F492974

General Info

Members Datasets Scaffolds Average Seq Length
1320 591 1222 136

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0153619|Ga0495686_0153619_254_733
Length 159
Sequence MDTGSPEENASKQESKFVRIKQGTSNVDQMFSKWQPAALSLFRFITGLLLFQYGVAKIFKFPVLPYFADIPPLIVAAGLIELVLGALLMIGLFTRPVAFILAGEMAFAYFMGHMFKSGAPVFLPLLNGGTAAILFCFACLYLATSGGGPISVDGMRGKK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
8 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
11 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
12 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
13 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
14 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
15 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
16 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
17 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
18 2791355199
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
21 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
22 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
23 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
24 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
25 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
26 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
27 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
28 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
29 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
30 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
31 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
32 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
33 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
34 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
35 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
36 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
37 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
38 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
39 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
40 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
41 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
42 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
43 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
44 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
45 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
46 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
47 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
48 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
49 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
50 2904699407
51 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
52 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
53 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
54 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
55 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
56 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
57 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
58 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
59 2922425934
60 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
61 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
62 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
63 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
64 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
65 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
66 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
67 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
68 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
69 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
70 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
71 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
72 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
73 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
74 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
75 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
76 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
77 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
78 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
79 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
80 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
81 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
82 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
83 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
84 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
85 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
86 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
87 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
88 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
89 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
90 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
92 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
93 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
97 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
98 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
99 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
100 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
101 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
102 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
103 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
104 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
105 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
106 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
107 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
108 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
109 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
110 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
111 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
112 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
113 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
114 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
115 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
116 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
117 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
118 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
119 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
120 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
121 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
122 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
123 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
124 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
125 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
126 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
127 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
128 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
129 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
130 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
131 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
132 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
133 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
134 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
135 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
136 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
137 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
138 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
139 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
140 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
141 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
142 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
143 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
144 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
145 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
146 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
147 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
148 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
149 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
150 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
151 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
152 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
153 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
154 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
155 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
156 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
157 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
158 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
159 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
160 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
161 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
162 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
163 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
164 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
165 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
166 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
167 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
168 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
169 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
170 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
171 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
172 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
173 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
174 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
175 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
176 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
177 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
178 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
179 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
180 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
181 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
182 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
183 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
184 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
185 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
186 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
187 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
188 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
189 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
190 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
191 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
192 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
193 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
194 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
195 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
196 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
197 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
198 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
199 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
200 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
201 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
202 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
203 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
204 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
205 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
206 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
207 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
208 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
209 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
210 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
211 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
212 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
213 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
214 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
215 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
216 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
217 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
218 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
219 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
220 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
221 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
222 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
223 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
224 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
225 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
226 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
227 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
228 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
230 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
231 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
233 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
235 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
298 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
299 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
300 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
306 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
307 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
308 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
309 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
310 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
311 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
312 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
313 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
314 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
315 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
316 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
317 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
318 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
319 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
320 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
321 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
323 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
324 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
325 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
326 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
327 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
328 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
329 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
330 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
331 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
332 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
333 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
