 Ga0495625_0106019 3300046660 Bacteria 1925
915 Ga0495625_0171535 3300046660 Bacteria 1448
916 Ga0495625_0217728 3300046660 Bacteria 1252
917 Ga0495625_0225335 3300046660 Bacteria 1226
918 Ga0495625_0465596 3300046660 Bacteria 778
919 Ga0495661_0103742 3300046665 Bacteria 1595
920 Ga0495661_0133006 3300046665 Bacteria 1361
921 Ga0495588_0076305 3300046674 Bacteria 1747
922 Ga0495658_0058588 3300046683 Bacteria 2203
923 Ga0495658_0333467 3300046683 Bacteria 963
924 Ga0495669_0043303 3300046684 Bacteria 2004
925 Ga0495613_0400814 3300046689 Bacteria 936
926 Ga0495670_0127741 3300046691 Bacteria 1324
927 Ga0495671_0036148 3300046692 Bacteria 2504
928 Ga0495671_0476054 3300046692 Bacteria 596
929 Ga0495649_0000105 3300046694 Bacteria 74750
930 Ga0495649_0066186 3300046694 Bacteria 1939
931 Ga0495589_0317863 3300046794 Bacteria 720
932 Ga0495600_0108075 3300046809 Bacteria 1812
933 Ga0495660_0216941 3300046810 Bacteria 904
934 Ga0495660_0256013 3300046810 Bacteria 810
935 Ga0495604_0590296 3300047317 Bacteria 713
936 Ga0495680_1103152 3300047322 Bacteria 501
937 Ga0495687_000233 3300047443 Bacteria 77056
938 Ga0495687_098283 3300047443 Bacteria 1104
939 Ga0495685_050912 3300047447 Bacteria 1405
940 Ga0495673_0025163 3300047469 Bacteria 2862
941 Ga0495681_0032669 3300047470 Bacteria 2617
942 Ga0495686_0000133 3300047472 Bacteria 151597
943 Ga0495686_0002422 3300047472 Bacteria 17639
944 Ga0495686_0010199 3300047472 Bacteria 6696
945 Ga0495686_0244332 3300047472 Bacteria 1011
946 Ga0495686_0390316 3300047472 Bacteria 749
947 Ga0495686_0417035 3300047472 Bacteria 718
948 Ga0495593_0572900 3300047673 Bacteria 567
949 Ga0495614_0023016 3300048089 Bacteria 2687
950 Ga0496100_0514498 3300048903 Bacteria 923
951 Ga0496102_0094764 3300048905 Bacteria 2766
952 Ga0496103_0207758 3300048906 Bacteria 1259
953 Ga0496104_0513882 3300048907 Bacteria 1109
954 Ga0496110_0286115 3300048913 Bacteria 1501
955 Ga0496113_0105034 3300048916 Bacteria 2193
956 Ga0496114_0091395 3300048917 Bacteria 2585
957 Ga0496115_0022950 3300048918 Bacteria 4839
958 Ga0496115_0738107 3300048918 Bacteria 771
959 Ga0496116_0000024 3300048919 Bacteria 471420
960 Ga0496116_0000029 3300048919 Bacteria 422187
961 Ga0496116_0005535 3300048919 Bacteria 11653
962 Ga0496117_0000007 3300048920 Bacteria 720505
963 Ga0496117_0001863 3300048920 Bacteria 28457
964 Ga0496117_0170046 3300048920 Bacteria 1266
965 Ga0496118_0022242 3300048921 Bacteria 5551
966 Ga0496118_0025644 3300048921 Bacteria 5047
967 Ga0496119_0000007 3300048922 Bacteria 475920
968 Ga0496119_0261209 3300048922 Bacteria 869
969 Ga0496121_0183138 3300048924 Bacteria 1509
970 Ga0496121_0473852 3300048924 Bacteria 801
971 Ga0496122_0000862 3300048925 Bacteria 57049
972 Ga0496122_0006922 3300048925 Bacteria 12808
973 Ga0496122_0025542 3300048925 Bacteria 5126
974 Ga0496123_0013292 3300048926 Bacteria 6932
975 Ga0496123_0015001 3300048926 Bacteria 6383
976 Ga0496123_0058126 3300048926 Bacteria 2511
977 Ga0496123_0211468 3300048926 Bacteria 985
978 Ga0496124_0013719 3300048927 Bacteria 7890
979 Ga0496124_0039503 3300048927 Bacteria 4091
980 Ga0496124_0438807 3300048927 Bacteria 894
981 Ga0496124_0894352 3300048927 Bacteria 539
982 Ga0496125_0000018 3300048928 Bacteria 482390
983 Ga0496125_0000031 3300048928 Bacteria 365156
984 Ga0496125_0048493 3300048928 Bacteria 3541
985 Ga0496125_0056896 3300048928 Bacteria 3172
986 Ga0496125_0179552 3300048928 Bacteria 1412
987 Ga0496125_0758204 3300048928 Bacteria 507
988 Ga0496126_0002974 3300048929 Bacteria 21999
989 Ga0496126_0645820 3300048929 Bacteria 828
990 Ga0501306_002387 3300049127 Bacteria 1919
991 Ga0501306_029242 3300049127 Bacteria 811
992 Ga0501306_088956 3300049127 Bacteria 541
993 Ga0501309_079192 3300049129 Bacteria 549
994 Ga0501310_000149 3300049130 Bacteria 6887
995 Ga0501310_006583 3300049130 Bacteria 1222
996 Ga0501310_033025 3300049130 Bacteria 694
997 Ga0501310_044778 3300049130 Bacteria 626
998 Ga0501310_048367 3300049130 Bacteria 609
999 Ga0501343_016908 3300049132 Bacteria 628
1000 Ga0501305_006266 3300049161 Bacteria 1471
1001 Ga0501305_013964 3300049161 Bacteria 1118
1002 Ga0501307_001686 3300049162 Bacteria 1924
1003 Ga0501307_003414 3300049162 Bacteria 1556
1004 Ga0501307_005780 3300049162 Bacteria 1315
1005 Ga0501307_022615 3300049162 Bacteria 828
1006 Ga0495678_012530 3300049459 Bacteria 4016
1007 Ga0495682_0007766 3300049460 Bacteria 4250
1008 Ga0501311_000988 3300049527 Bacteria 2306
1009 Ga0501311_013259 3300049527 Bacteria 1038
1010 Ga0501312_002704 3300049528 Bacteria 1938
1011 Ga0501312_007913 3300049528 Bacteria 1367
1012 Ga0501313_037565 3300049529 Bacteria 644
1013 Ga0501314_000001 3300049530 Bacteria 13837
1014 Ga0501315_004584 3300049531 Bacteria 1454
1015 Ga0501315_009200 3300049531 Bacteria 1164
1016 Ga0501315_020543 3300049531 Bacteria 887
1017 Ga0501315_089576 3300049531 Bacteria 532
1018 Ga0501316_001608 3300049532 Bacteria 1957
1019 Ga0501316_001710 3300049532 Bacteria 1925
1020 Ga0501316_027774 3300049532 Bacteria 745
1021 Ga0501316_042567 3300049532 Bacteria 637
1022 Ga0501317_005939 3300049533 Bacteria 1326
1023 Ga0501317_036702 3300049533 Bacteria 733
1024 Ga0501319_000002 3300049535 Bacteria 13675
1025 Ga0501319_001107 3300049535 Bacteria 1493
1026 Ga0501320_000034 3300049536 Bacteria 6599
1027 Ga0501320_000628 3300049536 Bacteria 2173
1028 Ga0501320_004699 3300049536 Bacteria 1215
1029 Ga0501320_013307 3300049536 Bacteria 877
1030 Ga0501320_050179 3300049536 Bacteria 567
1031 Ga0501321_000590 3300049537 Bacteria 2423
1032 Ga0501321_003707 3300049537 Bacteria 1418
1033 Ga0501321_008543 3300049537 Bacteria 1089
1034 Ga0501321_066804 3300049537 Bacteria 553
1035 Ga0501322_000883 3300049538 Bacteria 1552
1036 Ga0501323_000002 3300049539 Bacteria 14311
1037 Ga0501323_001313 3300049539 Bacteria 2167
1038 Ga0501323_015373 3300049539 Bacteria 966
1039 Ga0501323_020427 3300049539 Bacteria 869
1040 Ga0501323_026262 3300049539 Bacteria 797
1041 Ga0501324_000002 3300049540 Bacteria 14212
1042 Ga0501324_010331 3300049540 Bacteria 849
1043 Ga0501324_014502 3300049540 Bacteria 756
1044 Ga0501324_038845 3300049540 Bacteria 539
1045 Ga0501325_000056 3300049541 Bacteria 3420
1046 Ga0501325_013523 3300049541 Bacteria 783
1047 Ga0501326_00020 3300049542 Bacteria 5374
