F492969

General Info

Members Datasets Scaffolds Average Seq Length
1320 333 1320 100

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10139411|Ga0182008_101394112
Length 111
Sequence MLPIWQRRLEVAKRRRFSEEGFGETVQRLMDEQGVTYRQLASRTGLSAGYLNHLVHGNRPVPSNDVVATLAGALEVEPEHFREYRLRMITDRLEAMPALIDRLYRQLNRRS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
186 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
325 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
330 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 2.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.08
Nodule 0
Rhizoplane 9.17
Rhizosphere 90.15
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10005819 3300005327 Bacteria 9988
2 Ga0070658_10009784 3300005327 Bacteria 7700
3 Ga0070658_10305038 3300005327 Bacteria 1358
4 Ga0070658_10339448 3300005327 Bacteria 1285
5 Ga0070658_10565127 3300005327 Bacteria 984
6 Ga0070658_10634156 3300005327 Unclassified 927
7 Ga0070658_11737190 3300005327 Bacteria 540
8 Ga0070683_100011542 3300005329 Bacteria 7645
9 Ga0070683_100177587 3300005329 Bacteria 2021
10 Ga0070683_100364830 3300005329 Unclassified 1376
11 Ga0070683_100401656 3300005329 Bacteria 1307
12 Ga0070683_100786395 3300005329 Unclassified 912
13 Ga0070680_100022331 3300005336 Bacteria 5039
14 Ga0070680_100294284 3300005336 Bacteria 1376
15 Ga0070680_100332357 3300005336 Bacteria 1291
16 Ga0070680_101995996 3300005336 Unclassified 503
17 Ga0070682_100051521 3300005337 Bacteria 2573
18 Ga0070682_100665680 3300005337 Bacteria 830
19 Ga0068868_100752929 3300005338 Bacteria 875
20 Ga0068868_100871422 3300005338 Unclassified 816
21 Ga0068868_101942309 3300005338 Unclassified 558
22 Ga0070660_100014452 3300005339 Bacteria 5687
23 Ga0070660_100032187 3300005339 Bacteria 3944
24 Ga0070660_100035529 3300005339 Bacteria 3772
25 Ga0070691_10389373 3300005341 Bacteria 783
26 Ga0070691_10703516 3300005341 Bacteria 607
27 Ga0070661_100103200 3300005344 Bacteria 2123
28 Ga0070661_100157128 3300005344 Bacteria 1721
29 Ga0070661_100771104 3300005344 Unclassified 787
30 Ga0070661_101698634 3300005344 Bacteria 535
31 Ga0070692_10026020 3300005345 Bacteria 2889
32 Ga0070671_101121643 3300005355 Unclassified 691
33 Ga0070659_100075403 3300005366 Unclassified 2688
34 Ga0070667_100032104 3300005367 Bacteria 4379
35 Ga0070709_10008061 3300005434 Bacteria 5779
36 Ga0070709_10055086 3300005434 Bacteria 2510
37 Ga0070709_10485473 3300005434 Bacteria 936
38 Ga0070709_10776855 3300005434 Bacteria 750
39 Ga0070709_11271244 3300005434 Bacteria 593
40 Ga0070714_100007174 3300005435 Bacteria 8646
41 Ga0070714_100035252 3300005435 Bacteria 4193
42 Ga0070714_100039377 3300005435 Bacteria 3979
43 Ga0070714_100058356 3300005435 Bacteria 3306
44 Ga0070714_100059064 3300005435 Bacteria 3287
45 Ga0070714_100080598 3300005435 Bacteria 2833
46 Ga0070714_100092793 3300005435 Bacteria 2647
47 Ga0070714_100103922 3300005435 Bacteria 2507
48 Ga0070714_100501286 3300005435 Bacteria 1158
49 Ga0070714_101127655 3300005435 Bacteria 765
50 Ga0070714_101359164 3300005435 Bacteria 694
51 Ga0070714_101718812 3300005435 Bacteria 613
52 Ga0070714_102337734 3300005435 Unclassified 520
53 Ga0070713_100018400 3300005436 Bacteria 5310
54 Ga0070713_100020135 3300005436 Bacteria 5109
55 Ga0070713_100035621 3300005436 Bacteria 4008
56 Ga0070713_100208054 3300005436 Bacteria 1770
57 Ga0070713_100270504 3300005436 Bacteria 1556
58 Ga0070713_100378505 3300005436 Bacteria 1318
59 Ga0070713_101332364 3300005436 Bacteria 696
60 Ga0070713_101583613 3300005436 Unclassified 636
61 Ga0070713_101910026 3300005436 Unclassified 576
62 Ga0070710_10009113 3300005437 Bacteria 4852
63 Ga0070710_10024166 3300005437 Bacteria 3203
64 Ga0070710_10300219 3300005437 Bacteria 1048
65 Ga0070710_11145998 3300005437 Unclassified 573
66 Ga0070710_11394154 3300005437 Bacteria 524
67 Ga0070711_100018154 3300005439 Bacteria 4487
68 Ga0070711_100034100 3300005439 Bacteria 3393
69 Ga0070711_100158062 3300005439 Unclassified 1716
70 Ga0070711_100726213 3300005439 Unclassified 838
71 Ga0070711_101598403 3300005439 Unclassified 570
72 Ga0070711_101797280 3300005439 Bacteria 538
73 Ga0070705_100257240 3300005440 Unclassified 1229
74 Ga0070694_100558559 3300005444 Bacteria 917
75 Ga0070708_100311090 3300005445 Bacteria 1484
76 Ga0070708_100953431 3300005445 Bacteria 805
77 Ga0070708_101146318 3300005445 Unclassified 728
78 Ga0070663_100553485 3300005455 Bacteria 962
79 Ga0070678_100392242 3300005456 Bacteria 1204
80 Ga0070678_101620687 3300005456 Bacteria 608
81 Ga0070662_100885497 3300005457 Bacteria 761
82 Ga0070681_10023352 3300005458 Bacteria 6218
83 Ga0070681_10055488 3300005458 Bacteria 3944
84 Ga0070681_10085532 3300005458 Bacteria 3106
85 Ga0070681_10166831 3300005458 Bacteria 2124
86 Ga0070681_10170454 3300005458 Bacteria 2098
87 Ga0070681_10176918 3300005458 Bacteria 2056
88 Ga0070681_10292105 3300005458 Bacteria 1540
89 Ga0070681_10606519 3300005458 Unclassified 1009
90 Ga0070706_100221090 3300005467 Bacteria 1768
91 Ga0070707_100001400 3300005468 Bacteria 23671
92 Ga0070707_100161731 3300005468 Bacteria 2181
93 Ga0070707_100282257 3300005468 Bacteria 1614
94 Ga0070707_100652507 3300005468 Bacteria 1015
95 Ga0074259_11690746 3300005507 Bacteria 500
96 Ga0070699_100584377 3300005518 Unclassified 1018
97 Ga0070699_101317993 3300005518 Unclassified 662
98 Ga0070679_100029725 3300005530 Bacteria 5391
99 Ga0070679_100061702 3300005530 Bacteria 3737
100 Ga0070679_100072428 3300005530 Bacteria 3438
101 Ga0070679_100087393 3300005530 Bacteria 3105
102 Ga0070679_100094898 3300005530 Bacteria 2970
103 Ga0070679_100176180 3300005530 Bacteria 2111
104 Ga0070679_100745932 3300005530 Bacteria 922
105 Ga0070684_100043652 3300005535 Bacteria 3873
106 Ga0070684_100098286 3300005535 Bacteria 2611
107 Ga0070684_100436568 3300005535 Bacteria 1209
108 Ga0070684_100453084 3300005535 Bacteria 1186
109 Ga0070684_100578801 3300005535 Bacteria 1043
110 Ga0070684_100898388 3300005535 Bacteria 830
111 Ga0070697_100156689 3300005536 Bacteria 1923
112 Ga0070697_100583459 3300005536 Bacteria 982
113 Ga0070697_100633399 3300005536 Bacteria 941
114 Ga0070695_100000062 3300005545 Bacteria 43594
115 Ga0070696_100527819 3300005546 Bacteria 943
116 Ga0070696_101144348 3300005546 Bacteria 656
117 Ga0070696_101263241 3300005546 Bacteria 626
118 Ga0070696_101386229 3300005546 Bacteria 599
119 Ga0070696_101929023 3300005546 Bacteria 512
120 Ga0070693_101226327 3300005547 Bacteria 577
121 Ga0070693_101398840 3300005547 Unclassified 544
122 Ga0068855_100025372 3300005563 Bacteria 7092
123 Ga0068855_100160460 3300005563 Bacteria 2552
124 Ga0068855_100282963 3300005563 Bacteria 1841
125 Ga0068855_100422538 3300005563 Bacteria 1458
126 Ga0068855_100445613 3300005563 Bacteria 1413
127 Ga0068855_100452560 3300005563 Bacteria 1401
128 Ga0070664_100039647 3300005564 Bacteria 3969
129 Ga0068857_100043795 3300005577 Bacteria 3969
130 Ga0068856_100280234 3300005614 Bacteria 1684
131 Ga0068856_101078500 3300005614 Unclassified 821
132 Ga0068856_102258056 3300005614 Unclassified 553
133 Ga0070702_100025480 3300005615 Bacteria 3170
134 Ga0068852_100523954 3300005616 Unclassified 1183
135 Ga0068864_100851798 3300005618 Unclassified 898
136 Ga0068858_101349445 3300005842 Unclassified 702
137 Ga0081455_10035488 3300005937 Bacteria 4455
138 Ga0081455_10086671 3300005937 Bacteria 2550
139 Ga0081455_10138886 3300005937 Bacteria 1890
140 Ga0081538_10000136 3300005981 Bacteria 76141
141 Ga0081538_10002521 3300005981 Bacteria 17836
142 Ga0081538_10003973 3300005981 Bacteria 13776
143 Ga0081538_10022124 3300005981 Bacteria 4618
144 Ga0081538_10073298 3300005981 Bacteria 1872
145 Ga0081538_10151814 3300005981 Unclassified 1047
146 Ga0070717_10012634 3300006028 Bacteria 6443
147 Ga0070717_10032992 3300006028 Bacteria 4175
148 Ga0070717_10059329 3300006028 Bacteria 3166
149 Ga0070717_10066952 3300006028 Bacteria 2987
150 Ga0070717_10259887 3300006028 Unclassified 1536
151 Ga0070717_10299132 3300006028 Bacteria 1430
152 Ga0070717_10406965 3300006028 Bacteria 1223
153 Ga0070717_10913138 3300006028 Unclassified 799
154 Ga0075432_10522035 3300006058 Bacteria 532
155 Ga0070715_10007615 3300006163 Bacteria 3735
156 Ga0070715_10131537 3300006163 Bacteria 1205
157 Ga0070716_100017489 3300006173 Bacteria 3718
158 Ga0070716_100037357 3300006173 Bacteria 2684
159 Ga0070716_100216898 3300006173 Bacteria 1283
160 Ga0070712_100034964 3300006175 Bacteria 3408
161 Ga0070712_100072995 3300006175 Bacteria 2460
162 Ga0070712_100146513 3300006175 Bacteria 1808
163 Ga0070712_100156081 3300006175 Bacteria 1758
164 Ga0070712_100503055 3300006175 Bacteria 1016
165 Ga0070712_100837382 3300006175 Bacteria 791
166 Ga0070712_100914191 3300006175 Bacteria 757
167 Ga0070712_100936583 3300006175 Unclassified 748
168 Ga0070712_101570089 3300006175 Unclassified 575
169 Ga0070712_101661480 3300006175 Unclassified 559
170 Ga0070712_102044087 3300006175 Unclassified 502
171 Ga0097621_101114692 3300006237 Bacteria 741
172 Ga0068871_101511748 3300006358 Unclassified 634
173 Ga0075428_100005458 3300006844 Bacteria 14138
174 Ga0075430_100012449 3300006846 Bacteria 7238
175 Ga0075430_100394958 3300006846 Bacteria 1141
176 Ga0075430_100476674 3300006846 Bacteria 1030
177 Ga0075431_100136071 3300006847 Bacteria 2533
178 Ga0075433_10101468 3300006852 Bacteria 2548
179 Ga0075433_10257125 3300006852 Bacteria 1549
180 Ga0075433_11129633 3300006852 Bacteria 681
181 Ga0075434_100010946 3300006871 Bacteria 8531
182 Ga0075434_100036845 3300006871 Bacteria 4839
183 Ga0075429_100078876 3300006880 Bacteria 2870
184 Ga0068865_100437799 3300006881 Bacteria 1078
185 Ga0068865_101805519 3300006881 Bacteria 553
186 Ga0075436_100615087 3300006914 Bacteria 801
187 Ga0075435_100003008 3300007076 Bacteria 11350
188 Ga0075435_100102122 3300007076 Bacteria 2377
189 Ga0075435_100454256 3300007076 Bacteria 1105
190 Ga0105240_10009653 3300009093 Bacteria 13646
191 Ga0105240_10054502 3300009093 Bacteria 5011
192 Ga0105240_10066947 3300009093 Bacteria 4454
193 Ga0105240_10860947 3300009093 Bacteria 977
194 Ga0105240_12331792 3300009093 Bacteria 554
195 Ga0111539_10405652 3300009094 Bacteria 1587
196 Ga0105245_10066360 3300009098 Bacteria 3265
197 Ga0105245_10595964 3300009098 Unclassified 1131
198 Ga0105245_11161206 3300009098 Bacteria 819
199 Ga0105245_12399254 3300009098 Bacteria 581
200 Ga0105245_12995518 3300009098 Bacteria 523
201 Ga0105247_10169823 3300009101 Bacteria 1449
202 Ga0105247_10316818 3300009101 Unclassified 1087
203 Ga0114129_10022016 3300009147 Bacteria 9046
204 Ga0114129_10598709 3300009147 Unclassified 1428
205 Ga0105243_10587447 3300009148 Bacteria 1070
206 Ga0105243_11105485 3300009148 Unclassified 801
207 Ga0105243_11240711 3300009148 Bacteria 760
208 Ga0105241_11226215 3300009174 Unclassified 711
209 Ga0105242_10889415 3300009176 Bacteria 889
210 Ga0105242_12800503 3300009176 Bacteria 538
211 Ga0105248_10130632 3300009177 Bacteria 2834
212 Ga0105248_10879500 3300009177 Bacteria 1012
213 Ga0105248_10994834 3300009177 Unclassified 947
214 Ga0105248_11235769 3300009177 Bacteria 845
215 Ga0105237_10039556 3300009545 Bacteria 4760
216 Ga0105237_10215146 3300009545 Bacteria 1922
217 Ga0105237_10262638 3300009545 Bacteria 1729
218 Ga0105237_11074173 3300009545 Unclassified 812
219 Ga0105238_10029328 3300009551 Bacteria 5605
220 Ga0105238_10966951 3300009551 Bacteria 872
221 Ga0105238_11049204 3300009551 Unclassified 837
222 Ga0105239_10677845 3300010375 Bacteria 1178
223 Ga0105239_11696353 3300010375 Unclassified 731
224 Ga0105246_11010051 3300011119 Bacteria 754
225 Ga0157316_1068837 3300012510 Bacteria 530
226 Ga0157373_10255286 3300013100 Bacteria 1240
227 Ga0157373_10632601 3300013100 Bacteria 780
228 Ga0157370_10039274 3300013104 Bacteria 4574
229 Ga0157370_10213877 3300013104 Unclassified 1786
230 Ga0157370_10290393 3300013104 Unclassified 1510
231 Ga0157370_10335866 3300013104 Bacteria 1393
232 Ga0157370_10339433 3300013104 Bacteria 1385
233 Ga0157370_11757157 3300013104 Unclassified 557
234 Ga0157369_10001204 3300013105 Bacteria 32229
235 Ga0157369_10001856 3300013105 Bacteria 25507
236 Ga0157369_10041923 3300013105 Bacteria 4995
237 Ga0157369_10058446 3300013105 Bacteria 4160
238 Ga0157369_10287182 3300013105 Bacteria 1713
239 Ga0157369_10341214 3300013105 Bacteria 1556
240 Ga0157369_10383000 3300013105 Bacteria 1460
241 Ga0157369_10737077 3300013105 Unclassified 1014
242 Ga0157369_10881330 3300013105 Bacteria 918
243 Ga0157369_12007803 3300013105 Unclassified 587
244 Ga0157369_12527197 3300013105 Bacteria 520
245 Ga0157374_10011973 3300013296 Bacteria 7531
246 Ga0157374_10498610 3300013296 Bacteria 1222
247 Ga0163162_10276620 3300013306 Bacteria 1811
248 Ga0157372_10011775 3300013307 Bacteria 9317
249 Ga0157372_10068866 3300013307 Bacteria 3979
250 Ga0157372_10094402 3300013307 Bacteria 3406
251 Ga0157372_10247741 3300013307 Bacteria 2068
252 Ga0157372_10502336 3300013307 Bacteria 1414
253 Ga0157372_11301278 3300013307 Bacteria 839
254 Ga0157372_11717117 3300013307 Bacteria 722
255 Ga0157375_10435797 3300013308 Bacteria 1476
256 Ga0182008_10139411 3300014497 Unclassified 1212
257 Ga0182008_10157510 3300014497 Bacteria 1141
258 Ga0182008_10188112 3300014497 Unclassified 1047
259 Ga0182008_10273259 3300014497 Bacteria 877
260 Ga0182008_10649296 3300014497 Bacteria 597
261 Ga0157376_10029992 3300014969 Bacteria 4336
262 Ga0157376_10754402 3300014969 Bacteria 982
263 Ga0157376_11600648 3300014969 Bacteria 686
264 Ga0182006_1120070 3300015261 Bacteria 914
265 Ga0182006_1239470 3300015261 Bacteria 596
266 Ga0182007_10110101 3300015262 Bacteria 916
267 Ga0197907_10563710 3300020069 Bacteria 729
268 Ga0197907_10573604 3300020069 Bacteria 973
269 Ga0197907_11227556 3300020069 Bacteria 997
270 Ga0206356_10180444 3300020070 Bacteria 681
271 Ga0206356_10432715 3300020070 Unclassified 1108
272 Ga0206356_11012638 3300020070 Bacteria 703
273 Ga0206356_11092075 3300020070 Bacteria 3517
274 Ga0206356_11222836 3300020070 Bacteria 776
275 Ga0206350_10267790 3300020080 Bacteria 925
276 Ga0206350_10497261 3300020080 Unclassified 729
277 Ga0206354_10674964 3300020081 Bacteria 1126
278 Ga0206354_10881760 3300020081 Bacteria 3681
279 Ga0206354_11142272 3300020081 Bacteria 698
280 Ga0206354_11636654 3300020081 Bacteria 2516
281 Ga0206353_10140028 3300020082 Bacteria 3185
282 Ga0206353_10285007 3300020082 Bacteria 1694
283 Ga0206353_10352402 3300020082 Bacteria 620
284 Ga0206353_10406529 3300020082 Bacteria 3953
285 Ga0206353_10671973 3300020082 Bacteria 955
286 Ga0206353_10888588 3300020082 Bacteria 3334
287 Ga0206353_12069808 3300020082 Bacteria 1516
288 Ga0154015_1486064 3300020610 Unclassified 683
289 Ga0213874_10083297 3300021377 Bacteria 1040
290 Ga0213874_10158799 3300021377 Bacteria 793
291 Ga0213871_10017618 3300021441 Bacteria 1738
292 Ga0224712_10059960 3300022467 Bacteria 1513
293 Ga0224712_10110483 3300022467 Bacteria 1178
294 Ga0224712_10136576 3300022467 Bacteria 1075
295 Ga0224712_10154231 3300022467 Bacteria 1020
296 Ga0224712_10195528 3300022467 Unclassified 917
297 Ga0224712_10224282 3300022467 Bacteria 861
298 Ga0224712_10538266 3300022467 Bacteria 567
299 Ga0207692_10041264 3300025898 Bacteria 2283
300 Ga0207692_10124605 3300025898 Bacteria 1447
301 Ga0207692_10271822 3300025898 Unclassified 1022
302 Ga0207685_10013868 3300025905 Unclassified 2506
303 Ga0207685_10023347 3300025905 Bacteria 2104
304 Ga0207699_10025181 3300025906 Bacteria 3264
305 Ga0207699_10159957 3300025906 Bacteria 1498
306 Ga0207699_10445111 3300025906 Archaea 928
307 Ga0207699_10940605 3300025906 Bacteria 638
308 Ga0207699_11128984 3300025906 Bacteria 580
309 Ga0207705_10060825 3300025909 Bacteria 2728
310 Ga0207705_10082159 3300025909 Bacteria 2349
311 Ga0207705_10084653 3300025909 Bacteria 2315
312 Ga0207705_10090781 3300025909 Bacteria 2237
313 Ga0207705_10397528 3300025909 Bacteria 1066
314 Ga0207705_10744811 3300025909 Bacteria 761
315 Ga0207684_10275077 3300025910 Unclassified 1452
316 Ga0207654_11073131 3300025911 Unclassified 586
317 Ga0207707_10056416 3300025912 Bacteria 3417
318 Ga0207707_10088691 3300025912 Bacteria 2702
319 Ga0207707_10186119 3300025912 Bacteria 1812
320 Ga0207707_10297386 3300025912 Bacteria 1396
321 Ga0207707_10365916 3300025912 Unclassified 1241
322 Ga0207707_10446830 3300025912 Unclassified 1106
323 Ga0207707_10465017 3300025912 Bacteria 1081
324 Ga0207695_10038896 3300025913 Bacteria 5116
325 Ga0207695_10168500 3300025913 Unclassified 2117
326 Ga0207695_10315240 3300025913 Unclassified 1454
327 Ga0207695_11675251 3300025913 Unclassified 517
328 Ga0207671_10204332 3300025914 Bacteria 1543
329 Ga0207693_10000662 3300025915 Bacteria 30935
330 Ga0207693_10001177 3300025915 Bacteria 23356
331 Ga0207693_10066752 3300025915 Bacteria 2816
332 Ga0207693_10137564 3300025915 Bacteria 1921
333 Ga0207693_10320995 3300025915 Bacteria 1212
334 Ga0207693_10611351 3300025915 Bacteria 848
335 Ga0207693_11190245 3300025915 Unclassified 575
336 Ga0207663_10019788 3300025916 Bacteria 3800
337 Ga0207663_10078640 3300025916 Bacteria 2151
338 Ga0207663_10134883 3300025916 Bacteria 1711
339 Ga0207663_10197698 3300025916 Unclassified 1448
340 Ga0207663_10606594 3300025916 Bacteria 860
341 Ga0207663_10711484 3300025916 Bacteria 796
342 Ga0207663_10751330 3300025916 Bacteria 775
343 Ga0207660_10044524 3300025917 Bacteria 3123
344 Ga0207660_10248488 3300025917 Bacteria 1403
345 Ga0207660_10411066 3300025917 Bacteria 1090
346 Ga0207660_10415356 3300025917 Bacteria 1085
347 Ga0207657_10000739 3300025919 Bacteria 34678
348 Ga0207657_10003274 3300025919 Bacteria 17326
349 Ga0207657_10024996 3300025919 Bacteria 5518
350 Ga0207649_10099985 3300025920 Bacteria 1917
351 Ga0207652_10080760 3300025921 Bacteria 2843
352 Ga0207652_10161630 3300025921 Bacteria 2008
353 Ga0207652_10171384 3300025921 Bacteria 1948
354 Ga0207652_10296911 3300025921 Bacteria 1458
355 Ga0207652_10299928 3300025921 Bacteria 1450
356 Ga0207652_10954362 3300025921 Bacteria 755
357 Ga0207652_11461547 3300025921 Unclassified 587
358 Ga0207652_11782320 3300025921 Unclassified 521
359 Ga0207646_10006489 3300025922 Bacteria 12075
360 Ga0207646_10152685 3300025922 Bacteria 2083
361 Ga0207646_10167966 3300025922 Bacteria 1981
362 Ga0207646_10221549 3300025922 Bacteria 1709
363 Ga0207646_10352759 3300025922 Bacteria 1329
364 Ga0207646_10499880 3300025922 Bacteria 1096
365 Ga0207646_11421640 3300025922 Bacteria 603
366 Ga0207694_10053522 3300025924 Bacteria 3130
367 Ga0207694_10681832 3300025924 Bacteria 866
368 Ga0207659_11653207 3300025926 Unclassified 546
369 Ga0207687_10042669 3300025927 Bacteria 3122
370 Ga0207687_10414732 3300025927 Bacteria 1110
371 Ga0207700_10025409 3300025928 Bacteria 4111
372 Ga0207700_10061830 3300025928 Bacteria 2842
373 Ga0207700_10152037 3300025928 Bacteria 1914
374 Ga0207700_10171940 3300025928 Bacteria 1808
375 Ga0207700_10447030 3300025928 Bacteria 1139
376 Ga0207700_10781895 3300025928 Bacteria 853
377 Ga0207700_11066696 3300025928 Bacteria 723
378 Ga0207700_11139488 3300025928 Unclassified 697
379 Ga0207664_10014583 3300025929 Bacteria 5680
380 Ga0207664_10026349 3300025929 Bacteria 4393
381 Ga0207664_10028163 3300025929 Bacteria 4267
382 Ga0207664_10061691 3300025929 Bacteria 2992
383 Ga0207664_10097421 3300025929 Bacteria 2423
384 Ga0207664_10098659 3300025929 Bacteria 2409
385 Ga0207664_10123757 3300025929 Bacteria 2168
386 Ga0207664_10207810 3300025929 Bacteria 1693
387 Ga0207664_10253589 3300025929 Bacteria 1536
388 Ga0207664_10312789 3300025929 Bacteria 1384
389 Ga0207664_10345327 3300025929 Bacteria 1316
390 Ga0207664_10391355 3300025929 Unclassified 1235
391 Ga0207664_10674601 3300025929 Unclassified 929
392 Ga0207664_10953228 3300025929 Bacteria 770
393 Ga0207664_10959429 3300025929 Bacteria 767
394 Ga0207664_10961390 3300025929 Bacteria 766
395 Ga0207664_11813334 3300025929 Unclassified 533
396 Ga0207644_10529689 3300025931 Bacteria 974
397 Ga0207644_10559527 3300025931 Bacteria 947
398 Ga0207690_10204401 3300025932 Unclassified 1502
399 Ga0207686_10954620 3300025934 Bacteria 694
400 Ga0207704_10783562 3300025938 Bacteria 795
401 Ga0207665_10000060 3300025939 Bacteria 70443
402 Ga0207665_10083470 3300025939 Bacteria 2203
403 Ga0207665_10282019 3300025939 Bacteria 1237
404 Ga0207665_10818831 3300025939 Unclassified 736
405 Ga0207711_10309641 3300025941 Bacteria 1458
406 Ga0207711_11791992 3300025941 Unclassified 557
407 Ga0207711_12084672 3300025941 Unclassified 510
408 Ga0207661_10049224 3300025944 Bacteria 3354
409 Ga0207661_10063029 3300025944 Bacteria 3001
410 Ga0207661_10102318 3300025944 Bacteria 2408
411 Ga0207661_10150474 3300025944 Bacteria 2011
412 Ga0207661_10803706 3300025944 Bacteria 866
413 Ga0207679_10028264 3300025945 Bacteria 3889
414 Ga0207667_10090118 3300025949 Bacteria 3169
415 Ga0207667_10237986 3300025949 Bacteria 1863
416 Ga0207667_10238939 3300025949 Bacteria 1859
417 Ga0207667_10301062 3300025949 Bacteria 1638
418 Ga0207667_10303491 3300025949 Bacteria 1631
419 Ga0207640_10892426 3300025981 Bacteria 776
420 Ga0207658_10029790 3300025986 Bacteria 3859
421 Ga0207677_11203927 3300026023 Unclassified 693
422 Ga0207639_10838179 3300026041 Unclassified 858
423 Ga0207639_11456161 3300026041 Bacteria 643
424 Ga0207678_10237400 3300026067 Bacteria 1561
425 Ga0207702_10007978 3300026078 Bacteria 8973
426 Ga0207702_10206357 3300026078 Bacteria 1824
427 Ga0207641_10085877 3300026088 Bacteria 2743