334 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
335 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
336 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
337 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
338 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
339 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
340 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
341 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
342 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
343 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
344 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
345 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
346 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
347 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
348 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
349 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
350 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
351 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
352 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
353 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
354 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
355 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
356 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
357 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
358 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
359 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
360 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
361 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
362 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
363 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
364 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
365 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
366 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
367 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
368 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
369 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
370 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
371 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
372 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
373 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
374 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
375 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
376 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
377 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
378 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
379 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
380 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
381 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
382 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
383 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
384 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
385 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
386 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
387 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
388 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
389 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
390 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
391 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
392 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
393 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
394 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
395 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
396 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
397 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
398 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
399 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
400 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
401 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
402 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
403 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
404 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
405 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
406 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
407 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
408 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
409 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
410 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
411 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
412 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
413 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
414 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
415 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
416 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
417 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
418 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
419 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
420 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
421 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
422 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
423 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
424 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
425 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
426 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
427 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
428 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
429 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
430 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
431 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
432 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
433 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
434 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
435 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
436 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
437 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
438 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
439 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
440 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
441 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
442 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
443 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
444 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
445 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
446 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
447 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
448 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
449 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
450 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
451 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
452 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
453 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
454 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
455 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
456 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
457 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
458 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
459 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
460 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
461 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
462 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
477 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
478 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
479 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
480 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
481 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
482 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
483 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
484 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
485 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
486 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
487 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
488 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
489 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
490 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
493 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
494 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
495 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
496 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
497 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
498 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
499 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
500 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
501 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
502 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
503 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
504 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
505 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
506 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
507 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
508 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
509 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
510 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
511 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
512 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
513 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
514 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
515 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
516 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
517 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
518 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
519 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
520 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
521 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
522 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
523 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
524 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
525 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
526 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
527 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
528 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
529 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
530 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
531 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
532 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
533 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
534 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
535 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
536 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
537 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
538 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
539 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
540 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
541 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
542 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
543 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
544 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
545 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
546 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
547 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
548 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
549 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
550 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
551 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
552 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
553 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
554 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
555 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
556 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
557 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
558 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
559 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
560 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
561 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
562 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
563 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
564 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
565 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
566 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
567 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
568 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
569 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
570 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
571 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
572 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
573 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
574 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
575 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
576 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
577 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
578 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
579 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
580 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
581 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
582 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
583 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
584 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
585 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
586 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
587 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
588 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
589 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
590 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
591 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.48
Metatranscriptomes 0.3
Isolates 7.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.88
Nodule 5.76
Rhizoplane 3.86
Rhizosphere 63.41
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1028333 3300000549 Bacteria 654
2 JGI24750J21931_1007657 3300002070 Bacteria 1362
3 JGI24742J22300_10012428 3300002244 Bacteria 1419
4 JGI25153J46596_10000472 3300003215 Bacteria 25779
5 JGI25153J46596_10005441 3300003215 Bacteria 6683
6 JGI25153J46596_10009052 3300003215 Bacteria 4677
7 JGI25153J46596_10009819 3300003215 Bacteria 4396