1048 Ga0501326_09971 3300049542 Bacteria 566
1049 Ga0501327_01292 3300049543 Bacteria 1180
1050 Ga0501328_00037 3300049544 Bacteria 2833
1051 Ga0501328_11067 3300049544 Bacteria 516
1052 Ga0501329_01391 3300049545 Bacteria 1051
1053 Ga0501329_13237 3300049545 Bacteria 542
1054 Ga0501330_001422 3300049546 Bacteria 1236
1055 Ga0501330_001661 3300049546 Bacteria 1186
1056 Ga0501330_006234 3300049546 Bacteria 777
1057 Ga0501331_00092 3300049547 Bacteria 2734
1058 Ga0501333_009569 3300049549 Bacteria 682
1059 Ga0501334_01349 3300049550 Bacteria 1342
1060 Ga0501334_03288 3300049550 Bacteria 997
1061 Ga0501335_000742 3300049551 Bacteria 2246
1062 Ga0501335_001452 3300049551 Bacteria 1822
1063 Ga0501335_008567 3300049551 Bacteria 963
1064 Ga0501335_014867 3300049551 Bacteria 790
1065 Ga0501335_020269 3300049551 Bacteria 707
1066 Ga0501335_035351 3300049551 Bacteria 576
1067 Ga0501336_009708 3300049552 Bacteria 762
1068 Ga0501336_009945 3300049552 Bacteria 756
1069 Ga0501337_000031 3300049553 Bacteria 5086
1070 Ga0501337_001289 3300049553 Bacteria 1414
1071 Ga0501337_003436 3300049553 Bacteria 1006
1072 Ga0501338_00373 3300049554 Bacteria 1952
1073 Ga0501340_001429 3300049556 Bacteria 1289
1074 Ga0501340_006416 3300049556 Bacteria 790
1075 Ga0501031_0026756 3300049568 Bacteria 3760
1076 Ga0501032_0007271 3300049569 Bacteria 8100
1077 Ga0501032_0048968 3300049569 Bacteria 2852
1078 Ga0501032_0396137 3300049569 Bacteria 887
1079 Ga0501033_0000011 3300049570 Bacteria 259130
1080 Ga0501033_0131892 3300049570 Bacteria 1810
1081 Ga0501034_0001265 3300049571 Bacteria 34324
1082 Ga0501034_0390568 3300049571 Bacteria 1315
1083 Ga0501036_0019659 3300049572 Bacteria 5670
1084 Ga0501036_0166298 3300049572 Bacteria 1859
1085 Ga0501037_0013217 3300049573 Bacteria 6084
1086 Ga0501038_0002395 3300049574 Bacteria 17463
1087 Ga0501038_0075723 3300049574 Bacteria 2844
1088 Ga0501039_0023075 3300049575 Bacteria 4773
1089 Ga0501040_0522141 3300049576 Bacteria 856
1090 Ga0501043_0024223 3300049579 Bacteria 4762
1091 Ga0501043_0881339 3300049579 Bacteria 643
1092 Ga0501047_0406992 3300049581 Bacteria 1193
1093 Ga0501048_0268643 3300049582 Bacteria 1212
1094 Ga0501198_001947 3300049649 Bacteria 2740
1095 Ga0501217_014128 3300049661 Bacteria 1800
1096 Ga0501223_025877 3300049663 Bacteria 1142
1097 Ga0501224_004359 3300049664 Bacteria 2011
1098 Ga0501235_139173 3300049669 Bacteria 620
1099 Ga0501238_000015 3300049671 Bacteria 31964
1100 Ga0501238_001674 3300049671 Bacteria 2579
1101 Ga0501249_004157 3300049679 Bacteria 2931
1102 Ga0501249_016566 3300049679 Bacteria 1584
1103 Ga0501249_022408 3300049679 Bacteria 1382
1104 Ga0501251_000697 3300049681 Bacteria 3019
1105 Ga0501252_060643 3300049682 Bacteria 591
1106 Ga0501255_024276 3300049684 Bacteria 806
1107 Ga0501225_0310649 3300049705 Bacteria 536
1108 Ga0501241_000002 3300049758 Bacteria 194532
1109 Ga0501241_001391 3300049758 Bacteria 4970
1110 Ga0501241_003188 3300049758 Bacteria 3112
1111 Ga0501263_016694 3300049760 Bacteria 958
1112 Ga0501266_000002 3300049763 Bacteria 459947
1113 Ga0501269_000004 3300049766 Bacteria 91854
1114 Ga0501269_015808 3300049766 Bacteria 928
1115 Ga0501280_000239 3300049776 Bacteria 13899
1116 Ga0501280_027081 3300049776 Bacteria 881
1117 Ga0501282_022136 3300049778 Bacteria 701
1118 Ga0501035_0004622 3300049822 Bacteria 13050
1119 Ga0501035_0018430 3300049822 Bacteria 6432
1120 Ga0501044_0023913 3300049823 Bacteria 6493
1121 Ga0501045_0000053 3300049824 Bacteria 51403
1122 Ga0501204_002065 3300049850 Bacteria 2022
1123 nmdc:mga0k408_150668_c1 3300050493 Bacteria 965
1124 nmdc:mga0k408_22365_c1 3300050493 Bacteria 3560
1125 nmdc:mga0k408_349_c2 3300050493 Bacteria 1877
1126 nmdc:mga0k408_452852_c1 3300050493 Bacteria 762
1127 nmdc:mga07m45_530437_c1 3300050496 Bacteria 681
1128 nmdc:mga08y16_946750_c1 3300050511 Bacteria 844
1129 Ga0500578_0670910 3300053086 Bacteria 561
1130 Ga0500646_0004786 3300053090 Bacteria 3426
1131 Ga0500646_0064896 3300053090 Bacteria 1083
1132 Ga0500651_0000078 3300053093 Bacteria 62741
1133 Ga0500641_0000168 3300053096 Bacteria 24462
1134 Ga0500641_0005947 3300053096 Bacteria 4321
1135 Ga0500650_0464662 3300053098 Bacteria 541
1136 Ga0500594_0227933 3300053118 Bacteria 617
1137 Ga0500608_000214 3300053122 Bacteria 23145
1138 Ga0500608_087806 3300053122 Bacteria 1458
1139 Ga0500618_000057 3300053125 Bacteria 98383
1140 Ga0500642_0057580 3300053130 Bacteria 1734
1141 Ga0500652_245013 3300053131 Bacteria 712
1142 Ga0500658_0000002 3300053134 Bacteria 548440
1143 Ga0500559_0077755 3300053136 Bacteria 1504
1144 Ga0500559_0173989 3300053136 Bacteria 1013
1145 Ga0500561_0057890 3300053137 Bacteria 1077
1146 Ga0500564_099097 3300053138 Bacteria 1290
1147 Ga0500568_0122186 3300053139 Bacteria 970
1148 Ga0500573_0377679 3300053140 Bacteria 679
1149 Ga0500579_261869 3300053143 Bacteria 548
1150 Ga0500588_0421235 3300053146 Bacteria 509
1151 Ga0500589_068495 3300053147 Bacteria 1611
1152 Ga0500616_0068519 3300053153 Bacteria 1817
1153 Ga0500624_000412 3300053157 Bacteria 13199
1154 Ga0500634_0195996 3300053161 Bacteria 892
1155 Ga0500584_196186 3300053726 Bacteria 681
1156 Ga0500645_045549 3300053730 Bacteria 1289
1157 Ga0587093_002351 3300059478 Bacteria 1745
1158 Ga0587093_005525 3300059478 Bacteria 1339
1159 Ga0587093_008088 3300059478 Bacteria 1189
1160 Ga0587066_001010 3300059490 Bacteria 2663
1161 Ga0587070_012110 3300059491 Bacteria 1304
1162 Ga0587070_077901 3300059491 Bacteria 721
1163 Ga0587073_0004228 3300059492 Bacteria 2042
1164 Ga0587073_0136105 3300059492 Bacteria 680
1165 Ga0587077_000755 3300059493 Bacteria 3065
1166 Ga0587077_004049 3300059493 Bacteria 1896
1167 Ga0587080_032855 3300059503 Bacteria 912
1168 Ga0587080_052037 3300059503 Bacteria 776
1169 Ga0587083_0007032 3300059505 Bacteria 1704
1170 Ga0587083_0009203 3300059505 Bacteria 1569
1171 Ga0587083_0010186 3300059505 Bacteria 1518
1172 Ga0587083_0067751 3300059505 Bacteria 821
1173 Ga0587086_069553 3300059507 Bacteria 602
1174 Ga0587088_002584 3300059508 Bacteria 2082
1175 Ga0587089_041766 3300059509 Bacteria 712
1176 Ga0587089_100535 3300059509 Bacteria 524
1177 Ga0587090_035231 3300059510 Bacteria 856
1178 Ga0587091_007866 3300059511 Bacteria 1553
1179 Ga0587091_071736 3300059511 Bacteria 759