428 Ga0207648_12060857 3300026089 Unclassified 532
429 Ga0207674_10072656 3300026116 Bacteria 3455
430 Ga0207674_11967398 3300026116 Unclassified 550
431 Ga0207683_10171358 3300026121 Bacteria 1966
432 Ga0207428_10336742 3300027907 Bacteria 1112
433 Ga0265337_1148993 3300028556 Unclassified 634
434 Ga0265319_1021907 3300028563 Bacteria 2339
435 Ga0265334_10042042 3300028573 Bacteria 1783
436 Ga0265318_10083349 3300028577 Bacteria 1180
437 Ga0265322_10014394 3300028654 Bacteria 2286
438 Ga0265336_10003451 3300028666 Bacteria 6193
439 Ga0265336_10083432 3300028666 Bacteria 953
440 Ga0265336_10113993 3300028666 Bacteria 805
441 Ga0265338_10010298 3300028800 Bacteria 10988
442 Ga0265338_10010986 3300028800 Bacteria 10520
443 Ga0265338_10013097 3300028800 Bacteria 9398
444 Ga0265338_10025999 3300028800 Bacteria 5918
445 Ga0265338_10032561 3300028800 Bacteria 5079
446 Ga0265338_10068567 3300028800 Bacteria 3055
447 Ga0265338_10113504 3300028800 Bacteria 2176
448 Ga0265338_10121449 3300028800 Bacteria 2081
449 Ga0265338_10672344 3300028800 Bacteria 716
450 Ga0265338_10773822 3300028800 Unclassified 659
451 Ga0265338_10959841 3300028800 Unclassified 580
452 Ga0265324_10005245 3300029957 Bacteria 5636
453 Ga0265332_10073266 3300031238 Bacteria 1457
454 Ga0265320_10410787 3300031240 Unclassified 598
455 Ga0265325_10004773 3300031241 Bacteria 8492
456 Ga0265325_10107490 3300031241 Bacteria 1359
457 Ga0265325_10142147 3300031241 Bacteria 1140
458 Ga0265329_10092500 3300031242 Bacteria 960
459 Ga0265340_10012880 3300031247 Bacteria 4408
460 Ga0265339_10005030 3300031249 Bacteria 8892
461 Ga0265339_10008194 3300031249 Bacteria 6669
462 Ga0265331_10045657 3300031250 Bacteria 2115
463 Ga0265331_10078835 3300031250 Bacteria 1533
464 Ga0265331_10085464 3300031250 Bacteria 1462
465 Ga0265327_10007271 3300031251 Bacteria 8590
466 Ga0265327_10014976 3300031251 Bacteria 5041
467 Ga0265327_10276733 3300031251 Bacteria 742
468 Ga0265316_10006806 3300031344 Bacteria 10868
469 Ga0265316_10033976 3300031344 Bacteria 4147
470 Ga0265316_10225392 3300031344 Bacteria 1382
471 Ga0265316_10487357 3300031344 Unclassified 882
472 Ga0265316_10862831 3300031344 Bacteria 633
473 Ga0265313_10007875 3300031595 Bacteria 7181
474 Ga0265313_10024527 3300031595 Bacteria 3219
475 Ga0265313_10049717 3300031595 Bacteria 2016
476 Ga0265313_10196071 3300031595 Bacteria 842
477 Ga0265314_10002229 3300031711 Bacteria 20166
478 Ga0265314_10010464 3300031711 Bacteria 7733
479 Ga0265314_10137449 3300031711 Bacteria 1516
480 Ga0265314_10271340 3300031711 Unclassified 964
481 Ga0265342_10021386 3300031712 Bacteria 4133
482 Ga0265342_10073784 3300031712 Bacteria 1984
483 Ga0373926_0018093 3300035083 Bacteria 2422
484 Ga0373926_0085770 3300035083 Bacteria 1168
485 Ga0373934_0078178 3300035086 Bacteria 1327
486 Ga0373932_0192377 3300035112 Unclassified 721
487 Ga0373936_0019580 3300035113 Bacteria 2623
488 Ga0373936_0085998 3300035113 Unclassified 1313
489 Ga0373936_0140890 3300035113 Bacteria 1041
490 Ga0373939_0254143 3300035114 Bacteria 685
491 Ga0373941_0166999 3300035115 Unclassified 818
492 Ga0373945_0058790 3300035116 Bacteria 1430
493 Ga0373945_0112213 3300035116 Bacteria 1076
494 Ga0373953_0122497 3300035117 Bacteria 1105
495 Ga0373954_0382235 3300035118 Unclassified 696
496 Ga0373956_0025909 3300035119 Bacteria 2537
497 Ga0373956_0147134 3300035119 Bacteria 1108
498 Ga0373957_0138521 3300035120 Bacteria 994
499 Ga0373957_0267979 3300035120 Unclassified 721
500 Ga0373943_0003688 3300035170 Bacteria 6964
501 Ga0373943_0006524 3300035170 Bacteria 5242
502 Ga0373943_0034614 3300035170 Bacteria 2410
503 Ga0373943_0233583 3300035170 Unclassified 1028
504 Ga0373946_0010006 3300035171 Bacteria 3506
505 Ga0373946_0626734 3300035171 Bacteria 559
506 Ga0373955_0026369 3300035172 Bacteria 2993
507 Ga0373955_0272335 3300035172 Unclassified 1018
508 Ga0373955_0356109 3300035172 Bacteria 887
509 Ga0373955_0787509 3300035172 Unclassified 584
510 Ga0373924_0043377 3300035410 Bacteria 1847
511 Ga0373924_0345030 3300035410 Bacteria 663
512 Ga0373924_0368145 3300035410 Bacteria 641
513 Ga0373935_0098532 3300035692 Bacteria 1924
514 Ga0373935_0395626 3300035692 Unclassified 991
515 Ga0373935_0862485 3300035692 Unclassified 670
516 Ga0373927_0073735 3300035695 Bacteria 2210
517 Ga0373927_0390711 3300035695 Bacteria 918
518 Ga0373947_0002320 3300035725 Bacteria 11504
519 Ga0373947_0017658 3300035725 Bacteria 4105
520 Ga0373947_0018889 3300035725 Bacteria 3971
521 Ga0373947_0428733 3300035725 Bacteria 894
522 Ga0373947_0526438 3300035725 Bacteria 804
523 Ga0373937_0030625 3300036401 Bacteria 4872
524 Ga0373937_0128957 3300036401 Bacteria 2361
525 Ga0373937_0528235 3300036401 Bacteria 1121
526 Ga0373937_0531415 3300036401 Bacteria 1117
527 Ga0373937_0712732 3300036401 Bacteria 950
528 Ga0373937_1214486 3300036401 Bacteria 702
529 Ga0373937_1820637 3300036401 Bacteria 555
530 Ga0373925_0010642 3300037068 Bacteria 6672
531 Ga0373925_0020725 3300037068 Bacteria 4789
532 Ga0373925_0033843 3300037068 Bacteria 3765
533 Ga0373925_1357605 3300037068 Unclassified 583
534 Ga0373925_1638164 3300037068 Unclassified 526
535 Ga0395899_0015072 3300037312 Bacteria 5892
536 Ga0395899_0064381 3300037312 Bacteria 2696
537 Ga0395900_0021178 3300037418 Bacteria 6646
538 Ga0395900_0076144 3300037418 Bacteria 3449
539 Ga0395900_0130545 3300037418 Bacteria 2575
540 Ga0395900_0209059 3300037418 Bacteria 1971
541 Ga0395900_0214691 3300037418 Bacteria 1942
542 Ga0395900_0295093 3300037418 Bacteria 1609
543 Ga0395900_0461454 3300037418 Bacteria 1225
544 Ga0395900_0514045 3300037418 Bacteria 1146
545 Ga0395898_0021217 3300037466 Bacteria 6589
546 Ga0395898_0102419 3300037466 Bacteria 2748
547 Ga0395898_0169195 3300037466 Archaea 2089
548 Ga0395898_0219229 3300037466 Bacteria 1815
549 Ga0395898_0443889 3300037466 Bacteria 1236
550 Ga0395898_0507487 3300037466 Bacteria 1147
551 Ga0395898_0600230 3300037466 Bacteria 1043
552 Ga0395898_0752584 3300037466 Bacteria 916
553 Ga0395898_0826693 3300037466 Bacteria 866
554 Ga0395898_1119667 3300037466 Unclassified 720
555 Ga0395898_1200128 3300037466 Bacteria 690
556 Ga0395898_1418862 3300037466 Bacteria 622
557 Ga0395898_1519433 3300037466 Bacteria 595
558 Ga0395905_0227773 3300037471 Bacteria 1743
559 Ga0395905_0761229 3300037471 Bacteria 871
560 Ga0395905_0867626 3300037471 Bacteria 806
561 Ga0395905_1366104 3300037471 Bacteria 612
562 Ga0395905_1853973 3300037471 Bacteria 509
563 Ga0395901_0028667 3300038443 Bacteria 5727
564 Ga0395901_0029945 3300038443 Bacteria 5607
565 Ga0395901_0037180 3300038443 Bacteria 5036
566 Ga0395901_0049114 3300038443 Bacteria 4383
567 Ga0395901_0149661 3300038443 Bacteria 2453
568 Ga0395901_0210768 3300038443 Bacteria 2034
569 Ga0395901_0433022 3300038443 Bacteria 1347
570 Ga0395901_0456029 3300038443 Bacteria 1307
571 Ga0395901_0546607 3300038443 Bacteria 1174
572 Ga0395901_0745060 3300038443 Bacteria 973
573 Ga0395901_1357511 3300038443 Unclassified 671
574 Ga0395901_1504168 3300038443 Bacteria 629
575 Ga0395901_1602861 3300038443 Unclassified 604
576 Ga0395901_1770698 3300038443 Unclassified 567
577 Ga0395901_1985990 3300038443 Unclassified 528
578 Ga0395901_2033890 3300038443 Unclassified 520
579 Ga0436365_0792175 3300039437 Unclassified 772
580 Ga0436365_1108698 3300039437 Bacteria 794
581 Ga0436360_0619128 3300039438 Bacteria 13472
582 Ga0436360_1152980 3300039438 Bacteria 5667
583 Ga0436363_1375679 3300039450 Bacteria 1436
584 Ga0436363_1460754 3300039450 Bacteria 876
585 Ga0436362_0697180 3300039453 Bacteria 1449
586 Ga0436362_1210214 3300039453 Bacteria 6384
587 Ga0451787_740278 3300041441 Bacteria 527
588 Ga0451793_0829543 3300041452 Bacteria 623
589 Ga0451807_0899059 3300041486 Archaea 710
590 Ga0451853_0838820 3300041512 Unclassified 1496
591 Ga0439458_0060306 3300042157 Bacteria 946
592 Ga0466969_0002720 3300044656 Bacteria 9452
593 Ga0466969_0535441 3300044656 Bacteria 535
594 Ga0466965_0005134 3300044683 Bacteria 5875
595 Ga0466965_0014876 3300044683 Bacteria 3689
596 Ga0466965_0018262 3300044683 Bacteria 3360
597 Ga0466965_0040756 3300044683 Bacteria 2287
598 Ga0466965_0590274 3300044683 Unclassified 630
599 Ga0466966_0022146 3300044684 Bacteria 4172
600 Ga0466966_0190068 3300044684 Bacteria 1244
601 Ga0466966_0239101 3300044684 Bacteria 1095
602 Ga0466966_0296711 3300044684 Bacteria 971
603 Ga0466966_0299536 3300044684 Bacteria 966
604 Ga0466966_0330036 3300044684 Unclassified 916
605 Ga0466961_0004361 3300044693 Bacteria 8863
606 Ga0466961_0013977 3300044693 Bacteria 5145
607 Ga0466961_0014149 3300044693 Bacteria 5118
608 Ga0466961_0025466 3300044693 Bacteria 3804
609 Ga0466961_0050729 3300044693 Bacteria 2650
610 Ga0466961_0144969 3300044693 Unclassified 1485
611 Ga0466963_0000776 3300044694 Bacteria 15852
612 Ga0466963_0003553 3300044694 Bacteria 8953
613 Ga0466963_0004108 3300044694 Bacteria 8419
614 Ga0466963_0005116 3300044694 Bacteria 7660
615 Ga0466963_0008663 3300044694 Bacteria 6105
616 Ga0466963_0009464 3300044694 Bacteria 5867
617 Ga0466963_0014868 3300044694 Bacteria 4807
618 Ga0466963_0016673 3300044694 Bacteria 4570
619 Ga0466963_0019292 3300044694 Bacteria 4274
620 Ga0466963_0033684 3300044694 Bacteria 3328
621 Ga0466963_0037025 3300044694 Bacteria 3184
622 Ga0466963_0053357 3300044694 Bacteria 2684
623 Ga0466963_0053952 3300044694 Bacteria 2670
624 Ga0466963_0080175 3300044694 Bacteria 2209
625 Ga0466963_0082675 3300044694 Bacteria 2177
626 Ga0466963_0154097 3300044694 Bacteria 1597
627 Ga0466963_0198757 3300044694 Bacteria 1402
628 Ga0466963_0199219 3300044694 Unclassified 1400
629 Ga0466963_0231225 3300044694 Bacteria 1295
630 Ga0466963_0353768 3300044694 Bacteria 1034
631 Ga0466963_0463261 3300044694 Bacteria 894
632 Ga0466963_0464918 3300044694 Bacteria 893
633 Ga0466963_0557552 3300044694 Bacteria 809
634 Ga0466963_0720316 3300044694 Bacteria 704
635 Ga0466963_0734292 3300044694 Bacteria 696
636 Ga0466963_0821348 3300044694 Bacteria 655
637 Ga0466963_0932482 3300044694 Bacteria 612
638 Ga0466964_0004036 3300044706 Bacteria 5395
639 Ga0466964_0010742 3300044706 Bacteria 3458
640 Ga0466964_0022709 3300044706 Bacteria 2436
641 Ga0466964_0084888 3300044706 Bacteria 1366
642 Ga0466964_0087302 3300044706 Bacteria 1351
643 Ga0466964_0123702 3300044706 Bacteria 1169
644 Ga0466964_0156525 3300044706 Bacteria 1061
645 Ga0466964_0187280 3300044706 Unclassified 985
646 Ga0466964_0188140 3300044706 Bacteria 983
647 Ga0466964_0244480 3300044706 Bacteria 882
648 Ga0466964_0313835 3300044706 Bacteria 794
649 Ga0466964_0402622 3300044706 Bacteria 715
650 Ga0466964_0516025 3300044706 Bacteria 644
651 Ga0466971_0002654 3300044719 Bacteria 7552
652 Ga0466971_0035954 3300044719 Bacteria 2221
653 Ga0466971_0101119 3300044719 Bacteria 1325
654 Ga0466971_0138913 3300044719 Unclassified 1131
655 Ga0466971_0584182 3300044719 Unclassified 556
656 Ga0466968_0001944 3300044735 Bacteria 7492
657 Ga0466968_0003607 3300044735 Bacteria 5731
658 Ga0466968_0047422 3300044735 Bacteria 1827
659 Ga0466968_0053026 3300044735 Bacteria 1736
660 Ga0466968_0067367 3300044735 Bacteria 1552
661 Ga0466968_0076026 3300044735 Bacteria 1469
662 Ga0466968_0081263 3300044735 Bacteria 1424
663 Ga0466968_0124926 3300044735 Unclassified 1167
664 Ga0466968_0147904 3300044735 Bacteria 1078
665 Ga0466968_0186201 3300044735 Bacteria 967
666 Ga0466968_0313446 3300044735 Bacteria 756
667 Ga0466968_0468475 3300044735 Bacteria 624
668 Ga0466970_0064092 3300044765 Unclassified 1971
669 Ga0466970_0368588 3300044765 Bacteria 816
670 Ga0466957_0002420 3300044842 Bacteria 10019
671 Ga0466957_0006059 3300044842 Bacteria 6826
672 Ga0466957_0016735 3300044842 Bacteria 4289
673 Ga0466957_0020828 3300044842 Bacteria 3858
674 Ga0466957_0023038 3300044842 Bacteria 3677
675 Ga0466957_0032867 3300044842 Bacteria 3109
676 Ga0466957_0058404 3300044842 Bacteria 2363
677 Ga0466957_0152772 3300044842 Bacteria 1494
678 Ga0466957_0431642 3300044842 Bacteria 905
679 Ga0466957_0758023 3300044842 Bacteria 688
680 Ga0466957_1015049 3300044842 Unclassified 596
681 Ga0466960_0030757 3300044901 Bacteria 2473
682 Ga0466960_0125647 3300044901 Unclassified 1348
683 Ga0466960_0237885 3300044901 Unclassified 1007
684 Ga0466960_0387984 3300044901 Bacteria 802
685 Ga0466960_0393140 3300044901 Bacteria 797
686 Ga0466960_0689527 3300044901 Bacteria 612
687 Ga0466960_0920295 3300044901 Unclassified 534
688 Ga0466959_0001728 3300045049 Bacteria 13579
689 Ga0466959_0006520 3300045049 Bacteria 8093
690 Ga0466959_0013001 3300045049 Bacteria 6027
691 Ga0466959_0034403 3300045049 Bacteria 3747
692 Ga0466959_0214073 3300045049 Bacteria 1338
693 Ga0466959_0627048 3300045049 Bacteria 722
694 Ga0466959_0954315 3300045049 Bacteria 571
695 Ga0466959_1072408 3300045049 Bacteria 536
696 Ga0466958_0002506 3300045836 Bacteria 9254
697 Ga0466958_0039977 3300045836 Bacteria 2819
698 Ga0466958_0056805 3300045836 Bacteria 2378
699 Ga0466958_0060895 3300045836 Bacteria 2298
700 Ga0466958_0070654 3300045836 Bacteria 2137
701 Ga0466958_0080370 3300045836 Bacteria 2005
702 Ga0466958_0089662 3300045836 Bacteria 1901
703 Ga0466958_0155274 3300045836 Bacteria 1444
704 Ga0466958_0322644 3300045836 Bacteria 992
705 Ga0466958_0384117 3300045836 Bacteria 906
706 Ga0466958_0398015 3300045836 Bacteria 889
707 Ga0466958_0429660 3300045836 Bacteria 854
708 Ga0466958_0988389 3300045836 Bacteria 549
709 Ga0466967_0000305 3300045976 Bacteria 22092
710 Ga0466967_0001226 3300045976 Bacteria 14472
711 Ga0466967_0003528 3300045976 Bacteria 10232
712 Ga0466967_0004124 3300045976 Bacteria 9710
713 Ga0466967_0004340 3300045976 Bacteria 9538
714 Ga0466967_0004811 3300045976 Bacteria 9203
715 Ga0466967_0010051 3300045976 Bacteria 7070
716 Ga0466967_0018003 3300045976 Bacteria 5633
717 Ga0466967_0032578 3300045976 Bacteria 4402
718 Ga0466967_0037090 3300045976 Bacteria 4168
719 Ga0466967_0048143 3300045976 Bacteria 3721
720 Ga0466967_0072416 3300045976 Bacteria 3088
721 Ga0466967_0079366 3300045976 Bacteria 2958
722 Ga0466967_0105674 3300045976 Bacteria 2579
723 Ga0466967_0128896 3300045976 Unclassified 2346
724 Ga0466967_0137670 3300045976 Bacteria 2272
725 Ga0466967_0141258 3300045976 Bacteria 2243
726 Ga0466967_0222705 3300045976 Bacteria 1793
727 Ga0466967_0244113 3300045976 Bacteria 1714
728 Ga0466967_0256597 3300045976 Bacteria 1672
729 Ga0466967_0269145 3300045976 Unclassified 1632
730 Ga0466967_0321827 3300045976 Bacteria 1491
731 Ga0466967_0422456 3300045976 Bacteria 1299
732 Ga0466967_0438329 3300045976 Bacteria 1275
733 Ga0466967_0456325 3300045976 Bacteria 1249
734 Ga0466967_0510898 3300045976 Bacteria 1180
735 Ga0466967_0554244 3300045976 Bacteria 1131
736 Ga0466967_0585203 3300045976 Bacteria 1100
737 Ga0466967_0633144 3300045976 Bacteria 1057
738 Ga0466967_0687998 3300045976 Unclassified 1012
739 Ga0466967_0695874 3300045976 Unclassified 1006
740 Ga0466967_0800958 3300045976 Bacteria 935
741 Ga0466967_1501858 3300045976 Unclassified 671
742 Ga0466967_1617704 3300045976 Bacteria 645
743 Ga0495617_260043 3300046452 Unclassified 534
744 Ga0495592_0000100 3300046454 Bacteria 76535
745 Ga0495592_0074509 3300046454 Bacteria 2466
746 Ga0495592_0090625 3300046454 Bacteria 2193
747 Ga0495592_0150276 3300046454 Bacteria 1611
748 Ga0495592_0201239 3300046454 Bacteria 1344
749 Ga0495592_0392253 3300046454 Bacteria 881
750 Ga0495592_0701395 3300046454 Unclassified 609
751 Ga0495592_0728498 3300046454 Bacteria 594
752 Ga0495603_0030547 3300046455 Bacteria 3244
753 Ga0495603_0576439 3300046455 Bacteria 644
754 Ga0495629_0000667 3300046459 Bacteria 27761
755 Ga0495629_0005062 3300046459 Bacteria 9864
756 Ga0495629_0031510 3300046459 Bacteria 3754
757 Ga0495629_0063722 3300046459 Bacteria 2574
758 Ga0495629_0080940 3300046459 Bacteria 2267
759 Ga0495629_0130586 3300046459 Bacteria 1750
760 Ga0495629_0192111 3300046459 Bacteria 1413
761 Ga0495629_0335252 3300046459 Bacteria 1033
762 Ga0495629_0678619 3300046459 Unclassified 685
763 Ga0495641_0003180 3300046461 Bacteria 12491
764 Ga0495641_0005502 3300046461 Bacteria 8524
765 Ga0495641_0039332 3300046461 Bacteria 2206
766 Ga0495641_0068018 3300046461 Bacteria 1601
767 Ga0495641_0074063 3300046461 Unclassified 1527
768 Ga0495641_0076606 3300046461 Bacteria 1499
769 Ga0495641_0122062 3300046461 Bacteria 1162
770 Ga0495641_0226874 3300046461 Unclassified 838
771 Ga0495651_0000008 3300046462 Bacteria 156989
772 Ga0495651_0024701 3300046462 Bacteria 4674
773 Ga0495651_0064155 3300046462 Bacteria 2807
774 Ga0495651_0104100 3300046462 Bacteria 2108
775 Ga0495651_0135041 3300046462 Bacteria 1796
776 Ga0495651_0335451 3300046462 Bacteria 1003
777 Ga0495651_0397543 3300046462 Bacteria 900
778 Ga0495651_0507511 3300046462 Bacteria 771
779 Ga0495651_0522946 3300046462 Bacteria 757
780 Ga0495653_0000519 3300046463 Bacteria 29635
781 Ga0495653_0065486 3300046463 Bacteria 2735
782 Ga0495653_0066285 3300046463 Bacteria 2716
783 Ga0495653_0084738 3300046463 Bacteria 2333
784 Ga0495653_0093019 3300046463 Bacteria 2200
785 Ga0495653_0103459 3300046463 Bacteria 2059
786 Ga0495653_0148781 3300046463 Bacteria 1638
787 Ga0495653_0151121 3300046463 Bacteria 1622
788 Ga0495653_0250214 3300046463 Unclassified 1176
789 Ga0495653_0352936 3300046463 Unclassified 945
790 Ga0495653_0381350 3300046463 Bacteria 900
791 Ga0495653_0490343 3300046463 Bacteria 767
792 Ga0495653_0943392 3300046463 Bacteria 512
793 Ga0495580_0063144 3300046472 Bacteria 2598
794 Ga0495582_0000092 3300046473 Bacteria 46401
795 Ga0495582_0056850 3300046473 Bacteria 2156
796 Ga0495582_0070506 3300046473 Bacteria 1933
797 Ga0495582_0093688 3300046473 Bacteria 1676
798 Ga0495582_0105173 3300046473 Unclassified 1582
799 Ga0495582_0117201 3300046473 Bacteria 1498
800 Ga0495582_0429202 3300046473 Bacteria 763
801 Ga0495639_0003153 3300046475 Bacteria 7163
802 Ga0495639_0007418 3300046475 Bacteria 4708
803 Ga0495639_0318669 3300046475 Bacteria 777
804 Ga0495639_0477174 3300046475 Bacteria 635
805 Ga0495639_0748755 3300046475 Bacteria 506
806 Ga0495662_0012267 3300046476 Bacteria 4185
807 Ga0495662_0120790 3300046476 Bacteria 1286
808 Ga0495662_0278477 3300046476 Bacteria 823
809 Ga0495662_0280950 3300046476 Bacteria 819
810 Ga0495664_0030604 3300046477 Bacteria 3154
811 Ga0495664_0064893 3300046477 Bacteria 2176
812 Ga0495664_0098386 3300046477 Bacteria 1761
813 Ga0495664_0110290 3300046477 Bacteria 1661
814 Ga0495664_0158970 3300046477 Unclassified 1371
815 Ga0495664_0268154 3300046477 Unclassified 1032
816 Ga0495664_0292659 3300046477 Unclassified 983
817 Ga0495664_0406049 3300046477 Unclassified 818
818 Ga0495664_0684247 3300046477 Unclassified 607
819 Ga0495584_0039698 3300046491 Unclassified 2378
820 Ga0495585_0095454 3300046492 Bacteria 1597
821 Ga0495594_0088830 3300046499 Bacteria 1730
822 Ga0495596_0243238 3300046500 Unclassified 698
823 Ga0495608_0004506 3300046511 Bacteria 9951
824 Ga0495608_0010256 3300046511 Bacteria 6537
825 Ga0495608_0026089 3300046511 Bacteria 3986
826 Ga0495608_0030218 3300046511 Bacteria 3670
827 Ga0495608_0066451 3300046511 Bacteria 2361
828 Ga0495608_0093965 3300046511 Bacteria 1937
829 Ga0495608_0105850 3300046511 Bacteria 1811
830 Ga0495608_0256517 3300046511 Bacteria 1089
831 Ga0495608_0314313 3300046511 Bacteria 968
832 Ga0495618_0001843 3300046514 Bacteria 13974
833 Ga0495618_0047133 3300046514 Bacteria 2721
834 Ga0495618_0075772 3300046514 Bacteria 2143
835 Ga0495618_0175150 3300046514 Bacteria 1364
836 Ga0495618_0272165 3300046514 Bacteria 1058
837 Ga0495618_0421697 3300046514 Bacteria 813
838 Ga0495628_0000016 3300046516 Bacteria 170260
839 Ga0495628_0075298 3300046516 Bacteria 2629
840 Ga0495628_0128098 3300046516 Bacteria 1943
841 Ga0495628_0137338 3300046516 Bacteria 1867
842 Ga0495628_0211095 3300046516 Bacteria 1460
843 Ga0495628_0253597 3300046516 Unclassified 1313
844 Ga0495628_0351612 3300046516 Bacteria 1083
845 Ga0495628_0741717 3300046516 Unclassified 691
846 Ga0495628_0822839 3300046516 Bacteria 648
847 Ga0495628_1053988 3300046516 Unclassified 557
848 Ga0495628_1091268 3300046516 Unclassified 545
849 Ga0495630_0001255 3300046517 Bacteria 17499
850 Ga0495630_0011938 3300046517 Bacteria 6298
851 Ga0495630_0018448 3300046517 Bacteria 5125
852 Ga0495630_0034620 3300046517 Bacteria 3772
853 Ga0495630_0103217 3300046517 Bacteria 2157
854 Ga0495630_0255961 3300046517 Bacteria 1337
855 Ga0495631_0047188 3300046518 Bacteria 1892
856 Ga0495644_0003153 3300046523 Bacteria 6522
857 Ga0495663_0144716 3300046525 Bacteria 808
858 Ga0495666_0007834 3300046526 Bacteria 5350
859 Ga0495666_0016821 3300046526 Bacteria 3641
860 Ga0495666_0366906 3300046526 Unclassified 648
861 Ga0495652_0000888 3300046529 Bacteria 34393
862 Ga0495652_0035652 3300046529 Bacteria 4329
863 Ga0495652_0061327 3300046529 Bacteria 3175
864 Ga0495652_0192981 3300046529 Bacteria 1553
865 Ga0495652_0226915 3300046529 Bacteria 1399
866 Ga0495652_0356934 3300046529 Bacteria 1045
867 Ga0495652_0566117 3300046529 Bacteria 779
868 Ga0495652_0931811 3300046529 Bacteria 571
869 Ga0495665_0000240 3300046531 Bacteria 27586
870 Ga0495665_0041824 3300046531 Bacteria 2439
871 Ga0495665_0526717 3300046531 Unclassified 594
872 Ga0495640_0010703 3300046533 Bacteria 7076
873 Ga0495640_0034913 3300046533 Bacteria 3561
874 Ga0495640_0046670 3300046533 Bacteria 3000
875 Ga0495640_0169420 3300046533 Unclassified 1396
876 Ga0495640_0295070 3300046533 Bacteria 1007
877 Ga0495640_0405365 3300046533 Bacteria 837