8 JGI25153J46596_10011461 3300003215 Bacteria 3917
9 JGI25160J50197_1002192 3300003354 Bacteria 9182
10 JGI25160J50197_1008449 3300003354 Bacteria 3921
11 JGI25160J50197_1013575 3300003354 Bacteria 2769
12 JGI25404J52841_10022340 3300003659 Bacteria 1367
13 JGI25404J52841_10053954 3300003659 Bacteria 844
14 Ga0055526_1009092 3300003771 Bacteria 4846
15 Ga0055531_10014195 3300003794 Bacteria 3607
16 JGI25405J52794_10014185 3300003911 Bacteria 1553
17 Ga0055543_1015878 3300004625 Bacteria 1440
18 Ga0065165_1003559 3300005262 Bacteria 10766
19 Ga0065165_1003853 3300005262 Bacteria 9962
20 Ga0065165_1018994 3300005262 Bacteria 2469
21 Ga0065165_1079852 3300005262 Bacteria 851
22 Ga0065165_1114374 3300005262 Bacteria 660
23 Ga0065707_10273588 3300005295 Bacteria 1065
24 Ga0070676_10662571 3300005328 Bacteria 759
25 Ga0070683_100850693 3300005329 Bacteria 875
26 Ga0070690_100452997 3300005330 Bacteria 952
27 Ga0070670_100170963 3300005331 Bacteria 1885
28 Ga0070670_100572531 3300005331 Bacteria 1009
29 Ga0070670_100620259 3300005331 Bacteria 969
30 Ga0070670_102227136 3300005331 Bacteria 505
31 Ga0068869_100042838 3300005334 Bacteria 3248
32 Ga0068869_100085418 3300005334 Bacteria 2364
33 Ga0068869_100154070 3300005334 Bacteria 1784
34 Ga0068869_100761395 3300005334 Bacteria 830
35 Ga0068869_100900581 3300005334 Bacteria 765
36 Ga0068869_101045167 3300005334 Bacteria 713
37 Ga0070666_10053315 3300005335 Bacteria 2727
38 Ga0070666_10102740 3300005335 Bacteria 1971
39 Ga0070680_100110473 3300005336 Bacteria 2289
40 Ga0070680_101749694 3300005336 Bacteria 539
41 Ga0070682_100247304 3300005337 Bacteria 1284
42 Ga0068868_100153850 3300005338 Bacteria 1895
43 Ga0068868_100574773 3300005338 Bacteria 996
44 Ga0070660_100578933 3300005339 Bacteria 938
45 Ga0070660_100814677 3300005339 Bacteria 786
46 Ga0070689_101023400 3300005340 Bacteria 736
47 Ga0070691_10513533 3300005341 Bacteria 694
48 Ga0070661_100288474 3300005344 Bacteria 1275
49 Ga0070661_100405317 3300005344 Bacteria 1079
50 Ga0070661_100638715 3300005344 Bacteria 863
51 Ga0070661_101675607 3300005344 Bacteria 538
52 Ga0070668_100093470 3300005347 Bacteria 2373
53 Ga0070668_100214062 3300005347 Bacteria 1586
54 Ga0070668_100250748 3300005347 Bacteria 1469
55 Ga0070668_100548748 3300005347 Bacteria 1006
56 Ga0070668_100601784 3300005347 Bacteria 962
57 Ga0070668_100658320 3300005347 Bacteria 921
58 Ga0070669_100369757 3300005353 Bacteria 1167
59 Ga0070674_100771291 3300005356 Bacteria 828
60 Ga0070674_100997199 3300005356 Bacteria 735
61 Ga0070673_100252154 3300005364 Bacteria 1539
62 Ga0070688_100283257 3300005365 Bacteria 1192
63 Ga0070659_100401645 3300005366 Bacteria 1157
64 Ga0070659_100426481 3300005366 Bacteria 1122
65 Ga0070659_100927812 3300005366 Bacteria 762
66 Ga0070659_101526241 3300005366 Bacteria 596
67 Ga0070667_100073038 3300005367 Bacteria 2924
68 Ga0070667_101525634 3300005367 Bacteria 628
69 Ga0070709_10018262 3300005434 Bacteria 4035
70 Ga0070709_10056927 3300005434 Bacteria 2474
71 Ga0070714_100045655 3300005435 Bacteria 3714
72 Ga0070714_100160138 3300005435 Bacteria 2036
73 Ga0070714_100186990 3300005435 Bacteria 1888
74 Ga0070713_100052649 3300005436 Bacteria 3371
75 Ga0070713_100273740 3300005436 Bacteria 1547
76 Ga0070713_101247974 3300005436 Bacteria 720
77 Ga0070710_10006722 3300005437 Bacteria 5543
78 Ga0070710_10225180 3300005437 Bacteria 1195
79 Ga0070701_10088778 3300005438 Bacteria 1689
80 Ga0070701_11261695 3300005438 Bacteria 527
81 Ga0070711_100002267 3300005439 Bacteria 10903
82 Ga0070711_100007952 3300005439 Bacteria 6466
83 Ga0070711_100055202 3300005439 Bacteria 2743
84 Ga0070711_100136144 3300005439 Bacteria 1836
85 Ga0070705_100321880 3300005440 Bacteria 1117
86 Ga0070705_100993488 3300005440 Bacteria 681
87 Ga0070700_100129410 3300005441 Bacteria 1701
88 Ga0070663_100036074 3300005455 Bacteria 3434
89 Ga0070663_100043119 3300005455 Bacteria 3173
90 Ga0070663_100046224 3300005455 Bacteria 3079
91 Ga0070663_100060665 3300005455 Bacteria 2721
92 Ga0070663_100208731 3300005455 Bacteria 1528
93 Ga0070663_100435037 3300005455 Bacteria 1078
94 Ga0070663_101030048 3300005455 Bacteria 717
95 Ga0070678_100080216 3300005456 Bacteria 2471
96 Ga0070678_100322956 3300005456 Bacteria 1319
97 Ga0070678_100381895 3300005456 Bacteria 1219
98 Ga0070678_100567313 3300005456 Bacteria 1009
99 Ga0070678_100613113 3300005456 Bacteria 973
100 Ga0070662_100088795 3300005457 Bacteria 2317
101 Ga0070662_100570354 3300005457 Bacteria 950
102 Ga0070681_10093689 3300005458 Bacteria 2952
103 Ga0070681_10196417 3300005458 Bacteria 1936
104 Ga0068867_100373787 3300005459 Bacteria 1195
105 Ga0068867_100462130 3300005459 Bacteria 1084
106 Ga0070685_10210776 3300005466 Bacteria 1268
107 Ga0070685_10211748 3300005466 Bacteria 1265
108 Ga0070706_100153508 3300005467 Bacteria 2150
109 Ga0070707_100151016 3300005468 Bacteria 2262
110 Ga0070698_100049606 3300005471 Bacteria 4283
111 Ga0070698_100108450 3300005471 Bacteria 2743
112 Ga0070699_100085031 3300005518 Bacteria 2760
113 Ga0070684_100254342 3300005535 Bacteria 1606
114 Ga0070697_100346345 3300005536 Bacteria 1283
115 Ga0068853_100039389 3300005539 Bacteria 4030
116 Ga0068853_100089715 3300005539 Bacteria 2700
117 Ga0068853_100362898 3300005539 Bacteria 1350
118 Ga0068853_100436045 3300005539 Bacteria 1231
119 Ga0068853_100547786 3300005539 Bacteria 1096
120 Ga0070672_100246702 3300005543 Bacteria 1503
121 Ga0070672_101011848 3300005543 Bacteria 737
122 Ga0070695_100449823 3300005545 Bacteria 987
123 Ga0070696_100096905 3300005546 Bacteria 2108
124 Ga0070693_100034898 3300005547 Bacteria 2785
125 Ga0070693_100091598 3300005547 Bacteria 1834
126 Ga0070693_100296525 3300005547 Bacteria 1088
127 Ga0070665_100145669 3300005548 Bacteria 2371
128 Ga0070665_100199162 3300005548 Bacteria 2003
129 Ga0070665_100212898 3300005548 Bacteria 1933
130 Ga0070665_100263003 3300005548 Bacteria 1726
131 Ga0070665_100375948 3300005548 Bacteria 1428
132 Ga0070665_100388288 3300005548 Bacteria 1403
133 Ga0070665_100496407 3300005548 Bacteria 1232
134 Ga0070665_100835770 3300005548 Bacteria 934
135 Ga0070665_101315364 3300005548 Bacteria 732
136 Ga0068855_100420616 3300005563 Bacteria 1462
137 Ga0070664_101125925 3300005564 Bacteria 740
138 Ga0068857_100081351 3300005577 Bacteria 2892
139 Ga0068857_100414741 3300005577 Bacteria 1255
140 Ga0068854_100051014 3300005578 Bacteria 2963
141 Ga0068854_100117527 3300005578 Bacteria 2014
142 Ga0068854_100132481 3300005578 Bacteria 1905
143 Ga0068854_100486767 3300005578 Bacteria 1037
144 Ga0068854_101109823 3300005578 Bacteria 705
145 Ga0068856_100449393 3300005614 Bacteria 1309
146 Ga0068856_101300487 3300005614 Bacteria 742
147 Ga0070702_100152071 3300005615 Bacteria 1487
148 Ga0068852_100037914 3300005616 Bacteria 4046
149 Ga0068852_100258731 3300005616 Bacteria 1670
150 Ga0068852_100655479 3300005616 Bacteria 1057
151 Ga0068852_101462316 3300005616 Bacteria 706
152 Ga0068859_100058789 3300005617 Bacteria 3873
153 Ga0068859_100627225 3300005617 Bacteria 1167
154 Ga0068864_101511805 3300005618 Bacteria 674
155 Ga0068864_101760038 3300005618 Bacteria 625
156 Ga0068866_10558304 3300005718 Bacteria 767
157 Ga0068861_100139922 3300005719 Bacteria 1974
158 Ga0068861_100167241 3300005719 Bacteria 1819
159 Ga0068861_100371601 3300005719 Bacteria 1260
160 Ga0068851_10221768 3300005834 Bacteria 1063
161 Ga0068870_10421258 3300005840 Bacteria 874
162 Ga0068863_100035315 3300005841 Bacteria 4762
163 Ga0068863_100636971 3300005841 Bacteria 1057
164 Ga0068863_101638617 3300005841 Bacteria 653
165 Ga0068858_100207233 3300005842 Bacteria 1855
166 Ga0068858_100388636 3300005842 Bacteria 1339
167 Ga0068858_100676498 3300005842 Bacteria 1003
168 Ga0068858_101293741 3300005842 Bacteria 717
169 Ga0068860_100000503 3300005843 Bacteria 48508
170 Ga0068860_100093721 3300005843 Bacteria 2862
171 Ga0068860_100237968 3300005843 Bacteria 1770
172 Ga0068860_100569987 3300005843 Bacteria 1135
173 Ga0068860_101526264 3300005843 Bacteria 690
174 Ga0068860_102159872 3300005843 Bacteria 578
175 Ga0068862_100276166 3300005844 Bacteria 1538
176 Ga0068862_100336751 3300005844 Bacteria 1396
177 Ga0081455_10003167 3300005937 Bacteria 19102
178 Ga0081455_10059660 3300005937 Bacteria 3220
179 Ga0081455_10175758 3300005937 Bacteria 1626
180 Ga0081540_1003216 3300005983 Bacteria 13018
181 Ga0081540_1021572 3300005983 Bacteria 3829
182 Ga0081540_1023528 3300005983 Bacteria 3599
183 Ga0081540_1027471 3300005983 Bacteria 3223
184 Ga0081540_1041474 3300005983 Bacteria 2386
185 Ga0081540_1055339 3300005983 Bacteria 1933
186 Ga0081540_1075802 3300005983 Bacteria 1536
187 Ga0081539_10034639 3300005985 Bacteria 3048
188 Ga0070717_10009967 3300006028 Bacteria 7148
189 Ga0070717_10024153 3300006028 Bacteria 4823
190 Ga0070717_10890816 3300006028 Bacteria 810
191 Ga0075365_10016403 3300006038 Bacteria 4506
192 Ga0075365_10018977 3300006038 Bacteria 4236
193 Ga0075365_10040534 3300006038 Bacteria 3037
194 Ga0075365_10040718 3300006038 Bacteria 3031
195 Ga0075365_10053601 3300006038 Bacteria 2672
196 Ga0075365_10188859 3300006038 Bacteria 1441
197 Ga0075365_10273209 3300006038 Bacteria 1189
198 Ga0075368_10017827 3300006042 Bacteria 2661
199 Ga0075368_10113852 3300006042 Bacteria 1117
200 Ga0075363_100001995 3300006048 Bacteria 8127
201 Ga0075363_100135024 3300006048 Bacteria 1386
202 Ga0075363_100200315 3300006048 Bacteria 1140
203 Ga0075363_100428206 3300006048 Bacteria 780
204 Ga0075364_10042281 3300006051 Bacteria 2960
205 Ga0075364_10122450 3300006051 Bacteria 1742
206 Ga0075364_10248096 3300006051 Bacteria 1210
207 Ga0075364_10640988 3300006051 Bacteria 726
208 Ga0075364_10703525 3300006051 Bacteria 689
209 Ga0075432_10398365 3300006058 Bacteria 594
210 Ga0070715_10002384 3300006163 Bacteria 5754
211 Ga0070716_100004420 3300006173 Bacteria 6721
212 Ga0070716_100100668 3300006173 Bacteria 1771
213 Ga0070716_100926553 3300006173 Bacteria 684
214 Ga0070712_100085114 3300006175 Bacteria 2301
215 Ga0070712_100117731 3300006175 Bacteria 1994
216 Ga0070712_100139184 3300006175 Bacteria 1850
217 Ga0070712_100701470 3300006175 Bacteria 863
218 Ga0070712_100885590 3300006175 Bacteria 769
219 Ga0070712_101069452 3300006175 Bacteria 699
220 Ga0070712_101087861 3300006175 Bacteria 693
221 Ga0075362_10072311 3300006177 Bacteria 1577
222 Ga0075362_10096087 3300006177 Bacteria 1380
223 Ga0075362_10133368 3300006177 Bacteria 1183
224 Ga0075362_10154916 3300006177 Bacteria 1101
225 Ga0075362_10293239 3300006177 Bacteria 806
226 Ga0075367_10069655 3300006178 Bacteria 2112
227 Ga0075367_10082850 3300006178 Bacteria 1942
228 Ga0075367_10098442 3300006178 Bacteria 1785
229 Ga0075369_10018548 3300006186 Bacteria 2834
230 Ga0075369_10030019 3300006186 Bacteria 2287
231 Ga0075369_10042859 3300006186 Bacteria 1940
232 Ga0075369_10249895 3300006186 Bacteria 823
233 Ga0075369_10354305 3300006186 Bacteria 689
234 Ga0075366_10085420 3300006195 Bacteria 1887
235 Ga0075366_10099715 3300006195 Bacteria 1743
236 Ga0075366_10187259 3300006195 Bacteria 1257
237 Ga0075366_10215140 3300006195 Bacteria 1170
238 Ga0075366_10438606 3300006195 Bacteria 805
239 Ga0097621_100924090 3300006237 Bacteria 813
240 Ga0075370_10007496 3300006353 Bacteria 5561
241 Ga0075370_10030019 3300006353 Bacteria 3032
242 Ga0075370_10039239 3300006353 Bacteria 2667
243 Ga0075370_10039847 3300006353 Bacteria 2648
244 Ga0075370_10046929 3300006353 Bacteria 2445
245 Ga0075370_10246684 3300006353 Bacteria 1058
246 Ga0075370_10286893 3300006353 Bacteria 978
247 Ga0068871_100657870 3300006358 Bacteria 957
248 Ga0075428_100597564 3300006844 Bacteria 1179
249 Ga0075428_101069328 3300006844 Bacteria 853
250 Ga0075433_10964081 3300006852 Bacteria 743
251 Ga0075434_100041162 3300006871 Bacteria 4576
252 Ga0068865_100494700 3300006881 Bacteria 1018
253 Ga0075436_100341501 3300006914 Bacteria 1078
254 Ga0097620_100058780 3300006931 Bacteria 3873
255 Ga0097620_100627259 3300006931 Bacteria 1167
256 Ga0099824_1020528 3300006942 Bacteria 4838
257 Ga0099823_1098135 3300006944 Bacteria 920
258 Ga0075435_100024687 3300007076 Bacteria 4668
259 Ga0075435_100409607 3300007076 Bacteria 1167
260 Ga0099794_10075643 3300007265 Bacteria 1655
261 Ga0099794_10120394 3300007265 Bacteria 1320
262 Ga0099794_10174216 3300007265 Bacteria 1097
263 Ga0099794_10548499 3300007265 Bacteria 610
264 Ga0099795_10005436 3300007788 Bacteria 3387
265 Ga0099795_10048777 3300007788 Bacteria 1535
266 Ga0099795_10134430 3300007788 Bacteria 1001
267 Ga0099795_10537966 3300007788 Bacteria 549
268 Ga0105250_10084364 3300009092 Bacteria 1289
269 Ga0105240_10004957 3300009093 Bacteria 20021
270 Ga0105240_10478615 3300009093 Bacteria 1388
271 Ga0111539_10331760 3300009094 Bacteria 1771
272 Ga0111539_10591812 3300009094 Bacteria 1292
273 Ga0105245_10073773 3300009098 Bacteria 3104
274 Ga0105245_10299958 3300009098 Bacteria 1576
275 Ga0105245_10406223 3300009098 Bacteria 1362
276 Ga0105245_11114991 3300009098 Bacteria 835
277 Ga0105247_10038734 3300009101 Bacteria 2911
278 Ga0105247_10133584 3300009101 Bacteria 1619
279 Ga0105247_10257549 3300009101 Bacteria 1195
280 Ga0105247_10269622 3300009101 Bacteria 1170
281 Ga0105247_10830123 3300009101 Bacteria 708
282 Ga0114129_10388114 3300009147 Bacteria 1842
283 Ga0105243_10144795 3300009148 Bacteria 2032
284 Ga0105243_10774814 3300009148 Bacteria 943
285 Ga0105243_12221593 3300009148 Bacteria 585
286 Ga0105241_10037913 3300009174 Bacteria 3633
287 Ga0105241_10069592 3300009174 Bacteria 2729
288 Ga0105241_10430170 3300009174 Bacteria 1164
289 Ga0105241_10577725 3300009174 Bacteria 1013
290 Ga0105241_10632054 3300009174 Bacteria 970
291 Ga0105241_10757570 3300009174 Bacteria 891
292 Ga0105241_11138663 3300009174 Bacteria 736
293 Ga0105242_10238944 3300009176 Bacteria 1632
294 Ga0105248_10302395 3300009177 Bacteria 1801
295 Ga0105248_10485881 3300009177 Bacteria 1392
296 Ga0105248_10667596 3300009177 Bacteria 1173
297 Ga0105248_12619949 3300009177 Bacteria 575
298 Ga0105237_10053382 3300009545 Bacteria 4054
299 Ga0105237_10059303 3300009545 Bacteria 3829
300 Ga0105237_10123798 3300009545 Bacteria 2580
301 Ga0105237_10134788 3300009545 Bacteria 2464
302 Ga0105237_10800229 3300009545 Bacteria 949
303 Ga0105237_11478147 3300009545 Bacteria 686
304 Ga0105237_12093761 3300009545 Bacteria 575
305 Ga0105238_10124009 3300009551 Bacteria 2563
306 Ga0105238_10196717 3300009551 Bacteria 1992
307 Ga0105238_10299288 3300009551 Bacteria 1592
308 Ga0105238_10442170 3300009551 Bacteria 1297
309 Ga0105238_11681726 3300009551 Bacteria 665
310 Ga0105249_10578856 3300009553 Bacteria 1176