1180 Ga0587092_004572 3300059512 Bacteria 1659
1181 Ga0587092_005398 3300059512 Bacteria 1574
1182 Ga0587092_034923 3300059512 Bacteria 850
1183 Ga0587094_013211 3300059513 Bacteria 1113
1184 Ga0587094_027056 3300059513 Bacteria 868
1185 Ga0587095_006475 3300059514 Bacteria 911
1186 Ga0587106_000803 3300059605 Bacteria 2469
1187 Ga0587109_069356 3300059624 Bacteria 759
1188 Ga0587117_033747 3300059627 Bacteria 784
1189 Ga0587062_029117 3300059639 Bacteria 835
1190 Ga0587067_011887 3300059640 Bacteria 1350
1191 Ga0587067_026246 3300059640 Bacteria 1042
1192 Ga0587068_030243 3300059641 Bacteria 935
1193 Ga0587068_042434 3300059641 Bacteria 827
1194 Ga0587069_010109 3300059642 Bacteria 1233
1195 Ga0587076_001180 3300059645 Bacteria 2578
1196 Ga0587076_007250 3300059645 Bacteria 1508
1197 Ga0587076_018545 3300059645 Bacteria 1122
1198 Ga0587076_031564 3300059645 Bacteria 942
1199 Ga0587076_067595 3300059645 Bacteria 735
1200 Ga0587079_096182 3300059647 Bacteria 700
1201 2511231097 2511231000 Bacteria 4488346
1202 2513232387 2513020052 Bacteria 5120511
1203 2520879552 2519899754 Bacteria 5336938
1204 2524006248 2523533629 Bacteria 2982326
1205 2585143598 2582581278 Bacteria 5296881
1206 2585156561 2582581281 Bacteria 4487904
1207 2585160788 2582581282 Bacteria 4495830
1208 2585427001 2582581873 Bacteria 3032664
1209 2586210041 2585427687 Bacteria 5544917
1210 2587679988 2585428045 Bacteria 5203023
1211 2587748646 2585428060 Bacteria 5304711
1212 2587753444 2585428061 Bacteria 3939663
1213 2587864971 2585428095 Bacteria 3789702
1214 2587945325 2585428115 Bacteria 4420269
1215 2588211504 2585428182 Bacteria 5007281
1216 2588215886 2585428183 Bacteria 5166119
1217 2588219308 2585428184 Bacteria 4978681
1218 2588224786 2585428185 Bacteria 4969476
1219 2588234621 2585428187 Bacteria 4629388
1220 2588447581 2588253712 Bacteria 5403181
1221 2590603208 2588254255 Bacteria 5014294
1222 2590610229 2588254257 Bacteria 5436094
1223 2599479370 2599185184 Bacteria 6430550
1224 2644009213 2643221600 Bacteria 5530138
1225 2644373950 2643221667 Bacteria 5627472
1226 2644643918 2643221716 Bacteria 4986332
1227 2644681813 2643221725 Bacteria 5087956
1228 2722726189 2721755487 Bacteria 6357185
1229 2729200742 2728369107 Bacteria 5082720
1230 2738698364 2738541273 Bacteria 4048577
1231 2738733048 2738541279 Bacteria 6149495
1232 2738755664 2738541283 Bacteria 7222293
1233 2738762119 2738541284 Bacteria 5199923
1234 2738765586 2738541285 Bacteria 6150075
1235 2738854414 2738541302 Bacteria 5944758
1236 2739214629 2738543007 Bacteria 6149845
1237 2739252690 2738543014 Bacteria 4048139
1238 2739301901 2738543023 Bacteria 6767879
1239 2739587966 2739367651 Bacteria 6359826
1240 2739614383 2739367656 Bacteria 5152243
1241 2739646685 2739367663 Bacteria 5040914
1242 2740002856 2739367857 Bacteria 5433684
1243 2740007673 2739367858 Bacteria 5432813
1244 2740060442 2739367874 Bacteria 4872888
1245 2753674221 2751185877 Bacteria 4921427
1246 2765575692 2765235839 Bacteria 5314748
1247 2772605797 2772190705 Bacteria 4666226
1248 2775674325 2775506739 Bacteria 3855222
1249 2776615255 2775506987 Bacteria 5373360
1250 2802655278 2802428842 Bacteria 4926114
1251 2816875539 2816332188 Bacteria 5133218
1252 2817413529 2816332280 Bacteria 5109718
1253 2819545841 2818991437 Bacteria 5805520
1254 2833640602 2833640130 Bacteria 4858325
1255 2842086269 2842083920 Bacteria 4857652
1256 2842724266 2842722452 Bacteria 6263924
1257 2842908283 2842903701 Bacteria 6986368
1258 2842913600 2842909656 Bacteria 6185908
1259 2849282587 2849281842 Bacteria 6065644
1260 2852625381 2852623160 Bacteria 4376875
1261 2852629125 2852627209 Bacteria 5896285
1262 2857617068 2857613821 Bacteria 4917088
1263 2857619737 2857618242 Bacteria 5635925
1264 2857631664 2857627736 Bacteria 5625397
1265 2871723618 2871720351 Bacteria 4862476
1266 2881247594 2881247448 Bacteria 3717788
1267 2881364121 2881359912 Bacteria 4935907
1268 2884934392 2884933994 Bacteria 4535041
1269 2887379696 2887375801 Bacteria 5334027
1270 2889293804 2889290771 Bacteria 5530962
1271 2890740650 2890737413 Bacteria 4269751
1272 2896320825 2896317667 Bacteria 4606601
1273 2902051176 2902048731 Bacteria 4976191
1274 2903898680 2903895155 Bacteria 5258610
1275 2904422380 2904419702 Bacteria 5166287
1276 2904449081 2904445276 Bacteria 5310396
1277 2904558514 2904555929 Bacteria 5218588
1278 2904782800 2904780799 Bacteria 5840761
1279 2906001161 2905999023 Bacteria 4591259
1280 2906800153 2906799679 Bacteria 4031749
1281 2919097940 2919097161 Bacteria 3860339
1282 2919180411 2919177583 Bacteria 5641607
1283 2919189083 2919186247 Bacteria 6244071
1284 2919194240 2919191525 Bacteria 5765973
1285 2919403179 2919399522 Bacteria 5164947
1286 2919438030 2919437846 Bacteria 6199444
1287 2919511845 2919509842 Bacteria 4104664
1288 2919684596 2919683626 Bacteria 5534354
1289 2928082321 2928078545 Bacteria 6534839
1290 2928149100 2928147474 Bacteria 6512076
1291 2929150585 2929150217 Bacteria 5462483
1292 2932085033 2932082852 Bacteria 6563563
1293 2939666762 2939664404 Bacteria 6364494
1294 2945924786 2945924605 Bacteria 4296724
1295 2945998911 2945997725 Bacteria 6404843
1296 2946024099 2946019816 Bacteria 4621265
1297 2954021354 2954016120 Bacteria 6446024
1298 2958461982 2958458903 Bacteria 5301041
1299 2958514517 2958512119 Bacteria 4528530
1300 2965321941 2965320100 Bacteria 3975600
1301 2977235866 2977232053 Bacteria 5485925
1302 2977247739 2977243572 Bacteria 4374394
1303 2977272057 2977268062 Bacteria 5243061
1304 2984574464 2984572630 Bacteria 4186940
1305 2984607913 2984606641 Bacteria 4186971
1306 2993375088 2993372514 Bacteria 4214139
1307 2993481951 2993480792 Bacteria 4022225
1308 3003234779 3003233435 Bacteria 4458031
1309 8036739246 8036736890 Bacteria 2944828
1310 8054311448 8054307821 Bacteria 5212224
1311 8055423564 8055419101 Bacteria 5289643
1312 8055591273 8055588893 Bacteria 3619545
1313 8055595082 8055592153 Bacteria 5961247
1314 8056443499 8056440228 Bacteria 4946504
1315 Ga0453684_0637847
1316 MRS2a_Contig_24813
1317 SwRhRL2b_contig_156102
1318 SwRhRL2b_contig_1853401
1319 SwRhRL2b_contig_2489919
1320 SwRhRL2b_contig_3583939
1321 MRS1b_contig_1810326
1322 2214800779
1323 JGI24741J21665_1003251
1324 JGI24740J21852_10008913