878 Ga0495640_0904540 3300046533 Bacteria 523
879 Ga0495640_0965899 3300046533 Unclassified 503
880 Ga0495586_0044281 3300046535 Bacteria 2397
881 Ga0495586_0046997 3300046535 Bacteria 2328
882 Ga0495586_0185110 3300046535 Bacteria 1179
883 Ga0495586_0368421 3300046535 Bacteria 826
884 Ga0495586_0553009 3300046535 Unclassified 664
885 Ga0495587_0000048 3300046536 Bacteria 105358
886 Ga0495587_0015592 3300046536 Bacteria 4740
887 Ga0495587_0049055 3300046536 Bacteria 2500
888 Ga0495587_0093097 3300046536 Bacteria 1740
889 Ga0495587_0109656 3300046536 Bacteria 1586
890 Ga0495587_0307193 3300046536 Unclassified 886
891 Ga0495587_0311931 3300046536 Unclassified 879
892 Ga0495587_0501388 3300046536 Unclassified 671
893 Ga0495587_0841488 3300046536 Unclassified 500
894 Ga0495645_0000029 3300046543 Bacteria 113119
895 Ga0495645_0030615 3300046543 Bacteria 3920
896 Ga0495645_0103512 3300046543 Bacteria 2022
897 Ga0495645_0373793 3300046543 Bacteria 913
898 Ga0495645_0396319 3300046543 Bacteria 880
899 Ga0495645_0521057 3300046543 Bacteria 740
900 Ga0495667_0026239 3300046559 Bacteria 3925
901 Ga0495667_0026269 3300046559 Bacteria 3923
902 Ga0495667_0027749 3300046559 Bacteria 3812
903 Ga0495667_0056684 3300046559 Bacteria 2576
904 Ga0495667_0267931 3300046559 Bacteria 1085
905 Ga0495667_0311123 3300046559 Bacteria 997
906 Ga0495667_0366664 3300046559 Bacteria 909
907 Ga0495667_0384053 3300046559 Bacteria 885
908 Ga0495667_0518108 3300046559 Unclassified 746
909 Ga0495656_0022937 3300046615 Bacteria 2451
910 Ga0495634_0023555 3300046642 Bacteria 4325
911 Ga0495634_0034560 3300046642 Bacteria 3468
912 Ga0495634_0041235 3300046642 Bacteria 3135
913 Ga0495634_0117068 3300046642 Bacteria 1709
914 Ga0495634_0161982 3300046642 Bacteria 1410
915 Ga0495634_0211404 3300046642 Bacteria 1201
916 Ga0495634_0252161 3300046642 Bacteria 1079
917 Ga0495634_0323017 3300046642 Bacteria 929
918 Ga0495634_0433765 3300046642 Unclassified 777
919 Ga0495611_0073931 3300046648 Bacteria 1560
920 Ga0495635_0014662 3300046663 Bacteria 5483
921 Ga0495635_0039170 3300046663 Bacteria 3280
922 Ga0495635_0050923 3300046663 Bacteria 2854
923 Ga0495635_0053636 3300046663 Bacteria 2778
924 Ga0495635_0095244 3300046663 Bacteria 2035
925 Ga0495635_0187792 3300046663 Unclassified 1403
926 Ga0495635_0429771 3300046663 Bacteria 875
927 Ga0495635_0518920 3300046663 Bacteria 783
928 Ga0495659_0102707 3300046664 Bacteria 1109
929 Ga0495661_0366690 3300046665 Bacteria 706
930 Ga0495588_0338886 3300046674 Bacteria 791
931 Ga0495588_0376607 3300046674 Bacteria 745
932 Ga0495588_0583017 3300046674 Unclassified 586
933 Ga0495657_0007230 3300046675 Bacteria 8606
934 Ga0495657_0021009 3300046675 Bacteria 4690
935 Ga0495657_0038643 3300046675 Bacteria 3283
936 Ga0495657_0059590 3300046675 Bacteria 2532
937 Ga0495657_0178276 3300046675 Bacteria 1305
938 Ga0495657_0284889 3300046675 Bacteria 988
939 Ga0495657_0471131 3300046675 Bacteria 734
940 Ga0495657_0596306 3300046675 Unclassified 639
941 Ga0495599_0000181 3300046678 Bacteria 41303
942 Ga0495599_0000985 3300046678 Bacteria 15949
943 Ga0495599_0157339 3300046678 Bacteria 1405
944 Ga0495599_0357594 3300046678 Bacteria 875
945 Ga0495599_0525621 3300046678 Bacteria 694
946 Ga0495599_0619394 3300046678 Unclassified 629
947 Ga0495599_0633811 3300046678 Bacteria 620
948 Ga0495599_0642336 3300046678 Bacteria 615
949 Ga0495623_0000093 3300046679 Bacteria 53441
950 Ga0495623_0055699 3300046679 Bacteria 2491
951 Ga0495623_0234695 3300046679 Unclassified 1039
952 Ga0495623_0559217 3300046679 Bacteria 598
953 Ga0495623_0568759 3300046679 Bacteria 592
954 Ga0495646_0000416 3300046680 Bacteria 22540
955 Ga0495646_0139578 3300046680 Bacteria 1356
956 Ga0495646_0385749 3300046680 Bacteria 730
957 Ga0495646_0472663 3300046680 Bacteria 646
958 Ga0495647_0041503 3300046681 Bacteria 1752
959 Ga0495647_0349367 3300046681 Unclassified 673
960 Ga0495658_0001970 3300046683 Bacteria 10482
961 Ga0495658_0032131 3300046683 Bacteria 2864
962 Ga0495658_0080930 3300046683 Bacteria 1906
963 Ga0495658_0126647 3300046683 Bacteria 1550
964 Ga0495658_0154306 3300046683 Bacteria 1412
965 Ga0495658_0471390 3300046683 Bacteria 802
966 Ga0495658_0952362 3300046683 Unclassified 548
967 Ga0495613_0007818 3300046689 Bacteria 7953
968 Ga0495613_0020548 3300046689 Bacteria 4922
969 Ga0495613_0024524 3300046689 Bacteria 4493
970 Ga0495613_0067682 3300046689 Unclassified 2607
971 Ga0495613_0084573 3300046689 Bacteria 2303
972 Ga0495613_0108603 3300046689 Bacteria 2001
973 Ga0495613_0119614 3300046689 Bacteria 1892
974 Ga0495613_0199743 3300046689 Bacteria 1410
975 Ga0495613_0455306 3300046689 Bacteria 866
976 Ga0495624_0006810 3300046690 Bacteria 8069
977 Ga0495624_0024422 3300046690 Bacteria 3977
978 Ga0495624_0064946 3300046690 Unclassified 2280
979 Ga0495624_0137135 3300046690 Unclassified 1499
980 Ga0495624_0654057 3300046690 Bacteria 625
981 Ga0495670_0083127 3300046691 Bacteria 1633
982 Ga0495589_0027871 3300046794 Bacteria 2855
983 Ga0495600_0009227 3300046809 Bacteria 6086
984 Ga0495600_0017022 3300046809 Bacteria 4620
985 Ga0495600_0058200 3300046809 Bacteria 2524
986 Ga0495600_0192009 3300046809 Bacteria 1313
987 Ga0495600_0198957 3300046809 Bacteria 1287
988 Ga0495600_0232450 3300046809 Bacteria 1177
989 Ga0495600_0625215 3300046809 Bacteria 653
990 Ga0495581_0000519 3300047315 Bacteria 19732
991 Ga0495581_0074341 3300047315 Bacteria 1966
992 Ga0495581_0204409 3300047315 Bacteria 1155
993 Ga0495581_0730711 3300047315 Unclassified 570
994 Ga0495604_0000111 3300047317 Bacteria 68576
995 Ga0495604_0110023 3300047317 Bacteria 2010
996 Ga0495604_0111443 3300047317 Bacteria 1994
997 Ga0495604_0114798 3300047317 Bacteria 1958
998 Ga0495604_0115617 3300047317 Bacteria 1949
999 Ga0495604_0496569 3300047317 Bacteria 792
1000 Ga0495636_0085772 3300047318 Bacteria 1361
1001 Ga0495674_0015045 3300047319 Bacteria 7241
1002 Ga0495674_0050405 3300047319 Bacteria 3673
1003 Ga0495674_0095276 3300047319 Bacteria 2538
1004 Ga0495674_0114665 3300047319 Bacteria 2281
1005 Ga0495674_0543827 3300047319 Bacteria 925
1006 Ga0495674_0648814 3300047319 Unclassified 832
1007 Ga0495674_0912444 3300047319 Bacteria 677
1008 Ga0495676_0000654 3300047321 Bacteria 28845
1009 Ga0495676_0049510 3300047321 Bacteria 3377
1010 Ga0495676_0105804 3300047321 Bacteria 2074
1011 Ga0495676_0135755 3300047321 Bacteria 1769
1012 Ga0495676_0264422 3300047321 Bacteria 1169
1013 Ga0495676_0508044 3300047321 Bacteria 790
1014 Ga0495680_0027258 3300047322 Bacteria 4696
1015 Ga0495680_0028517 3300047322 Bacteria 4576
1016 Ga0495680_0030091 3300047322 Bacteria 4437
1017 Ga0495680_0030642 3300047322 Bacteria 4390
1018 Ga0495680_0077617 3300047322 Bacteria 2515
1019 Ga0495680_0077873 3300047322 Bacteria 2510
1020 Ga0495680_0118572 3300047322 Unclassified 1956
1021 Ga0495680_0161642 3300047322 Bacteria 1626
1022 Ga0495680_0211388 3300047322 Bacteria 1389
1023 Ga0495680_0313048 3300047322 Unclassified 1100
1024 Ga0495680_0611036 3300047322 Bacteria 728
1025 Ga0495680_0862591 3300047322 Unclassified 587
1026 Ga0495680_1091268 3300047322 Bacteria 505
1027 Ga0495675_0000376 3300047444 Bacteria 30923
1028 Ga0495675_0046482 3300047444 Bacteria 2763
1029 Ga0495675_0483918 3300047444 Bacteria 712
1030 Ga0495675_0646251 3300047444 Bacteria 596
1031 Ga0495675_0668898 3300047444 Unclassified 584
1032 Ga0495677_0037427 3300047445 Bacteria 1772
1033 Ga0495679_173980 3300047446 Unclassified 572
1034 Ga0495684_0003775 3300047471 Bacteria 11830
1035 Ga0495684_0013297 3300047471 Bacteria 6345
1036 Ga0495684_0023335 3300047471 Bacteria 4756
1037 Ga0495684_0028408 3300047471 Bacteria 4294
1038 Ga0495684_0044240 3300047471 Bacteria 3409
1039 Ga0495684_0052449 3300047471 Bacteria 3112
1040 Ga0495684_0204253 3300047471 Bacteria 1455
1041 Ga0495684_0252064 3300047471 Bacteria 1284
1042 Ga0495684_0300308 3300047471 Bacteria 1153
1043 Ga0495593_0004272 3300047673 Bacteria 8496
1044 Ga0495593_0018456 3300047673 Bacteria 3918
1045 Ga0495593_0085014 3300047673 Bacteria 1633
1046 Ga0495593_0112051 3300047673 Bacteria 1393
1047 Ga0495593_0460429 3300047673 Bacteria 637
1048 Ga0495602_0000141 3300048088 Bacteria 67940
1049 Ga0495602_0212365 3300048088 Bacteria 1467
1050 Ga0495602_0242841 3300048088 Bacteria 1346
1051 Ga0495602_0325787 3300048088 Bacteria 1116
1052 Ga0495602_0551641 3300048088 Bacteria 799
1053 Ga0495614_0028508 3300048089 Bacteria 2405
1054 Ga0495614_0036948 3300048089 Bacteria 2096
1055 Ga0495614_0219810 3300048089 Bacteria 863
1056 Ga0495614_0222244 3300048089 Bacteria 859
1057 Ga0496100_0012118 3300048903 Bacteria 4932
1058 Ga0496100_0024825 3300048903 Bacteria 3661
1059 Ga0496100_0048882 3300048903 Bacteria 2732
1060 Ga0496100_0122428 3300048903 Bacteria 1822
1061 Ga0496100_0287892 3300048903 Bacteria 1227
1062 Ga0496100_0343375 3300048903 Bacteria 1126
1063 Ga0496100_0755740 3300048903 Bacteria 760
1064 Ga0496100_0860985 3300048903 Unclassified 711
1065 Ga0496100_0935491 3300048903 Unclassified 681
1066 Ga0496101_0015300 3300048904 Bacteria 5167
1067 Ga0496101_0032623 3300048904 Bacteria 3668
1068 Ga0496101_0057452 3300048904 Bacteria 2814
1069 Ga0496101_0103316 3300048904 Bacteria 2136
1070 Ga0496101_0397664 3300048904 Unclassified 1085
1071 Ga0496101_0944657 3300048904 Bacteria 678
1072 Ga0496101_0946826 3300048904 Bacteria 678
1073 Ga0496102_0021142 3300048905 Bacteria 5753
1074 Ga0496102_0043883 3300048905 Bacteria 4055
1075 Ga0496102_0189305 3300048905 Bacteria 1939
1076 Ga0496102_0453253 3300048905 Bacteria 1203
1077 Ga0496102_0704118 3300048905 Bacteria 933
1078 Ga0496102_0942909 3300048905 Bacteria 784
1079 Ga0496102_1018416 3300048905 Bacteria 749
1080 Ga0496102_1782351 3300048905 Bacteria 533
1081 Ga0496103_0041322 3300048906 Bacteria 2835
1082 Ga0496103_0075072 3300048906 Bacteria 2120
1083 Ga0496103_0137162 3300048906 Bacteria 1563
1084 Ga0496104_0008292 3300048907 Bacteria 9229
1085 Ga0496104_0013704 3300048907 Bacteria 7310
1086 Ga0496104_0014178 3300048907 Bacteria 7192
1087 Ga0496104_0029221 3300048907 Bacteria 5113
1088 Ga0496104_0054911 3300048907 Bacteria 3765
1089 Ga0496104_0282156 3300048907 Bacteria 1574
1090 Ga0496104_1064802 3300048907 Bacteria 712
1091 Ga0496104_1443241 3300048907 Bacteria 591
1092 Ga0496105_0003059 3300048908 Bacteria 12294
1093 Ga0496105_0015773 3300048908 Bacteria 6028
1094 Ga0496105_0016329 3300048908 Bacteria 5925
1095 Ga0496105_0172652 3300048908 Bacteria 1772
1096 Ga0496105_0195322 3300048908 Bacteria 1653
1097 Ga0496105_0217102 3300048908 Bacteria 1557
1098 Ga0496105_0361803 3300048908 Bacteria 1157
1099 Ga0496105_0549488 3300048908 Bacteria 901
1100 Ga0496105_1035502 3300048908 Bacteria 612
1101 Ga0496106_0018069 3300048909 Bacteria 5212
1102 Ga0496106_0029410 3300048909 Bacteria 4094
1103 Ga0496106_0046619 3300048909 Bacteria 3259
1104 Ga0496106_0084656 3300048909 Bacteria 2440
1105 Ga0496106_1351980 3300048909 Bacteria 552
1106 Ga0496107_0007631 3300048910 Bacteria 7470
1107 Ga0496107_0027539 3300048910 Bacteria 4035
1108 Ga0496107_0122197 3300048910 Bacteria 1918
1109 Ga0496107_0296799 3300048910 Bacteria 1203
1110 Ga0496107_0367955 3300048910 Unclassified 1069
1111 Ga0496107_0395981 3300048910 Unclassified 1027
1112 Ga0496107_0405575 3300048910 Bacteria 1014
1113 Ga0496107_0409509 3300048910 Bacteria 1008
1114 Ga0496107_0436903 3300048910 Bacteria 973
1115 Ga0496108_0009640 3300048911 Bacteria 7827
1116 Ga0496108_0016952 3300048911 Bacteria 5954
1117 Ga0496108_0211401 3300048911 Bacteria 1684
1118 Ga0496108_0280157 3300048911 Unclassified 1451
1119 Ga0496108_1290412 3300048911 Bacteria 614
1120 Ga0496109_0027557 3300048912 Bacteria 5074
1121 Ga0496109_0103589 3300048912 Bacteria 2641
1122 Ga0496109_0111390 3300048912 Bacteria 2545
1123 Ga0496109_0162050 3300048912 Bacteria 2095
1124 Ga0496109_0223536 3300048912 Bacteria 1771
1125 Ga0496109_0398096 3300048912 Bacteria 1301
1126 Ga0496109_0515020 3300048912 Bacteria 1129
1127 Ga0496109_0916894 3300048912 Bacteria 814
1128 Ga0496109_1213516 3300048912 Unclassified 691
1129 Ga0496110_0017249 3300048913 Bacteria 6039
1130 Ga0496110_0206589 3300048913 Bacteria 1785
1131 Ga0496110_0346168 3300048913 Bacteria 1354
1132 Ga0496110_1737948 3300048913 Bacteria 534
1133 Ga0496110_1747632 3300048913 Unclassified 532
1134 Ga0496111_0123837 3300048914 Bacteria 1910
1135 Ga0496111_0397658 3300048914 Unclassified 1018
1136 Ga0496111_0538422 3300048914 Bacteria 858
1137 Ga0496111_0850908 3300048914 Bacteria 658
1138 Ga0496111_1231207 3300048914 Bacteria 529
1139 Ga0496112_0005626 3300048915 Bacteria 10872
1140 Ga0496112_0014515 3300048915 Bacteria 7315
1141 Ga0496112_0037055 3300048915 Bacteria 4760
1142 Ga0496112_0064033 3300048915 Bacteria 3627
1143 Ga0496112_0122499 3300048915 Bacteria 2571
1144 Ga0496112_0168622 3300048915 Bacteria 2155
1145 Ga0496112_0200579 3300048915 Bacteria 1954
1146 Ga0496112_0264432 3300048915 Bacteria 1669
1147 Ga0496112_0337089 3300048915 Unclassified 1451
1148 Ga0496112_1157015 3300048915 Unclassified 691
1149 Ga0496112_1723691 3300048915 Bacteria 539
1150 Ga0496113_0056253 3300048916 Bacteria 2953
1151 Ga0496113_0105053 3300048916 Bacteria 2192
1152 Ga0496113_0112263 3300048916 Bacteria 2123
1153 Ga0496113_0189462 3300048916 Bacteria 1632
1154 Ga0496113_0324049 3300048916 Bacteria 1235
1155 Ga0496113_0706618 3300048916 Bacteria 804
1156 Ga0496114_0001144 3300048917 Bacteria 20053
1157 Ga0496114_0006596 3300048917 Bacteria 9149
1158 Ga0496114_0030722 3300048917 Bacteria 4420
1159 Ga0496114_0126730 3300048917 Bacteria 2201
1160 Ga0496114_0192363 3300048917 Bacteria 1785
1161 Ga0496114_0452525 3300048917 Bacteria 1137
1162 Ga0496114_0689422 3300048917 Bacteria 896
1163 Ga0496114_0927172 3300048917 Bacteria 753
1164 Ga0496114_0955299 3300048917 Unclassified 739
1165 Ga0496115_0001178 3300048918 Bacteria 18760
1166 Ga0496115_0006785 3300048918 Bacteria 8398
1167 Ga0496115_0032835 3300048918 Bacteria 4097
1168 Ga0496115_0046075 3300048918 Bacteria 3483
1169 Ga0496115_0154873 3300048918 Bacteria 1893
1170 Ga0496115_0216830 3300048918 Archaea 1580
1171 Ga0496115_0597648 3300048918 Unclassified 877
1172 Ga0496115_0664273 3300048918 Unclassified 822
1173 Ga0496115_0980022 3300048918 Bacteria 647
1174 Ga0496115_1271236 3300048918 Unclassified 550
1175 Ga0496120_0382867 3300048923 Unclassified 625
1176 Ga0501031_0004912 3300049568 Bacteria 8688
1177 Ga0501031_0131320 3300049568 Bacteria 1636
1178 Ga0501032_0093297 3300049569 Bacteria 1996
1179 Ga0501033_0476136 3300049570 Bacteria 865
1180 Ga0501033_0515347 3300049570 Bacteria 826
1181 Ga0501034_1099899 3300049571 Bacteria 676
1182 Ga0501036_0007319 3300049572 Bacteria 8990
1183 Ga0501036_0098710 3300049572 Bacteria 2469
1184 Ga0501036_1258108 3300049572 Bacteria 602
1185 Ga0501038_0050348 3300049574 Bacteria 3599
1186 Ga0501039_0002809 3300049575 Bacteria 13012
1187 Ga0501039_0092401 3300049575 Bacteria 2358
1188 Ga0501040_0009765 3300049576 Bacteria 6265
1189 Ga0501040_0129242 3300049576 Bacteria 1775
1190 Ga0501041_0009588 3300049577 Bacteria 5708
1191 Ga0501041_0533215 3300049577 Bacteria 748
1192 Ga0501041_0580469 3300049577 Bacteria 715
1193 Ga0501042_0003743 3300049578 Bacteria 9613
1194 Ga0501042_0048064 3300049578 Bacteria 3042
1195 Ga0501042_0944722 3300049578 Unclassified 628
1196 Ga0501042_1414221 3300049578 Bacteria 507
1197 Ga0501043_0789829 3300049579 Bacteria 687
1198 Ga0501046_0024547 3300049580 Bacteria 4943
1199 Ga0501046_0077652 3300049580 Bacteria 2570
1200 Ga0501048_0004195 3300049582 Bacteria 10986
1201 Ga0501048_0126007 3300049582 Bacteria 1810
1202 Ga0501048_0344306 3300049582 Bacteria 1063
1203 Ga0501067_0010737 3300049583 Bacteria 5066
1204 Ga0501067_0814668 3300049583 Bacteria 526
1205 Ga0501068_0031119 3300049584 Bacteria 3169
1206 Ga0501068_0115318 3300049584 Bacteria 1673
1207 Ga0501068_0704707 3300049584 Bacteria 660
1208 Ga0501069_0106183 3300049585 Bacteria 1596
1209 Ga0501069_0145369 3300049585 Bacteria 1361
1210 Ga0501069_0170556 3300049585 Bacteria 1255
1211 Ga0501070_0017999 3300049586 Bacteria 5929
1212 Ga0501070_0061188 3300049586 Bacteria 3120
1213 Ga0501070_0088379 3300049586 Bacteria 2565
1214 Ga0501071_0017987 3300049587 Bacteria 4887
1215 Ga0501071_0063166 3300049587 Bacteria 2684
1216 Ga0501072_0011062 3300049588 Bacteria 6885
1217 Ga0501072_0012707 3300049588 Bacteria 6438
1218 Ga0501072_0060417 3300049588 Bacteria 2989
1219 Ga0501073_0312073 3300049589 Bacteria 1085
1220 Ga0501074_0078434 3300049590 Bacteria 2370
1221 Ga0501075_0055440 3300049591 Bacteria 2982
1222 Ga0501075_0058833 3300049591 Bacteria 2894
1223 Ga0501075_0118322 3300049591 Unclassified 2015
1224 Ga0501076_0005282 3300049592 Bacteria 9259
1225 Ga0501076_0050246 3300049592 Bacteria 3298
1226 Ga0501076_0056557 3300049592 Bacteria 3114
1227 Ga0501077_0002796 3300049593 Bacteria 10472
1228 Ga0501077_0003681 3300049593 Bacteria 9227
1229 Ga0501077_0258879 3300049593 Bacteria 1107
1230 Ga0501077_0671518 3300049593 Bacteria 666
1231 Ga0501079_0002965 3300049741 Bacteria 12411
1232 Ga0501079_0092329 3300049741 Bacteria 2345
1233 Ga0501080_0102058 3300049742 Bacteria 2661
1234 Ga0501080_0168917 3300049742 Bacteria 2018
1235 Ga0501080_0172016 3300049742 Bacteria 1997
1236 Ga0501080_1664323 3300049742 Bacteria 539
1237 Ga0501081_0005311 3300049743 Bacteria 8308
1238 Ga0501081_0847655 3300049743 Unclassified 688
1239 Ga0501083_0000131 3300049744 Bacteria 51265
1240 Ga0501083_0520658 3300049744 Bacteria 774
1241 Ga0501035_1083399 3300049822 Bacteria 626
1242 Ga0501035_1223997 3300049822 Bacteria 582
1243 Ga0501044_0769356 3300049823 Bacteria 844
1244 Ga0501044_1292640 3300049823 Bacteria 596
1245 Ga0501045_0002356 3300049824 Bacteria 12832
1246 Ga0501045_0050119 3300049824 Bacteria 3045
1247 Ga0501045_0596639 3300049824 Bacteria 818
1248 nmdc:mga05p37_3875_c1 3300050507 Bacteria 17497
1249 nmdc:mga09592_12059_c1 3300050508 Bacteria 7032
1250 nmdc:mga0qj67_138611_c1 3300050509 Bacteria 1972
1251 nmdc:mga0qj67_205247_c1 3300050509 Bacteria 1601
1252 nmdc:mga08y16_109680_c1 3300050511 Bacteria 2873
1253 nmdc:mga0n895_23557_c1 3300050512 Bacteria 5788
1254 nmdc:mga0n895_4184_c1 3300050512 Bacteria 11786
1255 nmdc:mga0n895_531590_c1 3300050512 Bacteria 1183
1256 nmdc:mga0n895_956605_c1 3300050512 Bacteria 839
1257 nmdc:mga0rr50_125363_c1 3300050513 Bacteria 2050
1258 nmdc:mga0rr50_163597_c1 3300050513 Bacteria 1808
1259 nmdc:mga0rr50_199809_c1 3300050513 Bacteria 1642
1260 nmdc:mga08x19_468094_c1 3300050514 Unclassified 888
1261 nmdc:mga0a205_1159908_c1 3300050515 Unclassified 620
1262 nmdc:mga0a205_117449_c1 3300050515 Bacteria 2558
1263 nmdc:mga0a205_174542_c1 3300050515 Bacteria 2045
1264 nmdc:mga0a205_304149_c1 3300050515 Bacteria 1467
1265 Ga0495601_0000206 3300053077 Bacteria 31438
1266 Ga0495601_0007569 3300053077 Bacteria 6375
1267 Ga0495601_0044527 3300053077 Bacteria 2789
1268 Ga0495601_0067955 3300053077 Bacteria 2271
1269 Ga0495601_0077951 3300053077 Bacteria 2122
1270 Ga0495601_0094632 3300053077 Bacteria 1925
1271 Ga0495601_0102784 3300053077 Bacteria 1847
1272 Ga0495601_0239562 3300053077 Bacteria 1184
1273 Ga0495601_0325312 3300053077 Bacteria 1001
1274 Ga0495601_0338170 3300053077 Bacteria 979
1275 Ga0495601_0362644 3300053077 Bacteria 941
1276 Ga0495612_0019918 3300053078 Bacteria 2688
1277 Ga0495612_0109319 3300053078 Unclassified 1182
1278 Ga0495612_0150435 3300053078 Bacteria 1013
1279 Ga0495612_0239745 3300053078 Unclassified 805
1280 Ga0495612_0267616 3300053078 Bacteria 762
1281 Ga0495612_0386726 3300053078 Bacteria 634
1282 Ga0495655_0015472 3300053083 Bacteria 1622
1283 Ga0495595_0005153 3300053084 Bacteria 5281
1284 Ga0495595_0006129 3300053084 Bacteria 4887
1285 Ga0495595_0016554 3300053084 Bacteria 3157
1286 Ga0495595_0017171 3300053084 Bacteria 3111
1287 Ga0495595_0058217 3300053084 Bacteria 1804
1288 Ga0495595_0169953 3300053084 Bacteria 1079
1289 Ga0495595_0171579 3300053084 Bacteria 1073
1290 Ga0495595_0292696 3300053084 Unclassified 818
1291 Ga0495595_0598410 3300053084 Bacteria 564
1292 Ga0495619_0000291 3300053085 Bacteria 35704
1293 Ga0495619_0006747 3300053085 Bacteria 7262
1294 Ga0495619_0007034 3300053085 Bacteria 7119
1295 Ga0495619_0019582 3300053085 Bacteria 4303
1296 Ga0495619_0021257 3300053085 Bacteria 4140
1297 Ga0495619_0024149 3300053085 Bacteria 3898
1298 Ga0495619_0034560 3300053085 Bacteria 3287
1299 Ga0495619_0062641 3300053085 Bacteria 2476
1300 Ga0495619_0065601 3300053085 Bacteria 2422
1301 Ga0495619_0096594 3300053085 Unclassified 2006
1302 Ga0495619_0206395 3300053085 Bacteria 1360
1303 Ga0495619_0869731 3300053085 Unclassified 607
1304 Ga0500566_0024712 3300053094 Bacteria 3525
1305 Ga0501084_0021299 3300054114 Bacteria 5403
1306 Ga0501084_0113520 3300054114 Bacteria 2277
1307 Ga0501084_1081865 3300054114 Bacteria 673
1308 Ga0590074_008830 3300059423 Bacteria 1678
1309 Ga0587082_090023 3300059504 Bacteria 653
1310 Ga0501082_0011995 3300060353 Bacteria 7452
1311 Ga0501082_0087247 3300060353 Bacteria 2692
1312 Ga0501082_0194891 3300060353 Bacteria 1762
1313 Ga0466962_0005398 3300061719 Bacteria 6147
1314 Ga0466962_0012746 3300061719 Bacteria 4044
1315 Ga0466962_0055714 3300061719 Bacteria 1889
1316 Ga0466962_0063658 3300061719 Bacteria 1761
1317 Ga0466962_0378956 3300061719 Bacteria 706
1318 Ga0466962_0403782 3300061719 Bacteria 684
1319 Ga0530510_0004716 3300061734 Bacteria 9432
1320 Ga0530510_0027300 3300061734 Bacteria 4091