311 Ga0105249_10647491 3300009553 Bacteria 1114
312 Ga0105249_11584354 3300009553 Bacteria 727
313 Ga0105249_12469386 3300009553 Bacteria 592
314 Ga0099796_10149631 3300010159 Bacteria 918
315 Ga0099796_10210429 3300010159 Bacteria 793
316 Ga0099796_10222055 3300010159 Bacteria 775
317 Ga0105239_10020953 3300010375 Bacteria 7212
318 Ga0105239_10095960 3300010375 Bacteria 3275
319 Ga0105239_10142500 3300010375 Bacteria 2672
320 Ga0105239_10267715 3300010375 Bacteria 1921
321 Ga0105239_10371171 3300010375 Bacteria 1617
322 Ga0105239_10421858 3300010375 Bacteria 1511
323 Ga0105239_10568010 3300010375 Bacteria 1292
324 Ga0105239_10972499 3300010375 Bacteria 976
325 Ga0105246_10130279 3300011119 Bacteria 1878
326 Ga0105246_10146770 3300011119 Bacteria 1781
327 Ga0105246_10234181 3300011119 Bacteria 1448
328 Ga0105246_10401838 3300011119 Bacteria 1138
329 Ga0105246_11046461 3300011119 Bacteria 742
330 Ga0105246_11715491 3300011119 Bacteria 597
331 Ga0157373_10312320 3300013100 Bacteria 1117
332 Ga0157371_10203224 3300013102 Bacteria 1421
333 Ga0157371_10812842 3300013102 Bacteria 705
334 Ga0157370_11104193 3300013104 Bacteria 717
335 Ga0157369_10247516 3300013105 Bacteria 1861
336 Ga0157369_10300439 3300013105 Bacteria 1670
337 Ga0157378_10169593 3300013297 Bacteria 2046
338 Ga0157378_10202436 3300013297 Bacteria 1878
339 Ga0163162_10029409 3300013306 Bacteria 5437
340 Ga0163162_10107603 3300013306 Bacteria 2884
341 Ga0163162_10869235 3300013306 Bacteria 1016
342 Ga0163162_11024028 3300013306 Bacteria 934
343 Ga0163162_11314237 3300013306 Bacteria 822
344 Ga0157372_10335864 3300013307 Bacteria 1760
345 Ga0157372_10958274 3300013307 Bacteria 992
346 Ga0157375_10270624 3300013308 Bacteria 1861
347 Ga0157375_10350117 3300013308 Bacteria 1643
348 Ga0157375_10352711 3300013308 Bacteria 1637
349 Ga0157375_10410748 3300013308 Bacteria 1520
350 Ga0157375_11575902 3300013308 Bacteria 776
351 Ga0163163_10038380 3300014325 Bacteria 4668
352 Ga0163163_10226083 3300014325 Bacteria 1920
353 Ga0157380_10211406 3300014326 Bacteria 1729
354 Ga0157380_10368602 3300014326 Bacteria 1351
355 Ga0157380_11003074 3300014326 Bacteria 868
356 Ga0157379_10034808 3300014968 Bacteria 4492
357 Ga0157379_10363314 3300014968 Bacteria 1327
358 Ga0157379_10487787 3300014968 Bacteria 1141
359 Ga0157379_11615089 3300014968 Bacteria 633
360 Ga0157376_10358122 3300014969 Bacteria 1398
361 Ga0157376_11031207 3300014969 Bacteria 846
362 Ga0157376_11418883 3300014969 Bacteria 726
363 Ga0163161_10213857 3300017792 Bacteria 1490
364 Ga0163161_10791532 3300017792 Bacteria 796
365 Ga0206350_11469909 3300020080 Bacteria 879
366 Ga0206353_11783555 3300020082 Bacteria 664
367 Ga0214544_1000002 3300021320 Bacteria 753857
368 Ga0214542_1000001 3300021321 Bacteria 1018696
369 Ga0214542_1037264 3300021321 Bacteria 1394
370 Ga0214545_1000001 3300021324 Bacteria 1092817
371 Ga0214545_1029177 3300021324 Bacteria 2525
372 Ga0214543_1000001 3300021327 Bacteria 776921
373 Ga0213873_10065597 3300021358 Bacteria 991
374 Ga0213874_10069360 3300021377 Bacteria 1121
375 Ga0224712_10207107 3300022467 Bacteria 893
376 Ga0224712_10215445 3300022467 Bacteria 877
377 Ga0209677_104330 3300025253 Bacteria 4146
378 Ga0209233_1002725 3300025261 Bacteria 6362
379 Ga0209233_1011472 3300025261 Bacteria 2609
380 Ga0209673_1032716 3300025273 Bacteria 1598
381 Ga0209564_1002508 3300025295 Bacteria 14250
382 Ga0209564_1004524 3300025295 Bacteria 8457
383 Ga0209564_1009791 3300025295 Bacteria 4504
384 Ga0209564_1010831 3300025295 Bacteria 4154
385 Ga0209758_1000021 3300025297 Bacteria 697691
386 Ga0209758_1001632 3300025297 Bacteria 25487
387 Ga0209758_1002055 3300025297 Bacteria 21535
388 Ga0209758_1003008 3300025297 Bacteria 16134
389 Ga0209758_1030454 3300025297 Bacteria 2234
390 Ga0209758_1033155 3300025297 Bacteria 2081
391 Ga0209758_1037034 3300025297 Bacteria 1892
392 Ga0209758_1037482 3300025297 Bacteria 1873
393 Ga0209256_1006522 3300025299 Bacteria 6132
394 Ga0209256_1061217 3300025299 Bacteria 876
395 Ga0207426_1000960 3300025302 Bacteria 28422
396 Ga0207426_1004043 3300025302 Bacteria 7425
397 Ga0207426_1015353 3300025302 Bacteria 2779
398 Ga0209257_1002332 3300025304 Bacteria 19132
399 Ga0207697_10270992 3300025315 Bacteria 752
400 Ga0207697_10358614 3300025315 Bacteria 647
401 Ga0207656_10045214 3300025321 Bacteria 1884
402 Ga0207656_10515633 3300025321 Bacteria 607
403 Ga0207692_10000524 3300025898 Bacteria 13610
404 Ga0207642_10286486 3300025899 Bacteria 949
405 Ga0207710_10011733 3300025900 Bacteria 3686
406 Ga0207710_10503422 3300025900 Bacteria 629
407 Ga0207710_10582223 3300025900 Bacteria 584
408 Ga0207688_10220794 3300025901 Bacteria 1141
409 Ga0207688_10383730 3300025901 Bacteria 869
410 Ga0207680_10161396 3300025903 Bacteria 1503
411 Ga0207680_10183540 3300025903 Bacteria 1416
412 Ga0207647_10378875 3300025904 Bacteria 799
413 Ga0207685_10059983 3300025905 Bacteria 1503
414 Ga0207699_10065696 3300025906 Bacteria 2200
415 Ga0207699_10149525 3300025906 Bacteria 1544
416 Ga0207645_10110973 3300025907 Bacteria 1775
417 Ga0207643_10025614 3300025908 Bacteria 3261
418 Ga0207684_11214170 3300025910 Bacteria 624
419 Ga0207654_10012909 3300025911 Bacteria 4285
420 Ga0207654_10079790 3300025911 Bacteria 1966
421 Ga0207654_10113935 3300025911 Bacteria 1687
422 Ga0207654_10599118 3300025911 Bacteria 786
423 Ga0207707_10015827 3300025912 Bacteria 6577
424 Ga0207707_10020204 3300025912 Bacteria 5815
425 Ga0207695_10000378 3300025913 Bacteria 101352
426 Ga0207695_10350381 3300025913 Bacteria 1364
427 Ga0207695_10922659 3300025913 Bacteria 753
428 Ga0207671_10005974 3300025914 Bacteria 11019
429 Ga0207671_10072553 3300025914 Bacteria 2570
430 Ga0207671_10554433 3300025914 Bacteria 916
431 Ga0207671_10906402 3300025914 Bacteria 697
432 Ga0207693_10005027 3300025915 Bacteria 11102
433 Ga0207693_10014111 3300025915 Bacteria 6433
434 Ga0207693_10085310 3300025915 Bacteria 2474
435 Ga0207663_10000451 3300025916 Bacteria 17854
436 Ga0207663_10047963 3300025916 Bacteria 2640
437 Ga0207663_10082366 3300025916 Bacteria 2110
438 Ga0207660_11155839 3300025917 Bacteria 630
439 Ga0207657_10181427 3300025919 Bacteria 1702
440 Ga0207657_10197663 3300025919 Bacteria 1619
441 Ga0207657_10551261 3300025919 Bacteria 901
442 Ga0207649_10105400 3300025920 Bacteria 1874
443 Ga0207649_10188764 3300025920 Bacteria 1448
444 Ga0207649_11138891 3300025920 Bacteria 616
445 Ga0207681_10198440 3300025923 Bacteria 1539
446 Ga0207694_10096891 3300025924 Bacteria 2333
447 Ga0207694_10182459 3300025924 Bacteria 1702
448 Ga0207694_10644244 3300025924 Bacteria 892
449 Ga0207650_10067668 3300025925 Bacteria 2680
450 Ga0207659_11751403 3300025926 Bacteria 528
451 Ga0207687_10794440 3300025927 Bacteria 807
452 Ga0207700_10002015 3300025928 Bacteria 11604
453 Ga0207700_10298619 3300025928 Bacteria 1390
454 Ga0207700_10720495 3300025928 Bacteria 891
455 Ga0207664_10017534 3300025929 Bacteria 5252
456 Ga0207664_10247165 3300025929 Bacteria 1555
457 Ga0207664_11398112 3300025929 Bacteria 620
458 Ga0207644_10059761 3300025931 Bacteria 2757
459 Ga0207690_10406778 3300025932 Bacteria 1086
460 Ga0207690_10451486 3300025932 Bacteria 1033
461 Ga0207686_10046010 3300025934 Bacteria 2689
462 Ga0207709_10046312 3300025935 Bacteria 2639
463 Ga0207709_10366681 3300025935 Bacteria 1092
464 Ga0207670_10313965 3300025936 Bacteria 1231
465 Ga0207670_11385169 3300025936 Bacteria 597
466 Ga0207669_10030199 3300025937 Bacteria 3008
467 Ga0207704_10302268 3300025938 Bacteria 1226
468 Ga0207665_10002128 3300025939 Bacteria 13402
469 Ga0207665_10348260 3300025939 Bacteria 1118
470 Ga0207665_11200319 3300025939 Bacteria 605
471 Ga0207691_10091375 3300025940 Bacteria 2727
472 Ga0207691_10643762 3300025940 Bacteria 896
473 Ga0207691_11428757 3300025940 Bacteria 568
474 Ga0207711_10337214 3300025941 Bacteria 1395
475 Ga0207711_10637484 3300025941 Bacteria 994
476 Ga0207689_10052903 3300025942 Bacteria 3345
477 Ga0207689_10121366 3300025942 Bacteria 2150
478 Ga0207689_10136106 3300025942 Bacteria 2023
479 Ga0207689_10150833 3300025942 Bacteria 1916
480 Ga0207661_10192288 3300025944 Bacteria 1790
481 Ga0207679_10241662 3300025945 Bacteria 1530
482 Ga0207679_11805561 3300025945 Bacteria 559
483 Ga0207667_10059382 3300025949 Bacteria 4005
484 Ga0207667_11376610 3300025949 Bacteria 680
485 Ga0207651_10362731 3300025960 Bacteria 1223
486 Ga0207712_10153783 3300025961 Bacteria 1780
487 Ga0207712_10550121 3300025961 Bacteria 993
488 Ga0207712_11840585 3300025961 Bacteria 542
489 Ga0207668_10030893 3300025972 Bacteria 3523
490 Ga0207668_10372625 3300025972 Bacteria 1199
491 Ga0207668_10498091 3300025972 Bacteria 1047
492 Ga0207668_10631885 3300025972 Bacteria 935
493 Ga0207668_10725470 3300025972 Bacteria 875
494 Ga0207640_10612021 3300025981 Bacteria 923
495 Ga0207640_10708859 3300025981 Bacteria 864
496 Ga0207658_10275079 3300025986 Bacteria 1441
497 Ga0207677_10224824 3300026023 Bacteria 1508
498 Ga0207677_10254788 3300026023 Bacteria 1427
499 Ga0207677_11588859 3300026023 Bacteria 605
500 Ga0207703_10072010 3300026035 Bacteria 2856
501 Ga0207703_10161146 3300026035 Bacteria 1965
502 Ga0207703_10331593 3300026035 Bacteria 1396
503 Ga0207639_10161107 3300026041 Bacteria 1891
504 Ga0207678_10013802 3300026067 Bacteria 7098
505 Ga0207678_10016384 3300026067 Bacteria 6508
506 Ga0207678_10058708 3300026067 Bacteria 3310
507 Ga0207678_10067068 3300026067 Bacteria 3080
508 Ga0207678_10089215 3300026067 Bacteria 2635
509 Ga0207678_10232622 3300026067 Bacteria 1578
510 Ga0207678_10480488 3300026067 Bacteria 1082
511 Ga0207678_10987030 3300026067 Bacteria 745
512 Ga0207708_10244927 3300026075 Bacteria 1443
513 Ga0207708_10458128 3300026075 Bacteria 1063
514 Ga0207702_11127863 3300026078 Bacteria 778
515 Ga0207702_11197838 3300026078 Bacteria 754
516 Ga0207702_11738654 3300026078 Bacteria 616
517 Ga0207641_10106255 3300026088 Bacteria 2481
518 Ga0207648_10126701 3300026089 Bacteria 2246
519 Ga0207648_10564642 3300026089 Bacteria 1046
520 Ga0207676_10109436 3300026095 Bacteria 2309
521 Ga0207676_10712042 3300026095 Bacteria 974
522 Ga0207676_11782026 3300026095 Bacteria 614
523 Ga0207674_10213494 3300026116 Bacteria 1878
524 Ga0207674_10427480 3300026116 Bacteria 1280
525 Ga0207674_11502755 3300026116 Bacteria 643
526 Ga0207675_100056996 3300026118 Bacteria 3645
527 Ga0207675_100280601 3300026118 Bacteria 1619
528 Ga0207683_10122121 3300026121 Bacteria 2339
529 Ga0207683_10175687 3300026121 Bacteria 1941
530 Ga0207683_10183642 3300026121 Bacteria 1897
531 Ga0207683_10227290 3300026121 Bacteria 1701
532 Ga0207683_10439855 3300026121 Bacteria 1202
533 Ga0207683_10654423 3300026121 Bacteria 973
534 Ga0207698_10063172 3300026142 Bacteria 2896
535 Ga0207698_10355488 3300026142 Bacteria 1385
536 Ga0209389_1000008 3300027296 Bacteria 227385
537 Ga0209389_1000121 3300027296 Bacteria 70490
538 Ga0209589_1002735 3300027357 Bacteria 30739
539 Ga0209489_103445 3300027361 Bacteria 30849
540 Ga0209489_108921 3300027361 Bacteria 13078
541 Ga0209179_1007263 3300027512 Bacteria 1823
542 Ga0209179_1070409 3300027512 Bacteria 766
543 Ga0209588_1138592 3300027671 Bacteria 774
544 Ga0209588_1216911 3300027671 Bacteria 592
545 Ga0268266_10002224 3300028379 Bacteria 21181
546 Ga0268266_10052951 3300028379 Bacteria 3486
547 Ga0268266_10139753 3300028379 Bacteria 2173
548 Ga0268266_10257040 3300028379 Bacteria 1617
549 Ga0268266_10386215 3300028379 Bacteria 1321
550 Ga0268266_10513966 3300028379 Bacteria 1144
551 Ga0268266_10603548 3300028379 Bacteria 1054
552 Ga0268266_11019194 3300028379 Bacteria 801
553 Ga0268266_11050413 3300028379 Bacteria 788
554 Ga0268266_11441573 3300028379 Bacteria 664
555 Ga0268266_12368435 3300028379 Bacteria 502
556 Ga0268265_10124749 3300028380 Bacteria 2128
557 Ga0268265_10471195 3300028380 Bacteria 1177
558 Ga0268265_10624895 3300028380 Bacteria 1032
559 Ga0268265_11801547 3300028380 Bacteria 618
560 Ga0268264_10000185 3300028381 Bacteria 131374
561 Ga0268264_10370321 3300028381 Bacteria 1369
562 Ga0307515_10225691 3300028794 Bacteria 1679
563 Ga0307515_10493440 3300028794 Bacteria 836
564 Ga0265338_10274306 3300028800 Bacteria 1235
565 Ga0265339_10008628 3300031249 Bacteria 6470
566 Ga0307509_10004249 3300031507 Bacteria 20876
567 Ga0307508_10015749 3300031616 Bacteria 6891
568 Ga0307508_10029469 3300031616 Bacteria 4961
569 Ga0307508_10279775 3300031616 Bacteria 1262
570 Ga0265314_10083597 3300031711 Bacteria 2098
571 Ga0265314_10085444 3300031711 Bacteria 2068
572 Ga0265342_10007736 3300031712 Bacteria 7825
573 Ga0307516_10145109 3300031730 Bacteria 2139
574 Ga0307516_10275546 3300031730 Bacteria 1366
575 Ga0307516_10542889 3300031730 Bacteria 816
576 Ga0307518_10433115 3300031838 Bacteria 714
577 Ga0307409_101517604 3300031995 Bacteria 698
578 Ga0307414_11565880 3300032004 Bacteria 614
579 Ga0307411_11304611 3300032005 Bacteria 661
580 Ga0307507_10005195 3300033179 Bacteria 21749
581 Ga0307510_10035891 3300033180 Bacteria 5527
582 Ga0307510_10122842 3300033180 Bacteria 2295
583 Ga0373926_0033177 3300035083 Bacteria 1824
584 Ga0373934_0014244 3300035086 Bacteria 3013
585 Ga0373923_0031733 3300035111 Bacteria 2131
586 Ga0373923_0085647 3300035111 Bacteria 1372
587 Ga0373936_0106474 3300035113 Bacteria 1187
588 Ga0373936_0122315 3300035113 Bacteria 1113
589 Ga0373936_0172676 3300035113 Bacteria 945
590 Ga0373936_0209172 3300035113 Bacteria 863
591 Ga0373945_0005241 3300035116 Bacteria 4145
592 Ga0373953_0002113 3300035117 Bacteria 5935
593 Ga0373953_0003587 3300035117 Bacteria 4854
594 Ga0373953_0186763 3300035117 Bacteria 895
595 Ga0373953_0347058 3300035117 Bacteria 650
596 Ga0373954_0005008 3300035118 Bacteria 5720
597 Ga0373954_0005085 3300035118 Bacteria 5673
598 Ga0373954_0009691 3300035118 Bacteria 4240
599 Ga0373956_0001696 3300035119 Bacteria 9086
600 Ga0373956_0039561 3300035119 Bacteria 2090
601 Ga0373957_0006803 3300035120 Bacteria 3622
602 Ga0373957_0114970 3300035120 Bacteria 1086
603 Ga0373957_0120878 3300035120 Bacteria 1060
604 Ga0373943_0155773 3300035170 Bacteria 1240
605 Ga0373943_0221746 3300035170 Bacteria 1053
606 Ga0373955_0000654 3300035172 Bacteria 14784
607 Ga0373955_0001917 3300035172 Bacteria 8980
608 Ga0373955_0016162 3300035172 Bacteria 3669
609 Ga0373955_0364492 3300035172 Bacteria 876
610 Ga0373924_0001605 3300035410 Bacteria 7413
611 Ga0373924_0013613 3300035410 Bacteria 3058
612 Ga0373924_0043558 3300035410 Bacteria 1843
613 Ga0373935_0010545 3300035692 Bacteria 5544
614 Ga0373935_0032760 3300035692 Bacteria 3230
615 Ga0373935_0034676 3300035692 Bacteria 3147
616 Ga0373935_0450317 3300035692 Bacteria 930