1325 JGI24740J21852_10033543
1326 JGI24737J22298_10001860
1327 JGI24735J21928_10000003
1328 JGI24735J21928_10005021
1329 JGI24744J21845_10001128
1330 JGI25162J39368_1000039
1331 JGI25162J39368_1001202
1332 JGI25164J39214_1001166
1333 JGI25152J39213_1000006
1334 JGI25150J39212_1000005
1335 JGI25151J46595_10000004
1336 JGI25165J46597_1000678
1337 JGI25153J46596_10000004
1338 Ga0006758J48902_1029451
1339 rootH1_10024556
1340 rootH1_10160693
1341 rootH2_10056635
1342 rootL2_10101710
1343 rootH1_10045781
1344 rootH1_10193341
1345 Ga0007409J51694_1063312
1346 Ga0006562J51391_1003423
1347 Ga0006562J51391_1007655
1348 Ga0055536_1000004
1349 Ga0055530_10000817
1350 Ga0058863_10111335
1351 Ga0058861_10176091
1352 Ga0058860_10114316
1353 Ga0058860_10142251
1354 Ga0058862_10102512
1355 Ga0065717_1001968
1356 Ga0065716_1002480
1357 Ga0065714_10002624
1358 Ga0065714_10005956
1359 Ga0065714_10009786
1360 Ga0065714_10013697
1361 Ga0065714_10022334
1362 Ga0065714_10045584
1363 Ga0065714_10047236
1364 Ga0065714_10079789
1365 Ga0065714_10102584
1366 Ga0065714_10160851
1367 Ga0065714_10163029
1368 Ga0065714_10250665
1369 Ga0065704_10000307
1370 Ga0065704_10004597
1371 Ga0065704_10073035
1372 Ga0065704_10078273
1373 Ga0065704_10082398
1374 Ga0065704_10096211
1375 Ga0065704_10102101
1376 Ga0065704_10177771
1377 Ga0065704_10269193
1378 Ga0065704_10346795
1379 Ga0065704_10399407
1380 Ga0065704_10458670
1381 Ga0065715_10036832
1382 Ga0065715_10521621
1383 Ga0065715_10569858
1384 Ga0065715_10866960
1385 Ga0065715_10927087
1386 Ga0070658_10000153
1387 Ga0070658_10120312
1388 Ga0070658_10244897
1389 Ga0070676_10000312
1390 Ga0070683_100018688
1391 Ga0070683_100032136
1392 Ga0070690_100580742
1393 Ga0070670_100135400
1394 Ga0070680_100005676
1395 Ga0070682_100000768
1396 Ga0068868_100104416
1397 Ga0068868_100118877
1398 Ga0070660_100043744
1399 Ga0070660_100057675
1400 Ga0070691_10252658
1401 Ga0070668_100276810
1402 Ga0070669_100349495
1403 Ga0070671_100045958
1404 Ga0070671_101121230
1405 Ga0070674_100123468
1406 Ga0070673_100043212
1407 Ga0070659_100000375
1408 Ga0070659_101692991
1409 Ga0070667_101647679
1410 Ga0070678_100032095
1411 Ga0070678_100234064
1412 Ga0070662_100000074
1413 Ga0070662_100794941
1414 Ga0070681_10002985
1415 Ga0068867_100010877
1416 Ga0068867_100970210
1417 Ga0074259_10883899
1418 Ga0070679_100006255
1419 Ga0070679_100727393
1420 Ga0070684_100006351
1421 Ga0070684_100723154
1422 Ga0068853_100150954
1423 Ga0068853_100167326
1424 Ga0070693_101517646
1425 Ga0070665_100000372
1426 Ga0070704_101084299
1427 Ga0068855_100000360
1428 Ga0068855_100012268
1429 Ga0068855_100025831
1430 Ga0068855_100061070
1431 Ga0068855_100071470
1432 Ga0068855_100279474
1433 Ga0068855_100524481
1434 Ga0068855_100671044
1435 Ga0068855_100814966
1436 Ga0068855_100859569
1437 Ga0068855_102101977
1438 Ga0068857_100489716
1439 Ga0068854_100266832
1440 Ga0068854_100936506
1441 Ga0068856_100016148
1442 Ga0068856_100058008
1443 Ga0068856_100147792
1444 Ga0068856_100153582
1445 Ga0068856_100340133
1446 Ga0068856_100423074
1447 Ga0068856_100667106
1448 Ga0068852_100010466
1449 Ga0068852_100268045
1450 Ga0068852_100411938
1451 Ga0068852_100462537
1452 Ga0068852_101512163
1453 Ga0068859_102399722
1454 Ga0068859_102708143
1455 Ga0068866_10152156
1456 Ga0068863_100897056
1457 Ga0068863_101631036
1458 Ga0068863_101913908
1459 Ga0068860_100562306
1460 Ga0070716_100062251
1461 Ga0075362_10012264
1462 Ga0075369_10350950
1463 Ga0075366_10089546
1464 Ga0075366_10252599
1465 Ga0097621_100007799
1466 Ga0097621_100200943
1467 Ga0075370_10177105
1468 Ga0068871_100000141
1469 Ga0068871_100350639
1470 Ga0068865_100000917
1471 Ga0097620_102399396
1472 Ga0097620_102707874
1473 Ga0099824_1003374
1474 Ga0079104_1000280
1475 Ga0099826_10000125
1476 Ga0105251_10038077
1477 Ga0105251_10057935
1478 Ga0105251_10498151
1479 Ga0105244_10000027
1480 Ga0105244_10000160
1481 Ga0105244_10015827
1482 Ga0105240_10000082
1483 Ga0105240_10073384
1484 Ga0105240_10204993
1485 Ga0105240_10432476
1486 Ga0105240_10481262
1487 Ga0105240_10924097
1488 Ga0105240_10971270
1489 Ga0105240_11222634
1490 Ga0111539_11039008
1491 Ga0105245_10144700
1492 Ga0105245_10812450
1493 Ga0105245_11624337
1494 Ga0105243_10000009
1495 Ga0105243_10003612
1496 Ga0105243_10014278
1497 Ga0105241_10111599
1498 Ga0105241_10177460
1499 Ga0105241_10191865
1500 Ga0105241_10555896
1501 Ga0105241_11121315
1502 Ga0105241_11613001
1503 Ga0105242_10053982
1504 Ga0105242_10227333
1505 Ga0105242_10279101
1506 Ga0105242_10692446
1507 Ga0105242_10847467
1508 Ga0105237_10000794
1509 Ga0105237_10002553
1510 Ga0105237_10006510
1511 Ga0105237_10015313
1512 Ga0105237_10015662
1513 Ga0105237_10047854
1514 Ga0105237_10071252
1515 Ga0105237_10083942
1516 Ga0105237_10185132
1517 Ga0105237_11452365
1518 Ga0105238_10017754
1519 Ga0105238_10194984
1520 Ga0105249_10092720
1521 Ga0105249_10192006
1522 Ga0130086_1024805
1523 Ga0130085_1035330
1524 Ga0105239_10000011
1525 Ga0105239_10005378
1526 Ga0105239_10015682
1527 Ga0105239_10248837
1528 Ga0105239_10262733
1529 Ga0105239_10429598
1530 Ga0105239_12090703
1531 Ga0157327_1007676
1532 Ga0157373_10000006
1533 Ga0157373_10001033
1534 Ga0157373_10001369
1535 Ga0157373_10002831
1536 Ga0157373_10009996
1537 Ga0157373_10028999
1538 Ga0157373_10059430
1539 Ga0157373_11166423
1540 Ga0157371_10000041
1541 Ga0157371_10000091
1542 Ga0157371_10001553
1543 Ga0157371_10001678
1544 Ga0157371_10013476
1545 Ga0157371_10021684
1546 Ga0157371_10033811
1547 Ga0157370_10012207
1548 Ga0157370_10014051
1549 Ga0157370_10019740
1550 Ga0157370_10041216
1551 Ga0157370_10042074
1552 Ga0157370_10073063
1553 Ga0157370_10106885
1554 Ga0157370_10327925
1555 Ga0157370_10553788
1556 Ga0157370_10693077
1557 Ga0157370_10856639
1558 Ga0157370_11487469
1559 Ga0157369_10000016
1560 Ga0157369_10000613
1561 Ga0157369_10008868
1562 Ga0157369_10010007
1563 Ga0157369_10030357
1564 Ga0157369_10080886
1565 Ga0157369_10408180
1566 Ga0157369_11507817
1567 Ga0157374_10030641
1568 Ga0157374_10077301
1569 Ga0157374_10104516
1570 Ga0157374_10208307
1571 Ga0157374_10210459
1572 Ga0157374_10371931
1573 Ga0157374_10454107
1574 Ga0157374_10986484
1575 Ga0157374_11416639
1576 Ga0157374_11420827
1577 Ga0157378_10008303
1578 Ga0157378_10060889
1579 Ga0157378_10378236