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0092401 Ga0501039_0092401_561_845 94
2 3300049577 Ga0501041_0533215 Ga0501041_0533215_78_371 97
3 3300005367 Ga0070667_100032104 Ga0070667_1000321043 98
4 3300005435 Ga0070714_100080598 Ga0070714_1000805982 98
5 3300005435 Ga0070714_100501286 Ga0070714_1005012862 98
6 3300005435 Ga0070714_101359164 Ga0070714_1013591642 98
7 3300005456 Ga0070678_101620687 Ga0070678_1016206871 98
8 3300005842 Ga0068858_101349445 Ga0068858_1013494452 98
9 3300006173 Ga0070716_100037357 Ga0070716_1000373572 98
10 3300006175 Ga0070712_100936583 Ga0070712_1009365832 98
11 3300006914 Ga0075436_100615087 Ga0075436_1006150872 98
12 3300009093 Ga0105240_12331792 Ga0105240_123317922 98
13 3300009176 Ga0105242_10889415 Ga0105242_108894152 98
14 3300013104 Ga0157370_10335866 Ga0157370_103358662 98
15 3300013105 Ga0157369_10041923 Ga0157369_100419235 98
16 3300013307 Ga0157372_10502336 Ga0157372_105023362 98
17 3300014497 Ga0182008_10188112 Ga0182008_101881121 98
18 3300014497 Ga0182008_10273259 Ga0182008_102732591 98
19 3300014497 Ga0182008_10649296 Ga0182008_106492962 98
20 3300015261 Ga0182006_1120070 Ga0182006_11200701 98
21 3300025906 Ga0207699_10940605 Ga0207699_109406052 98
22 3300025915 Ga0207693_10320995 Ga0207693_103209951 98
23 3300025915 Ga0207693_10611351 Ga0207693_106113511 98
24 3300025929 Ga0207664_10123757 Ga0207664_101237572 98
25 3300025929 Ga0207664_10207810 Ga0207664_102078102 98
26 3300025929 Ga0207664_10959429 Ga0207664_109594292 98
27 3300025934 Ga0207686_10954620 Ga0207686_109546202 98
28 3300025939 Ga0207665_10083470 Ga0207665_100834702 98
29 3300025986 Ga0207658_10029790 Ga0207658_100297903 98
30 3300028654 Ga0265322_10014394 Ga0265322_100143942 98
31 3300028800 Ga0265338_10025999 Ga0265338_100259992 98
32 3300028800 Ga0265338_10068567 Ga0265338_100685674 98
33 3300028800 Ga0265338_10773822 Ga0265338_107738221 98
34 3300028800 Ga0265338_10959841 Ga0265338_109598411 98
35 3300031241 Ga0265325_10107490 Ga0265325_101074902 98
36 3300031241 Ga0265325_10142147 Ga0265325_101421471 98
37 3300031249 Ga0265339_10005030 Ga0265339_100050302 98
38 3300031250 Ga0265331_10085464 Ga0265331_100854642 98
39 3300031344 Ga0265316_10033976 Ga0265316_100339763 98
40 3300031344 Ga0265316_10225392 Ga0265316_102253922 98
41 3300031595 Ga0265313_10049717 Ga0265313_100497172 98
42 3300031711 Ga0265314_10010464 Ga0265314_100104643 98
43 3300031711 Ga0265314_10137449 Ga0265314_101374492 98
44 3300031711 Ga0265314_10271340 Ga0265314_102713402 98
45 3300031712 Ga0265342_10073784 Ga0265342_100737842 98
46 3300035113 Ga0373936_0140890 Ga0373936_0140890_264_560 98
47 3300035171 Ga0373946_0626734 Ga0373946_0626734_27_329 98
48 3300037068 Ga0373925_1638164 Ga0373925_1638164_83_379 98
49 3300037418 Ga0395900_0214691 Ga0395900_0214691_1612_1908 98
50 3300037466 Ga0395898_0826693 Ga0395898_0826693_548_844 98
51 3300038443 Ga0395901_0049114 Ga0395901_0049114_367_663 98
52 3300039438 Ga0436360_0619128 Ga0436360_0619128_4416_4712 98
53 3300039453 Ga0436362_0697180 Ga0436362_0697180_989_1285 98
54 3300042157 Ga0439458_0060306 Ga0439458_0060306_171_467 98
55 3300044694 Ga0466963_0821348 Ga0466963_0821348_62_358 98
56 3300044706 Ga0466964_0188140 Ga0466964_0188140_530_826 98
57 3300044719 Ga0466971_0101119 Ga0466971_0101119_832_1128 98
58 3300044735 Ga0466968_0047422 Ga0466968_0047422_810_1106 98
59 3300044735 Ga0466968_0076026 Ga0466968_0076026_738_1034 98
60 3300045976 Ga0466967_0003528 Ga0466967_0003528_1070_1366 98
61 3300045976 Ga0466967_0456325 Ga0466967_0456325_589_885 98
62 3300046462 Ga0495651_0507511 Ga0495651_0507511_153_449 98
63 3300046463 Ga0495653_0490343 Ga0495653_0490343_338_634 98
64 3300046511 Ga0495608_0314313 Ga0495608_0314313_99_395 98
65 3300046529 Ga0495652_0931811 Ga0495652_0931811_181_477 98
66 3300046543 Ga0495645_0373793 Ga0495645_0373793_426_722 98
67 3300046559 Ga0495667_0384053 Ga0495667_0384053_344_640 98
68 3300046615 Ga0495656_0022937 Ga0495656_0022937_118_414 98
69 3300046679 Ga0495623_0568759 Ga0495623_0568759_152_448 98
70 3300046809 Ga0495600_0232450 Ga0495600_0232450_130_426 98
71 3300047444 Ga0495675_0668898 Ga0495675_0668898_64_360 98
72 3300048088 Ga0495602_0325787 Ga0495602_0325787_135_431 98
73 3300048905 Ga0496102_1782351 Ga0496102_1782351_84_380 98
74 3300053077 Ga0495601_0067955 Ga0495601_0067955_447_743 98
75 3300005327 Ga0070658_10009784 Ga0070658_100097849 99
76 3300005327 Ga0070658_10305038 Ga0070658_103050382 99
77 3300005327 Ga0070658_10339448 Ga0070658_103394481 99
78 3300005327 Ga0070658_10565127 Ga0070658_105651272 99
79 3300005327 Ga0070658_10634156 Ga0070658_106341562 99
80 3300005329 Ga0070683_100011542 Ga0070683_10001154210 99
81 3300005329 Ga0070683_100177587 Ga0070683_1001775872 99
82 3300005329 Ga0070683_100401656 Ga0070683_1004016561 99
83 3300005336 Ga0070680_100294284 Ga0070680_1002942842 99
84 3300005336 Ga0070680_101995996 Ga0070680_1019959961 99
85 3300005337 Ga0070682_100665680 Ga0070682_1006656803 99
86 3300005338 Ga0068868_100871422 Ga0068868_1008714222 99
87 3300005339 Ga0070660_100032187 Ga0070660_1000321873 99
88 3300005339 Ga0070660_100035529 Ga0070660_1000355295 99
89 3300005341 Ga0070691_10389373 Ga0070691_103893732 99
90 3300005344 Ga0070661_100157128 Ga0070661_1001571285 99
91 3300005344 Ga0070661_101698634 Ga0070661_1016986341 99
92 3300005355 Ga0070671_101121643 Ga0070671_1011216432 99
93 3300005434 Ga0070709_10008061 Ga0070709_100080615 99
94 3300005434 Ga0070709_10485473 Ga0070709_104854731 99
95 3300005434 Ga0070709_10776855 Ga0070709_107768551 99
96 3300005435 Ga0070714_100007174 Ga0070714_1000071742 99
97 3300005435 Ga0070714_100039377 Ga0070714_1000393772 99
98 3300005435 Ga0070714_100092793 Ga0070714_1000927932 99
99 3300005435 Ga0070714_100103922 Ga0070714_1001039223 99
100 3300005435 Ga0070714_101127655 Ga0070714_1011276551 99
101 3300005435 Ga0070714_101718812 Ga0070714_1017188121 99
102 3300005436 Ga0070713_100035621 Ga0070713_1000356212 99
103 3300005436 Ga0070713_100378505 Ga0070713_1003785052 99
104 3300005436 Ga0070713_101583613 Ga0070713_1015836131 99
105 3300005436 Ga0070713_101910026 Ga0070713_1019100261 99
106 3300005437 Ga0070710_10024166 Ga0070710_100241662 99
107 3300005437 Ga0070710_10300219 Ga0070710_103002192 99
108 3300005439 Ga0070711_100018154 Ga0070711_1000181542 99
109 3300005439 Ga0070711_100726213 Ga0070711_1007262131 99
110 3300005439 Ga0070711_101598403 Ga0070711_1015984031 99
111 3300005439 Ga0070711_101797280 Ga0070711_1017972802 99
112 3300005440 Ga0070705_100257240 Ga0070705_1002572402 99
113 3300005445 Ga0070708_100311090 Ga0070708_1003110902 99
114 3300005455 Ga0070663_100553485 Ga0070663_1005534852 99
115 3300005456 Ga0070678_100392242 Ga0070678_1003922422 99
116 3300005458 Ga0070681_10085532 Ga0070681_100855323 99
117 3300005458 Ga0070681_10166831 Ga0070681_101668313 99
118 3300005458 Ga0070681_10176918 Ga0070681_101769182 99
119 3300005458 Ga0070681_10292105 Ga0070681_102921052 99
120 3300005458 Ga0070681_10606519 Ga0070681_106065192 99
121 3300005467 Ga0070706_100221090 Ga0070706_1002210902 99
122 3300005468 Ga0070707_100161731 Ga0070707_1001617312 99
123 3300005468 Ga0070707_100282257 Ga0070707_1002822574 99
124 3300005468 Ga0070707_100652507 Ga0070707_1006525072 99
125 3300005507 Ga0074259_11690746 Ga0074259_116907461 99
126 3300005518 Ga0070699_100584377 Ga0070699_1005843772 99
127 3300005530 Ga0070679_100029725 Ga0070679_1000297253 99
128 3300005530 Ga0070679_100061702 Ga0070679_1000617022 99
129 3300005530 Ga0070679_100072428 Ga0070679_1000724284 99
130 3300005530 Ga0070679_100745932 Ga0070679_1007459322 99
131 3300005535 Ga0070684_100043652 Ga0070684_1000436523 99
132 3300005535 Ga0070684_100098286 Ga0070684_1000982862 99
133 3300005535 Ga0070684_100453084 Ga0070684_1004530842 99
134 3300005535 Ga0070684_100898388 Ga0070684_1008983882 99
135 3300005536 Ga0070697_100633399 Ga0070697_1006333992 99
136 3300005546 Ga0070696_100527819 Ga0070696_1005278191 99
137 3300005546 Ga0070696_101144348 Ga0070696_1011443482 99
138 3300005546 Ga0070696_101263241 Ga0070696_1012632411 99
139 3300005546 Ga0070696_101386229 Ga0070696_1013862291 99
140 3300005546 Ga0070696_101929023 Ga0070696_1019290231 99
141 3300005547 Ga0070693_101226327 Ga0070693_1012263272 99
142 3300005563 Ga0068855_100025372 Ga0068855_1000253727 99
143 3300005563 Ga0068855_100160460 Ga0068855_1001604604 99
144 3300005563 Ga0068855_100282963 Ga0068855_1002829632 99
145 3300005563 Ga0068855_100445613 Ga0068855_1004456131 99
146 3300005614 Ga0068856_100280234 Ga0068856_1002802342 99
147 3300005614 Ga0068856_101078500 Ga0068856_1010785002 99
148 3300005616 Ga0068852_100523954 Ga0068852_1005239542 99
149 3300005937 Ga0081455_10035488 Ga0081455_100354885 99
150 3300005937 Ga0081455_10086671 Ga0081455_100866712 99
151 3300005937 Ga0081455_10138886 Ga0081455_101388862 99
152 3300005981 Ga0081538_10000136 Ga0081538_1000013672 99
153 3300005981 Ga0081538_10002521 Ga0081538_1000252113 99
154 3300005981 Ga0081538_10003973 Ga0081538_100039738 99
155 3300005981 Ga0081538_10022124 Ga0081538_100221244 99
156 3300005981 Ga0081538_10073298 Ga0081538_100732983 99
157 3300005981 Ga0081538_10151814 Ga0081538_101518142 99
158 3300006028 Ga0070717_10032992 Ga0070717_100329922 99
159 3300006028 Ga0070717_10406965 Ga0070717_104069652 99
160 3300006058 Ga0075432_10522035 Ga0075432_105220351 99
161 3300006163 Ga0070715_10007615 Ga0070715_100076154 99
162 3300006163 Ga0070715_10131537 Ga0070715_101315372 99
163 3300006173 Ga0070716_100017489 Ga0070716_1000174893 99
164 3300006175 Ga0070712_100156081 Ga0070712_1001560812 99
165 3300006175 Ga0070712_100503055 Ga0070712_1005030552 99
166 3300006175 Ga0070712_100914191 Ga0070712_1009141912 99
167 3300006175 Ga0070712_101570089 Ga0070712_1015700892 99
168 3300006175 Ga0070712_101661480 Ga0070712_1016614802 99
169 3300006175 Ga0070712_102044087 Ga0070712_1020440872 99
170 3300006358 Ga0068871_101511748 Ga0068871_1015117481 99
171 3300006844 Ga0075428_100005458 Ga0075428_10000545819 99
172 3300006846 Ga0075430_100012449 Ga0075430_1000124491 99
173 3300006846 Ga0075430_100394958 Ga0075430_1003949582 99
174 3300006846 Ga0075430_100476674 Ga0075430_1004766741 99
175 3300006847 Ga0075431_100136071 Ga0075431_1001360712 99
176 3300006852 Ga0075433_10101468 Ga0075433_101014682 99
177 3300006852 Ga0075433_10257125 Ga0075433_102571252 99
178 3300006871 Ga0075434_100010946 Ga0075434_1000109463 99
179 3300006880 Ga0075429_100078876 Ga0075429_1000788761 99
180 3300006881 Ga0068865_101805519 Ga0068865_1018055192 99
181 3300007076 Ga0075435_100003008 Ga0075435_1000030084 99
182 3300007076 Ga0075435_100454256 Ga0075435_1004542562 99
183 3300009093 Ga0105240_10054502 Ga0105240_100545024 99
184 3300009093 Ga0105240_10066947 Ga0105240_100669472 99
185 3300009093 Ga0105240_10860947 Ga0105240_108609472 99
186 3300009098 Ga0105245_11161206 Ga0105245_111612062 99
187 3300009098 Ga0105245_12399254 Ga0105245_123992541 99
188 3300009098 Ga0105245_12995518 Ga0105245_129955181 99
189 3300009101 Ga0105247_10169823 Ga0105247_101698232 99
190 3300009147 Ga0114129_10022016 Ga0114129_100220168 99
191 3300009147 Ga0114129_10598709 Ga0114129_105987092 99
192 3300009148 Ga0105243_10587447 Ga0105243_105874472 99
193 3300009148 Ga0105243_11105485 Ga0105243_111054852 99
194 3300009148 Ga0105243_11240711 Ga0105243_112407112 99
195 3300009174 Ga0105241_11226215 Ga0105241_112262152 99
196 3300009176 Ga0105242_12800503 Ga0105242_128005031 99
197 3300009177 Ga0105248_10130632 Ga0105248_101306324 99
198 3300009177 Ga0105248_10879500 Ga0105248_108795002 99
199 3300009177 Ga0105248_10994834 Ga0105248_109948342 99
200 3300009545 Ga0105237_10215146 Ga0105237_102151461 99
201 3300009545 Ga0105237_11074173 Ga0105237_110741732 99
202 3300009551 Ga0105238_10966951 Ga0105238_109669512 99
203 3300013100 Ga0157373_10255286 Ga0157373_102552861 99
204 3300013100 Ga0157373_10632601 Ga0157373_106326012 99
205 3300013104 Ga0157370_10039274 Ga0157370_100392748 99
206 3300013104 Ga0157370_10213877 Ga0157370_102138772 99
207 3300013104 Ga0157370_10290393 Ga0157370_102903932 99
208 3300013105 Ga0157369_10001204 Ga0157369_1000120426 99
209 3300013105 Ga0157369_10001856 Ga0157369_1000185611 99
210 3300013105 Ga0157369_10341214 Ga0157369_103412142 99
211 3300013105 Ga0157369_10383000 Ga0157369_103830004 99
212 3300013105 Ga0157369_10737077 Ga0157369_107370772 99
213 3300013105 Ga0157369_12007803 Ga0157369_120078032 99
214 3300013105 Ga0157369_12527197 Ga0157369_125271972 99
215 3300013296 Ga0157374_10011973 Ga0157374_100119738 99
216 3300013307 Ga0157372_10068866 Ga0157372_100688668 99
217 3300013307 Ga0157372_10247741 Ga0157372_102477412 99
218 3300013307 Ga0157372_11301278 Ga0157372_113012782 99
219 3300013307 Ga0157372_11717117 Ga0157372_117171171 99
220 3300013308 Ga0157375_10435797 Ga0157375_104357972 99
221 3300014969 Ga0157376_10754402 Ga0157376_107544021 99
222 3300014969 Ga0157376_11600648 Ga0157376_116006482 99
223 3300015261 Ga0182006_1239470 Ga0182006_12394701 99
224 3300015262 Ga0182007_10110101 Ga0182007_101101012 99
225 3300020069 Ga0197907_10563710 Ga0197907_105637101 99
226 3300020069 Ga0197907_10573604 Ga0197907_105736041 99
227 3300020069 Ga0197907_11227556 Ga0197907_112275563 99
228 3300020070 Ga0206356_10180444 Ga0206356_101804441 99
229 3300020070 Ga0206356_11012638 Ga0206356_110126382 99
230 3300020070 Ga0206356_11222836 Ga0206356_112228361 99
231 3300020080 Ga0206350_10267790 Ga0206350_102677902 99
232 3300020081 Ga0206354_10674964 Ga0206354_106749642 99
233 3300020081 Ga0206354_10881760 Ga0206354_108817603 99
234 3300020081 Ga0206354_11142272 Ga0206354_111422722 99
235 3300020081 Ga0206354_11636654 Ga0206354_116366545 99
236 3300020082 Ga0206353_10140028 Ga0206353_101400282 99
237 3300020082 Ga0206353_10352402 Ga0206353_103524021 99
238 3300020082 Ga0206353_10406529 Ga0206353_104065292 99
239 3300020082 Ga0206353_10671973 Ga0206353_106719731 99
240 3300020082 Ga0206353_10888588 Ga0206353_108885882 99
241 3300020082 Ga0206353_12069808 Ga0206353_120698082 99
242 3300021377 Ga0213874_10083297 Ga0213874_100832972 99
243 3300021377 Ga0213874_10158799 Ga0213874_101587991 99
244 3300021441 Ga0213871_10017618 Ga0213871_100176182 99
245 3300022467 Ga0224712_10059960 Ga0224712_100599602 99
246 3300022467 Ga0224712_10110483 Ga0224712_101104832 99
247 3300022467 Ga0224712_10136576 Ga0224712_101365761 99
248 3300022467 Ga0224712_10224282 Ga0224712_102242822 99
249 3300022467 Ga0224712_10538266 Ga0224712_105382661 99
250 3300025898 Ga0207692_10124605 Ga0207692_101246052 99
251 3300025905 Ga0207685_10013868 Ga0207685_100138683 99
252 3300025905 Ga0207685_10023347 Ga0207685_100233472 99
253 3300025906 Ga0207699_10025181 Ga0207699_100251813 99
254 3300025906 Ga0207699_11128984 Ga0207699_111289842 99
255 3300025909 Ga0207705_10082159 Ga0207705_100821592 99
256 3300025909 Ga0207705_10084653 Ga0207705_100846532 99
257 3300025909 Ga0207705_10090781 Ga0207705_100907812 99
258 3300025909 Ga0207705_10397528 Ga0207705_103975282 99
259 3300025909 Ga0207705_10744811 Ga0207705_107448111 99
260 3300025910 Ga0207684_10275077 Ga0207684_102750771 99
261 3300025911 Ga0207654_11073131 Ga0207654_110731311 99
262 3300025912 Ga0207707_10056416 Ga0207707_100564162 99
263 3300025912 Ga0207707_10186119 Ga0207707_101861192 99
264 3300025912 Ga0207707_10297386 Ga0207707_102973862 99
265 3300025912 Ga0207707_10465017 Ga0207707_104650172 99
266 3300025913 Ga0207695_10168500 Ga0207695_101685002 99
267 3300025913 Ga0207695_10315240 Ga0207695_103152402 99
268 3300025913 Ga0207695_11675251 Ga0207695_116752511 99
269 3300025915 Ga0207693_10000662 Ga0207693_100006623 99
270 3300025915 Ga0207693_10066752 Ga0207693_100667522 99
271 3300025916 Ga0207663_10019788 Ga0207663_100197882 99
272 3300025916 Ga0207663_10078640 Ga0207663_100786401 99
273 3300025916 Ga0207663_10606594 Ga0207663_106065941 99
274 3300025917 Ga0207660_10044524 Ga0207660_100445243 99
275 3300025917 Ga0207660_10415356 Ga0207660_104153564 99
276 3300025919 Ga0207657_10003274 Ga0207657_1000327422 99
277 3300025919 Ga0207657_10024996 Ga0207657_100249968 99
278 3300025921 Ga0207652_10080760 Ga0207652_100807602 99
279 3300025921 Ga0207652_10161630 Ga0207652_101616304 99
280 3300025921 Ga0207652_10296911 Ga0207652_102969112 99
281 3300025921 Ga0207652_10954362 Ga0207652_109543622 99
282 3300025921 Ga0207652_11782320 Ga0207652_117823201 99
283 3300025922 Ga0207646_10152685 Ga0207646_101526852 99
284 3300025922 Ga0207646_10167966 Ga0207646_101679662 99
285 3300025922 Ga0207646_10221549 Ga0207646_102215495 99
286 3300025922 Ga0207646_10352759 Ga0207646_103527592 99
287 3300025922 Ga0207646_10499880 Ga0207646_104998801 99
288 3300025922 Ga0207646_11421640 Ga0207646_114216401 99
289 3300025924 Ga0207694_10681832 Ga0207694_106818322 99
290 3300025926 Ga0207659_11653207 Ga0207659_116532072 99
291 3300025927 Ga0207687_10414732 Ga0207687_104147321 99
292 3300025928 Ga0207700_10025409 Ga0207700_100254094 99
293 3300025928 Ga0207700_10061830 Ga0207700_100618304 99
294 3300025929 Ga0207664_10014583 Ga0207664_100145833 99
295 3300025929 Ga0207664_10026349 Ga0207664_100263492 99
296 3300025929 Ga0207664_10028163 Ga0207664_100281632 99
297 3300025929 Ga0207664_10061691 Ga0207664_100616913 99
298 3300025929 Ga0207664_10097421 Ga0207664_100974215 99
299 3300025929 Ga0207664_10253589 Ga0207664_102535892 99
300 3300025929 Ga0207664_10391355 Ga0207664_103913552 99
301 3300025931 Ga0207644_10529689 Ga0207644_105296892 99
302 3300025939 Ga0207665_10000060 Ga0207665_1000006071 99
303 3300025941 Ga0207711_10309641 Ga0207711_103096413 99
304 3300025941 Ga0207711_11791992 Ga0207711_117919922 99
305 3300025944 Ga0207661_10049224 Ga0207661_100492241 99
306 3300025944 Ga0207661_10063029 Ga0207661_100630292 99
307 3300025944 Ga0207661_10803706 Ga0207661_108037062 99
308 3300025949 Ga0207667_10090118 Ga0207667_100901182 99
309 3300025949 Ga0207667_10238939 Ga0207667_102389394 99
310 3300025949 Ga0207667_10301062 Ga0207667_103010622 99
311 3300025949 Ga0207667_10303491 Ga0207667_103034912 99
312 3300025981 Ga0207640_10892426 Ga0207640_108924261 99
313 3300026067 Ga0207678_10237400 Ga0207678_102374001 99
314 3300026078 Ga0207702_10206357 Ga0207702_102063572 99
315 3300026089 Ga0207648_12060857 Ga0207648_120608571 99
316 3300026116 Ga0207674_11967398 Ga0207674_119673982 99
317 3300028556 Ga0265337_1148993 Ga0265337_11489932 99
318 3300028563 Ga0265319_1021907 Ga0265319_10219072 99
319 3300028573 Ga0265334_10042042 Ga0265334_100420422 99
320 3300028577 Ga0265318_10083349 Ga0265318_100833491 99
321 3300028666 Ga0265336_10003451 Ga0265336_100034513 99
322 3300028666 Ga0265336_10083432 Ga0265336_100834322 99
323 3300028666 Ga0265336_10113993 Ga0265336_101139932 99
324 3300028800 Ga0265338_10010298 Ga0265338_1001029813 99
325 3300028800 Ga0265338_10010986 Ga0265338_1001098615 99
326 3300028800 Ga0265338_10013097 Ga0265338_100130975 99
327 3300028800 Ga0265338_10032561 Ga0265338_100325613 99
328 3300028800 Ga0265338_10113504 Ga0265338_101135042 99
329 3300028800 Ga0265338_10121449 Ga0265338_101214492 99
330 3300028800 Ga0265338_10672344 Ga0265338_106723442 99
331 3300029957 Ga0265324_10005245 Ga0265324_100052456 99
332 3300031238 Ga0265332_10073266 Ga0265332_100732663 99
333 3300031240 Ga0265320_10410787 Ga0265320_104107871 99
334 3300031241 Ga0265325_10004773 Ga0265325_100047735 99
335 3300031242 Ga0265329_10092500 Ga0265329_100925002 99
336 3300031247 Ga0265340_10012880 Ga0265340_100128804 99
337 3300031249 Ga0265339_10008194 Ga0265339_100081942 99
338 3300031250 Ga0265331_10045657 Ga0265331_100456572 99
339 3300031250 Ga0265331_10078835 Ga0265331_100788352 99
340 3300031251 Ga0265327_10007271 Ga0265327_100072712 99
341 3300031251 Ga0265327_10014976 Ga0265327_100149763 99
342 3300031251 Ga0265327_10276733 Ga0265327_102767332 99
343 3300031344 Ga0265316_10006806 Ga0265316_100068062 99
344 3300031344 Ga0265316_10487357 Ga0265316_104873572 99
345 3300031344 Ga0265316_10862831 Ga0265316_108628311 99
346 3300031595 Ga0265313_10007875 Ga0265313_100078752 99
347 3300031595 Ga0265313_10024527 Ga0265313_100245276 99
348 3300031595 Ga0265313_10196071 Ga0265313_101960711 99
349 3300031711 Ga0265314_10002229 Ga0265314_1000222917 99
350 3300031712 Ga0265342_10021386 Ga0265342_100213862 99
351 3300035083 Ga0373926_0018093 Ga0373926_0018093_1685_1984 99
352 3300035083 Ga0373926_0085770 Ga0373926_0085770_176_481 99