617 Ga0373927_0018507 3300035695 Bacteria 4577
618 Ga0373927_0028939 3300035695 Bacteria 3613
619 Ga0373927_0079859 3300035695 Bacteria 2119
620 Ga0373933_0001815 3300035724 Bacteria 12375
621 Ga0373933_0007396 3300035724 Bacteria 5989
622 Ga0373933_0089651 3300035724 Bacteria 1896
623 Ga0373947_0007178 3300035725 Bacteria 6458
624 Ga0373947_0153153 3300035725 Bacteria 1486
625 Ga0373937_0009279 3300036401 Bacteria 8541
626 Ga0373937_0123998 3300036401 Bacteria 2409
627 Ga0373937_0608111 3300036401 Bacteria 1038
628 Ga0373937_0968470 3300036401 Bacteria 799
629 Ga0373937_1565503 3300036401 Bacteria 606
630 Ga0373925_0006804 3300037068 Bacteria 8373
631 Ga0373925_0036806 3300037068 Bacteria 3611
632 Ga0373925_0156327 3300037068 Bacteria 1794
633 Ga0373925_0770609 3300037068 Bacteria 793
634 Ga0373925_1412806 3300037068 Bacteria 570
635 Ga0395899_0016993 3300037312 Bacteria 5545
636 Ga0395900_0000361 3300037418 Bacteria 65918
637 Ga0395900_0525255 3300037418 Bacteria 1131
638 Ga0395905_0127300 3300037471 Bacteria 2395
639 Ga0395905_0152640 3300037471 Bacteria 2173
640 Ga0395905_0217899 3300037471 Bacteria 1787
641 Ga0395905_0901021 3300037471 Bacteria 787
642 Ga0395901_0320644 3300038443 Bacteria 1603
643 Ga0395901_0582442 3300038443 Bacteria 1130
644 Ga0395901_0624625 3300038443 Bacteria 1084
645 Ga0436365_1146796 3300039437 Bacteria 1452
646 Ga0436365_1716705 3300039437 Bacteria 4808
647 Ga0436360_0420359 3300039438 Bacteria 2244
648 Ga0436361_0051433 3300039447 Bacteria 883
649 Ga0436363_0234286 3300039450 Bacteria 1433
650 Ga0436362_0373664 3300039453 Bacteria 694
651 Ga0436362_0439870 3300039453 Bacteria 2660
652 Ga0451789_0382349 3300041443 Bacteria 1331
653 Ga0451789_0487446 3300041443 Bacteria 529
654 Ga0451807_1616728 3300041486 Bacteria 1406
655 Ga0451807_2559663 3300041486 Bacteria 568
656 Ga0451833_0292474 3300041491 Bacteria 503
657 Ga0451841_1457417 3300041498 Bacteria 895
658 Ga0451853_3923295 3300041512 Bacteria 504
659 Ga0450905_106040 3300042142 Bacteria 508
660 Ga0466972_0004782 3300044658 Bacteria 6785
661 Ga0466965_0051814 3300044683 Bacteria 2037
662 Ga0466965_0295951 3300044683 Bacteria 877
663 Ga0466963_0150967 3300044694 Bacteria 1613
664 Ga0466968_0006041 3300044735 Bacteria 4546
665 Ga0466968_0139862 3300044735 Bacteria 1107
666 Ga0466960_0030663 3300044901 Bacteria 2476
667 Ga0466960_0391756 3300044901 Bacteria 799
668 Ga0466959_0056697 3300045049 Bacteria 2858
669 Ga0466967_0106052 3300045976 Bacteria 2575
670 Ga0466967_0128481 3300045976 Bacteria 2350
671 Ga0466967_2493582 3300045976 Bacteria 512
672 Ga0495592_0004099 3300046454 Bacteria 10596
673 Ga0495592_0004904 3300046454 Bacteria 9849
674 Ga0495592_0042264 3300046454 Bacteria 3414
675 Ga0495592_0092975 3300046454 Bacteria 2161
676 Ga0495592_0398631 3300046454 Bacteria 872
677 Ga0495603_0438745 3300046455 Bacteria 748
678 Ga0495629_0002829 3300046459 Bacteria 13259
679 Ga0495629_0003943 3300046459 Bacteria 11161
680 Ga0495638_0036102 3300046460 Bacteria 3149
681 Ga0495638_0188969 3300046460 Bacteria 1170
682 Ga0495651_0014893 3300046462 Bacteria 6012
683 Ga0495651_0045237 3300046462 Bacteria 3410
684 Ga0495651_0061893 3300046462 Bacteria 2864
685 Ga0495651_0373216 3300046462 Bacteria 937
686 Ga0495653_0054219 3300046463 Bacteria 3064
687 Ga0495653_0120438 3300046463 Bacteria 1871
688 Ga0495653_0316077 3300046463 Bacteria 1014
689 Ga0495650_0286449 3300046471 Bacteria 554
690 Ga0495582_0044946 3300046473 Bacteria 2432
691 Ga0495639_0010400 3300046475 Bacteria 4007
692 Ga0495662_0135393 3300046476 Bacteria 1212
693 Ga0495664_0009901 3300046477 Bacteria 5348
694 Ga0495664_0024884 3300046477 Bacteria 3482
695 Ga0495664_0042170 3300046477 Bacteria 2702
696 Ga0495664_0904159 3300046477 Bacteria 516
697 Ga0495584_0257724 3300046491 Bacteria 887
698 Ga0495584_0262518 3300046491 Bacteria 878
699 Ga0495584_0375987 3300046491 Bacteria 722
700 Ga0495607_0012688 3300046501 Bacteria 5550
701 Ga0495583_0179494 3300046506 Bacteria 867
702 Ga0495583_0184866 3300046506 Bacteria 852
703 Ga0495606_0028417 3300046507 Bacteria 3946
704 Ga0495608_0009394 3300046511 Bacteria 6837
705 Ga0495608_0036761 3300046511 Bacteria 3295
706 Ga0495608_0058675 3300046511 Bacteria 2537
707 Ga0495608_0683821 3300046511 Bacteria 611
708 Ga0495610_0370755 3300046512 Bacteria 534
709 Ga0495616_0152525 3300046513 Bacteria 1044
710 Ga0495618_0018145 3300046514 Bacteria 4319
711 Ga0495618_0064513 3300046514 Bacteria 2327
712 Ga0495618_0274739 3300046514 Bacteria 1052
713 Ga0495620_0013635 3300046515 Bacteria 4156
714 Ga0495620_0179984 3300046515 Bacteria 818
715 Ga0495628_0025979 3300046516 Bacteria 4781
716 Ga0495628_0083128 3300046516 Bacteria 2486
717 Ga0495630_0101653 3300046517 Bacteria 2175
718 Ga0495630_0147529 3300046517 Bacteria 1789
719 Ga0495630_0321072 3300046517 Bacteria 1184
720 Ga0495630_0472982 3300046517 Bacteria 961
721 Ga0495630_0508298 3300046517 Bacteria 924
722 Ga0495631_0031182 3300046518 Bacteria 2414
723 Ga0495637_0272737 3300046520 Bacteria 605
724 Ga0495643_0042298 3300046522 Bacteria 2482
725 Ga0495643_0165258 3300046522 Bacteria 1086
726 Ga0495643_0233447 3300046522 Bacteria 866
727 Ga0495643_0468242 3300046522 Bacteria 546
728 Ga0495648_0052162 3300046524 Bacteria 2486
729 Ga0495648_0254745 3300046524 Bacteria 845
730 Ga0495666_0234605 3300046526 Bacteria 838
731 Ga0495642_0501820 3300046528 Bacteria 537
732 Ga0495652_0007665 3300046529 Bacteria 9941
733 Ga0495652_0014289 3300046529 Bacteria 7130
734 Ga0495652_0059728 3300046529 Bacteria 3225
735 Ga0495652_0362537 3300046529 Bacteria 1035
736 Ga0495652_0622364 3300046529 Bacteria 734
737 Ga0495654_0003707 3300046530 Bacteria 9272
738 Ga0495654_0163143 3300046530 Bacteria 977
739 Ga0495665_0031748 3300046531 Bacteria 2826
740 Ga0495640_0019557 3300046533 Bacteria 4995
741 Ga0495640_0027019 3300046533 Bacteria 4143
742 Ga0495640_0033150 3300046533 Bacteria 3671
743 Ga0495640_0101686 3300046533 Bacteria 1886
744 Ga0495640_0407900 3300046533 Bacteria 833
745 Ga0495586_0277416 3300046535 Bacteria 959
746 Ga0495587_0015651 3300046536 Bacteria 4731
747 Ga0495587_0029595 3300046536 Bacteria 3324
748 Ga0495587_0046610 3300046536 Bacteria 2572
749 Ga0495587_0152951 3300046536 Bacteria 1315
750 Ga0495609_0354632 3300046538 Bacteria 591
751 Ga0495621_0130457 3300046539 Bacteria 977
752 Ga0495645_0004447 3300046543 Bacteria 9568
753 Ga0495645_0012169 3300046543 Bacteria 6059
754 Ga0495645_0723136 3300046543 Bacteria 603
755 Ga0495622_0018402 3300046557 Bacteria 3253
756 Ga0495622_0021843 3300046557 Bacteria 2981
757 Ga0495622_0028791 3300046557 Bacteria 2595
758 Ga0495622_0097730 3300046557 Bacteria 1347
759 Ga0495667_0008508 3300046559 Bacteria 6965
760 Ga0495667_0029608 3300046559 Bacteria 3685
761 Ga0495667_0072740 3300046559 Bacteria 2240
762 Ga0495667_0209255 3300046559 Bacteria 1247
763 Ga0495656_0011388 3300046615 Bacteria 3264
764 Ga0495656_0312677 3300046615 Bacteria 807
765 Ga0495656_0406056 3300046615 Bacteria 713
766 Ga0495668_0123568 3300046616 Bacteria 1416
767 Ga0495668_0146713 3300046616 Bacteria 1292
768 Ga0495668_0224708 3300046616 Bacteria 1028
769 Ga0495634_0012048 3300046642 Bacteria 6269
770 Ga0495634_0014729 3300046642 Bacteria 5628
771 Ga0495611_0055070 3300046648 Bacteria 1799
772 Ga0495625_0061291 3300046660 Bacteria 2662
773 Ga0495625_0418917 3300046660 Bacteria 833
774 Ga0495635_0001593 3300046663 Bacteria 15272
775 Ga0495635_0004356 3300046663 Bacteria 9798
776 Ga0495635_0017629 3300046663 Bacteria 4987
777 Ga0495635_0057029 3300046663 Bacteria 2688
778 Ga0495659_0378675 3300046664 Bacteria 608
779 Ga0495588_0183773 3300046674 Bacteria 1105
780 Ga0495588_0339262 3300046674 Bacteria 790
781 Ga0495657_0005903 3300046675 Bacteria 9622
782 Ga0495657_0017156 3300046675 Bacteria 5261
783 Ga0495657_0053555 3300046675 Bacteria 2699
784 Ga0495657_0100112 3300046675 Bacteria 1847
785 Ga0495599_0003578 3300046678 Bacteria 9109
786 Ga0495599_0007978 3300046678 Bacteria 6423
787 Ga0495599_0045761 3300046678 Bacteria 2744
788 Ga0495599_0218843 3300046678 Bacteria 1166
789 Ga0495623_0014466 3300046679 Bacteria 5106
790 Ga0495623_0019902 3300046679 Bacteria 4339
791 Ga0495623_0033232 3300046679 Bacteria 3310
792 Ga0495623_0177519 3300046679 Bacteria 1240
793 Ga0495646_0002355 3300046680 Bacteria 11571
794 Ga0495646_0019861 3300046680 Bacteria 4249
795 Ga0495646_0022475 3300046680 Bacteria 3979
796 Ga0495647_0226105 3300046681 Bacteria 827
797 Ga0495658_0250499 3300046683 Bacteria 1114
798 Ga0495669_0166830 3300046684 Bacteria 1046
799 Ga0495669_0372153 3300046684 Bacteria 691
800 Ga0495613_0023828 3300046689 Bacteria 4561
801 Ga0495613_0047589 3300046689 Bacteria 3168
802 Ga0495624_0023114 3300046690 Bacteria 4102
803 Ga0495624_0047452 3300046690 Bacteria 2729
804 Ga0495624_0205745 3300046690 Bacteria 1195
805 Ga0495624_0696746 3300046690 Bacteria 603
806 Ga0495670_0013251 3300046691 Bacteria 4055
807 Ga0495670_0447970 3300046691 Bacteria 699
808 Ga0495670_0784625 3300046691 Bacteria 520
809 Ga0495671_0292761 3300046692 Bacteria 783
810 Ga0495671_0362376 3300046692 Bacteria 695
811 Ga0495671_0437897 3300046692 Bacteria 625
812 Ga0495649_0039388 3300046694 Bacteria 2591
813 Ga0495649_0141799 3300046694 Bacteria 1265
814 Ga0495649_0433860 3300046694 Bacteria 657
815 Ga0495600_0004104 3300046809 Bacteria 8664
816 Ga0495600_0007598 3300046809 Bacteria 6640
817 Ga0495600_0010963 3300046809 Bacteria 5639
818 Ga0495660_0164086 3300046810 Bacteria 1087
819 Ga0495660_0262527 3300046810 Bacteria 797
820 Ga0495581_0012239 3300047315 Bacteria 4969
821 Ga0495581_0087214 3300047315 Bacteria 1809
822 Ga0495581_0197835 3300047315 Bacteria 1176
823 Ga0495604_0007639 3300047317 Bacteria 8562
824 Ga0495604_0011675 3300047317 Bacteria 6985
825 Ga0495604_0041114 3300047317 Bacteria 3626
826 Ga0495604_0049040 3300047317 Bacteria 3282
827 Ga0495674_0052222 3300047319 Bacteria 3598
828 Ga0495674_0760262 3300047319 Bacteria 756
829 Ga0495672_0010334 3300047320 Bacteria 6664
830 Ga0495672_0025612 3300047320 Bacteria 3771
831 Ga0495672_0181881 3300047320 Bacteria 1064
832 Ga0495676_0025669 3300047321 Bacteria 5084
833 Ga0495680_0017276 3300047322 Bacteria 6164
834 Ga0495680_0021605 3300047322 Bacteria 5385
835 Ga0495680_0022137 3300047322 Bacteria 5306
836 Ga0495680_0806161 3300047322 Bacteria 613
837 Ga0495683_0194879 3300047323 Bacteria 917
838 Ga0495675_0002949 3300047444 Bacteria 10219
839 Ga0495675_0016494 3300047444 Bacteria 4672
840 Ga0495677_0089100 3300047445 Bacteria 1162
841 Ga0495673_0068536 3300047469 Bacteria 1499
842 Ga0495673_0184252 3300047469 Bacteria 789
843 Ga0495673_0264715 3300047469 Bacteria 624
844 Ga0495684_0002455 3300047471 Bacteria 14793
845 Ga0495684_0022863 3300047471 Bacteria 4809
846 Ga0495686_0018484 3300047472 Bacteria 4675
847 Ga0495686_0047566 3300047472 Bacteria 2708
848 Ga0495686_0143251 3300047472 Bacteria 1409
849 Ga0495686_0153619 3300047472 Bacteria 1350
850 Ga0495686_0172030 3300047472 Bacteria 1259
851 Ga0495686_0410331 3300047472 Bacteria 725
852 Ga0495593_0015060 3300047673 Bacteria 4393
853 Ga0495593_0015312 3300047673 Bacteria 4346
854 Ga0495593_0021021 3300047673 Bacteria 3649
855 Ga0495593_0266740 3300047673 Bacteria 857
856 Ga0495602_0020088 3300048088 Bacteria 6607
857 Ga0495602_0130045 3300048088 Bacteria 2009
858 Ga0495602_0179814 3300048088 Bacteria 1633
859 Ga0495602_0391038 3300048088 Bacteria 994
860 Ga0495614_0073888 3300048089 Bacteria 1472
861 Ga0495626_0310434 3300048091 Bacteria 622
862 Ga0495626_0326718 3300048091 Bacteria 602
863 Ga0496100_0138598 3300048903 Bacteria 1721
864 Ga0496100_0275646 3300048903 Bacteria 1252
865 Ga0496101_0736192 3300048904 Bacteria 778
866 Ga0496101_0888107 3300048904 Bacteria 702
867 Ga0496102_0063011 3300048905 Bacteria 3395
868 Ga0496102_0106121 3300048905 Bacteria 2614
869 Ga0496102_0294186 3300048905 Bacteria 1530
870 Ga0496102_0685502 3300048905 Bacteria 948
871 Ga0496103_0386385 3300048906 Bacteria 899
872 Ga0496104_0010283 3300048907 Bacteria 8355
873 Ga0496104_0126851 3300048907 Bacteria 2450
874 Ga0496104_0247603 3300048907 Bacteria 1695
875 Ga0496104_0828957 3300048907 Bacteria 831
876 Ga0496105_0000723 3300048908 Bacteria 22379
877 Ga0496105_0241392 3300048908 Bacteria 1466
878 Ga0496106_0036778 3300048909 Bacteria 3662
879 Ga0496106_0171772 3300048909 Bacteria 1718
880 Ga0496106_0174272 3300048909 Bacteria 1706
881 Ga0496106_0185464 3300048909 Bacteria 1653
882 Ga0496106_0216847 3300048909 Bacteria 1525
883 Ga0496106_0231862 3300048909 Bacteria 1474
884 Ga0496107_0061146 3300048910 Bacteria 2727
885 Ga0496107_0585362 3300048910 Bacteria 825
886 Ga0496108_0087488 3300048911 Bacteria 2646
887 Ga0496108_0113908 3300048911 Bacteria 2315
888 Ga0496108_0175718 3300048911 Bacteria 1854
889 Ga0496109_0034528 3300048912 Bacteria 4556
890 Ga0496109_0235133 3300048912 Bacteria 1724
891 Ga0496109_0728883 3300048912 Bacteria 929
892 Ga0496110_0020924 3300048913 Bacteria 5527
893 Ga0496110_0391225 3300048913 Bacteria 1267
894 Ga0496110_0903848 3300048913 Bacteria 789
895 Ga0496112_0027002 3300048915 Bacteria 5534
896 Ga0496112_0425918 3300048915 Bacteria 1266
897 Ga0496113_0374943 3300048916 Bacteria 1142
898 Ga0496113_0439727 3300048916 Bacteria 1048
899 Ga0496114_0110369 3300048917 Bacteria 2356
900 Ga0496114_0149160 3300048917 Bacteria 2028
901 Ga0496114_0469677 3300048917 Bacteria 1113
902 Ga0496114_1277349 3300048917 Bacteria 621
903 Ga0496115_0026931 3300048918 Bacteria 4493
904 Ga0496115_0098359 3300048918 Bacteria 2396
905 Ga0496115_0134415 3300048918 Bacteria 2039
906 Ga0496115_0493690 3300048918 Bacteria 985
907 Ga0496115_1135447 3300048918 Bacteria 590
908 Ga0496115_1246605 3300048918 Bacteria 556
909 Ga0496116_0004734 3300048919 Bacteria 12854
910 Ga0496116_0187055 3300048919 Bacteria 1101
911 Ga0496117_0004259 3300048920 Bacteria 15962
912 Ga0496117_0095415 3300048920 Bacteria 1900
913 Ga0496117_0152853 3300048920 Bacteria 1363
914 Ga0496117_0179333 3300048920 Bacteria 1220
915 Ga0496117_0308783 3300048920 Bacteria 834
916 Ga0496118_0003088 3300048921 Bacteria 21359
917 Ga0496118_0229661 3300048921 Bacteria 1072
918 Ga0496118_0414948 3300048921 Bacteria 694
919 Ga0496118_0491579 3300048921 Bacteria 612
920 Ga0496119_0084401 3300048922 Bacteria 1821
921 Ga0496120_0008406 3300048923 Bacteria 7493
922 Ga0496120_0095868 3300048923 Bacteria 1576
923 Ga0496120_0212702 3300048923 Bacteria 929
924 Ga0496120_0493749 3300048923 Bacteria 527
925 Ga0496121_0000125 3300048924 Bacteria 169274
926 Ga0496121_0016621 3300048924 Bacteria 7582
927 Ga0496121_0076072 3300048924 Bacteria 2678