1580 Ga0163162_10003331
1581 Ga0163162_10033491
1582 Ga0163162_10047580
1583 Ga0163162_10068714
1584 Ga0163162_10106514
1585 Ga0163162_10278112
1586 Ga0163162_11176876
1587 Ga0163162_11396126
1588 Ga0157372_10000030
1589 Ga0157372_10000332
1590 Ga0157372_10003430
1591 Ga0157372_10011651
1592 Ga0157372_10037880
1593 Ga0157372_10129288
1594 Ga0157372_10157361
1595 Ga0157372_10903284
1596 Ga0157375_10099030
1597 Ga0157375_10904988
1598 Ga0157375_11032639
1599 Ga0157375_11275906
1600 Ga0157375_11403714
1601 Ga0157375_11429406
1602 Ga0157375_11618320
1603 Ga0157375_13212846
1604 Ga0163163_10980641
1605 Ga0163163_11138066
1606 Ga0163163_11580757
1607 Ga0163163_12203559
1608 Ga0157380_10000051
1609 Ga0157380_10946651
1610 Ga0182008_10000003
1611 Ga0182008_10000034
1612 Ga0182008_10001770
1613 Ga0182008_10003643
1614 Ga0182008_10111138
1615 Ga0182008_10345321
1616 Ga0182008_10716442
1617 Ga0157377_10009989
1618 Ga0157379_11114424
1619 Ga0157376_10125737
1620 Ga0157376_10271219
1621 Ga0182006_1000001
1622 Ga0182006_1000103
1623 Ga0182006_1006389
1624 Ga0182006_1008481
1625 Ga0182006_1009290
1626 Ga0182006_1062134
1627 Ga0182006_1068748
1628 Ga0182007_10000002
1629 Ga0182007_10005771
1630 Ga0182007_10015899
1631 Ga0183373_1004
1632 Ga0163161_10000039
1633 Ga0163161_10000207
1634 Ga0163161_10009312
1635 Ga0163161_10039425
1636 Ga0163161_10054256
1637 Ga0163161_10097976
1638 Ga0163161_10125798
1639 Ga0163161_10317631
1640 Ga0163161_10554453
1641 Ga0163161_10628450
1642 Ga0163161_10709095
1643 Ga0163161_10739282
1644 Ga0163161_11250984
1645 Ga0197907_10757494
1646 Ga0197907_11138220
1647 Ga0206356_10991038
1648 Ga0206356_11209637
1649 Ga0206356_11535795
1650 Ga0206349_1692805
1651 Ga0206351_10267476
1652 Ga0206351_10387294
1653 Ga0206351_10512829
1654 Ga0206351_10991482
1655 Ga0206352_10226992
1656 Ga0206352_10382572
1657 Ga0206352_10622029
1658 Ga0206352_10835038
1659 Ga0206350_10018304
1660 Ga0206350_11221028
1661 Ga0206354_10248047
1662 Ga0206354_10263498
1663 Ga0206354_11507030
1664 Ga0206353_10159245
1665 Ga0206353_10736142
1666 Ga0154015_1024308
1667 Ga0154015_1037437
1668 Ga0154015_1309672
1669 Ga0213872_10051000
1670 Ga0224712_10004189
1671 Ga0224712_10045345
1672 Ga0224712_10082607
1673 Ga0209563_127189
1674 Ga0207427_100025
1675 Ga0209437_100010
1676 Ga0209437_100135
1677 Ga0207425_1000008
1678 Ga0209026_1000610
1679 Ga0209026_1004574
1680 Ga0209148_1033295
1681 Ga0209148_1037006
1682 Ga0209129_1000040
1683 Ga0209129_1049492
1684 Ga0209233_1000017
1685 Ga0209233_1032971
1686 Ga0209675_1000200
1687 Ga0209676_1000009
1688 Ga0209025_1000020
1689 Ga0209758_1000022
1690 Ga0209050_1000048
1691 Ga0207655_1000016
1692 Ga0207655_1000038
1693 Ga0207655_1062533
1694 Ga0207713_1057298
1695 Ga0207642_10051496
1696 Ga0207642_10122961
1697 Ga0207647_10000303
1698 Ga0207647_10032931
1699 Ga0207647_10036461
1700 Ga0207645_10000035
1701 Ga0207705_10000108
1702 Ga0207705_10328136
1703 Ga0207654_10023808
1704 Ga0207654_10124200
1705 Ga0207654_10648325
1706 Ga0207654_10982565
1707 Ga0207707_10032972
1708 Ga0207695_10000053
1709 Ga0207695_10039657
1710 Ga0207695_10062421
1711 Ga0207695_10080728
1712 Ga0207695_10085252
1713 Ga0207695_10288044
1714 Ga0207671_10005849
1715 Ga0207671_10011776
1716 Ga0207671_10013363
1717 Ga0207671_10018120
1718 Ga0207671_10020602
1719 Ga0207671_10034795
1720 Ga0207671_10072375
1721 Ga0207671_10722220
1722 Ga0207671_10847229
1723 Ga0207660_10360566
1724 Ga0207657_10055251
1725 Ga0207657_10111319
1726 Ga0207657_10231799
1727 Ga0207657_10398871
1728 Ga0207649_10253338
1729 Ga0207652_10002419
1730 Ga0207652_10095693
1731 Ga0207652_11552987
1732 Ga0207681_10486661
1733 Ga0207694_10009649
1734 Ga0207694_10042226
1735 Ga0207650_10136672
1736 Ga0207687_10126670
1737 Ga0207687_11130250
1738 Ga0207664_10602438
1739 Ga0207644_11375596
1740 Ga0207690_10000936
1741 Ga0207690_10069096
1742 Ga0207706_10019009
1743 Ga0207706_10854126
1744 Ga0207686_10059526
1745 Ga0207686_10187305
1746 Ga0207709_10000026
1747 Ga0207709_10000084
1748 Ga0207709_10020248
1749 Ga0207709_11582225
1750 Ga0207704_10000036
1751 Ga0207665_10034201
1752 Ga0207691_10186142
1753 Ga0207691_10275349
1754 Ga0207689_10558361
1755 Ga0207661_10013292
1756 Ga0207661_10014621
1757 Ga0207667_10000430
1758 Ga0207667_10022849
1759 Ga0207667_10023666
1760 Ga0207667_10041900
1761 Ga0207667_10093127
1762 Ga0207667_10242746
1763 Ga0207667_10265903
1764 Ga0207651_10009416
1765 Ga0207712_10542484
1766 Ga0207668_10020698
1767 Ga0207668_11671342
1768 Ga0207640_10192986
1769 Ga0207640_10666795
1770 Ga0207640_10912444
1771 Ga0207658_10494531
1772 Ga0207658_10975083
1773 Ga0207677_11055425
1774 Ga0207639_10167234
1775 Ga0207639_10380458
1776 Ga0207639_10546031
1777 Ga0207639_11132541
1778 Ga0207702_10010443
1779 Ga0207702_10068465
1780 Ga0207702_10069982
1781 Ga0207702_10311424
1782 Ga0207702_10318830
1783 Ga0207702_10322206
1784 Ga0207702_10370041
1785 Ga0207702_10567715
1786 Ga0207702_12422588
1787 Ga0207648_10000333
1788 Ga0207648_11039269
1789 Ga0207676_11854756
1790 Ga0207674_10641092
1791 Ga0207674_10812864
1792 Ga0207674_11110581
1793 Ga0207683_10003418
1794 Ga0207683_10918146
1795 Ga0207698_10013453
1796 Ga0207698_10137832
1797 Ga0207698_10150675
1798 Ga0207698_10337062
1799 Ga0207698_10485173
1800 Ga0209281_1000337
1801 Ga0209489_111364
1802 Ga0209995_1079267
1803 Ga0209968_1001995
1804 Ga0209968_1042388
1805 Ga0209999_1008578
1806 Ga0210002_1004025
1807 Ga0209282_1014100
1808 Ga0268266_10000658
1809 Ga0268264_10861207
1810 Ga0265337_1069686
1811 Ga0265337_1133038
1812 Ga0265326_10159196
1813 Ga0265334_10025950
1814 Ga0265334_10102722
1815 Ga0265318_10048406
1816 Ga0265323_10000040
1817 Ga0265336_10018763
1818 Ga0307517_10012583
1819 Ga0307517_10233819
1820 Ga0307517_10295128
1821 Ga0307515_10179470
1822 Ga0307515_10302211
1823 Ga0307515_10339301
1824 Ga0307515_10669408
1825 Ga0265338_10001162
1826 Ga0265338_10007954
1827 Ga0265338_10570954
1828 Ga0316177_1073605
1829 Ga0316176_1042405
1830 Ga0314311_1036826
1831 Ga0316183_1033300
1832 Ga0316181_1007760
1833 Ga0316181_1034557
1834 Ga0316182_1143329
1835 Ga0316182_1415427
1836 Ga0265330_10109929
1837 Ga0265339_10431907
1838 Ga0265327_10000370
1839 Ga0265327_10075375
1840 Ga0265327_10134823
1841 Ga0265316_10000486
1842 Ga0265316_10004585