353 3300035086 Ga0373934_0078178 Ga0373934_0078178_259_561 99
354 3300035112 Ga0373932_0192377 Ga0373932_0192377_246_545 99
355 3300035113 Ga0373936_0019580 Ga0373936_0019580_1760_2059 99
356 3300035113 Ga0373936_0085998 Ga0373936_0085998_319_618 99
357 3300035114 Ga0373939_0254143 Ga0373939_0254143_360_659 99
358 3300035115 Ga0373941_0166999 Ga0373941_0166999_229_528 99
359 3300035116 Ga0373945_0058790 Ga0373945_0058790_819_1118 99
360 3300035116 Ga0373945_0112213 Ga0373945_0112213_633_932 99
361 3300035117 Ga0373953_0122497 Ga0373953_0122497_273_575 99
362 3300035118 Ga0373954_0382235 Ga0373954_0382235_120_419 99
363 3300035119 Ga0373956_0025909 Ga0373956_0025909_1871_2170 99
364 3300035120 Ga0373957_0138521 Ga0373957_0138521_263_562 99
365 3300035120 Ga0373957_0267979 Ga0373957_0267979_367_666 99
366 3300035170 Ga0373943_0003688 Ga0373943_0003688_3095_3394 99
367 3300035170 Ga0373943_0006524 Ga0373943_0006524_2480_2779 99
368 3300035170 Ga0373943_0034614 Ga0373943_0034614_484_789 99
369 3300035171 Ga0373946_0010006 Ga0373946_0010006_1807_2106 99
370 3300035172 Ga0373955_0026369 Ga0373955_0026369_438_737 99
371 3300035172 Ga0373955_0272335 Ga0373955_0272335_120_419 99
372 3300035172 Ga0373955_0356109 Ga0373955_0356109_521_820 99
373 3300035410 Ga0373924_0043377 Ga0373924_0043377_1069_1368 99
374 3300035410 Ga0373924_0345030 Ga0373924_0345030_115_417 99
375 3300035692 Ga0373935_0098532 Ga0373935_0098532_1143_1448 99
376 3300035692 Ga0373935_0395626 Ga0373935_0395626_628_927 99
377 3300035692 Ga0373935_0862485 Ga0373935_0862485_242_541 99
378 3300035695 Ga0373927_0073735 Ga0373927_0073735_1586_1885 99
379 3300035695 Ga0373927_0390711 Ga0373927_0390711_343_648 99
380 3300035725 Ga0373947_0002320 Ga0373947_0002320_9658_9957 99
381 3300035725 Ga0373947_0017658 Ga0373947_0017658_2175_2480 99
382 3300035725 Ga0373947_0018889 Ga0373947_0018889_1292_1591 99
383 3300036401 Ga0373937_0030625 Ga0373937_0030625_1898_2197 99
384 3300036401 Ga0373937_0128957 Ga0373937_0128957_1219_1521 99
385 3300036401 Ga0373937_0531415 Ga0373937_0531415_291_590 99
386 3300036401 Ga0373937_1820637 Ga0373937_1820637_188_487 99
387 3300037068 Ga0373925_0010642 Ga0373925_0010642_1744_2043 99
388 3300037068 Ga0373925_0020725 Ga0373925_0020725_4212_4517 99
389 3300037068 Ga0373925_0033843 Ga0373925_0033843_1413_1712 99
390 3300037312 Ga0395899_0015072 Ga0395899_0015072_2998_3297 99
391 3300037312 Ga0395899_0064381 Ga0395899_0064381_216_515 99
392 3300037418 Ga0395900_0021178 Ga0395900_0021178_14_313 99
393 3300037418 Ga0395900_0076144 Ga0395900_0076144_346_645 99
394 3300037418 Ga0395900_0209059 Ga0395900_0209059_894_1193 99
395 3300037418 Ga0395900_0295093 Ga0395900_0295093_1147_1446 99
396 3300037418 Ga0395900_0461454 Ga0395900_0461454_540_839 99
397 3300037418 Ga0395900_0514045 Ga0395900_0514045_30_329 99
398 3300037466 Ga0395898_0021217 Ga0395898_0021217_4001_4300 99
399 3300037466 Ga0395898_0102419 Ga0395898_0102419_2030_2329 99
400 3300037466 Ga0395898_0169195 Ga0395898_0169195_1062_1361 99
401 3300037466 Ga0395898_0219229 Ga0395898_0219229_597_896 99
402 3300037466 Ga0395898_0443889 Ga0395898_0443889_765_1064 99
403 3300037466 Ga0395898_0507487 Ga0395898_0507487_654_953 99
404 3300037466 Ga0395898_0600230 Ga0395898_0600230_387_686 99
405 3300037466 Ga0395898_1119667 Ga0395898_1119667_46_345 99
406 3300037466 Ga0395898_1200128 Ga0395898_1200128_226_525 99
407 3300037466 Ga0395898_1418862 Ga0395898_1418862_141_440 99
408 3300037471 Ga0395905_0227773 Ga0395905_0227773_996_1295 99
409 3300037471 Ga0395905_0761229 Ga0395905_0761229_95_394 99
410 3300037471 Ga0395905_0867626 Ga0395905_0867626_375_674 99
411 3300037471 Ga0395905_1366104 Ga0395905_1366104_55_354 99
412 3300037471 Ga0395905_1853973 Ga0395905_1853973_21_320 99
413 3300038443 Ga0395901_0028667 Ga0395901_0028667_3255_3554 99
414 3300038443 Ga0395901_0029945 Ga0395901_0029945_3535_3834 99
415 3300038443 Ga0395901_0149661 Ga0395901_0149661_682_981 99
416 3300038443 Ga0395901_0210768 Ga0395901_0210768_1366_1665 99
417 3300038443 Ga0395901_0433022 Ga0395901_0433022_334_633 99
418 3300038443 Ga0395901_0456029 Ga0395901_0456029_580_879 99
419 3300038443 Ga0395901_0546607 Ga0395901_0546607_328_627 99
420 3300038443 Ga0395901_0745060 Ga0395901_0745060_350_649 99
421 3300038443 Ga0395901_1504168 Ga0395901_1504168_184_483 99
422 3300038443 Ga0395901_1602861 Ga0395901_1602861_201_500 99
423 3300038443 Ga0395901_1985990 Ga0395901_1985990_155_454 99
424 3300038443 Ga0395901_2033890 Ga0395901_2033890_193_492 99
425 3300039437 Ga0436365_0792175 Ga0436365_0792175_254_553 99
426 3300039437 Ga0436365_1108698 Ga0436365_1108698_411_710 99
427 3300039438 Ga0436360_1152980 Ga0436360_1152980_4173_4472 99
428 3300039450 Ga0436363_1375679 Ga0436363_1375679_624_923 99
429 3300039450 Ga0436363_1460754 Ga0436363_1460754_161_460 99
430 3300039453 Ga0436362_1210214 Ga0436362_1210214_3908_4207 99
431 3300041441 Ga0451787_740278 Ga0451787_740278_29_328 99
432 3300041486 Ga0451807_0899059 Ga0451807_0899059_371_670 99
433 3300041512 Ga0451853_0838820 Ga0451853_0838820_769_1068 99
434 3300044683 Ga0466965_0014876 Ga0466965_0014876_2305_2604 99
435 3300044684 Ga0466966_0022146 Ga0466966_0022146_1582_1881 99
436 3300044684 Ga0466966_0239101 Ga0466966_0239101_42_341 99
437 3300044684 Ga0466966_0296711 Ga0466966_0296711_396_695 99
438 3300044684 Ga0466966_0299536 Ga0466966_0299536_163_462 99
439 3300044693 Ga0466961_0013977 Ga0466961_0013977_1611_1910 99
440 3300044693 Ga0466961_0025466 Ga0466961_0025466_2547_2846 99
441 3300044693 Ga0466961_0144969 Ga0466961_0144969_1006_1305 99
442 3300044694 Ga0466963_0008663 Ga0466963_0008663_2284_2583 99
443 3300044694 Ga0466963_0014868 Ga0466963_0014868_1014_1313 99
444 3300044694 Ga0466963_0033684 Ga0466963_0033684_1394_1693 99
445 3300044694 Ga0466963_0037025 Ga0466963_0037025_133_432 99
446 3300044694 Ga0466963_0154097 Ga0466963_0154097_1107_1406 99
447 3300044694 Ga0466963_0720316 Ga0466963_0720316_253_552 99
448 3300044694 Ga0466963_0932482 Ga0466963_0932482_238_537 99
449 3300044706 Ga0466964_0313835 Ga0466964_0313835_285_584 99
450 3300044706 Ga0466964_0402622 Ga0466964_0402622_204_503 99
451 3300044706 Ga0466964_0516025 Ga0466964_0516025_103_402 99
452 3300044719 Ga0466971_0138913 Ga0466971_0138913_553_852 99
453 3300044719 Ga0466971_0584182 Ga0466971_0584182_146_445 99
454 3300044735 Ga0466968_0001944 Ga0466968_0001944_3390_3689 99
455 3300044735 Ga0466968_0081263 Ga0466968_0081263_466_765 99
456 3300044735 Ga0466968_0186201 Ga0466968_0186201_557_856 99
457 3300044842 Ga0466957_0152772 Ga0466957_0152772_47_346 99
458 3300044842 Ga0466957_1015049 Ga0466957_1015049_146_445 99
459 3300044901 Ga0466960_0689527 Ga0466960_0689527_270_569 99
460 3300045049 Ga0466959_0001728 Ga0466959_0001728_9778_10077 99
461 3300045049 Ga0466959_0006520 Ga0466959_0006520_1016_1315 99
462 3300045049 Ga0466959_0034403 Ga0466959_0034403_2111_2410 99
463 3300045049 Ga0466959_0627048 Ga0466959_0627048_113_412 99
464 3300045049 Ga0466959_1072408 Ga0466959_1072408_126_425 99
465 3300045836 Ga0466958_0039977 Ga0466958_0039977_2422_2721 99
466 3300045836 Ga0466958_0060895 Ga0466958_0060895_1843_2142 99
467 3300045836 Ga0466958_0155274 Ga0466958_0155274_526_825 99
468 3300045836 Ga0466958_0384117 Ga0466958_0384117_199_498 99
469 3300045836 Ga0466958_0988389 Ga0466958_0988389_28_327 99
470 3300045976 Ga0466967_0010051 Ga0466967_0010051_4496_4795 99
471 3300045976 Ga0466967_0072416 Ga0466967_0072416_342_641 99
472 3300045976 Ga0466967_0128896 Ga0466967_0128896_1377_1676 99
473 3300045976 Ga0466967_0222705 Ga0466967_0222705_932_1231 99
474 3300045976 Ga0466967_0244113 Ga0466967_0244113_62_361 99
475 3300045976 Ga0466967_0256597 Ga0466967_0256597_434_733 99
476 3300045976 Ga0466967_0422456 Ga0466967_0422456_194_493 99
477 3300045976 Ga0466967_0438329 Ga0466967_0438329_589_888 99
478 3300045976 Ga0466967_0510898 Ga0466967_0510898_850_1149 99
479 3300045976 Ga0466967_0687998 Ga0466967_0687998_229_528 99
480 3300045976 Ga0466967_0800958 Ga0466967_0800958_194_493 99
481 3300045976 Ga0466967_1501858 Ga0466967_1501858_86_385 99
482 3300046454 Ga0495592_0000100 Ga0495592_0000100_66569_66871 99
483 3300046454 Ga0495592_0074509 Ga0495592_0074509_1814_2113 99
484 3300046454 Ga0495592_0201239 Ga0495592_0201239_402_707 99
485 3300046454 Ga0495592_0392253 Ga0495592_0392253_134_433 99
486 3300046454 Ga0495592_0701395 Ga0495592_0701395_290_589 99
487 3300046454 Ga0495592_0728498 Ga0495592_0728498_232_531 99
488 3300046455 Ga0495603_0576439 Ga0495603_0576439_151_450 99
489 3300046459 Ga0495629_0000667 Ga0495629_0000667_10630_10929 99
490 3300046459 Ga0495629_0005062 Ga0495629_0005062_6173_6478 99
491 3300046459 Ga0495629_0130586 Ga0495629_0130586_1177_1476 99
492 3300046459 Ga0495629_0192111 Ga0495629_0192111_646_945 99
493 3300046459 Ga0495629_0335252 Ga0495629_0335252_626_925 99
494 3300046459 Ga0495629_0678619 Ga0495629_0678619_158_457 99
495 3300046461 Ga0495641_0003180 Ga0495641_0003180_151_450 99
496 3300046461 Ga0495641_0005502 Ga0495641_0005502_1606_1911 99
497 3300046461 Ga0495641_0039332 Ga0495641_0039332_1195_1500 99
498 3300046462 Ga0495651_0000008 Ga0495651_0000008_64778_65080 99
499 3300046462 Ga0495651_0024701 Ga0495651_0024701_950_1249 99
500 3300046462 Ga0495651_0064155 Ga0495651_0064155_1611_1910 99
501 3300046462 Ga0495651_0104100 Ga0495651_0104100_167_472 99
502 3300046462 Ga0495651_0335451 Ga0495651_0335451_189_488 99
503 3300046463 Ga0495653_0000519 Ga0495653_0000519_25388_25690 99
504 3300046463 Ga0495653_0065486 Ga0495653_0065486_1699_1998 99
505 3300046463 Ga0495653_0084738 Ga0495653_0084738_1368_1673 99
506 3300046463 Ga0495653_0103459 Ga0495653_0103459_395_694 99
507 3300046463 Ga0495653_0148781 Ga0495653_0148781_431_730 99
508 3300046463 Ga0495653_0151121 Ga0495653_0151121_1236_1535 99
509 3300046472 Ga0495580_0063144 Ga0495580_0063144_1352_1657 99
510 3300046473 Ga0495582_0000092 Ga0495582_0000092_35907_36206 99
511 3300046473 Ga0495582_0056850 Ga0495582_0056850_484_789 99
512 3300046473 Ga0495582_0117201 Ga0495582_0117201_535_834 99
513 3300046475 Ga0495639_0003153 Ga0495639_0003153_839_1144 99
514 3300046475 Ga0495639_0007418 Ga0495639_0007418_3053_3352 99
515 3300046475 Ga0495639_0477174 Ga0495639_0477174_300_599 99
516 3300046476 Ga0495662_0012267 Ga0495662_0012267_1593_1892 99
517 3300046476 Ga0495662_0280950 Ga0495662_0280950_30_335 99
518 3300046477 Ga0495664_0030604 Ga0495664_0030604_288_593 99
519 3300046477 Ga0495664_0064893 Ga0495664_0064893_779_1078 99
520 3300046477 Ga0495664_0110290 Ga0495664_0110290_602_901 99
521 3300046477 Ga0495664_0406049 Ga0495664_0406049_462_761 99
522 3300046477 Ga0495664_0684247 Ga0495664_0684247_40_339 99
523 3300046499 Ga0495594_0088830 Ga0495594_0088830_113_412 99
524 3300046511 Ga0495608_0004506 Ga0495608_0004506_5202_5504 99
525 3300046511 Ga0495608_0026089 Ga0495608_0026089_1164_1463 99
526 3300046511 Ga0495608_0105850 Ga0495608_0105850_627_926 99
527 3300046514 Ga0495618_0001843 Ga0495618_0001843_10230_10532 99
528 3300046514 Ga0495618_0075772 Ga0495618_0075772_278_577 99
529 3300046514 Ga0495618_0421697 Ga0495618_0421697_384_689 99
530 3300046516 Ga0495628_0000016 Ga0495628_0000016_169626_169928 99
531 3300046516 Ga0495628_0075298 Ga0495628_0075298_382_687 99
532 3300046516 Ga0495628_0128098 Ga0495628_0128098_353_652 99
533 3300046516 Ga0495628_0253597 Ga0495628_0253597_171_470 99
534 3300046516 Ga0495628_0351612 Ga0495628_0351612_224_523 99
535 3300046516 Ga0495628_0741717 Ga0495628_0741717_54_353 99
536 3300046517 Ga0495630_0001255 Ga0495630_0001255_6392_6691 99
537 3300046517 Ga0495630_0018448 Ga0495630_0018448_4034_4339 99
538 3300046517 Ga0495630_0034620 Ga0495630_0034620_282_581 99
539 3300046517 Ga0495630_0103217 Ga0495630_0103217_129_428 99
540 3300046526 Ga0495666_0007834 Ga0495666_0007834_1469_1774 99
541 3300046526 Ga0495666_0016821 Ga0495666_0016821_1633_1932 99
542 3300046529 Ga0495652_0000888 Ga0495652_0000888_24232_24534 99
543 3300046529 Ga0495652_0035652 Ga0495652_0035652_823_1122 99
544 3300046529 Ga0495652_0061327 Ga0495652_0061327_663_968 99
545 3300046529 Ga0495652_0566117 Ga0495652_0566117_251_550 99
546 3300046531 Ga0495665_0000240 Ga0495665_0000240_21618_21917 99
547 3300046531 Ga0495665_0041824 Ga0495665_0041824_485_790 99
548 3300046531 Ga0495665_0526717 Ga0495665_0526717_195_494 99
549 3300046533 Ga0495640_0034913 Ga0495640_0034913_2351_2650 99
550 3300046533 Ga0495640_0046670 Ga0495640_0046670_1833_2132 99
551 3300046533 Ga0495640_0169420 Ga0495640_0169420_935_1234 99
552 3300046533 Ga0495640_0295070 Ga0495640_0295070_429_734 99
553 3300046533 Ga0495640_0965899 Ga0495640_0965899_59_358 99
554 3300046535 Ga0495586_0044281 Ga0495586_0044281_1608_1913 99
555 3300046535 Ga0495586_0185110 Ga0495586_0185110_644_943 99
556 3300046535 Ga0495586_0368421 Ga0495586_0368421_320_619 99
557 3300046536 Ga0495587_0000048 Ga0495587_0000048_95264_95566 99
558 3300046536 Ga0495587_0049055 Ga0495587_0049055_1475_1774 99
559 3300046536 Ga0495587_0307193 Ga0495587_0307193_226_525 99
560 3300046536 Ga0495587_0311931 Ga0495587_0311931_31_330 99
561 3300046536 Ga0495587_0841488 Ga0495587_0841488_40_339 99
562 3300046543 Ga0495645_0000029 Ga0495645_0000029_17554_17856 99
563 3300046543 Ga0495645_0521057 Ga0495645_0521057_418_723 99
564 3300046559 Ga0495667_0026269 Ga0495667_0026269_1586_1885 99
565 3300046559 Ga0495667_0027749 Ga0495667_0027749_450_749 99
566 3300046559 Ga0495667_0267931 Ga0495667_0267931_111_410 99
567 3300046559 Ga0495667_0366664 Ga0495667_0366664_442_747 99
568 3300046642 Ga0495634_0023555 Ga0495634_0023555_1306_1605 99
569 3300046642 Ga0495634_0034560 Ga0495634_0034560_663_968 99
570 3300046642 Ga0495634_0211404 Ga0495634_0211404_718_1017 99
571 3300046642 Ga0495634_0252161 Ga0495634_0252161_295_594 99
572 3300046642 Ga0495634_0323017 Ga0495634_0323017_415_714 99
573 3300046642 Ga0495634_0433765 Ga0495634_0433765_212_511 99
574 3300046663 Ga0495635_0039170 Ga0495635_0039170_522_821 99
575 3300046663 Ga0495635_0050923 Ga0495635_0050923_1012_1311 99
576 3300046663 Ga0495635_0187792 Ga0495635_0187792_393_692 99
577 3300046663 Ga0495635_0429771 Ga0495635_0429771_526_825 99
578 3300046674 Ga0495588_0583017 Ga0495588_0583017_69_368 99
579 3300046675 Ga0495657_0007230 Ga0495657_0007230_8127_8426 99
580 3300046675 Ga0495657_0021009 Ga0495657_0021009_3199_3498 99
581 3300046675 Ga0495657_0059590 Ga0495657_0059590_494_793 99
582 3300046678 Ga0495599_0000181 Ga0495599_0000181_9125_9427 99
583 3300046678 Ga0495599_0157339 Ga0495599_0157339_884_1183 99
584 3300046678 Ga0495599_0357594 Ga0495599_0357594_535_834 99
585 3300046678 Ga0495599_0633811 Ga0495599_0633811_233_532 99
586 3300046678 Ga0495599_0642336 Ga0495599_0642336_194_499 99
587 3300046679 Ga0495623_0000093 Ga0495623_0000093_28160_28462 99
588 3300046679 Ga0495623_0055699 Ga0495623_0055699_710_1009 99
589 3300046679 Ga0495623_0234695 Ga0495623_0234695_719_1018 99
590 3300046680 Ga0495646_0000416 Ga0495646_0000416_10666_10968 99
591 3300046680 Ga0495646_0472663 Ga0495646_0472663_182_481 99
592 3300046681 Ga0495647_0041503 Ga0495647_0041503_893_1192 99
593 3300046683 Ga0495658_0001970 Ga0495658_0001970_6809_7114 99
594 3300046683 Ga0495658_0032131 Ga0495658_0032131_1541_1840 99
595 3300046683 Ga0495658_0126647 Ga0495658_0126647_499_804 99
596 3300046683 Ga0495658_0154306 Ga0495658_0154306_951_1250 99
597 3300046683 Ga0495658_0471390 Ga0495658_0471390_156_455 99
598 3300046689 Ga0495613_0007818 Ga0495613_0007818_5522_5827 99
599 3300046689 Ga0495613_0024524 Ga0495613_0024524_1861_2160 99
600 3300046689 Ga0495613_0067682 Ga0495613_0067682_1953_2252 99
601 3300046689 Ga0495613_0084573 Ga0495613_0084573_95_394 99
602 3300046689 Ga0495613_0108603 Ga0495613_0108603_1271_1570 99
603 3300046689 Ga0495613_0119614 Ga0495613_0119614_633_932 99
604 3300046690 Ga0495624_0006810 Ga0495624_0006810_2369_2668 99
605 3300046690 Ga0495624_0064946 Ga0495624_0064946_1829_2134 99
606 3300046690 Ga0495624_0654057 Ga0495624_0654057_75_374 99
607 3300046809 Ga0495600_0009227 Ga0495600_0009227_1815_2117 99
608 3300046809 Ga0495600_0017022 Ga0495600_0017022_2102_2401 99
609 3300047315 Ga0495581_0000519 Ga0495581_0000519_8878_9177 99
610 3300047315 Ga0495581_0204409 Ga0495581_0204409_389_688 99
611 3300047317 Ga0495604_0000111 Ga0495604_0000111_17392_17694 99
612 3300047317 Ga0495604_0110023 Ga0495604_0110023_142_441 99
613 3300047317 Ga0495604_0111443 Ga0495604_0111443_1454_1753 99
614 3300047319 Ga0495674_0050405 Ga0495674_0050405_1871_2170 99
615 3300047319 Ga0495674_0114665 Ga0495674_0114665_373_678 99
616 3300047319 Ga0495674_0912444 Ga0495674_0912444_157_456 99
617 3300047321 Ga0495676_0000654 Ga0495676_0000654_12223_12522 99
618 3300047321 Ga0495676_0049510 Ga0495676_0049510_1604_1909 99
619 3300047321 Ga0495676_0135755 Ga0495676_0135755_268_567 99
620 3300047322 Ga0495680_0027258 Ga0495680_0027258_2310_2609 99
621 3300047322 Ga0495680_0028517 Ga0495680_0028517_2986_3288 99
622 3300047322 Ga0495680_0030091 Ga0495680_0030091_2468_2767 99
623 3300047322 Ga0495680_0077617 Ga0495680_0077617_130_429 99
624 3300047322 Ga0495680_0118572 Ga0495680_0118572_1273_1572 99
625 3300047322 Ga0495680_0611036 Ga0495680_0611036_155_460 99
626 3300047322 Ga0495680_1091268 Ga0495680_1091268_70_369 99
627 3300047444 Ga0495675_0000376 Ga0495675_0000376_2464_2766 99
628 3300047444 Ga0495675_0046482 Ga0495675_0046482_2177_2476 99
629 3300047471 Ga0495684_0013297 Ga0495684_0013297_3235_3534 99
630 3300047471 Ga0495684_0023335 Ga0495684_0023335_2932_3231 99
631 3300047471 Ga0495684_0028408 Ga0495684_0028408_3505_3810 99
632 3300047471 Ga0495684_0044240 Ga0495684_0044240_929_1228 99
633 3300047471 Ga0495684_0052449 Ga0495684_0052449_512_817 99
634 3300047471 Ga0495684_0204253 Ga0495684_0204253_830_1135 99
635 3300047673 Ga0495593_0004272 Ga0495593_0004272_605_910 99
636 3300047673 Ga0495593_0018456 Ga0495593_0018456_1556_1855 99
637 3300047673 Ga0495593_0112051 Ga0495593_0112051_784_1089 99
638 3300048088 Ga0495602_0000141 Ga0495602_0000141_15028_15330 99
639 3300048088 Ga0495602_0242841 Ga0495602_0242841_224_523 99
640 3300048088 Ga0495602_0551641 Ga0495602_0551641_322_621 99
641 3300048089 Ga0495614_0028508 Ga0495614_0028508_484_789 99
642 3300048089 Ga0495614_0036948 Ga0495614_0036948_206_505 99
643 3300048089 Ga0495614_0219810 Ga0495614_0219810_174_479 99
644 3300048903 Ga0496100_0012118 Ga0496100_0012118_2974_3273 99
645 3300048903 Ga0496100_0024825 Ga0496100_0024825_406_705 99
646 3300048903 Ga0496100_0048882 Ga0496100_0048882_614_913 99
647 3300048903 Ga0496100_0343375 Ga0496100_0343375_361_660 99
648 3300048903 Ga0496100_0860985 Ga0496100_0860985_212_511 99
649 3300048903 Ga0496100_0935491 Ga0496100_0935491_329_628 99
650 3300048904 Ga0496101_0015300 Ga0496101_0015300_1608_1907 99
651 3300048904 Ga0496101_0032623 Ga0496101_0032623_2222_2521 99
652 3300048904 Ga0496101_0057452 Ga0496101_0057452_1332_1631 99
653 3300048905 Ga0496102_0021142 Ga0496102_0021142_1778_2077 99
654 3300048905 Ga0496102_0453253 Ga0496102_0453253_252_551 99
655 3300048905 Ga0496102_0942909 Ga0496102_0942909_143_442 99
656 3300048905 Ga0496102_1018416 Ga0496102_1018416_226_525 99
657 3300048906 Ga0496103_0075072 Ga0496103_0075072_1660_1959 99
658 3300048906 Ga0496103_0137162 Ga0496103_0137162_410_709 99
659 3300048907 Ga0496104_0029221 Ga0496104_0029221_1816_2115 99
660 3300048907 Ga0496104_0054911 Ga0496104_0054911_703_1002 99
661 3300048907 Ga0496104_1064802 Ga0496104_1064802_199_498 99
662 3300048907 Ga0496104_1443241 Ga0496104_1443241_127_426 99
663 3300048908 Ga0496105_0016329 Ga0496105_0016329_989_1288 99
664 3300048908 Ga0496105_0217102 Ga0496105_0217102_720_1019 99
665 3300048908 Ga0496105_1035502 Ga0496105_1035502_278_577 99
666 3300048909 Ga0496106_0018069 Ga0496106_0018069_1223_1522 99
667 3300048909 Ga0496106_0029410 Ga0496106_0029410_2893_3192 99
668 3300048909 Ga0496106_0046619 Ga0496106_0046619_1301_1600 99
669 3300048909 Ga0496106_1351980 Ga0496106_1351980_117_416 99
670 3300048910 Ga0496107_0007631 Ga0496107_0007631_5360_5659 99
671 3300048910 Ga0496107_0027539 Ga0496107_0027539_1367_1666 99
672 3300048910 Ga0496107_0122197 Ga0496107_0122197_246_545 99
673 3300048910 Ga0496107_0296799 Ga0496107_0296799_599_898 99
674 3300048910 Ga0496107_0367955 Ga0496107_0367955_22_321 99
675 3300048910 Ga0496107_0405575 Ga0496107_0405575_336_635 99
676 3300048911 Ga0496108_0280157 Ga0496108_0280157_1017_1316 99