928 Ga0496121_0095409 3300048924 Bacteria 2311
929 Ga0496121_0117679 3300048924 Bacteria 2013
930 Ga0496121_0119342 3300048924 Bacteria 1994
931 Ga0496121_0145305 3300048924 Bacteria 1753
932 Ga0496121_0208757 3300048924 Bacteria 1385
933 Ga0496121_0243736 3300048924 Bacteria 1251
934 Ga0496121_0252348 3300048924 Bacteria 1222
935 Ga0496121_0289581 3300048924 Bacteria 1116
936 Ga0496121_0314016 3300048924 Bacteria 1058
937 Ga0496121_0470456 3300048924 Bacteria 805
938 Ga0496122_0039256 3300048925 Bacteria 3778
939 Ga0496122_0073686 3300048925 Bacteria 2419
940 Ga0496122_0089136 3300048925 Bacteria 2111
941 Ga0496123_0016780 3300048926 Bacteria 5923
942 Ga0496123_0151656 3300048926 Bacteria 1249
943 Ga0496124_0010613 3300048927 Bacteria 9308
944 Ga0496124_0082762 3300048927 Bacteria 2634
945 Ga0496124_0084916 3300048927 Bacteria 2595
946 Ga0496124_0201709 3300048927 Bacteria 1512
947 Ga0496124_0216325 3300048927 Bacteria 1445
948 Ga0496124_0348366 3300048927 Bacteria 1049
949 Ga0496124_0378269 3300048927 Bacteria 991
950 Ga0496125_0000576 3300048928 Bacteria 62844
951 Ga0496125_0003556 3300048928 Bacteria 18769
952 Ga0496125_0004044 3300048928 Bacteria 17188
953 Ga0496125_0006115 3300048928 Bacteria 13131
954 Ga0496125_0019582 3300048928 Bacteria 6377
955 Ga0496125_0147225 3300048928 Bacteria 1625
956 Ga0496125_0177747 3300048928 Bacteria 1422
957 Ga0496125_0202652 3300048928 Bacteria 1297
958 Ga0496126_0003482 3300048929 Bacteria 19864
959 Ga0496126_0021101 3300048929 Bacteria 6369
960 Ga0496126_0058272 3300048929 Bacteria 3482
961 Ga0496126_0084458 3300048929 Bacteria 2800
962 Ga0496126_0117484 3300048929 Bacteria 2310
963 Ga0496126_0152106 3300048929 Bacteria 1982
964 Ga0496126_0213502 3300048929 Bacteria 1623
965 Ga0496126_0254709 3300048929 Bacteria 1461
966 Ga0496126_0281491 3300048929 Bacteria 1377
967 Ga0496126_0318254 3300048929 Bacteria 1280
968 Ga0496126_0370003 3300048929 Bacteria 1169
969 Ga0496126_0374307 3300048929 Bacteria 1161
970 Ga0496126_0510245 3300048929 Bacteria 960
971 Ga0496126_0683396 3300048929 Bacteria 799
972 Ga0496126_0712165 3300048929 Bacteria 779
973 Ga0496126_0718546 3300048929 Bacteria 774
974 Ga0496126_1178167 3300048929 Bacteria 565
975 Ga0501031_0005248 3300049568 Bacteria 8443
976 Ga0501031_0070323 3300049568 Bacteria 2280
977 Ga0501031_0884370 3300049568 Bacteria 572
978 Ga0501032_0000030 3300049569 Bacteria 130405
979 Ga0501033_0000060 3300049570 Bacteria 103159
980 Ga0501033_0180436 3300049570 Bacteria 1513
981 Ga0501034_0000117 3300049571 Bacteria 144865
982 Ga0501034_0405086 3300049571 Bacteria 1286
983 Ga0501034_0421400 3300049571 Bacteria 1256
984 Ga0501034_0681412 3300049571 Bacteria 928
985 Ga0501036_0000349 3300049572 Bacteria 32571
986 Ga0501036_0135381 3300049572 Bacteria 2080
987 Ga0501037_0000561 3300049573 Bacteria 29494
988 Ga0501037_0051928 3300049573 Bacteria 2998
989 Ga0501038_0000570 3300049574 Bacteria 32618
990 Ga0501038_0106827 3300049574 Bacteria 2322
991 Ga0501038_0960887 3300049574 Bacteria 629
992 Ga0501039_0003520 3300049575 Bacteria 11726
993 Ga0501039_0389670 3300049575 Bacteria 1094
994 Ga0501040_0995952 3300049576 Bacteria 608
995 Ga0501041_0508070 3300049577 Bacteria 767
996 Ga0501042_0607144 3300049578 Bacteria 795
997 Ga0501043_0000972 3300049579 Bacteria 25318
998 Ga0501043_0025570 3300049579 Bacteria 4632
999 Ga0501043_0214826 3300049579 Bacteria 1490
1000 Ga0501046_0000214 3300049580 Bacteria 60379
1001 Ga0501046_0218198 3300049580 Bacteria 1413
1002 Ga0501047_0000246 3300049581 Bacteria 64361
1003 Ga0501047_0434997 3300049581 Bacteria 1142
1004 Ga0501048_0007131 3300049582 Bacteria 8491
1005 Ga0501048_0317846 3300049582 Bacteria 1109
1006 Ga0501067_0000398 3300049583 Bacteria 23734
1007 Ga0501067_0021099 3300049583 Bacteria 3605
1008 Ga0501067_0028749 3300049583 Bacteria 3081
1009 Ga0501068_0001432 3300049584 Bacteria 12656
1010 Ga0501068_0377014 3300049584 Bacteria 913
1011 Ga0501069_0007157 3300049585 Bacteria 5849
1012 Ga0501070_0373496 3300049586 Bacteria 1156
1013 Ga0501071_0182245 3300049587 Bacteria 1574
1014 Ga0501071_0527049 3300049587 Bacteria 907
1015 Ga0501071_0935589 3300049587 Bacteria 669
1016 Ga0501072_0006414 3300049588 Bacteria 8963
1017 Ga0501073_0000203 3300049589 Bacteria 39315
1018 Ga0501073_0450723 3300049589 Bacteria 889
1019 Ga0501074_0000410 3300049590 Bacteria 25626
1020 Ga0501074_0445567 3300049590 Bacteria 918
1021 Ga0501076_0329381 3300049592 Bacteria 1253
1022 Ga0501076_0586650 3300049592 Bacteria 919
1023 Ga0501076_0945503 3300049592 Bacteria 710
1024 Ga0501079_0009370 3300049741 Bacteria 7420
1025 Ga0501079_1164711 3300049741 Bacteria 607
1026 Ga0501080_0003578 3300049742 Bacteria 13678
1027 Ga0501080_0256097 3300049742 Bacteria 1595
1028 Ga0501081_1144058 3300049743 Bacteria 589
1029 Ga0501081_1229650 3300049743 Bacteria 568
1030 Ga0501083_0008773 3300049744 Bacteria 7134
1031 Ga0501035_0000212 3300049822 Bacteria 69856
1032 Ga0501035_0276363 3300049822 Bacteria 1420
1033 Ga0501044_0001196 3300049823 Bacteria 30769
1034 Ga0501044_0231507 3300049823 Bacteria 1795
1035 Ga0501044_0311849 3300049823 Bacteria 1499
1036 Ga0501044_1469526 3300049823 Bacteria 547
1037 Ga0501045_0030829 3300049824 Bacteria 3882
1038 Ga0501045_0368137 3300049824 Bacteria 1070
1039 nmdc:mga03683_135432_c1 3300050489 Bacteria 1104
1040 nmdc:mga03683_210903_c1 3300050489 Bacteria 894
1041 nmdc:mga03n38_106575_c1 3300050490 Bacteria 1359
1042 nmdc:mga03n38_128213_c1 3300050490 Bacteria 1254
1043 nmdc:mga03n38_1553_c1 3300050490 Bacteria 6660
1044 nmdc:mga00v17_107752_c1 3300050491 Bacteria 1765
1045 nmdc:mga00v17_34577_c2 3300050491 Bacteria 1609
1046 nmdc:mga00v17_73996_c1 3300050491 Bacteria 2116
1047 nmdc:mga0yw44_166105_c1 3300050492 Bacteria 1447
1048 nmdc:mga0yw44_16655_c1 3300050492 Bacteria 3978
1049 nmdc:mga0yw44_38547_c1 3300050492 Bacteria 2829
1050 nmdc:mga0yw44_39479_c1 3300050492 Bacteria 2800
1051 nmdc:mga0yw44_485355_c1 3300050492 Bacteria 838
1052 nmdc:mga0yw44_62329_c1 3300050492 Bacteria 2290
1053 nmdc:mga0k408_303365_c1 3300050493 Bacteria 953
1054 nmdc:mga0k408_304361_c1 3300050493 Bacteria 951
1055 nmdc:mga0k408_51282_c2 3300050493 Bacteria 1535
1056 nmdc:mga0k408_584712_c1 3300050493 Bacteria 659
1057 nmdc:mga0k408_71835_c1 3300050493 Bacteria 2020
1058 nmdc:mga0k408_88359_c1 3300050493 Bacteria 1820
1059 nmdc:mga06z11_143684_c1 3300050494 Bacteria 1351
1060 nmdc:mga06z11_46228_c1 3300050494 Bacteria 2205
1061 nmdc:mga06z11_74470_c1 3300050494 Bacteria 1805
1062 nmdc:mga04h51_250762_c1 3300050495 Bacteria 709
1063 nmdc:mga07m45_205815_c1 3300050496 Bacteria 1145
1064 nmdc:mga07m45_25003_c1 3300050496 Bacteria 3274
1065 nmdc:mga07m45_33961_c1 3300050496 Bacteria 2834
1066 nmdc:mga07m45_445529_c1 3300050496 Bacteria 751
1067 nmdc:mga07m45_46988_c1 3300050496 Bacteria 2426
1068 nmdc:mga05p37_371810_c1 3300050507 Bacteria 1677
1069 nmdc:mga08y16_1404688_c1 3300050511 Bacteria 661
1070 nmdc:mga08y16_372766_c1 3300050511 Bacteria 1464
1071 nmdc:mga0n895_20634_c1 3300050512 Bacteria 6149
1072 nmdc:mga0n895_454825_c1 3300050512 Bacteria 1292
1073 nmdc:mga0rr50_24153_c1 3300050513 Bacteria 4206
1074 nmdc:mga08x19_517253_c1 3300050514 Bacteria 843
1075 nmdc:mga08x19_78608_c1 3300050514 Bacteria 2162
1076 nmdc:mga0a205_1122642_c1 3300050515 Bacteria 634
1077 nmdc:mga0sz30_137399_c1 3300050516 Bacteria 1079
1078 nmdc:mga0sz30_288030_c1 3300050516 Bacteria 732
1079 nmdc:mga0sz30_49993_c1 3300050516 Bacteria 1772
1080 nmdc:mga0sz30_81144_c1 3300050516 Bacteria 1404
1081 Ga0495601_0016203 3300053077 Bacteria 4514
1082 Ga0495601_0027635 3300053077 Bacteria 3508
1083 Ga0495601_0183577 3300053077 Bacteria 1367
1084 Ga0495601_0349956 3300053077 Bacteria 961
1085 Ga0495601_0448400 3300053077 Bacteria 835
1086 Ga0495601_0524562 3300053077 Bacteria 763
1087 Ga0495612_0005217 3300053078 Bacteria 5369
1088 Ga0495612_0102346 3300053078 Bacteria 1220
1089 Ga0500635_0358177 3300053080 Bacteria 577
1090 Ga0495655_0262183 3300053083 Bacteria 584
1091 Ga0495655_0331778 3300053083 Bacteria 529
1092 Ga0495655_0346184 3300053083 Bacteria 519
1093 Ga0495595_0002117 3300053084 Bacteria 7710
1094 Ga0495595_0092174 3300053084 Bacteria 1454
1095 Ga0495619_0001733 3300053085 Bacteria 14473
1096 Ga0495619_0262163 3300053085 Bacteria 1197
1097 Ga0495619_0505396 3300053085 Bacteria 831
1098 Ga0495619_0751323 3300053085 Bacteria 661
1099 Ga0500578_0066268 3300053086 Bacteria 2303
1100 Ga0500578_0299349 3300053086 Bacteria 954
1101 Ga0500578_0374869 3300053086 Bacteria 826
1102 Ga0500643_000015 3300053087 Bacteria 310312
1103 Ga0500643_087682 3300053087 Bacteria 850
1104 Ga0500644_0128415 3300053088 Bacteria 995
1105 Ga0500581_250031 3300053089 Bacteria 744
1106 Ga0500646_0086683 3300053090 Bacteria 963
1107 Ga0500647_0133268 3300053091 Bacteria 1170
1108 Ga0500647_0185946 3300053091 Bacteria 950
1109 Ga0500583_0012287 3300053092 Bacteria 3260
1110 Ga0500583_0139672 3300053092 Bacteria 1203
1111 Ga0500651_0022319 3300053093 Bacteria 3952
1112 Ga0500651_0023742 3300053093 Bacteria 3841
1113 Ga0500566_0000103 3300053094 Bacteria 43464
1114 Ga0500566_0001736 3300053094 Bacteria 12790
1115 Ga0500566_0287934 3300053094 Bacteria 779
1116 Ga0500640_002395 3300053095 Bacteria 6191
1117 Ga0500641_0025996 3300053096 Bacteria 2269
1118 Ga0500641_0055443 3300053096 Bacteria 1641
1119 Ga0500648_287578 3300053097 Bacteria 734
1120 Ga0500650_0031343 3300053098 Bacteria 2416
1121 Ga0500650_0072474 3300053098 Bacteria 1610
1122 Ga0500650_0519080 3300053098 Bacteria 505
1123 Ga0500554_116101 3300053102 Bacteria 901
1124 Ga0500555_002428 3300053103 Bacteria 5405
1125 Ga0500556_0000045 3300053104 Bacteria 130653
1126 Ga0500556_0064236 3300053104 Bacteria 1359
1127 Ga0500562_130270 3300053108 Bacteria 685
1128 Ga0500569_005518 3300053109 Bacteria 2721
1129 Ga0500569_009023 3300053109 Bacteria 2303
1130 Ga0500572_001623 3300053111 Bacteria 5915
1131 Ga0500591_015321 3300053115 Bacteria 3688
1132 Ga0500592_003427 3300053116 Bacteria 2533
1133 Ga0500593_164244 3300053117 Bacteria 845
1134 Ga0500594_0034252 3300053118 Bacteria 1355
1135 Ga0500594_0053683 3300053118 Bacteria 1142
1136 Ga0500595_006846 3300053119 Bacteria 4797
1137 Ga0500595_011978 3300053119 Bacteria 3369
1138 Ga0500595_019337 3300053119 Bacteria 2472
1139 Ga0500595_032978 3300053119 Bacteria 1722
1140 Ga0500595_036295 3300053119 Bacteria 1616
1141 Ga0500595_056065 3300053119 Bacteria 1205
1142 Ga0500597_134524 3300053120 Bacteria 1067
1143 Ga0500607_060416 3300053121 Bacteria 1988
1144 Ga0500608_001250 3300053122 Bacteria 9043
1145 Ga0500614_011202 3300053123 Bacteria 1937
1146 Ga0500621_160597 3300053126 Bacteria 834
1147 Ga0500642_0000024 3300053130 Bacteria 134373
1148 Ga0500642_0000086 3300053130 Bacteria 48427
1149 Ga0500642_0001352 3300053130 Bacteria 7009
1150 Ga0500642_0046985 3300053130 Bacteria 1889
1151 Ga0500642_0341662 3300053130 Bacteria 666
1152 Ga0500652_000135 3300053131 Bacteria 27760
1153 Ga0500655_061228 3300053133 Bacteria 759
1154 Ga0500658_0043797 3300053134 Bacteria 1803
1155 Ga0500559_0000414 3300053136 Bacteria 30678
1156 Ga0500559_0000500 3300053136 Bacteria 27488
1157 Ga0500559_0065394 3300053136 Bacteria 1629
1158 Ga0500559_0182128 3300053136 Bacteria 990
1159 Ga0500559_0206860 3300053136 Bacteria 925
1160 Ga0500564_236436 3300053138 Bacteria 731
1161 Ga0500568_0000469 3300053139 Bacteria 29931
1162 Ga0500568_0008824 3300053139 Bacteria 4833
1163 Ga0500568_0016080 3300053139 Bacteria 3334
1164 Ga0500568_0021651 3300053139 Bacteria 2762
1165 Ga0500568_0087431 3300053139 Bacteria 1178
1166 Ga0500573_0210077 3300053140 Bacteria 1027
1167 Ga0500577_0000773 3300053142 Bacteria 8234
1168 Ga0500577_0156795 3300053142 Bacteria 968
1169 Ga0500577_0287116 3300053142 Bacteria 717
1170 Ga0500586_001132 3300053145 Bacteria 5519
1171 Ga0500589_169257 3300053147 Bacteria 870
1172 Ga0500589_217020 3300053147 Bacteria 723
1173 Ga0500590_063474 3300053148 Bacteria 1852
1174 Ga0500590_113165 3300053148 Bacteria 1284
1175 Ga0500590_140210 3300053148 Bacteria 1105
1176 Ga0500590_301740 3300053148 Bacteria 602
1177 Ga0500603_000931 3300053150 Bacteria 6919
1178 Ga0500604_0000270 3300053151 Bacteria 14474
1179 Ga0500604_0006501 3300053151 Bacteria 3092
1180 Ga0500604_0013790 3300053151 Bacteria 2194
1181 Ga0500616_0000054 3300053153 Bacteria 290186
1182 Ga0500616_0016813 3300053153 Bacteria 4157
1183 Ga0500619_049211 3300053154 Bacteria 1359
1184 Ga0500619_208113 3300053154 Bacteria 655
1185 Ga0500622_0002469 3300053156 Bacteria 13329
1186 Ga0500622_0033009 3300053156 Bacteria 2714
1187 Ga0500627_0019817 3300053158 Bacteria 2687
1188 Ga0500627_0056492 3300053158 Bacteria 1720
1189 Ga0500627_0281844 3300053158 Bacteria 729
1190 Ga0500627_0364678 3300053158 Bacteria 621
1191 Ga0500630_006668 3300053159 Bacteria 5658
1192 Ga0500634_0051449 3300053161 Bacteria 2216
1193 Ga0500634_0111738 3300053161 Bacteria 1347
1194 Ga0500634_0366805 3300053161 Bacteria 543
1195 Ga0500638_010502 3300053162 Bacteria 4059
1196 Ga0500638_064128 3300053162 Bacteria 1762
1197 Ga0500638_261295 3300053162 Bacteria 690
1198 Ga0500638_276787 3300053162 Bacteria 660
1199 Ga0500639_000007 3300053163 Bacteria 152350
1200 Ga0500639_100173 3300053163 Bacteria 1427
1201 Ga0500636_0058456 3300053177 Bacteria 2253
1202 Ga0500636_0063116 3300053177 Bacteria 2160
1203 Ga0500636_0260680 3300053177 Bacteria 877
1204 Ga0500637_0036416 3300053178 Bacteria 2762
1205 Ga0500637_0338305 3300053178 Bacteria 806
1206 Ga0500567_142547 3300053723 Bacteria 914
1207 Ga0500570_082856 3300053724 Bacteria 1435
1208 Ga0500611_090914 3300053727 Bacteria 777
1209 Ga0500657_210903 3300053728 Bacteria 630
1210 Ga0500645_071226 3300053730 Bacteria 997
1211 Ga0500609_046246 3300053731 Bacteria 603
1212 Ga0500596_000038 3300053735 Bacteria 17540
1213 Ga0500596_000636 3300053735 Bacteria 6751
1214 Ga0500596_017831 3300053735 Bacteria 1065
1215 Ga0500596_021187 3300053735 Bacteria 979
1216 Ga0500601_000153 3300053737 Bacteria 14318
1217 Ga0500601_011643 3300053737 Bacteria 989
1218 Ga0501084_0002218 3300054114 Bacteria 15588
1219 Ga0501084_1666730 3300054114 Bacteria 533
1220 Ga0500661_030338 3300055283 Bacteria 954
1221 Ga0500661_042965 3300055283 Bacteria 801
1222 Ga0501082_1336114 3300060353 Bacteria 626

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053728 Ga0500657_210903 Ga0500657_210903_290_619 107
2 3300048917 Ga0496114_1277349 Ga0496114_1277349_254_607 115
3 iso_pu_bacteria 2908739725 2908740372 115
4 3300017792 Ga0163161_10213857 Ga0163161_102138573 123
5 3300049587 Ga0501071_0935589 Ga0501071_0935589_238_639 124