1843 Ga0265316_10065971
1844 Ga0265316_10363451
1845 Ga0307509_10114085
1846 Ga0307408_100003785
1847 Ga0307408_100003845
1848 Ga0307408_100005144
1849 Ga0307408_100015317
1850 Ga0307408_100966780
1851 Ga0316575_10072812
1852 Ga0316579_10126698
1853 Ga0316579_10303502
1854 Ga0316579_10397442
1855 Ga0265342_10069939
1856 Ga0265342_10106285
1857 Ga0265342_10165993
1858 Ga0265342_10234540
1859 Ga0316576_10017698
1860 Ga0316576_10018128
1861 Ga0316576_10021761
1862 Ga0316576_10027616
1863 Ga0316576_10039513
1864 Ga0316576_10044468
1865 Ga0316576_10060515
1866 Ga0316576_10106177
1867 Ga0316576_10141263
1868 Ga0316576_10208640
1869 Ga0316576_10452242
1870 Ga0316576_10620299
1871 Ga0316578_10023848
1872 Ga0316578_10042897
1873 Ga0316578_10081543
1874 Ga0316578_10312557
1875 Ga0316578_10334512
1876 Ga0307405_10000005
1877 Ga0307405_10000006
1878 Ga0307405_10080775
1879 Ga0307405_10217445
1880 Ga0316577_10039011
1881 Ga0316577_10251991
1882 Ga0307413_10001014
1883 Ga0307413_10001307
1884 Ga0307413_10464591
1885 Ga0307413_10685145
1886 Ga0307410_10000034
1887 Ga0307410_10428957
1888 Ga0307406_10000004
1889 Ga0307407_10000003
1890 Ga0307407_10000196
1891 Ga0307412_10002079
1892 Ga0307412_10003796
1893 Ga0307412_10012909
1894 Ga0307412_10014189
1895 Ga0307412_10014929
1896 Ga0307412_10041647
1897 Ga0307412_10248062
1898 Ga0307412_10465219
1899 Ga0307412_10932103
1900 Ga0307409_100068515
1901 Ga0307416_100000002
1902 Ga0307416_100000006
1903 Ga0307416_100079899
1904 Ga0307414_10000011
1905 Ga0307414_10000030
1906 Ga0307414_10000527
1907 Ga0307414_10000673
1908 Ga0307414_10005329
1909 Ga0307414_10005856
1910 Ga0307414_10008647
1911 Ga0307414_10009488
1912 Ga0307414_10012166
1913 Ga0307414_10019816
1914 Ga0307414_10043096
1915 Ga0307414_10065136
1916 Ga0307414_10082843
1917 Ga0307414_10085579
1918 Ga0307414_10087301
1919 Ga0307414_10125747
1920 Ga0307414_10126650
1921 Ga0307414_10198743
1922 Ga0307414_10457857
1923 Ga0307414_10606466
1924 Ga0307414_10904314
1925 Ga0307414_11331723
1926 Ga0307414_11349251
1927 Ga0307411_10000004
1928 Ga0307411_10001861
1929 Ga0307411_10055855
1930 Ga0307411_10892300
1931 Ga0307411_11077058
1932 Ga0307411_11551145
1933 Ga0316583_10220733
1934 Ga0316585_10003939
1935 Ga0316585_10053022
1936 Ga0316585_10072804
1937 Ga0316585_10175678
1938 Ga0316580_10075571
1939 Ga0316580_10095681
1940 Ga0316580_10138765
1941 Ga0316593_10000201
1942 Ga0316593_10003117
1943 Ga0316593_10003954
1944 Ga0316593_10006093
1945 Ga0316593_10040978
1946 Ga0316593_10066960
1947 Ga0316593_10094169
1948 Ga0316593_10119539
1949 Ga0316593_10157582
1950 Ga0316593_10162772
1951 Ga0316593_10193787
1952 Ga0307507_10000034
1953 Ga0307510_10003892
1954 Ga0307510_10030428
1955 Ga0316592_1000331
1956 Ga0316592_1000945
1957 Ga0316592_1001036
1958 Ga0316592_1014787
1959 Ga0316592_1015296
1960 Ga0316592_1015321
1961 Ga0316592_1080804
1962 Ga0316586_1009678
1963 Ga0316588_1001461
1964 Ga0316588_1047427
1965 Ga0316588_1049774
1966 Ga0316588_1062965
1967 Ga0316587_1009264
1968 Ga0316596_1000052
1969 Ga0316596_1000348
1970 Ga0316596_1000575
1971 Ga0316596_1003747
1972 Ga0316596_1003898
1973 Ga0316596_1006680
1974 Ga0316596_1019521
1975 Ga0316596_1021732
1976 Ga0316596_1031647
1977 Ga0316596_1032001
1978 Ga0316596_1049625
1979 Ga0316596_1052248
1980 Ga0316596_1106897
1981 Ga0316596_1119275
1982 Ga0316596_1143532
1983 Ga0316596_1154244
1984 Ga0373955_0376856
1985 Ga0316574_0027184
1986 Ga0316574_0047218
1987 Ga0316574_0056124
1988 Ga0316574_0056810
1989 Ga0316574_0068566
1990 Ga0316574_0165017
1991 Ga0316574_0246045
1992 Ga0316574_0481877
1993 Ga0316574_0850595
1994 Ga0373937_1708080
1995 Ga0316582_0014930
1996 Ga0316582_0036309
1997 Ga0316582_0196506
1998 Ga0316582_0638495
1999 Ga0316584_0005378
2000 Ga0316584_0048368
2001 Ga0316584_0087726
2002 Ga0316584_0277900
2003 Ga0316584_0284516
2004 Ga0316584_0285033
2005 Ga0316584_0658427
2006 Ga0395899_0000034
2007 Ga0395899_0000472
2008 Ga0395899_0000499
2009 Ga0395899_0000673
2010 Ga0395900_0000346
2011 Ga0395900_0000441
2012 Ga0395900_0169281
2013 Ga0395900_0208359
2014 Ga0395900_0827767
2015 Ga0395898_0021701
2016 Ga0395898_1478469
2017 Ga0395905_0000001
2018 Ga0395905_0000376
2019 Ga0395905_0000528
2020 Ga0395905_0127136
2021 Ga0395901_0000351
2022 Ga0395901_0003122
2023 Ga0395901_0896929
2024 Ga0400483_035362
2025 Ga0400483_183866
2026 Ga0400489_00932
2027 Ga0400489_18980
2028 Ga0436361_0433548
2029 Ga0439447_002479
2030 Ga0439466_0014751
2031 Ga0439465_0002928
2032 Ga0451788_26116
2033 Ga0451789_0913588
2034 Ga0451790_03894
2035 Ga0451790_15122
2036 Ga0451790_24363
2037 Ga0451790_25357
2038 Ga0451790_36804
2039 Ga0451792_07354
2040 Ga0451794_08398
2041 Ga0451794_24707
2042 Ga0451794_25189
2043 Ga0451794_39000
2044 Ga0451791_0489072
2045 Ga0451791_1291585
2046 Ga0451793_0486272
2047 Ga0451795_0972033
2048 Ga0451798_0268261
2049 Ga0451802_1884876
2050 Ga0451804_0735281
2051 Ga0451804_1059666
2052 Ga0451807_0242729
2053 Ga0451807_1458215
2054 Ga0451837_0551105
2055 Ga0451844_23593
2056 Ga0451849_1177343
2057 Ga0451851_0089935
2058 Ga0451843_1098053
2059 Ga0451843_1638388
2060 Ga0451855_0333792
2061 Ga0451855_0440306
2062 Ga0451855_0497909
2063 Ga0452271_37402
2064 Ga0452271_80664
2065 Ga0439445_0000090
2066 Ga0439445_0036329
2067 Ga0439448_0001990
2068 Ga0439432_122979
2069 Ga0439457_024112
2070 Ga0450901_005819
2071 Ga0451577_0000092
2072 Ga0451577_0000690
2073 Ga0451577_0005144
2074 Ga0451577_0023389
2075 Ga0451577_0024955
2076 Ga0451577_0025303
2077 Ga0451577_0028546
2078 Ga0451577_0047949
2079 Ga0451577_0066417
2080 Ga0451577_0091067
2081 Ga0451577_0107299
2082 Ga0451577_0300325
2083 Ga0451577_0360457
2084 Ga0451577_0389652
2085 Ga0451577_0487687
2086 Ga0451577_0551316
2087 Ga0451577_0801834
2088 Ga0451577_1658807
2089 Ga0451577_1721338
2090 Ga0453683_0000066
2091 Ga0453683_0000522
2092 Ga0453683_0006727
2093 Ga0453683_0010256
2094 Ga0453683_0118753
2095 Ga0453683_0139064
2096 Ga0453683_0162196
2097 Ga0453683_0214162
2098 Ga0453683_0215687
2099 Ga0453683_0215753
2100 Ga0453683_0216051
2101 Ga0453683_0278281
2102 Ga0453683_0318967
2103 Ga0453683_0621848
2104 Ga0466966_0001476
2105 Ga0466961_0182800
2106 Ga0466961_0863931
2107 Ga0453684_0000440
2108 Ga0453684_0000506
2109 Ga0453684_0001121
2110 Ga0453684_0001382