677 3300048911 Ga0496108_1290412 Ga0496108_1290412_164_463 99
678 3300048912 Ga0496109_0162050 Ga0496109_0162050_908_1207 99
679 3300048912 Ga0496109_0223536 Ga0496109_0223536_819_1118 99
680 3300048912 Ga0496109_0398096 Ga0496109_0398096_134_433 99
681 3300048913 Ga0496110_0017249 Ga0496110_0017249_1449_1748 99
682 3300048913 Ga0496110_1737948 Ga0496110_1737948_225_524 99
683 3300048914 Ga0496111_0123837 Ga0496111_0123837_1539_1838 99
684 3300048914 Ga0496111_0850908 Ga0496111_0850908_270_569 99
685 3300048915 Ga0496112_0005626 Ga0496112_0005626_5908_6207 99
686 3300048915 Ga0496112_0014515 Ga0496112_0014515_2262_2561 99
687 3300048915 Ga0496112_0037055 Ga0496112_0037055_1779_2078 99
688 3300048915 Ga0496112_0064033 Ga0496112_0064033_2032_2331 99
689 3300048915 Ga0496112_0122499 Ga0496112_0122499_837_1136 99
690 3300048915 Ga0496112_0200579 Ga0496112_0200579_620_919 99
691 3300048915 Ga0496112_0264432 Ga0496112_0264432_869_1168 99
692 3300048915 Ga0496112_0337089 Ga0496112_0337089_1017_1316 99
693 3300048915 Ga0496112_1723691 Ga0496112_1723691_114_413 99
694 3300048916 Ga0496113_0112263 Ga0496113_0112263_991_1290 99
695 3300048916 Ga0496113_0189462 Ga0496113_0189462_1269_1568 99
696 3300048916 Ga0496113_0706618 Ga0496113_0706618_350_649 99
697 3300048917 Ga0496114_0001144 Ga0496114_0001144_1119_1418 99
698 3300048917 Ga0496114_0006596 Ga0496114_0006596_4309_4608 99
699 3300048917 Ga0496114_0030722 Ga0496114_0030722_589_888 99
700 3300048917 Ga0496114_0192363 Ga0496114_0192363_110_409 99
701 3300048917 Ga0496114_0927172 Ga0496114_0927172_343_642 99
702 3300048918 Ga0496115_0001178 Ga0496115_0001178_6349_6648 99
703 3300048918 Ga0496115_0032835 Ga0496115_0032835_1734_2033 99
704 3300048918 Ga0496115_0046075 Ga0496115_0046075_340_639 99
705 3300048918 Ga0496115_0216830 Ga0496115_0216830_281_580 99
706 3300048918 Ga0496115_0664273 Ga0496115_0664273_317_616 99
707 3300048918 Ga0496115_1271236 Ga0496115_1271236_58_357 99
708 3300049568 Ga0501031_0004912 Ga0501031_0004912_4666_4965 99
709 3300049568 Ga0501031_0131320 Ga0501031_0131320_1199_1498 99
710 3300049569 Ga0501032_0093297 Ga0501032_0093297_415_714 99
711 3300049570 Ga0501033_0476136 Ga0501033_0476136_145_444 99
712 3300049570 Ga0501033_0515347 Ga0501033_0515347_33_332 99
713 3300049571 Ga0501034_1099899 Ga0501034_1099899_249_548 99
714 3300049572 Ga0501036_0007319 Ga0501036_0007319_1443_1742 99
715 3300049572 Ga0501036_0098710 Ga0501036_0098710_1592_1891 99
716 3300049572 Ga0501036_1258108 Ga0501036_1258108_51_350 99
717 3300049574 Ga0501038_0050348 Ga0501038_0050348_1463_1762 99
718 3300049575 Ga0501039_0002809 Ga0501039_0002809_1920_2219 99
719 3300049576 Ga0501040_0009765 Ga0501040_0009765_2387_2686 99
720 3300049576 Ga0501040_0129242 Ga0501040_0129242_331_630 99
721 3300049577 Ga0501041_0009588 Ga0501041_0009588_1656_1955 99
722 3300049577 Ga0501041_0580469 Ga0501041_0580469_353_652 99
723 3300049578 Ga0501042_0003743 Ga0501042_0003743_7894_8193 99
724 3300049578 Ga0501042_0048064 Ga0501042_0048064_1212_1511 99
725 3300049578 Ga0501042_0944722 Ga0501042_0944722_55_354 99
726 3300049578 Ga0501042_1414221 Ga0501042_1414221_59_358 99
727 3300049579 Ga0501043_0789829 Ga0501043_0789829_61_360 99
728 3300049580 Ga0501046_0024547 Ga0501046_0024547_3260_3559 99
729 3300049580 Ga0501046_0077652 Ga0501046_0077652_1694_1993 99
730 3300049582 Ga0501048_0004195 Ga0501048_0004195_3980_4279 99
731 3300049582 Ga0501048_0126007 Ga0501048_0126007_1253_1552 99
732 3300049582 Ga0501048_0344306 Ga0501048_0344306_17_316 99
733 3300049583 Ga0501067_0814668 Ga0501067_0814668_18_317 99
734 3300049584 Ga0501068_0031119 Ga0501068_0031119_965_1264 99
735 3300049584 Ga0501068_0704707 Ga0501068_0704707_338_637 99
736 3300049585 Ga0501069_0106183 Ga0501069_0106183_1228_1527 99
737 3300049585 Ga0501069_0170556 Ga0501069_0170556_358_657 99
738 3300049586 Ga0501070_0061188 Ga0501070_0061188_1522_1821 99
739 3300049586 Ga0501070_0088379 Ga0501070_0088379_483_782 99
740 3300049587 Ga0501071_0017987 Ga0501071_0017987_4269_4568 99
741 3300049587 Ga0501071_0063166 Ga0501071_0063166_66_365 99
742 3300049588 Ga0501072_0012707 Ga0501072_0012707_4471_4770 99
743 3300049588 Ga0501072_0060417 Ga0501072_0060417_2007_2306 99
744 3300049590 Ga0501074_0078434 Ga0501074_0078434_427_726 99
745 3300049591 Ga0501075_0055440 Ga0501075_0055440_522_821 99
746 3300049591 Ga0501075_0058833 Ga0501075_0058833_639_938 99
747 3300049591 Ga0501075_0118322 Ga0501075_0118322_1113_1412 99
748 3300049592 Ga0501076_0005282 Ga0501076_0005282_6397_6696 99
749 3300049592 Ga0501076_0050246 Ga0501076_0050246_1724_2023 99
750 3300049592 Ga0501076_0056557 Ga0501076_0056557_988_1287 99
751 3300049593 Ga0501077_0002796 Ga0501077_0002796_1614_1913 99
752 3300049593 Ga0501077_0003681 Ga0501077_0003681_938_1237 99
753 3300049593 Ga0501077_0258879 Ga0501077_0258879_275_574 99
754 3300049593 Ga0501077_0671518 Ga0501077_0671518_324_623 99
755 3300049741 Ga0501079_0002965 Ga0501079_0002965_9547_9846 99
756 3300049742 Ga0501080_0102058 Ga0501080_0102058_717_1016 99
757 3300049742 Ga0501080_0168917 Ga0501080_0168917_21_320 99
758 3300049742 Ga0501080_1664323 Ga0501080_1664323_62_361 99
759 3300049743 Ga0501081_0005311 Ga0501081_0005311_6368_6667 99
760 3300049743 Ga0501081_0847655 Ga0501081_0847655_244_543 99
761 3300049744 Ga0501083_0520658 Ga0501083_0520658_452_751 99
762 3300049822 Ga0501035_1083399 Ga0501035_1083399_264_563 99
763 3300049822 Ga0501035_1223997 Ga0501035_1223997_59_358 99
764 3300049823 Ga0501044_0769356 Ga0501044_0769356_404_703 99
765 3300049824 Ga0501045_0002356 Ga0501045_0002356_9960_10259 99
766 3300049824 Ga0501045_0050119 Ga0501045_0050119_147_446 99
767 3300049824 Ga0501045_0596639 Ga0501045_0596639_221_520 99
768 3300050507 nmdc:mga05p37_3875_c1 nmdc:mga05p37_3875_c1_10401_10700 99
769 3300050508 nmdc:mga09592_12059_c1 nmdc:mga09592_12059_c1_3976_4275 99
770 3300050509 nmdc:mga0qj67_138611_c1 nmdc:mga0qj67_138611_c1_1505_1804 99
771 3300050509 nmdc:mga0qj67_205247_c1 nmdc:mga0qj67_205247_c1_523_822 99
772 3300050512 nmdc:mga0n895_23557_c1 nmdc:mga0n895_23557_c1_3921_4220 99
773 3300050512 nmdc:mga0n895_531590_c1 nmdc:mga0n895_531590_c1_708_1007 99
774 3300050513 nmdc:mga0rr50_125363_c1 nmdc:mga0rr50_125363_c1_1260_1559 99
775 3300050513 nmdc:mga0rr50_199809_c1 nmdc:mga0rr50_199809_c1_526_825 99
776 3300050514 nmdc:mga08x19_468094_c1 nmdc:mga08x19_468094_c1_474_773 99
777 3300050515 nmdc:mga0a205_174542_c1 nmdc:mga0a205_174542_c1_414_713 99
778 3300050515 nmdc:mga0a205_304149_c1 nmdc:mga0a205_304149_c1_651_950 99
779 3300053077 Ga0495601_0000206 Ga0495601_0000206_15994_16296 99
780 3300053077 Ga0495601_0077951 Ga0495601_0077951_1144_1449 99
781 3300053077 Ga0495601_0094632 Ga0495601_0094632_1505_1804 99
782 3300053077 Ga0495601_0102784 Ga0495601_0102784_794_1093 99
783 3300053078 Ga0495612_0109319 Ga0495612_0109319_819_1118 99
784 3300053078 Ga0495612_0267616 Ga0495612_0267616_162_461 99
785 3300053078 Ga0495612_0386726 Ga0495612_0386726_172_477 99
786 3300053083 Ga0495655_0015472 Ga0495655_0015472_643_942 99
787 3300053084 Ga0495595_0058217 Ga0495595_0058217_1466_1765 99
788 3300053084 Ga0495595_0169953 Ga0495595_0169953_99_398 99
789 3300053084 Ga0495595_0171579 Ga0495595_0171579_540_839 99
790 3300053084 Ga0495595_0598410 Ga0495595_0598410_57_362 99
791 3300053085 Ga0495619_0000291 Ga0495619_0000291_33722_34024 99
792 3300053085 Ga0495619_0006747 Ga0495619_0006747_1535_1834 99
793 3300053085 Ga0495619_0007034 Ga0495619_0007034_4080_4379 99
794 3300053085 Ga0495619_0019582 Ga0495619_0019582_3101_3400 99
795 3300053085 Ga0495619_0024149 Ga0495619_0024149_3081_3380 99
796 3300053085 Ga0495619_0096594 Ga0495619_0096594_1479_1784 99
797 3300053094 Ga0500566_0024712 Ga0500566_0024712_56_361 99
798 3300054114 Ga0501084_0021299 Ga0501084_0021299_3458_3757 99
799 3300054114 Ga0501084_0113520 Ga0501084_0113520_1404_1703 99
800 3300054114 Ga0501084_1081865 Ga0501084_1081865_313_612 99
801 3300059423 Ga0590074_008830 Ga0590074_008830_1008_1307 99
802 3300059504 Ga0587082_090023 Ga0587082_090023_209_508 99
803 3300060353 Ga0501082_0011995 Ga0501082_0011995_1531_1830 99
804 3300060353 Ga0501082_0194891 Ga0501082_0194891_654_953 99
805 3300061719 Ga0466962_0378956 Ga0466962_0378956_104_403 99
806 3300061734 Ga0530510_0004716 Ga0530510_0004716_7479_7778 99
807 3300061734 Ga0530510_0027300 Ga0530510_0027300_203_502 99
808 3300005436 Ga0070713_100270504 Ga0070713_1002705042 100
809 3300005436 Ga0070713_101332364 Ga0070713_1013323642 100
810 3300005530 Ga0070679_100176180 Ga0070679_1001761802 100
811 3300006028 Ga0070717_10299132 Ga0070717_102991322 100
812 3300006175 Ga0070712_100072995 Ga0070712_1000729952 100
813 3300009551 Ga0105238_11049204 Ga0105238_110492042 100
814 3300025915 Ga0207693_10137564 Ga0207693_101375644 100
815 3300025916 Ga0207663_10711484 Ga0207663_107114841 100
816 3300025921 Ga0207652_10171384 Ga0207652_101713842 100
817 3300025928 Ga0207700_10447030 Ga0207700_104470302 100
818 3300025928 Ga0207700_10781895 Ga0207700_107818952 100
819 3300025928 Ga0207700_11066696 Ga0207700_110666962 100
820 3300025944 Ga0207661_10102318 Ga0207661_101023182 100
821 3300026041 Ga0207639_10838179 Ga0207639_108381792 100
822 3300026121 Ga0207683_10171358 Ga0207683_101713582 100
823 3300035725 Ga0373947_0526438 Ga0373947_0526438_214_516 100
824 3300036401 Ga0373937_0712732 Ga0373937_0712732_233_535 100
825 3300038443 Ga0395901_1770698 Ga0395901_1770698_130_432 100
826 3300044683 Ga0466965_0590274 Ga0466965_0590274_207_509 100
827 3300044684 Ga0466966_0190068 Ga0466966_0190068_702_1004 100
828 3300044694 Ga0466963_0080175 Ga0466963_0080175_1512_1814 100
829 3300044706 Ga0466964_0010742 Ga0466964_0010742_1000_1302 100
830 3300044842 Ga0466957_0020828 Ga0466957_0020828_3395_3697 100
831 3300044901 Ga0466960_0393140 Ga0466960_0393140_318_620 100
832 3300044901 Ga0466960_0920295 Ga0466960_0920295_105_407 100
833 3300045976 Ga0466967_0004811 Ga0466967_0004811_6558_6860 100
834 3300045976 Ga0466967_1617704 Ga0466967_1617704_269_571 100
835 3300046454 Ga0495592_0150276 Ga0495592_0150276_730_1032 100
836 3300046462 Ga0495651_0135041 Ga0495651_0135041_774_1076 100
837 3300046463 Ga0495653_0352936 Ga0495653_0352936_245_547 100
838 3300046463 Ga0495653_0943392 Ga0495653_0943392_181_483 100
839 3300046475 Ga0495639_0748755 Ga0495639_0748755_43_345 100
840 3300046477 Ga0495664_0158970 Ga0495664_0158970_861_1163 100
841 3300046477 Ga0495664_0268154 Ga0495664_0268154_706_1008 100
842 3300046511 Ga0495608_0093965 Ga0495608_0093965_891_1193 100
843 3300046511 Ga0495608_0256517 Ga0495608_0256517_675_977 100
844 3300046514 Ga0495618_0047133 Ga0495618_0047133_1248_1550 100
845 3300046516 Ga0495628_0822839 Ga0495628_0822839_166_468 100
846 3300046533 Ga0495640_0405365 Ga0495640_0405365_173_475 100
847 3300046536 Ga0495587_0093097 Ga0495587_0093097_37_339 100
848 3300046543 Ga0495645_0103512 Ga0495645_0103512_1078_1380 100
849 3300046559 Ga0495667_0311123 Ga0495667_0311123_216_518 100
850 3300046642 Ga0495634_0161982 Ga0495634_0161982_617_919 100
851 3300046663 Ga0495635_0053636 Ga0495635_0053636_1465_1767 100
852 3300046665 Ga0495661_0366690 Ga0495661_0366690_141_443 100
853 3300046678 Ga0495599_0525621 Ga0495599_0525621_131_433 100
854 3300046680 Ga0495646_0385749 Ga0495646_0385749_138_440 100
855 3300046809 Ga0495600_0192009 Ga0495600_0192009_153_455 100
856 3300046809 Ga0495600_0625215 Ga0495600_0625215_101_403 100
857 3300047317 Ga0495604_0115617 Ga0495604_0115617_1029_1331 100
858 3300047319 Ga0495674_0095276 Ga0495674_0095276_658_960 100
859 3300047319 Ga0495674_0648814 Ga0495674_0648814_217_519 100
860 3300047322 Ga0495680_0211388 Ga0495680_0211388_985_1287 100
861 3300047322 Ga0495680_0313048 Ga0495680_0313048_144_446 100
862 3300047444 Ga0495675_0483918 Ga0495675_0483918_128_430 100
863 3300047471 Ga0495684_0252064 Ga0495684_0252064_546_848 100
864 3300047471 Ga0495684_0300308 Ga0495684_0300308_315_617 100
865 3300048903 Ga0496100_0122428 Ga0496100_0122428_1082_1384 100
866 3300048904 Ga0496101_0944657 Ga0496101_0944657_230_532 100
867 3300048907 Ga0496104_0008292 Ga0496104_0008292_8583_8885 100
868 3300048908 Ga0496105_0015773 Ga0496105_0015773_1020_1322 100
869 3300048912 Ga0496109_0916894 Ga0496109_0916894_459_761 100
870 3300048914 Ga0496111_1231207 Ga0496111_1231207_19_321 100
871 3300049584 Ga0501068_0115318 Ga0501068_0115318_12_314 100
872 3300049585 Ga0501069_0145369 Ga0501069_0145369_564_866 100
873 3300049586 Ga0501070_0017999 Ga0501070_0017999_5581_5883 100
874 3300049588 Ga0501072_0011062 Ga0501072_0011062_3338_3640 100
875 3300049589 Ga0501073_0312073 Ga0501073_0312073_441_743 100
876 3300049741 Ga0501079_0092329 Ga0501079_0092329_1900_2202 100
877 3300049742 Ga0501080_0172016 Ga0501080_0172016_245_547 100
878 3300049744 Ga0501083_0000131 Ga0501083_0000131_24929_25231 100
879 3300049823 Ga0501044_1292640 Ga0501044_1292640_11_313 100
880 3300053077 Ga0495601_0325312 Ga0495601_0325312_259_561 100
881 3300053077 Ga0495601_0362644 Ga0495601_0362644_364_666 100
882 3300053084 Ga0495595_0017171 Ga0495595_0017171_482_784 100
883 3300053085 Ga0495619_0034560 Ga0495619_0034560_368_670 100
884 3300060353 Ga0501082_0087247 Ga0501082_0087247_831_1133 100
885 3300005327 Ga0070658_10005819 Ga0070658_100058199 101
886 3300005327 Ga0070658_11737190 Ga0070658_117371902 101
887 3300005329 Ga0070683_100364830 Ga0070683_1003648302 101
888 3300005329 Ga0070683_100786395 Ga0070683_1007863951 101
889 3300005336 Ga0070680_100022331 Ga0070680_1000223313 101
890 3300005336 Ga0070680_100332357 Ga0070680_1003323572 101
891 3300005337 Ga0070682_100051521 Ga0070682_1000515213 101
892 3300005338 Ga0068868_100752929 Ga0068868_1007529292 101
893 3300005338 Ga0068868_101942309 Ga0068868_1019423091 101
894 3300005339 Ga0070660_100014452 Ga0070660_1000144527 101
895 3300005341 Ga0070691_10703516 Ga0070691_107035162 101
896 3300005344 Ga0070661_100103200 Ga0070661_1001032004 101
897 3300005344 Ga0070661_100771104 Ga0070661_1007711042 101
898 3300005345 Ga0070692_10026020 Ga0070692_100260203 101
899 3300005366 Ga0070659_100075403 Ga0070659_1000754032 101
900 3300005434 Ga0070709_10055086 Ga0070709_100550863 101
901 3300005434 Ga0070709_11271244 Ga0070709_112712442 101
902 3300005435 Ga0070714_100035252 Ga0070714_1000352522 101
903 3300005435 Ga0070714_100058356 Ga0070714_1000583562 101
904 3300005435 Ga0070714_100059064 Ga0070714_1000590643 101
905 3300005435 Ga0070714_102337734 Ga0070714_1023377341 101
906 3300005436 Ga0070713_100018400 Ga0070713_1000184007 101
907 3300005436 Ga0070713_100020135 Ga0070713_1000201353 101
908 3300005436 Ga0070713_100208054 Ga0070713_1002080542 101
909 3300005437 Ga0070710_10009113 Ga0070710_100091134 101
910 3300005437 Ga0070710_11145998 Ga0070710_111459981 101
911 3300005437 Ga0070710_11394154 Ga0070710_113941541 101
912 3300005439 Ga0070711_100034100 Ga0070711_1000341003 101
913 3300005439 Ga0070711_100158062 Ga0070711_1001580622 101
914 3300005444 Ga0070694_100558559 Ga0070694_1005585592 101
915 3300005445 Ga0070708_100953431 Ga0070708_1009534312 101
916 3300005445 Ga0070708_101146318 Ga0070708_1011463182 101
917 3300005457 Ga0070662_100885497 Ga0070662_1008854972 101
918 3300005458 Ga0070681_10023352 Ga0070681_100233527 101
919 3300005458 Ga0070681_10055488 Ga0070681_100554882 101
920 3300005458 Ga0070681_10170454 Ga0070681_101704542 101
921 3300005468 Ga0070707_100001400 Ga0070707_10000140023 101
922 3300005518 Ga0070699_101317993 Ga0070699_1013179932 101
923 3300005530 Ga0070679_100087393 Ga0070679_1000873933 101
924 3300005530 Ga0070679_100094898 Ga0070679_1000948983 101
925 3300005535 Ga0070684_100436568 Ga0070684_1004365682 101
926 3300005535 Ga0070684_100578801 Ga0070684_1005788012 101
927 3300005536 Ga0070697_100156689 Ga0070697_1001566892 101
928 3300005536 Ga0070697_100583459 Ga0070697_1005834592 101
929 3300005545 Ga0070695_100000062 Ga0070695_10000006216 101
930 3300005547 Ga0070693_101398840 Ga0070693_1013988401 101
931 3300005563 Ga0068855_100422538 Ga0068855_1004225382 101
932 3300005563 Ga0068855_100452560 Ga0068855_1004525602 101
933 3300005564 Ga0070664_100039647 Ga0070664_1000396475 101
934 3300005577 Ga0068857_100043795 Ga0068857_1000437956 101
935 3300005614 Ga0068856_102258056 Ga0068856_1022580562 101
936 3300005615 Ga0070702_100025480 Ga0070702_1000254802 101
937 3300005618 Ga0068864_100851798 Ga0068864_1008517982 101
938 3300006028 Ga0070717_10012634 Ga0070717_100126344 101
939 3300006028 Ga0070717_10059329 Ga0070717_100593293 101
940 3300006028 Ga0070717_10066952 Ga0070717_100669523 101
941 3300006028 Ga0070717_10259887 Ga0070717_102598872 101
942 3300006028 Ga0070717_10913138 Ga0070717_109131382 101
943 3300006173 Ga0070716_100216898 Ga0070716_1002168982 101
944 3300006175 Ga0070712_100034964 Ga0070712_1000349642 101
945 3300006175 Ga0070712_100146513 Ga0070712_1001465132 101
946 3300006175 Ga0070712_100837382 Ga0070712_1008373822 101
947 3300006237 Ga0097621_101114692 Ga0097621_1011146922 101
948 3300006852 Ga0075433_11129633 Ga0075433_111296332 101
949 3300006871 Ga0075434_100036845 Ga0075434_1000368452 101
950 3300006881 Ga0068865_100437799 Ga0068865_1004377992 101
951 3300007076 Ga0075435_100102122 Ga0075435_1001021222 101
952 3300009093 Ga0105240_10009653 Ga0105240_100096537 101
953 3300009094 Ga0111539_10405652 Ga0111539_104056522 101
954 3300009098 Ga0105245_10066360 Ga0105245_100663605 101
955 3300009098 Ga0105245_10595964 Ga0105245_105959642 101
956 3300009101 Ga0105247_10316818 Ga0105247_103168182 101
957 3300009177 Ga0105248_11235769 Ga0105248_112357692 101
958 3300009545 Ga0105237_10039556 Ga0105237_100395563 101
959 3300009545 Ga0105237_10262638 Ga0105237_102626382 101
960 3300009551 Ga0105238_10029328 Ga0105238_100293282 101
961 3300010375 Ga0105239_10677845 Ga0105239_106778452 101
962 3300010375 Ga0105239_11696353 Ga0105239_116963532 101
963 3300011119 Ga0105246_11010051 Ga0105246_110100512 101
964 3300012510 Ga0157316_1068837 Ga0157316_10688371 101
965 3300013104 Ga0157370_10339433 Ga0157370_103394332 101
966 3300013104 Ga0157370_11757157 Ga0157370_117571572 101
967 3300013105 Ga0157369_10058446 Ga0157369_100584464 101
968 3300013105 Ga0157369_10287182 Ga0157369_102871822 101
969 3300013105 Ga0157369_10881330 Ga0157369_108813302 101
970 3300013296 Ga0157374_10498610 Ga0157374_104986102 101
971 3300013306 Ga0163162_10276620 Ga0163162_102766202 101
972 3300013307 Ga0157372_10011775 Ga0157372_100117752 101
973 3300013307 Ga0157372_10094402 Ga0157372_100944023 101
974 3300014497 Ga0182008_10139411 Ga0182008_101394112 101
975 3300014497 Ga0182008_10157510 Ga0182008_101575102 101
976 3300014969 Ga0157376_10029992 Ga0157376_100299924 101
977 3300020070 Ga0206356_10432715 Ga0206356_104327152 101
978 3300020070 Ga0206356_11092075 Ga0206356_110920753 101
979 3300020080 Ga0206350_10497261 Ga0206350_104972612 101
980 3300020082 Ga0206353_10285007 Ga0206353_102850072 101
981 3300020610 Ga0154015_1486064 Ga0154015_14860642 101
982 3300022467 Ga0224712_10154231 Ga0224712_101542312 101
983 3300022467 Ga0224712_10195528 Ga0224712_101955282 101
984 3300025898 Ga0207692_10041264 Ga0207692_100412642 101
985 3300025898 Ga0207692_10271822 Ga0207692_102718222 101
986 3300025906 Ga0207699_10159957 Ga0207699_101599572 101
987 3300025906 Ga0207699_10445111 Ga0207699_104451112 101
988 3300025909 Ga0207705_10060825 Ga0207705_100608253 101
989 3300025912 Ga0207707_10088691 Ga0207707_100886913 101
990 3300025912 Ga0207707_10365916 Ga0207707_103659162 101
991 3300025912 Ga0207707_10446830 Ga0207707_104468302 101
992 3300025913 Ga0207695_10038896 Ga0207695_100388962 101
993 3300025914 Ga0207671_10204332 Ga0207671_102043322 101
994 3300025915 Ga0207693_10001177 Ga0207693_1000117726 101
995 3300025915 Ga0207693_11190245 Ga0207693_111902452 101
996 3300025916 Ga0207663_10134883 Ga0207663_101348833 101
997 3300025916 Ga0207663_10197698 Ga0207663_101976981 101
998 3300025916 Ga0207663_10751330 Ga0207663_107513301 101
999 3300025917 Ga0207660_10248488 Ga0207660_102484882 101
1000 3300025917 Ga0207660_10411066 Ga0207660_104110662 101
1001 3300025919 Ga0207657_10000739 Ga0207657_100007397 101
1002 3300025920 Ga0207649_10099985 Ga0207649_100999852 101
1003 3300025921 Ga0207652_10299928 Ga0207652_102999282 101
1004 3300025921 Ga0207652_11461547 Ga0207652_114615472 101
1005 3300025922 Ga0207646_10006489 Ga0207646_1000648914 101