6 iso_pu_bacteria 3005718088 3005724088 124
7 3300047323 Ga0495683_0194879 Ga0495683_0194879_513_896 125
8 3300048091 Ga0495626_0326718 Ga0495626_0326718_108_491 125
9 3300053086 Ga0500578_0066268 Ga0500578_0066268_818_1201 125
10 3300053104 Ga0500556_0064236 Ga0500556_0064236_94_477 125
11 3300053130 Ga0500642_0001352 Ga0500642_0001352_4373_4756 125
12 3300053133 Ga0500655_061228 Ga0500655_061228_114_497 125
13 3300053151 Ga0500604_0013790 Ga0500604_0013790_1395_1778 125
14 3300053156 Ga0500622_0033009 Ga0500622_0033009_753_1136 125
15 3300053731 Ga0500609_046246 Ga0500609_046246_57_440 125
16 iso_pu_bacteria 2906635258 2906640305 125
17 iso_pu_bacteria 2906660503 2906663633 125
18 iso_pu_bacteria 2922425934 2922427215 125
19 iso_pu_bacteria 3005474847 3005476393 125
20 iso_pu_bacteria 8006926726 8006931732 125
21 iso_pu_bacteria 8019555841 8019560902 125
22 iso_pu_bacteria 8019565922 8019570985 125
23 iso_pu_bacteria 2728368998 2728751952 126
24 3300047315 Ga0495581_0197835 Ga0495581_0197835_518_907 127
25 3300005347 Ga0070668_100548748 Ga0070668_1005487482 128
26 3300005437 Ga0070710_10225180 Ga0070710_102251801 128
27 3300005439 Ga0070711_100055202 Ga0070711_1000552022 128
28 3300005457 Ga0070662_100570354 Ga0070662_1005703541 128
29 3300005545 Ga0070695_100449823 Ga0070695_1004498231 128
30 3300005578 Ga0068854_101109823 Ga0068854_1011098232 128
31 3300005616 Ga0068852_100037914 Ga0068852_1000379146 128
32 3300005843 Ga0068860_102159872 Ga0068860_1021598721 128
33 3300006175 Ga0070712_100085114 Ga0070712_1000851141 128
34 3300007788 Ga0099795_10005436 Ga0099795_100054363 128
35 3300009093 Ga0105240_10004957 Ga0105240_100049573 128
36 3300009098 Ga0105245_10299958 Ga0105245_102999581 128
37 3300009553 Ga0105249_10578856 Ga0105249_105788562 128
38 3300010159 Ga0099796_10222055 Ga0099796_102220551 128
39 3300010375 Ga0105239_10267715 Ga0105239_102677154 128
40 3300013306 Ga0163162_10029409 Ga0163162_100294092 128
41 3300014969 Ga0157376_11418883 Ga0157376_114188831 128
42 3300017792 Ga0163161_10791532 Ga0163161_107915321 128
43 3300025911 Ga0207654_10079790 Ga0207654_100797902 128
44 3300025913 Ga0207695_10000378 Ga0207695_1000037824 128
45 3300025914 Ga0207671_10005974 Ga0207671_100059744 128
46 3300025915 Ga0207693_10014111 Ga0207693_100141113 128
47 3300025916 Ga0207663_10047963 Ga0207663_100479632 128
48 3300025927 Ga0207687_10794440 Ga0207687_107944401 128
49 3300025939 Ga0207665_10348260 Ga0207665_103482602 128
50 3300025972 Ga0207668_10631885 Ga0207668_106318851 128
51 3300026142 Ga0207698_10063172 Ga0207698_100631723 128
52 3300031711 Ga0265314_10083597 Ga0265314_100835971 128
53 3300033180 Ga0307510_10035891 Ga0307510_100358913 128
54 3300035725 Ga0373947_0153153 Ga0373947_0153153_992_1393 128
55 3300039453 Ga0436362_0373664 Ga0436362_0373664_282_677 128
56 3300041498 Ga0451841_1457417 Ga0451841_1457417_469_861 128
57 3300046517 Ga0495630_0321072 Ga0495630_0321072_127_528 128
58 3300046535 Ga0495586_0277416 Ga0495586_0277416_410_811 128
59 3300048903 Ga0496100_0275646 Ga0496100_0275646_207_599 128
60 3300048909 Ga0496106_0185464 Ga0496106_0185464_1010_1402 128
61 3300048927 Ga0496124_0201709 Ga0496124_0201709_16_408 128
62 3300053077 Ga0495601_0524562 Ga0495601_0524562_30_599 128
63 3300055283 Ga0500661_030338 Ga0500661_030338_278_709 128
64 3300005436 Ga0070713_101247974 Ga0070713_1012479741 129
65 3300006173 Ga0070716_100100668 Ga0070716_1001006681 129
66 3300009148 Ga0105243_10774814 Ga0105243_107748142 129
67 3300009551 Ga0105238_10196717 Ga0105238_101967172 129
68 3300025261 Ga0209233_1002725 Ga0209233_10027252 129
69 3300025935 Ga0207709_10366681 Ga0207709_103666813 129
70 3300031711 Ga0265314_10085444 Ga0265314_100854443 129
71 3300031712 Ga0265342_10007736 Ga0265342_100077363 129
72 3300039437 Ga0436365_1146796 Ga0436365_1146796_791_1180 129
73 3300046477 Ga0495664_0904159 Ga0495664_0904159_100_504 129
74 3300046683 Ga0495658_0250499 Ga0495658_0250499_488_883 129
75 3300048915 Ga0496112_0425918 Ga0496112_0425918_638_1033 129
76 3300048918 Ga0496115_0134415 Ga0496115_0134415_1573_1968 129
77 3300048924 Ga0496121_0000125 Ga0496121_0000125_155181_155654 129
78 3300048929 Ga0496126_0254709 Ga0496126_0254709_253_648 129
79 3300049568 Ga0501031_0005248 Ga0501031_0005248_5089_5481 129
80 3300049569 Ga0501032_0000030 Ga0501032_0000030_126278_126670 129
81 3300049570 Ga0501033_0000060 Ga0501033_0000060_47761_48153 129
82 3300049571 Ga0501034_0000117 Ga0501034_0000117_82426_82818 129
83 3300049572 Ga0501036_0000349 Ga0501036_0000349_8437_8829 129
84 3300049573 Ga0501037_0000561 Ga0501037_0000561_23829_24221 129
85 3300049574 Ga0501038_0000570 Ga0501038_0000570_23768_24160 129
86 3300049575 Ga0501039_0003520 Ga0501039_0003520_8536_8928 129
87 3300049579 Ga0501043_0000972 Ga0501043_0000972_1726_2118 129
88 3300049580 Ga0501046_0000214 Ga0501046_0000214_27525_27917 129
89 3300049581 Ga0501047_0000246 Ga0501047_0000246_61975_62367 129
90 3300049582 Ga0501048_0007131 Ga0501048_0007131_5478_5870 129
91 3300049583 Ga0501067_0000398 Ga0501067_0000398_4371_4763 129
92 3300049584 Ga0501068_0001432 Ga0501068_0001432_5058_5450 129
93 3300049585 Ga0501069_0007157 Ga0501069_0007157_3815_4207 129
94 3300049586 Ga0501070_0373496 Ga0501070_0373496_686_1075 129
95 3300049588 Ga0501072_0006414 Ga0501072_0006414_5029_5421 129
96 3300049589 Ga0501073_0000203 Ga0501073_0000203_4438_4830 129
97 3300049590 Ga0501074_0000410 Ga0501074_0000410_23824_24216 129
98 3300049592 Ga0501076_0329381 Ga0501076_0329381_542_934 129
99 3300049741 Ga0501079_0009370 Ga0501079_0009370_3588_3980 129
100 3300049742 Ga0501080_0003578 Ga0501080_0003578_8916_9308 129
101 3300049743 Ga0501081_1144058 Ga0501081_1144058_151_543 129
102 3300049744 Ga0501083_0008773 Ga0501083_0008773_4730_5122 129
103 3300049822 Ga0501035_0000212 Ga0501035_0000212_11458_11850 129
104 3300049823 Ga0501044_0001196 Ga0501044_0001196_7170_7562 129
105 3300049823 Ga0501044_0231507 Ga0501044_0231507_802_1191 129
106 3300049824 Ga0501045_0030829 Ga0501045_0030829_673_1065 129
107 3300053153 Ga0500616_0016813 Ga0500616_0016813_606_1007 129
108 3300054114 Ga0501084_0002218 Ga0501084_0002218_3322_3714 129
109 iso_pu_bacteria 2513237098 2513675284 129
110 iso_pu_bacteria 2524023210 2524469116 129
111 iso_pu_bacteria 2885383462 2885389500 129
112 iso_pu_bacteria 2903768456 2903771463 129
113 iso_pu_bacteria 8056681323 8056681837 129
114 iso_pu_bacteria 8056689827 8056695477 129
115 3300005329 Ga0070683_100850693 Ga0070683_1008506932 130
116 3300005334 Ga0068869_101045167 Ga0068869_1010451671 130
117 3300005344 Ga0070661_101675607 Ga0070661_1016756071 130
118 3300005435 Ga0070714_100186990 Ga0070714_1001869901 130
119 3300005436 Ga0070713_100273740 Ga0070713_1002737402 130
120 3300005439 Ga0070711_100136144 Ga0070711_1001361442 130
121 3300005455 Ga0070663_101030048 Ga0070663_1010300481 130
122 3300005466 Ga0070685_10210776 Ga0070685_102107761 130
123 3300005548 Ga0070665_100496407 Ga0070665_1004964072 130
124 3300005577 Ga0068857_100081351 Ga0068857_1000813512 130
125 3300005614 Ga0068856_101300487 Ga0068856_1013004871 130
126 3300005618 Ga0068864_101511805 Ga0068864_1015118051 130
127 3300005842 Ga0068858_100207233 Ga0068858_1002072333 130
128 3300005983 Ga0081540_1027471 Ga0081540_10274713 130
129 3300006028 Ga0070717_10890816 Ga0070717_108908162 130
130 3300006175 Ga0070712_101087861 Ga0070712_1010878612 130
131 3300006358 Ga0068871_100657870 Ga0068871_1006578701 130
132 3300009101 Ga0105247_10038734 Ga0105247_100387344 130
133 3300009148 Ga0105243_12221593 Ga0105243_122215931 130
134 3300009174 Ga0105241_10577725 Ga0105241_105777252 130
135 3300009545 Ga0105237_10053382 Ga0105237_100533824 130
136 3300009551 Ga0105238_10124009 Ga0105238_101240093 130
137 3300009553 Ga0105249_12469386 Ga0105249_124693861 130
138 3300011119 Ga0105246_10146770 Ga0105246_101467703 130
139 3300013306 Ga0163162_10107603 Ga0163162_101076032 130
140 3300013308 Ga0157375_10352711 Ga0157375_103527112 130
141 3300014325 Ga0163163_10038380 Ga0163163_100383805 130
142 3300014968 Ga0157379_10034808 Ga0157379_100348085 130
143 3300014968 Ga0157379_11615089 Ga0157379_116150891 130
144 3300021358 Ga0213873_10065597 Ga0213873_100655973 130
145 3300021377 Ga0213874_10069360 Ga0213874_100693602 130
146 3300025914 Ga0207671_10072553 Ga0207671_100725533 130
147 3300025920 Ga0207649_11138891 Ga0207649_111388911 130
148 3300025924 Ga0207694_10096891 Ga0207694_100968911 130
149 3300025926 Ga0207659_11751403 Ga0207659_117514031 130
150 3300025928 Ga0207700_10298619 Ga0207700_102986192 130
151 3300025928 Ga0207700_10720495 Ga0207700_107204952 130
152 3300025929 Ga0207664_10247165 Ga0207664_102471651 130
153 3300025945 Ga0207679_11805561 Ga0207679_118055611 130
154 3300025961 Ga0207712_11840585 Ga0207712_118405851 130
155 3300026035 Ga0207703_10161146 Ga0207703_101611462 130
156 3300026067 Ga0207678_10987030 Ga0207678_109870302 130
157 3300026078 Ga0207702_11197838 Ga0207702_111978381 130
158 3300026095 Ga0207676_10109436 Ga0207676_101094361 130
159 3300026116 Ga0207674_10427480 Ga0207674_104274802 130
160 3300026116 Ga0207674_11502755 Ga0207674_115027551 130
161 3300028379 Ga0268266_10139753 Ga0268266_101397533 130
162 3300031249 Ga0265339_10008628 Ga0265339_100086282 130
163 3300035111 Ga0373923_0085647 Ga0373923_0085647_337_735 130
164 3300035113 Ga0373936_0122315 Ga0373936_0122315_366_764 130
165 3300035117 Ga0373953_0002113 Ga0373953_0002113_1932_2330 130
166 3300035117 Ga0373953_0347058 Ga0373953_0347058_65_463 130
167 3300035118 Ga0373954_0009691 Ga0373954_0009691_1576_1974 130
168 3300035119 Ga0373956_0039561 Ga0373956_0039561_1410_1808 130
169 3300035120 Ga0373957_0006803 Ga0373957_0006803_970_1368 130
170 3300035172 Ga0373955_0001917 Ga0373955_0001917_3220_3618 130
171 3300035172 Ga0373955_0364492 Ga0373955_0364492_340_738 130
172 3300035410 Ga0373924_0001605 Ga0373924_0001605_1191_1589 130
173 3300035692 Ga0373935_0034676 Ga0373935_0034676_401_799 130
174 3300035695 Ga0373927_0028939 Ga0373927_0028939_663_1061 130
175 3300036401 Ga0373937_0123998 Ga0373937_0123998_1154_1552 130
176 3300037068 Ga0373925_0156327 Ga0373925_0156327_652_1050 130
177 3300037068 Ga0373925_1412806 Ga0373925_1412806_144_542 130
178 3300039437 Ga0436365_1716705 Ga0436365_1716705_490_888 130
179 3300039438 Ga0436360_0420359 Ga0436360_0420359_1268_1666 130
180 3300039447 Ga0436361_0051433 Ga0436361_0051433_418_831 130
181 3300039450 Ga0436363_0234286 Ga0436363_0234286_739_1137 130
182 3300039453 Ga0436362_0439870 Ga0436362_0439870_2176_2589 130
183 3300042142 Ga0450905_106040 Ga0450905_106040_54_473 130
184 3300044694 Ga0466963_0150967 Ga0466963_0150967_79_477 130
185 3300044735 Ga0466968_0139862 Ga0466968_0139862_61_459 130
186 3300045049 Ga0466959_0056697 Ga0466959_0056697_2448_2846 130
187 3300046454 Ga0495592_0004099 Ga0495592_0004099_6848_7246 130
188 3300046462 Ga0495651_0045237 Ga0495651_0045237_1018_1416 130
189 3300046463 Ga0495653_0054219 Ga0495653_0054219_644_1042 130
190 3300046477 Ga0495664_0009901 Ga0495664_0009901_2535_2933 130
191 3300046511 Ga0495608_0036761 Ga0495608_0036761_970_1368 130
192 3300046514 Ga0495618_0018145 Ga0495618_0018145_1080_1478 130
193 3300046516 Ga0495628_0083128 Ga0495628_0083128_1246_1644 130
194 3300046517 Ga0495630_0101653 Ga0495630_0101653_1203_1601 130
195 3300046529 Ga0495652_0014289 Ga0495652_0014289_5294_5692 130
196 3300046533 Ga0495640_0033150 Ga0495640_0033150_1317_1715 130
197 3300046536 Ga0495587_0029595 Ga0495587_0029595_1358_1756 130
198 3300046543 Ga0495645_0004447 Ga0495645_0004447_6600_6998 130
199 3300046559 Ga0495667_0029608 Ga0495667_0029608_2273_2671 130
200 3300046615 Ga0495656_0406056 Ga0495656_0406056_12_404 130
201 3300046642 Ga0495634_0012048 Ga0495634_0012048_5353_5751 130
202 3300046663 Ga0495635_0017629 Ga0495635_0017629_3180_3578 130
203 3300046674 Ga0495588_0339262 Ga0495588_0339262_249_656 130
204 3300046675 Ga0495657_0017156 Ga0495657_0017156_2236_2634 130
205 3300046678 Ga0495599_0003578 Ga0495599_0003578_5777_6175 130
206 3300046679 Ga0495623_0033232 Ga0495623_0033232_1718_2116 130
207 3300046680 Ga0495646_0019861 Ga0495646_0019861_338_736 130
208 3300046690 Ga0495624_0205745 Ga0495624_0205745_58_456 130
209 3300046809 Ga0495600_0010963 Ga0495600_0010963_1435_1833 130
210 3300047317 Ga0495604_0011675 Ga0495604_0011675_2149_2547 130
211 3300047319 Ga0495674_0052222 Ga0495674_0052222_1104_1502 130
212 3300047320 Ga0495672_0025612 Ga0495672_0025612_532_924 130
213 3300047322 Ga0495680_0021605 Ga0495680_0021605_2589_2987 130
214 3300047444 Ga0495675_0016494 Ga0495675_0016494_2700_3098 130
215 3300047471 Ga0495684_0022863 Ga0495684_0022863_1077_1475 130
216 3300047673 Ga0495593_0021021 Ga0495593_0021021_1071_1469 130
217 3300048905 Ga0496102_0063011 Ga0496102_0063011_492_917 130
218 3300048907 Ga0496104_0126851 Ga0496104_0126851_25_450 130
219 3300048909 Ga0496106_0216847 Ga0496106_0216847_1009_1434 130
220 3300048910 Ga0496107_0061146 Ga0496107_0061146_2008_2433 130
221 3300048911 Ga0496108_0087488 Ga0496108_0087488_579_1004 130
222 3300048912 Ga0496109_0034528 Ga0496109_0034528_1620_2045 130
223 3300048913 Ga0496110_0020924 Ga0496110_0020924_271_696 130
224 3300048915 Ga0496112_0027002 Ga0496112_0027002_4571_4996 130
225 3300048918 Ga0496115_0098359 Ga0496115_0098359_1978_2376 130
226 3300048924 Ga0496121_0119342 Ga0496121_0119342_1298_1696 130
227 3300048929 Ga0496126_0117484 Ga0496126_0117484_1895_2293 130
228 3300049568 Ga0501031_0070323 Ga0501031_0070323_483_875 130
229 3300049568 Ga0501031_0884370 Ga0501031_0884370_48_467 130
230 3300049570 Ga0501033_0180436 Ga0501033_0180436_572_964 130
231 3300049571 Ga0501034_0405086 Ga0501034_0405086_414_806 130
232 3300049573 Ga0501037_0051928 Ga0501037_0051928_56_448 130
233 3300049574 Ga0501038_0106827 Ga0501038_0106827_538_930 130
234 3300049575 Ga0501039_0389670 Ga0501039_0389670_261_653 130
235 3300049576 Ga0501040_0995952 Ga0501040_0995952_66_485 130
236 3300049577 Ga0501041_0508070 Ga0501041_0508070_252_671 130
237 3300049578 Ga0501042_0607144 Ga0501042_0607144_53_472 130
238 3300049579 Ga0501043_0025570 Ga0501043_0025570_2599_2991 130
239 3300049580 Ga0501046_0218198 Ga0501046_0218198_281_673 130
240 3300049581 Ga0501047_0434997 Ga0501047_0434997_190_582 130
241 3300049582 Ga0501048_0317846 Ga0501048_0317846_293_685 130
242 3300049583 Ga0501067_0028749 Ga0501067_0028749_1423_1815 130
243 3300049584 Ga0501068_0377014 Ga0501068_0377014_43_435 130
244 3300049587 Ga0501071_0182245 Ga0501071_0182245_1014_1406 130
245 3300049589 Ga0501073_0450723 Ga0501073_0450723_286_678 130
246 3300049590 Ga0501074_0445567 Ga0501074_0445567_88_480 130