2111 Ga0453684_0001549
2112 Ga0453684_0004131
2113 Ga0453684_0004169
2114 Ga0453684_0004492
2115 Ga0453684_0009769
2116 Ga0453684_0012437
2117 Ga0453684_0035092
2118 Ga0453684_0049674
2119 Ga0453684_0064505
2120 Ga0453684_0076172
2121 Ga0453684_0104626
2122 Ga0453684_0133450
2123 Ga0453684_0143337
2124 Ga0453684_0145941
2125 Ga0453684_0182883
2126 Ga0453684_0213872
2127 Ga0453684_0267728
2128 Ga0453684_0385184
2129 Ga0453684_0417493
2130 Ga0453684_0532547
2131 Ga0453684_0577897
2132 Ga0453684_0811243
2133 Ga0453684_1058534
2134 Ga0453684_1398372
2135 Ga0453684_1490826
2136 Ga0453684_1491245
2137 Ga0466959_0124272
2138 Ga0451576_0000003
2139 Ga0451576_0000113
2140 Ga0451576_0000204
2141 Ga0451576_0000783
2142 Ga0451576_0003652
2143 Ga0451576_0011102
2144 Ga0451576_0013908
2145 Ga0451576_0022652
2146 Ga0451576_0047948
2147 Ga0451576_0083654
2148 Ga0451576_0088919
2149 Ga0451576_0143234
2150 Ga0451576_0277421
2151 Ga0451576_0291923
2152 Ga0451576_0438926
2153 Ga0451576_0937455
2154 Ga0451576_0995907
2155 Ga0451576_1846002
2156 Ga0451576_2409690
2157 Ga0466958_0007843
2158 Ga0495627_000022
2159 Ga0495627_002474
2160 Ga0495627_051473
2161 Ga0495592_0123750
2162 Ga0495590_0000627
2163 Ga0495638_0616280
2164 Ga0495651_0082640
2165 Ga0495650_0000023
2166 Ga0495650_0122333
2167 Ga0495662_0053308
2168 Ga0495585_0000476
2169 Ga0495585_0001907
2170 Ga0495585_0079477
2171 Ga0495607_0068813
2172 Ga0495607_0109464
2173 Ga0495583_0045267
2174 Ga0495606_0003554
2175 Ga0495606_0011558
2176 Ga0495606_0042764
2177 Ga0495606_0131694
2178 Ga0495606_0157197
2179 Ga0495606_0284996
2180 Ga0495606_0608547
2181 Ga0495610_0000005
2182 Ga0495610_0020639
2183 Ga0495610_0033472
2184 Ga0495610_0155940
2185 Ga0495610_0402938
2186 Ga0495616_0022430
2187 Ga0495616_0073426
2188 Ga0495616_0244907
2189 Ga0495628_1034669
2190 Ga0495631_0002385
2191 Ga0495631_0061979
2192 Ga0495632_0004162
2193 Ga0495632_0110742
2194 Ga0495632_0520565
2195 Ga0495637_0066720
2196 Ga0495643_0000294
2197 Ga0495643_0024720
2198 Ga0495644_0017124
2199 Ga0495648_0017616
2200 Ga0495648_0098997
2201 Ga0495648_0387851
2202 Ga0495663_0000053
2203 Ga0495663_0019140
2204 Ga0495663_0081759
2205 Ga0495642_0031330
2206 Ga0495652_0033059
2207 Ga0495654_0000003
2208 Ga0495654_0070029
2209 Ga0495587_0586209
2210 Ga0495609_0000003
2211 Ga0495609_0004523
2212 Ga0495609_0006730
2213 Ga0495609_0014049
2214 Ga0495597_0206106
2215 Ga0495633_0000072
2216 Ga0495633_0003150
2217 Ga0495633_0016150
2218 Ga0495633_0020940
2219 Ga0495633_0501692
2220 Ga0495668_0000165
2221 Ga0495668_0069683
2222 Ga0495634_0138088
2223 Ga0495634_0610215
2224 Ga0495611_0042182
2225 Ga0495625_0000096
2226 Ga0495625_0000308
2227 Ga0495625_0001933
2228 Ga0495625_0106019
2229 Ga0495625_0171535
2230 Ga0495625_0217728
2231 Ga0495625_0225335
2232 Ga0495625_0465596
2233 Ga0495661_0103742
2234 Ga0495661_0133006
2235 Ga0495588_0076305
2236 Ga0495658_0058588
2237 Ga0495658_0333467
2238 Ga0495669_0043303
2239 Ga0495613_0400814
2240 Ga0495670_0127741
2241 Ga0495671_0036148
2242 Ga0495671_0476054
2243 Ga0495649_0000105
2244 Ga0495649_0066186
2245 Ga0495589_0317863
2246 Ga0495600_0108075
2247 Ga0495660_0216941
2248 Ga0495660_0256013
2249 Ga0495604_0590296
2250 Ga0495680_1103152
2251 Ga0495687_000233
2252 Ga0495687_098283
2253 Ga0495685_050912
2254 Ga0495673_0025163
2255 Ga0495681_0032669
2256 Ga0495686_0000133
2257 Ga0495686_0002422
2258 Ga0495686_0010199
2259 Ga0495686_0244332
2260 Ga0495686_0390316
2261 Ga0495686_0417035
2262 Ga0495593_0572900
2263 Ga0495614_0023016
2264 Ga0496100_0514498
2265 Ga0496102_0094764
2266 Ga0496103_0207758
2267 Ga0496104_0513882
2268 Ga0496110_0286115
2269 Ga0496113_0105034
2270 Ga0496114_0091395
2271 Ga0496115_0022950
2272 Ga0496115_0738107
2273 Ga0496116_0000024
2274 Ga0496116_0000029
2275 Ga0496116_0005535
2276 Ga0496117_0000007
2277 Ga0496117_0001863
2278 Ga0496117_0170046
2279 Ga0496118_0022242
2280 Ga0496118_0025644
2281 Ga0496119_0000007
2282 Ga0496119_0261209
2283 Ga0496121_0183138
2284 Ga0496121_0473852
2285 Ga0496122_0000862
2286 Ga0496122_0006922
2287 Ga0496122_0025542
2288 Ga0496123_0013292
2289 Ga0496123_0015001
2290 Ga0496123_0058126
2291 Ga0496123_0211468
2292 Ga0496124_0013719
2293 Ga0496124_0039503
2294 Ga0496124_0438807
2295 Ga0496124_0894352
2296 Ga0496125_0000018
2297 Ga0496125_0000031
2298 Ga0496125_0048493
2299 Ga0496125_0056896
2300 Ga0496125_0179552
2301 Ga0496125_0758204
2302 Ga0496126_0002974
2303 Ga0496126_0645820
2304 Ga0501306_002387
2305 Ga0501306_029242
2306 Ga0501306_088956
2307 Ga0501309_079192
2308 Ga0501310_000149
2309 Ga0501310_006583
2310 Ga0501310_033025
2311 Ga0501310_044778
2312 Ga0501310_048367
2313 Ga0501343_016908
2314 Ga0501305_006266
2315 Ga0501305_013964
2316 Ga0501307_001686
2317 Ga0501307_003414
2318 Ga0501307_005780
2319 Ga0501307_022615
2320 Ga0495678_012530
2321 Ga0495682_0007766
2322 Ga0501311_000988
2323 Ga0501311_013259
2324 Ga0501312_002704
2325 Ga0501312_007913
2326 Ga0501313_037565
2327 Ga0501314_000001
2328 Ga0501315_004584
2329 Ga0501315_009200
2330 Ga0501315_020543
2331 Ga0501315_089576
2332 Ga0501316_001608
2333 Ga0501316_001710
2334 Ga0501316_027774
2335 Ga0501316_042567
2336 Ga0501317_005939
2337 Ga0501317_036702
2338 Ga0501319_000002
2339 Ga0501319_001107
2340 Ga0501320_000034
2341 Ga0501320_000628
2342 Ga0501320_004699
2343 Ga0501320_013307
2344 Ga0501320_050179
2345 Ga0501321_000590
2346 Ga0501321_003707
2347 Ga0501321_008543
2348 Ga0501321_066804
2349 Ga0501322_000883
2350 Ga0501323_000002
2351 Ga0501323_001313
2352 Ga0501323_015373
2353 Ga0501323_020427
2354 Ga0501323_026262
2355 Ga0501324_000002
2356 Ga0501324_010331
2357 Ga0501324_014502
2358 Ga0501324_038845
2359 Ga0501325_000056
2360 Ga0501325_013523
2361 Ga0501326_00020
2362 Ga0501326_09971
2363 Ga0501327_01292
2364 Ga0501328_00037
2365 Ga0501328_11067
2366 Ga0501329_01391
2367 Ga0501329_13237
2368 Ga0501330_001422
2369 Ga0501330_001661
2370 Ga0501330_006234
2371 Ga0501331_00092
2372 Ga0501333_009569
2373 Ga0501334_01349
2374 Ga0501334_03288
2375 Ga0501335_000742
2376 Ga0501335_001452
2377 Ga0501335_008567
2378 Ga0501335_014867
2379 Ga0501335_020269
2380 Ga0501335_035351
2381 Ga0501336_009708
2382 Ga0501336_009945
2383 Ga0501337_000031
2384 Ga0501337_001289
2385 Ga0501337_003436
2386 Ga0501338_00373