1006 3300025924 Ga0207694_10053522 Ga0207694_100535222 101
1007 3300025927 Ga0207687_10042669 Ga0207687_100426695 101
1008 3300025928 Ga0207700_10152037 Ga0207700_101520373 101
1009 3300025928 Ga0207700_10171940 Ga0207700_101719403 101
1010 3300025928 Ga0207700_11139488 Ga0207700_111394881 101
1011 3300025929 Ga0207664_10098659 Ga0207664_100986594 101
1012 3300025929 Ga0207664_10312789 Ga0207664_103127892 101
1013 3300025929 Ga0207664_10345327 Ga0207664_103453271 101
1014 3300025929 Ga0207664_10674601 Ga0207664_106746012 101
1015 3300025929 Ga0207664_10953228 Ga0207664_109532282 101
1016 3300025929 Ga0207664_10961390 Ga0207664_109613902 101
1017 3300025929 Ga0207664_11813334 Ga0207664_118133342 101
1018 3300025931 Ga0207644_10559527 Ga0207644_105595272 101
1019 3300025932 Ga0207690_10204401 Ga0207690_102044012 101
1020 3300025938 Ga0207704_10783562 Ga0207704_107835621 101
1021 3300025939 Ga0207665_10282019 Ga0207665_102820192 101
1022 3300025939 Ga0207665_10818831 Ga0207665_108188312 101
1023 3300025941 Ga0207711_12084672 Ga0207711_120846721 101
1024 3300025944 Ga0207661_10150474 Ga0207661_101504741 101
1025 3300025945 Ga0207679_10028264 Ga0207679_100282643 101
1026 3300025949 Ga0207667_10237986 Ga0207667_102379862 101
1027 3300026023 Ga0207677_11203927 Ga0207677_112039272 101
1028 3300026041 Ga0207639_11456161 Ga0207639_114561612 101
1029 3300026078 Ga0207702_10007978 Ga0207702_1000797810 101
1030 3300026088 Ga0207641_10085877 Ga0207641_100858772 101
1031 3300026116 Ga0207674_10072656 Ga0207674_100726565 101
1032 3300027907 Ga0207428_10336742 Ga0207428_103367422 101
1033 3300035119 Ga0373956_0147134 Ga0373956_0147134_374_679 101
1034 3300035170 Ga0373943_0233583 Ga0373943_0233583_260_568 101
1035 3300035172 Ga0373955_0787509 Ga0373955_0787509_126_431 101
1036 3300035410 Ga0373924_0368145 Ga0373924_0368145_12_317 101
1037 3300035725 Ga0373947_0428733 Ga0373947_0428733_496_804 101
1038 3300036401 Ga0373937_0528235 Ga0373937_0528235_768_1073 101
1039 3300036401 Ga0373937_1214486 Ga0373937_1214486_67_372 101
1040 3300037068 Ga0373925_1357605 Ga0373925_1357605_196_504 101
1041 3300037418 Ga0395900_0130545 Ga0395900_0130545_1224_1529 101
1042 3300037466 Ga0395898_0752584 Ga0395898_0752584_112_447 101
1043 3300037466 Ga0395898_1519433 Ga0395898_1519433_29_334 101
1044 3300038443 Ga0395901_0037180 Ga0395901_0037180_4645_4950 101
1045 3300038443 Ga0395901_1357511 Ga0395901_1357511_324_629 101
1046 3300041452 Ga0451793_0829543 Ga0451793_0829543_24_329 101
1047 3300044656 Ga0466969_0002720 Ga0466969_0002720_2003_2308 101
1048 3300044656 Ga0466969_0535441 Ga0466969_0535441_192_497 101
1049 3300044683 Ga0466965_0005134 Ga0466965_0005134_698_1003 101
1050 3300044683 Ga0466965_0018262 Ga0466965_0018262_465_770 101
1051 3300044683 Ga0466965_0040756 Ga0466965_0040756_1218_1523 101
1052 3300044684 Ga0466966_0330036 Ga0466966_0330036_45_350 101
1053 3300044693 Ga0466961_0004361 Ga0466961_0004361_6566_6871 101
1054 3300044693 Ga0466961_0014149 Ga0466961_0014149_495_800 101
1055 3300044693 Ga0466961_0050729 Ga0466961_0050729_484_789 101
1056 3300044694 Ga0466963_0000776 Ga0466963_0000776_4188_4493 101
1057 3300044694 Ga0466963_0003553 Ga0466963_0003553_1474_1779 101
1058 3300044694 Ga0466963_0004108 Ga0466963_0004108_1989_2294 101
1059 3300044694 Ga0466963_0005116 Ga0466963_0005116_2473_2808 101
1060 3300044694 Ga0466963_0009464 Ga0466963_0009464_4616_4921 101
1061 3300044694 Ga0466963_0016673 Ga0466963_0016673_79_384 101
1062 3300044694 Ga0466963_0019292 Ga0466963_0019292_1946_2251 101
1063 3300044694 Ga0466963_0053357 Ga0466963_0053357_245_550 101
1064 3300044694 Ga0466963_0053952 Ga0466963_0053952_849_1154 101
1065 3300044694 Ga0466963_0082675 Ga0466963_0082675_859_1164 101
1066 3300044694 Ga0466963_0198757 Ga0466963_0198757_576_881 101
1067 3300044694 Ga0466963_0199219 Ga0466963_0199219_427_732 101
1068 3300044694 Ga0466963_0231225 Ga0466963_0231225_148_453 101
1069 3300044694 Ga0466963_0353768 Ga0466963_0353768_14_319 101
1070 3300044694 Ga0466963_0463261 Ga0466963_0463261_571_876 101
1071 3300044694 Ga0466963_0464918 Ga0466963_0464918_472_777 101
1072 3300044694 Ga0466963_0557552 Ga0466963_0557552_239_544 101
1073 3300044694 Ga0466963_0734292 Ga0466963_0734292_260_565 101
1074 3300044706 Ga0466964_0004036 Ga0466964_0004036_5050_5355 101
1075 3300044706 Ga0466964_0022709 Ga0466964_0022709_129_434 101
1076 3300044706 Ga0466964_0084888 Ga0466964_0084888_598_903 101
1077 3300044706 Ga0466964_0087302 Ga0466964_0087302_713_1018 101
1078 3300044706 Ga0466964_0123702 Ga0466964_0123702_477_782 101
1079 3300044706 Ga0466964_0156525 Ga0466964_0156525_219_524 101
1080 3300044706 Ga0466964_0187280 Ga0466964_0187280_44_349 101
1081 3300044706 Ga0466964_0244480 Ga0466964_0244480_56_361 101
1082 3300044719 Ga0466971_0002654 Ga0466971_0002654_3483_3788 101
1083 3300044719 Ga0466971_0035954 Ga0466971_0035954_1582_1887 101
1084 3300044735 Ga0466968_0003607 Ga0466968_0003607_4235_4540 101
1085 3300044735 Ga0466968_0053026 Ga0466968_0053026_536_841 101
1086 3300044735 Ga0466968_0067367 Ga0466968_0067367_939_1244 101
1087 3300044735 Ga0466968_0124926 Ga0466968_0124926_598_903 101
1088 3300044735 Ga0466968_0147904 Ga0466968_0147904_497_802 101
1089 3300044735 Ga0466968_0313446 Ga0466968_0313446_235_540 101
1090 3300044735 Ga0466968_0468475 Ga0466968_0468475_302_607 101
1091 3300044765 Ga0466970_0064092 Ga0466970_0064092_1356_1661 101
1092 3300044765 Ga0466970_0368588 Ga0466970_0368588_62_367 101
1093 3300044842 Ga0466957_0002420 Ga0466957_0002420_5961_6266 101
1094 3300044842 Ga0466957_0006059 Ga0466957_0006059_6274_6579 101
1095 3300044842 Ga0466957_0016735 Ga0466957_0016735_2727_3032 101
1096 3300044842 Ga0466957_0023038 Ga0466957_0023038_1254_1559 101
1097 3300044842 Ga0466957_0032867 Ga0466957_0032867_65_400 101
1098 3300044842 Ga0466957_0058404 Ga0466957_0058404_382_687 101
1099 3300044842 Ga0466957_0431642 Ga0466957_0431642_260_565 101
1100 3300044842 Ga0466957_0758023 Ga0466957_0758023_195_500 101
1101 3300044901 Ga0466960_0030757 Ga0466960_0030757_921_1226 101
1102 3300044901 Ga0466960_0125647 Ga0466960_0125647_183_518 101
1103 3300044901 Ga0466960_0237885 Ga0466960_0237885_526_831 101
1104 3300044901 Ga0466960_0387984 Ga0466960_0387984_37_342 101
1105 3300045049 Ga0466959_0013001 Ga0466959_0013001_2003_2308 101
1106 3300045049 Ga0466959_0214073 Ga0466959_0214073_533_838 101
1107 3300045049 Ga0466959_0954315 Ga0466959_0954315_56_361 101
1108 3300045836 Ga0466958_0002506 Ga0466958_0002506_8823_9128 101
1109 3300045836 Ga0466958_0056805 Ga0466958_0056805_1641_1946 101
1110 3300045836 Ga0466958_0070654 Ga0466958_0070654_657_962 101
1111 3300045836 Ga0466958_0080370 Ga0466958_0080370_1055_1360 101
1112 3300045836 Ga0466958_0089662 Ga0466958_0089662_1485_1790 101
1113 3300045836 Ga0466958_0322644 Ga0466958_0322644_269_604 101
1114 3300045836 Ga0466958_0398015 Ga0466958_0398015_20_325 101
1115 3300045836 Ga0466958_0429660 Ga0466958_0429660_194_499 101
1116 3300045976 Ga0466967_0000305 Ga0466967_0000305_20475_20780 101
1117 3300045976 Ga0466967_0001226 Ga0466967_0001226_12108_12413 101
1118 3300045976 Ga0466967_0004124 Ga0466967_0004124_7373_7708 101
1119 3300045976 Ga0466967_0004340 Ga0466967_0004340_6758_7063 101
1120 3300045976 Ga0466967_0018003 Ga0466967_0018003_3504_3809 101
1121 3300045976 Ga0466967_0032578 Ga0466967_0032578_872_1177 101
1122 3300045976 Ga0466967_0037090 Ga0466967_0037090_1671_1976 101
1123 3300045976 Ga0466967_0048143 Ga0466967_0048143_1809_2114 101
1124 3300045976 Ga0466967_0079366 Ga0466967_0079366_809_1114 101
1125 3300045976 Ga0466967_0105674 Ga0466967_0105674_1178_1483 101
1126 3300045976 Ga0466967_0137670 Ga0466967_0137670_898_1203 101
1127 3300045976 Ga0466967_0141258 Ga0466967_0141258_440_745 101
1128 3300045976 Ga0466967_0269145 Ga0466967_0269145_1190_1495 101
1129 3300045976 Ga0466967_0321827 Ga0466967_0321827_1049_1354 101
1130 3300045976 Ga0466967_0554244 Ga0466967_0554244_471_776 101
1131 3300045976 Ga0466967_0585203 Ga0466967_0585203_235_540 101
1132 3300045976 Ga0466967_0633144 Ga0466967_0633144_718_1023 101
1133 3300045976 Ga0466967_0695874 Ga0466967_0695874_531_836 101
1134 3300046452 Ga0495617_260043 Ga0495617_260043_169_474 101
1135 3300046454 Ga0495592_0090625 Ga0495592_0090625_1628_1933 101
1136 3300046455 Ga0495603_0030547 Ga0495603_0030547_2094_2399 101
1137 3300046459 Ga0495629_0031510 Ga0495629_0031510_707_1012 101
1138 3300046459 Ga0495629_0063722 Ga0495629_0063722_1483_1788 101
1139 3300046459 Ga0495629_0080940 Ga0495629_0080940_1018_1323 101
1140 3300046461 Ga0495641_0068018 Ga0495641_0068018_397_702 101
1141 3300046461 Ga0495641_0074063 Ga0495641_0074063_980_1285 101
1142 3300046461 Ga0495641_0076606 Ga0495641_0076606_758_1063 101
1143 3300046461 Ga0495641_0122062 Ga0495641_0122062_150_455 101
1144 3300046461 Ga0495641_0226874 Ga0495641_0226874_492_797 101
1145 3300046462 Ga0495651_0397543 Ga0495651_0397543_541_846 101
1146 3300046462 Ga0495651_0522946 Ga0495651_0522946_41_346 101
1147 3300046463 Ga0495653_0066285 Ga0495653_0066285_687_992 101
1148 3300046463 Ga0495653_0093019 Ga0495653_0093019_1664_1969 101
1149 3300046463 Ga0495653_0250214 Ga0495653_0250214_737_1042 101
1150 3300046463 Ga0495653_0381350 Ga0495653_0381350_139_444 101
1151 3300046473 Ga0495582_0070506 Ga0495582_0070506_217_522 101
1152 3300046473 Ga0495582_0093688 Ga0495582_0093688_891_1196 101
1153 3300046473 Ga0495582_0105173 Ga0495582_0105173_174_479 101
1154 3300046473 Ga0495582_0429202 Ga0495582_0429202_373_678 101
1155 3300046475 Ga0495639_0318669 Ga0495639_0318669_148_453 101
1156 3300046476 Ga0495662_0120790 Ga0495662_0120790_588_893 101
1157 3300046476 Ga0495662_0278477 Ga0495662_0278477_31_336 101
1158 3300046477 Ga0495664_0098386 Ga0495664_0098386_543_848 101
1159 3300046477 Ga0495664_0292659 Ga0495664_0292659_188_493 101
1160 3300046491 Ga0495584_0039698 Ga0495584_0039698_447_752 101
1161 3300046492 Ga0495585_0095454 Ga0495585_0095454_761_1066 101
1162 3300046500 Ga0495596_0243238 Ga0495596_0243238_322_627 101
1163 3300046511 Ga0495608_0010256 Ga0495608_0010256_1860_2165 101
1164 3300046511 Ga0495608_0030218 Ga0495608_0030218_912_1217 101
1165 3300046511 Ga0495608_0066451 Ga0495608_0066451_1046_1351 101
1166 3300046514 Ga0495618_0175150 Ga0495618_0175150_501_806 101
1167 3300046514 Ga0495618_0272165 Ga0495618_0272165_325_630 101
1168 3300046516 Ga0495628_0137338 Ga0495628_0137338_241_546 101
1169 3300046516 Ga0495628_0211095 Ga0495628_0211095_1127_1432 101
1170 3300046516 Ga0495628_1053988 Ga0495628_1053988_137_442 101
1171 3300046516 Ga0495628_1091268 Ga0495628_1091268_53_358 101
1172 3300046517 Ga0495630_0011938 Ga0495630_0011938_2185_2490 101
1173 3300046517 Ga0495630_0255961 Ga0495630_0255961_708_1013 101
1174 3300046518 Ga0495631_0047188 Ga0495631_0047188_906_1211 101
1175 3300046523 Ga0495644_0003153 Ga0495644_0003153_3813_4118 101
1176 3300046525 Ga0495663_0144716 Ga0495663_0144716_487_792 101
1177 3300046526 Ga0495666_0366906 Ga0495666_0366906_207_515 101
1178 3300046529 Ga0495652_0192981 Ga0495652_0192981_801_1106 101
1179 3300046529 Ga0495652_0226915 Ga0495652_0226915_709_1014 101
1180 3300046529 Ga0495652_0356934 Ga0495652_0356934_674_979 101
1181 3300046533 Ga0495640_0010703 Ga0495640_0010703_3139_3444 101
1182 3300046533 Ga0495640_0904540 Ga0495640_0904540_203_508 101
1183 3300046535 Ga0495586_0046997 Ga0495586_0046997_1694_1999 101
1184 3300046535 Ga0495586_0553009 Ga0495586_0553009_171_476 101
1185 3300046536 Ga0495587_0015592 Ga0495587_0015592_2787_3092 101
1186 3300046536 Ga0495587_0109656 Ga0495587_0109656_1260_1565 101
1187 3300046536 Ga0495587_0501388 Ga0495587_0501388_87_392 101
1188 3300046543 Ga0495645_0030615 Ga0495645_0030615_3443_3748 101
1189 3300046543 Ga0495645_0396319 Ga0495645_0396319_409_714 101
1190 3300046559 Ga0495667_0026239 Ga0495667_0026239_2858_3163 101
1191 3300046559 Ga0495667_0056684 Ga0495667_0056684_1741_2046 101
1192 3300046559 Ga0495667_0518108 Ga0495667_0518108_200_505 101
1193 3300046642 Ga0495634_0041235 Ga0495634_0041235_786_1091 101
1194 3300046642 Ga0495634_0117068 Ga0495634_0117068_1031_1336 101
1195 3300046648 Ga0495611_0073931 Ga0495611_0073931_821_1126 101
1196 3300046663 Ga0495635_0014662 Ga0495635_0014662_3539_3844 101
1197 3300046663 Ga0495635_0095244 Ga0495635_0095244_1237_1542 101
1198 3300046663 Ga0495635_0518920 Ga0495635_0518920_330_635 101
1199 3300046664 Ga0495659_0102707 Ga0495659_0102707_251_556 101
1200 3300046674 Ga0495588_0338886 Ga0495588_0338886_112_417 101
1201 3300046674 Ga0495588_0376607 Ga0495588_0376607_182_487 101
1202 3300046675 Ga0495657_0038643 Ga0495657_0038643_1897_2211 101
1203 3300046675 Ga0495657_0178276 Ga0495657_0178276_555_860 101
1204 3300046675 Ga0495657_0284889 Ga0495657_0284889_235_540 101
1205 3300046675 Ga0495657_0471131 Ga0495657_0471131_198_503 101
1206 3300046675 Ga0495657_0596306 Ga0495657_0596306_46_351 101
1207 3300046678 Ga0495599_0000985 Ga0495599_0000985_2808_3113 101
1208 3300046678 Ga0495599_0619394 Ga0495599_0619394_45_350 101
1209 3300046679 Ga0495623_0559217 Ga0495623_0559217_157_462 101
1210 3300046680 Ga0495646_0139578 Ga0495646_0139578_1032_1337 101
1211 3300046681 Ga0495647_0349367 Ga0495647_0349367_224_529 101
1212 3300046683 Ga0495658_0080930 Ga0495658_0080930_581_886 101
1213 3300046683 Ga0495658_0952362 Ga0495658_0952362_231_536 101
1214 3300046689 Ga0495613_0020548 Ga0495613_0020548_4264_4569 101
1215 3300046689 Ga0495613_0199743 Ga0495613_0199743_20_325 101
1216 3300046689 Ga0495613_0455306 Ga0495613_0455306_313_618 101
1217 3300046690 Ga0495624_0024422 Ga0495624_0024422_3036_3344 101
1218 3300046690 Ga0495624_0137135 Ga0495624_0137135_289_594 101
1219 3300046691 Ga0495670_0083127 Ga0495670_0083127_1001_1306 101
1220 3300046794 Ga0495589_0027871 Ga0495589_0027871_307_612 101
1221 3300046809 Ga0495600_0058200 Ga0495600_0058200_1806_2111 101
1222 3300046809 Ga0495600_0198957 Ga0495600_0198957_810_1115 101
1223 3300047315 Ga0495581_0074341 Ga0495581_0074341_1492_1797 101
1224 3300047315 Ga0495581_0730711 Ga0495581_0730711_218_523 101
1225 3300047317 Ga0495604_0114798 Ga0495604_0114798_1145_1450 101
1226 3300047317 Ga0495604_0496569 Ga0495604_0496569_393_698 101
1227 3300047318 Ga0495636_0085772 Ga0495636_0085772_143_448 101
1228 3300047319 Ga0495674_0015045 Ga0495674_0015045_2889_3194 101
1229 3300047319 Ga0495674_0543827 Ga0495674_0543827_345_650 101
1230 3300047321 Ga0495676_0105804 Ga0495676_0105804_446_751 101
1231 3300047321 Ga0495676_0264422 Ga0495676_0264422_743_1048 101
1232 3300047321 Ga0495676_0508044 Ga0495676_0508044_226_531 101
1233 3300047322 Ga0495680_0030642 Ga0495680_0030642_1498_1803 101
1234 3300047322 Ga0495680_0077873 Ga0495680_0077873_928_1233 101
1235 3300047322 Ga0495680_0161642 Ga0495680_0161642_429_734 101
1236 3300047322 Ga0495680_0862591 Ga0495680_0862591_156_470 101
1237 3300047444 Ga0495675_0646251 Ga0495675_0646251_50_355 101
1238 3300047445 Ga0495677_0037427 Ga0495677_0037427_427_732 101
1239 3300047446 Ga0495679_173980 Ga0495679_173980_134_439 101
1240 3300047471 Ga0495684_0003775 Ga0495684_0003775_5210_5515 101
1241 3300047673 Ga0495593_0085014 Ga0495593_0085014_1269_1574 101
1242 3300047673 Ga0495593_0460429 Ga0495593_0460429_189_494 101
1243 3300048088 Ga0495602_0212365 Ga0495602_0212365_781_1086 101
1244 3300048089 Ga0495614_0222244 Ga0495614_0222244_215_520 101
1245 3300048903 Ga0496100_0287892 Ga0496100_0287892_771_1076 101
1246 3300048903 Ga0496100_0755740 Ga0496100_0755740_296_601 101
1247 3300048904 Ga0496101_0103316 Ga0496101_0103316_638_943 101
1248 3300048904 Ga0496101_0397664 Ga0496101_0397664_197_502 101
1249 3300048904 Ga0496101_0946826 Ga0496101_0946826_130_435 101
1250 3300048905 Ga0496102_0043883 Ga0496102_0043883_2582_2887 101
1251 3300048905 Ga0496102_0189305 Ga0496102_0189305_634_939 101
1252 3300048905 Ga0496102_0704118 Ga0496102_0704118_585_890 101
1253 3300048906 Ga0496103_0041322 Ga0496103_0041322_1288_1593 101
1254 3300048907 Ga0496104_0013704 Ga0496104_0013704_2250_2555 101
1255 3300048907 Ga0496104_0014178 Ga0496104_0014178_1060_1365 101
1256 3300048907 Ga0496104_0282156 Ga0496104_0282156_1137_1442 101
1257 3300048908 Ga0496105_0003059 Ga0496105_0003059_453_758 101
1258 3300048908 Ga0496105_0172652 Ga0496105_0172652_585_890 101
1259 3300048908 Ga0496105_0195322 Ga0496105_0195322_295_600 101
1260 3300048908 Ga0496105_0361803 Ga0496105_0361803_661_966 101
1261 3300048908 Ga0496105_0549488 Ga0496105_0549488_502_807 101
1262 3300048909 Ga0496106_0084656 Ga0496106_0084656_897_1202 101
1263 3300048910 Ga0496107_0395981 Ga0496107_0395981_444_749 101
1264 3300048910 Ga0496107_0409509 Ga0496107_0409509_300_605 101
1265 3300048910 Ga0496107_0436903 Ga0496107_0436903_174_479 101
1266 3300048911 Ga0496108_0009640 Ga0496108_0009640_6874_7179 101
1267 3300048911 Ga0496108_0016952 Ga0496108_0016952_682_987 101
1268 3300048911 Ga0496108_0211401 Ga0496108_0211401_1300_1635 101
1269 3300048912 Ga0496109_0027557 Ga0496109_0027557_2229_2534 101
1270 3300048912 Ga0496109_0103589 Ga0496109_0103589_1164_1469 101
1271 3300048912 Ga0496109_0111390 Ga0496109_0111390_1600_1905 101
1272 3300048912 Ga0496109_0515020 Ga0496109_0515020_411_716 101
1273 3300048912 Ga0496109_1213516 Ga0496109_1213516_80_385 101
1274 3300048913 Ga0496110_0206589 Ga0496110_0206589_1397_1702 101
1275 3300048913 Ga0496110_0346168 Ga0496110_0346168_727_1032 101
1276 3300048913 Ga0496110_1747632 Ga0496110_1747632_174_479 101
1277 3300048914 Ga0496111_0397658 Ga0496111_0397658_283_588 101
1278 3300048914 Ga0496111_0538422 Ga0496111_0538422_138_443 101
1279 3300048915 Ga0496112_0168622 Ga0496112_0168622_1186_1491 101
1280 3300048915 Ga0496112_1157015 Ga0496112_1157015_147_452 101
1281 3300048916 Ga0496113_0056253 Ga0496113_0056253_546_851 101
1282 3300048916 Ga0496113_0105053 Ga0496113_0105053_365_670 101
1283 3300048916 Ga0496113_0324049 Ga0496113_0324049_408_713 101
1284 3300048917 Ga0496114_0126730 Ga0496114_0126730_1399_1704 101
1285 3300048917 Ga0496114_0452525 Ga0496114_0452525_428_733 101
1286 3300048917 Ga0496114_0689422 Ga0496114_0689422_267_572 101
1287 3300048917 Ga0496114_0955299 Ga0496114_0955299_394_699 101
1288 3300048918 Ga0496115_0006785 Ga0496115_0006785_65_400 101
1289 3300048918 Ga0496115_0154873 Ga0496115_0154873_400_705 101
1290 3300048918 Ga0496115_0597648 Ga0496115_0597648_405_710 101
1291 3300048918 Ga0496115_0980022 Ga0496115_0980022_32_337 101
1292 3300048923 Ga0496120_0382867 Ga0496120_0382867_284_589 101
1293 3300049583 Ga0501067_0010737 Ga0501067_0010737_1343_1648 101
1294 3300050511 nmdc:mga08y16_109680_c1 nmdc:mga08y16_109680_c1_491_796 101
1295 3300050512 nmdc:mga0n895_4184_c1 nmdc:mga0n895_4184_c1_7211_7516 101
1296 3300050512 nmdc:mga0n895_956605_c1 nmdc:mga0n895_956605_c1_492_800 101
1297 3300050513 nmdc:mga0rr50_163597_c1 nmdc:mga0rr50_163597_c1_769_1074 101
1298 3300050515 nmdc:mga0a205_1159908_c1 nmdc:mga0a205_1159908_c1_279_587 101
1299 3300050515 nmdc:mga0a205_117449_c1 nmdc:mga0a205_117449_c1_1853_2158 101
1300 3300053077 Ga0495601_0007569 Ga0495601_0007569_3242_3547 101
1301 3300053077 Ga0495601_0044527 Ga0495601_0044527_1980_2285 101
1302 3300053077 Ga0495601_0239562 Ga0495601_0239562_244_549 101
1303 3300053077 Ga0495601_0338170 Ga0495601_0338170_455_760 101
1304 3300053078 Ga0495612_0019918 Ga0495612_0019918_1999_2304 101
1305 3300053078 Ga0495612_0150435 Ga0495612_0150435_628_933 101
1306 3300053078 Ga0495612_0239745 Ga0495612_0239745_20_325 101
1307 3300053084 Ga0495595_0005153 Ga0495595_0005153_3260_3565 101
1308 3300053084 Ga0495595_0006129 Ga0495595_0006129_3866_4171 101
1309 3300053084 Ga0495595_0016554 Ga0495595_0016554_1704_2009 101
1310 3300053084 Ga0495595_0292696 Ga0495595_0292696_69_383 101
1311 3300053085 Ga0495619_0021257 Ga0495619_0021257_3505_3810 101
1312 3300053085 Ga0495619_0062641 Ga0495619_0062641_1273_1578 101
1313 3300053085 Ga0495619_0065601 Ga0495619_0065601_383_688 101
1314 3300053085 Ga0495619_0206395 Ga0495619_0206395_715_1020 101
1315 3300053085 Ga0495619_0869731 Ga0495619_0869731_176_490 101
1316 3300061719 Ga0466962_0005398 Ga0466962_0005398_3149_3454 101
1317 3300061719 Ga0466962_0012746 Ga0466962_0012746_1730_2035 101
1318 3300061719 Ga0466962_0055714 Ga0466962_0055714_816_1121 101
1319 3300061719 Ga0466962_0063658 Ga0466962_0063658_1068_1373 101
1320 3300061719 Ga0466962_0403782 Ga0466962_0403782_184_489 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13560

HTH_31

Helix-turn-helix domain

22

84

0.95

PF01381

HTH_3

Helix-turn-helix

26

81

0.94

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

25

85

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9456 12 69
2cro-assembly1.cif.gz_A structure of phage 434 cro protein at 2.35 angstroms resolution 0.9412 11 68
4yba-assembly1.cif.gz_A the structure of the c.kpn2i controller protein 0.9372 13 65
3zkc-assembly1.cif.gz_A crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9338 13 70
3qq6-assembly1.cif.gz_A the n-terminal dna binding domain of sinr from bacillus subtilis 0.9314 12 71
ID Description Score Start End Superfamily
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9456 12 69 1.10.260.40
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9397 12 71 1.10.260.40
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9372 13 65 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9338 13 70 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9259 12 71 1.10.260.40
ID Description Score Start End GO Terms
AF-R5EGC9-F1-model_v4 Peptidase S24-like protein 0.9728 10 68 GO:0003677
AF-D5XBY9-F1-model_v4 Transcriptional regulator, XRE family 0.9692 11 71 GO:0003677
GO:0003700
GO:0005829
AF-A0A844K915-F1-model_v4 deleted 0.9684 10 71
AF-A0A848KQ95-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9668 12 75 GO:0003677
GO:0003700
GO:0005829
AF-L0DF52-F1-model_v4 Putative transcriptional regulator 0.9641 10 69 GO:0003677

Feature Viewer

pLDDT pTM Quality
87.42 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map