2387 Ga0501340_001429
2388 Ga0501340_006416
2389 Ga0501031_0026756
2390 Ga0501032_0007271
2391 Ga0501032_0048968
2392 Ga0501032_0396137
2393 Ga0501033_0000011
2394 Ga0501033_0131892
2395 Ga0501034_0001265
2396 Ga0501034_0390568
2397 Ga0501036_0019659
2398 Ga0501036_0166298
2399 Ga0501037_0013217
2400 Ga0501038_0002395
2401 Ga0501038_0075723
2402 Ga0501039_0023075
2403 Ga0501040_0522141
2404 Ga0501043_0024223
2405 Ga0501043_0881339
2406 Ga0501047_0406992
2407 Ga0501048_0268643
2408 Ga0501198_001947
2409 Ga0501217_014128
2410 Ga0501223_025877
2411 Ga0501224_004359
2412 Ga0501235_139173
2413 Ga0501238_000015
2414 Ga0501238_001674
2415 Ga0501249_004157
2416 Ga0501249_016566
2417 Ga0501249_022408
2418 Ga0501251_000697
2419 Ga0501252_060643
2420 Ga0501255_024276
2421 Ga0501225_0310649
2422 Ga0501241_000002
2423 Ga0501241_001391
2424 Ga0501241_003188
2425 Ga0501263_016694
2426 Ga0501266_000002
2427 Ga0501269_000004
2428 Ga0501269_015808
2429 Ga0501280_000239
2430 Ga0501280_027081
2431 Ga0501282_022136
2432 Ga0501035_0004622
2433 Ga0501035_0018430
2434 Ga0501044_0023913
2435 Ga0501045_0000053
2436 Ga0501204_002065
2437 nmdc:mga0k408_150668_c1
2438 nmdc:mga0k408_22365_c1
2439 nmdc:mga0k408_349_c2
2440 nmdc:mga0k408_452852_c1
2441 nmdc:mga07m45_530437_c1
2442 nmdc:mga08y16_946750_c1
2443 Ga0500578_0670910
2444 Ga0500646_0004786
2445 Ga0500646_0064896
2446 Ga0500651_0000078
2447 Ga0500641_0000168
2448 Ga0500641_0005947
2449 Ga0500650_0464662
2450 Ga0500594_0227933
2451 Ga0500608_000214
2452 Ga0500608_087806
2453 Ga0500618_000057
2454 Ga0500642_0057580
2455 Ga0500652_245013
2456 Ga0500658_0000002
2457 Ga0500559_0077755
2458 Ga0500559_0173989
2459 Ga0500561_0057890
2460 Ga0500564_099097
2461 Ga0500568_0122186
2462 Ga0500573_0377679
2463 Ga0500579_261869
2464 Ga0500588_0421235
2465 Ga0500589_068495
2466 Ga0500616_0068519
2467 Ga0500624_000412
2468 Ga0500634_0195996
2469 Ga0500584_196186
2470 Ga0500645_045549
2471 Ga0587093_002351
2472 Ga0587093_005525
2473 Ga0587093_008088
2474 Ga0587066_001010
2475 Ga0587070_012110
2476 Ga0587070_077901
2477 Ga0587073_0004228
2478 Ga0587073_0136105
2479 Ga0587077_000755
2480 Ga0587077_004049
2481 Ga0587080_032855
2482 Ga0587080_052037
2483 Ga0587083_0007032
2484 Ga0587083_0009203
2485 Ga0587083_0010186
2486 Ga0587083_0067751
2487 Ga0587086_069553
2488 Ga0587088_002584
2489 Ga0587089_041766
2490 Ga0587089_100535
2491 Ga0587090_035231
2492 Ga0587091_007866
2493 Ga0587091_071736
2494 Ga0587092_004572
2495 Ga0587092_005398
2496 Ga0587092_034923
2497 Ga0587094_013211
2498 Ga0587094_027056
2499 Ga0587095_006475
2500 Ga0587106_000803
2501 Ga0587109_069356
2502 Ga0587117_033747
2503 Ga0587062_029117
2504 Ga0587067_011887
2505 Ga0587067_026246
2506 Ga0587068_030243
2507 Ga0587068_042434
2508 Ga0587069_010109
2509 Ga0587076_001180
2510 Ga0587076_007250
2511 Ga0587076_018545
2512 Ga0587076_031564
2513 Ga0587076_067595
2514 Ga0587079_096182
2515 2511231097
2516 2513232387
2517 2520879552
2518 2524006248
2519 2585143598
2520 2585156561
2521 2585160788
2522 2585427001
2523 2586210041
2524 2587679988
2525 2587748646
2526 2587753444
2527 2587864971
2528 2587945325
2529 2588211504
2530 2588215886
2531 2588219308
2532 2588224786
2533 2588234621
2534 2588447581
2535 2590603208
2536 2590610229
2537 2599479370
2538 2644009213
2539 2644373950
2540 2644643918
2541 2644681813
2542 2722726189
2543 2729200742
2544 2738698364
2545 2738733048
2546 2738755664
2547 2738762119
2548 2738765586
2549 2738854414
2550 2739214629
2551 2739252690
2552 2739301901
2553 2739587966
2554 2739614383
2555 2739646685
2556 2740002856
2557 2740007673
2558 2740060442
2559 2753674221
2560 2765575692
2561 2772605797
2562 2775674325
2563 2776615255
2564 2802655278
2565 2816875539
2566 2817413529
2567 2819545841
2568 2833640602
2569 2842086269
2570 2842724266
2571 2842908283
2572 2842913600
2573 2849282587
2574 2852625381
2575 2852629125
2576 2857617068
2577 2857619737
2578 2857631664
2579 2871723618
2580 2881247594
2581 2881364121
2582 2884934392
2583 2887379696
2584 2889293804
2585 2890740650
2586 2896320825
2587 2902051176
2588 2903898680
2589 2904422380
2590 2904449081
2591 2904558514
2592 2904782800
2593 2906001161
2594 2906800153
2595 2919097940
2596 2919180411
2597 2919189083
2598 2919194240
2599 2919403179
2600 2919438030
2601 2919511845
2602 2919684596
2603 2928082321
2604 2928149100
2605 2929150585
2606 2932085033
2607 2939666762
2608 2945924786
2609 2945998911
2610 2946024099
2611 2954021354
2612 2958461982
2613 2958514517
2614 2965321941
2615 2977235866
2616 2977247739
2617 2977272057
2618 2984574464
2619 2984607913
2620 2993375088
2621 2993481951
2622 3003234779
2623 8036739246
2624 8054311448
2625 8055423564
2626 8055591273
2627 8055595082
2628 8056443499

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00411

Ribosomal_S11

Ribosomal protein S11

24

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cee-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9519 16 115
8cdv-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state ii) 0.9466 16 107
8cdv-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state ii) 0.9368 16 107
8cee-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9338 16 115
4v48-assembly1.cif.gz_BK real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9222 17 113
ID Description Score Start End Superfamily
af_Q23155_77_208_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8709 17 129 3.30.420.80
af_Q9VEN6_71_200_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.87 17 129 3.30.420.80
af_P9WH65_1_139_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8588 1 129 3.30.420.80
af_P9WH65_1_139_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8527 1 129 3.30.420.80
4ujzP00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8469 18 128 3.30.420.80
ID Description Score Start End GO Terms
AF-A0A3D0RPL5-F1-model_v4 30S ribosomal protein S11 0.9597 20 108 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D0RPL5-F1-model_v4 30S ribosomal protein S11 0.9492 20 108 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-H1DBZ7-F1-model_v4 deleted 0.9301 33 110
AF-A0A6J1V4G7-F1-model_v4 28S ribosomal protein S11, mitochondrial 0.9226 17 122 GO:0003735
GO:0005763
GO:0006412
AF-A0A6P1B509-F1-model_v4 deleted 0.9206 39 113

Map