247 3300049592 Ga0501076_0586650 Ga0501076_0586650_121_540 130
248 3300049742 Ga0501080_0256097 Ga0501080_0256097_1137_1529 130
249 3300049822 Ga0501035_0276363 Ga0501035_0276363_287_679 130
250 3300049823 Ga0501044_0311849 Ga0501044_0311849_942_1334 130
251 3300049823 Ga0501044_1469526 Ga0501044_1469526_94_492 130
252 3300049824 Ga0501045_0368137 Ga0501045_0368137_575_994 130
253 3300053077 Ga0495601_0016203 Ga0495601_0016203_1850_2248 130
254 3300053078 Ga0495612_0005217 Ga0495612_0005217_1335_1733 130
255 3300053084 Ga0495595_0092174 Ga0495595_0092174_375_773 130
256 3300053085 Ga0495619_0262163 Ga0495619_0262163_520_918 130
257 3300053091 Ga0500647_0133268 Ga0500647_0133268_572_970 130
258 3300053094 Ga0500566_0000103 Ga0500566_0000103_3419_3817 130
259 3300053095 Ga0500640_002395 Ga0500640_002395_2422_2820 130
260 3300053111 Ga0500572_001623 Ga0500572_001623_2670_3068 130
261 3300053115 Ga0500591_015321 Ga0500591_015321_2566_2964 130
262 3300053123 Ga0500614_011202 Ga0500614_011202_977_1375 130
263 3300053136 Ga0500559_0000500 Ga0500559_0000500_398_796 130
264 3300053139 Ga0500568_0021651 Ga0500568_0021651_1096_1488 130
265 3300053150 Ga0500603_000931 Ga0500603_000931_1644_2042 130
266 3300053159 Ga0500630_006668 Ga0500630_006668_683_1081 130
267 3300053162 Ga0500638_010502 Ga0500638_010502_3384_3782 130
268 3300053163 Ga0500639_000007 Ga0500639_000007_141437_141835 130
269 3300053735 Ga0500596_000038 Ga0500596_000038_2407_2805 130
270 3300054114 Ga0501084_1666730 Ga0501084_1666730_94_486 130
271 3300060353 Ga0501082_1336114 Ga0501082_1336114_84_503 130
272 iso_pu_bacteria 2507262055 2507508680 130
273 iso_pu_bacteria 2508501009 2508542776 130
274 iso_pu_bacteria 2508501042 2508691463 130
275 iso_pu_bacteria 2508501128 2509147922 130
276 iso_pu_bacteria 2513237137 2513863817 130
277 iso_pu_bacteria 2515154112 2515628268 130
278 iso_pu_bacteria 2602042107 2603860482 130
279 iso_pu_bacteria 2617270741 2617375858 130
280 iso_pu_bacteria 2791355196 2793062497 130
281 iso_pu_bacteria 2824704595 2824713648 130
282 iso_pu_bacteria 2824732956 2824739771 130
283 iso_pu_bacteria 2824746037 2824751587 130
284 iso_pu_bacteria 2824753945 2824763188 130
285 iso_pu_bacteria 2824763712 2824767486 130
286 iso_pu_bacteria 2842038055 2842039165 130
287 iso_pu_bacteria 2842045827 2842047888 130
288 iso_pu_bacteria 2849076700 2849079410 130
289 iso_pu_bacteria 2857524615 2857525432 130
290 iso_pu_bacteria 2874590934 2874593417 130
291 iso_pu_bacteria 2874628541 2874633308 130
292 iso_pu_bacteria 2874645413 2874648971 130
293 iso_pu_bacteria 2876771140 2876773166 130
294 iso_pu_bacteria 2876818435 2876822056 130
295 iso_pu_bacteria 2879074833 2879077211 130
296 iso_pu_bacteria 2879127579 2879130020 130
297 iso_pu_bacteria 2881665667 2881671082 130
298 iso_pu_bacteria 2885366525 2885370566 130
299 iso_pu_bacteria 2888388044 2888393902 130
300 iso_pu_bacteria 2893066018 2893070911 130
301 iso_pu_bacteria 2904699407 2904706686 130
302 iso_pu_bacteria 2904711408 2904714512 130
303 iso_pu_bacteria 2908775508 2908780086 130
304 iso_pu_bacteria 2919073203 2919074878 130
305 iso_pu_bacteria 2935608549 2935608791 130
306 iso_pu_bacteria 2935648319 2935649946 130
307 iso_pu_bacteria 2935656913 2935661902 130
308 iso_pu_bacteria 2935819856 2935821952 130
309 iso_pu_bacteria 2935847175 2935847534 130
310 iso_pu_bacteria 2935908558 2935909199 130
311 iso_pu_bacteria 2935916978 2935919920 130
312 iso_pu_bacteria 2935926038 2935926227 130
313 iso_pu_bacteria 2935934488 2935934677 130
314 iso_pu_bacteria 2935942939 2935943127 130
315 iso_pu_bacteria 2935951376 2935951565 130
316 iso_pu_bacteria 2935967501 2935967690 130
317 iso_pu_bacteria 2935975950 2935977112 130
318 iso_pu_bacteria 2935984226 2935988270 130
319 iso_pu_bacteria 2936011229 2936012571 130
320 iso_pu_bacteria 2936019824 2936021135 130
321 iso_pu_bacteria 2936028420 2936029864 130
322 iso_pu_bacteria 2936046547 2936047329 130
323 iso_pu_bacteria 2936055302 2936057513 130
324 iso_pu_bacteria 3005506211 3005510237 130
325 iso_pu_bacteria 8006933436 8006937734 130
326 iso_pu_bacteria 8006973647 8006977765 130
327 iso_pu_bacteria 8016630954 8016640454 130
328 iso_pu_bacteria 8019619141 8019628033 130
329 iso_pu_bacteria 8019629233 8019634567 130
330 iso_pu_bacteria 8019638758 8019645148 130
331 iso_pu_bacteria 8019659431 8019662462 130
332 iso_pu_bacteria 8019668869 8019671960 130
333 iso_pu_bacteria 8019687851 8019689972 130
334 3300005336 Ga0070680_101749694 Ga0070680_1017496941 131
335 3300005337 Ga0070682_100247304 Ga0070682_1002473042 131
336 3300005455 Ga0070663_100435037 Ga0070663_1004350371 131
337 3300005535 Ga0070684_100254342 Ga0070684_1002543422 131
338 3300005539 Ga0068853_100039389 Ga0068853_1000393891 131
339 3300005547 Ga0070693_100091598 Ga0070693_1000915983 131
340 3300005564 Ga0070664_101125925 Ga0070664_1011259251 131
341 3300005578 Ga0068854_100486767 Ga0068854_1004867672 131
342 3300005616 Ga0068852_100655479 Ga0068852_1006554792 131
343 3300006048 Ga0075363_100428206 Ga0075363_1004282062 131
344 3300006178 Ga0075367_10082850 Ga0075367_100828502 131
345 3300006353 Ga0075370_10039239 Ga0075370_100392394 131
346 3300009174 Ga0105241_10757570 Ga0105241_107575702 131
347 3300009545 Ga0105237_12093761 Ga0105237_120937611 131
348 3300009551 Ga0105238_10299288 Ga0105238_102992881 131
349 3300025321 Ga0207656_10515633 Ga0207656_105156332 131
350 3300025917 Ga0207660_11155839 Ga0207660_111558391 131
351 3300025924 Ga0207694_10182459 Ga0207694_101824593 131
352 3300025981 Ga0207640_10708859 Ga0207640_107088592 131
353 3300026067 Ga0207678_10089215 Ga0207678_100892153 131
354 3300026142 Ga0207698_10355488 Ga0207698_103554882 131
355 3300041486 Ga0451807_2559663 Ga0451807_2559663_18_419 131
356 3300046530 Ga0495654_0163143 Ga0495654_0163143_94_495 131
357 3300047469 Ga0495673_0184252 Ga0495673_0184252_297_698 131
358 3300048924 Ga0496121_0208757 Ga0496121_0208757_617_1018 131
359 3300048927 Ga0496124_0216325 Ga0496124_0216325_373_774 131
360 3300050494 nmdc:mga06z11_46228_c1 nmdc:mga06z11_46228_c1_1189_1590 131
361 3300050496 nmdc:mga07m45_46988_c1 nmdc:mga07m45_46988_c1_915_1316 131
362 3300053119 Ga0500595_006846 Ga0500595_006846_2805_3206 131
363 3300053139 Ga0500568_0016080 Ga0500568_0016080_441_842 131
364 3300053162 Ga0500638_276787 Ga0500638_276787_198_599 131
365 3300053724 Ga0500570_082856 Ga0500570_082856_386_787 131
366 iso_pu_bacteria 2513237139 2513872678 131
367 iso_pu_bacteria 2517093001 2517101332 131
368 iso_pu_bacteria 2524023205 2524440470 131
369 iso_pu_bacteria 2617270735 2617348923 131
370 iso_pu_bacteria 2744054633 2745075261 131
371 iso_pu_bacteria 2802429603 2805915424 131
372 iso_pu_bacteria 2824600985 2824603477 131
373 iso_pu_bacteria 2824609381 2824614756 131
374 iso_pu_bacteria 2824696289 2824701711 131
375 iso_pu_bacteria 2841957949 2841958574 131
376 iso_pu_bacteria 2847930680 2847936119 131
377 iso_pu_bacteria 2847939898 2847946471 131
378 iso_pu_bacteria 2874620515 2874627200 131
379 iso_pu_bacteria 2904666416 2904671280 131
380 iso_pu_bacteria 2906643746 2906650481 131
381 iso_pu_bacteria 2935959822 2935966385 131
382 iso_pu_bacteria 2941531003 2941532664 131
383 iso_pu_bacteria 3005483717 3005487254 131
384 3300003215 JGI25153J46596_10000472 JGI25153J46596_1000047217 132
385 3300003215 JGI25153J46596_10009052 JGI25153J46596_100090522 132
386 3300003215 JGI25153J46596_10009819 JGI25153J46596_100098193 132
387 3300003215 JGI25153J46596_10011461 JGI25153J46596_100114613 132
388 3300003354 JGI25160J50197_1002192 JGI25160J50197_10021924 132
389 3300003354 JGI25160J50197_1008449 JGI25160J50197_10084493 132
390 3300003354 JGI25160J50197_1013575 JGI25160J50197_10135751 132
391 3300003794 Ga0055531_10014195 Ga0055531_100141953 132
392 3300004625 Ga0055543_1015878 Ga0055543_10158782 132
393 3300005262 Ga0065165_1003559 Ga0065165_10035599 132
394 3300005262 Ga0065165_1003853 Ga0065165_100385310 132
395 3300005262 Ga0065165_1018994 Ga0065165_10189941 132
396 3300005262 Ga0065165_1114374 Ga0065165_11143741 132
397 3300005339 Ga0070660_100814677 Ga0070660_1008146772 132
398 3300005344 Ga0070661_100288474 Ga0070661_1002884741 132
399 3300005366 Ga0070659_101526241 Ga0070659_1015262411 132
400 3300005455 Ga0070663_100060665 Ga0070663_1000606652 132
401 3300005539 Ga0068853_100547786 Ga0068853_1005477861 132
402 3300005547 Ga0070693_100296525 Ga0070693_1002965251 132
403 3300005548 Ga0070665_100263003 Ga0070665_1002630031 132
404 3300005578 Ga0068854_100051014 Ga0068854_1000510143 132
405 3300005614 Ga0068856_100449393 Ga0068856_1004493931 132
406 3300005616 Ga0068852_100258731 Ga0068852_1002587311 132
407 3300005834 Ga0068851_10221768 Ga0068851_102217682 132
408 3300005843 Ga0068860_101526264 Ga0068860_1015262641 132
409 3300005983 Ga0081540_1023528 Ga0081540_10235283 132
410 3300006038 Ga0075365_10016403 Ga0075365_100164032 132
411 3300006038 Ga0075365_10040718 Ga0075365_100407184 132
412 3300006051 Ga0075364_10248096 Ga0075364_102480963 132
413 3300006178 Ga0075367_10098442 Ga0075367_100984423 132
414 3300006186 Ga0075369_10018548 Ga0075369_100185483 132
415 3300006186 Ga0075369_10354305 Ga0075369_103543051 132
416 3300006195 Ga0075366_10099715 Ga0075366_100997153 132
417 3300006195 Ga0075366_10187259 Ga0075366_101872591 132
418 3300006353 Ga0075370_10039847 Ga0075370_100398473 132
419 3300006353 Ga0075370_10046929 Ga0075370_100469291 132
420 3300006353 Ga0075370_10246684 Ga0075370_102466842 132
421 3300006942 Ga0099824_1020528 Ga0099824_10205283 132
422 3300009098 Ga0105245_10406223 Ga0105245_104062232 132
423 3300009174 Ga0105241_10430170 Ga0105241_104301702 132
424 3300009177 Ga0105248_12619949 Ga0105248_126199491 132
425 3300009545 Ga0105237_10123798 Ga0105237_101237983 132
426 3300009545 Ga0105237_10800229 Ga0105237_108002292 132
427 3300009551 Ga0105238_10442170 Ga0105238_104421702 132
428 3300010375 Ga0105239_10142500 Ga0105239_101425002 132
429 3300010375 Ga0105239_10371171 Ga0105239_103711712 132
430 3300010375 Ga0105239_10421858 Ga0105239_104218583 132
431 3300010375 Ga0105239_10972499 Ga0105239_109724991 132
432 3300013100 Ga0157373_10312320 Ga0157373_103123202 132
433 3300013102 Ga0157371_10203224 Ga0157371_102032242 132
434 3300013104 Ga0157370_11104193 Ga0157370_111041932 132
435 3300013105 Ga0157369_10247516 Ga0157369_102475162 132
436 3300013307 Ga0157372_10335864 Ga0157372_103358641 132
437 3300021320 Ga0214544_1000002 Ga0214544_1000002523 132
438 3300021321 Ga0214542_1000001 Ga0214542_1000001873 132
439 3300021321 Ga0214542_1037264 Ga0214542_10372642 132
440 3300021324 Ga0214545_1000001 Ga0214545_1000001939 132
441 3300021324 Ga0214545_1029177 Ga0214545_10291773 132
442 3300021327 Ga0214543_1000001 Ga0214543_1000001254 132
443 3300022467 Ga0224712_10215445 Ga0224712_102154452 132
444 3300025253 Ga0209677_104330 Ga0209677_1043302 132
445 3300025261 Ga0209233_1011472 Ga0209233_10114722 132
446 3300025273 Ga0209673_1032716 Ga0209673_10327162 132
447 3300025295 Ga0209564_1004524 Ga0209564_10045244 132
448 3300025295 Ga0209564_1009791 Ga0209564_10097914 132
449 3300025297 Ga0209758_1000021 Ga0209758_1000021607 132
450 3300025297 Ga0209758_1001632 Ga0209758_100163210 132
451 3300025297 Ga0209758_1002055 Ga0209758_100205511 132
452 3300025297 Ga0209758_1003008 Ga0209758_10030088 132
453 3300025297 Ga0209758_1037482 Ga0209758_10374823 132
454 3300025299 Ga0209256_1006522 Ga0209256_10065223 132
455 3300025302 Ga0207426_1000960 Ga0207426_100096013 132
456 3300025302 Ga0207426_1004043 Ga0207426_10040438 132
457 3300025302 Ga0207426_1015353 Ga0207426_10153532 132
458 3300025304 Ga0209257_1002332 Ga0209257_100233211 132
459 3300025321 Ga0207656_10045214 Ga0207656_100452142 132
460 3300025913 Ga0207695_10922659 Ga0207695_109226592 132
461 3300025914 Ga0207671_10554433 Ga0207671_105544331 132
462 3300025919 Ga0207657_10551261 Ga0207657_105512613 132
463 3300025924 Ga0207694_10644244 Ga0207694_106442441 132
464 3300025944 Ga0207661_10192288 Ga0207661_101922882 132
465 3300026067 Ga0207678_10016384 Ga0207678_100163843 132
466 3300026067 Ga0207678_10480488 Ga0207678_104804882 132
467 3300027296 Ga0209389_1000121 Ga0209389_100012150 132
468 3300027357 Ga0209589_1002735 Ga0209589_10027359 132
469 3300027361 Ga0209489_103445 Ga0209489_1034459 132
470 3300028379 Ga0268266_10257040 Ga0268266_102570401 132
471 3300031507 Ga0307509_10004249 Ga0307509_1000424919 132
472 3300031616 Ga0307508_10029469 Ga0307508_100294694 132
473 3300031730 Ga0307516_10145109 Ga0307516_101451093 132
474 3300031730 Ga0307516_10275546 Ga0307516_102755462 132
475 3300031730 Ga0307516_10542889 Ga0307516_105428891 132
476 3300033179 Ga0307507_10005195 Ga0307507_1000519519 132
477 3300035083 Ga0373926_0033177 Ga0373926_0033177_1292_1708 132
478 3300035086 Ga0373934_0014244 Ga0373934_0014244_212_628 132
479 3300035113 Ga0373936_0106474 Ga0373936_0106474_557_973 132
480 3300035116 Ga0373945_0005241 Ga0373945_0005241_3236_3652 132
481 3300035117 Ga0373953_0186763 Ga0373953_0186763_182_598 132
482 3300035118 Ga0373954_0005085 Ga0373954_0005085_4613_5029 132
483 3300035120 Ga0373957_0114970 Ga0373957_0114970_362_778 132
484 3300035170 Ga0373943_0155773 Ga0373943_0155773_791_1207 132
485 3300035170 Ga0373943_0221746 Ga0373943_0221746_469_876 132
486 3300035172 Ga0373955_0016162 Ga0373955_0016162_922_1338 132
487 3300035410 Ga0373924_0043558 Ga0373924_0043558_1400_1816 132
488 3300035692 Ga0373935_0010545 Ga0373935_0010545_2345_2752 132
489 3300035692 Ga0373935_0032760 Ga0373935_0032760_765_1181 132
490 3300035695 Ga0373927_0018507 Ga0373927_0018507_1740_2147 132
491 3300035695 Ga0373927_0079859 Ga0373927_0079859_977_1393 132
492 3300035724 Ga0373933_0007396 Ga0373933_0007396_2033_2449 132
493 3300035725 Ga0373947_0007178 Ga0373947_0007178_2424_2840 132
494 3300036401 Ga0373937_0968470 Ga0373937_0968470_356_772 132
495 3300037068 Ga0373925_0006804 Ga0373925_0006804_4660_5067 132
496 3300037068 Ga0373925_0036806 Ga0373925_0036806_1401_1817 132
497 3300041443 Ga0451789_0382349 Ga0451789_0382349_550_954 132
498 3300041486 Ga0451807_1616728 Ga0451807_1616728_895_1299 132
499 3300044683 Ga0466965_0051814 Ga0466965_0051814_840_1244 132
500 3300044901 Ga0466960_0391756 Ga0466960_0391756_344_748 132
501 3300045976 Ga0466967_2493582 Ga0466967_2493582_16_420 132
502 3300046454 Ga0495592_0092975 Ga0495592_0092975_1475_1891 132
503 3300046455 Ga0495603_0438745 Ga0495603_0438745_246_653 132
504 3300046460 Ga0495638_0188969 Ga0495638_0188969_458_862 132
505 3300046463 Ga0495653_0316077 Ga0495653_0316077_225_641 132
506 3300046473 Ga0495582_0044946 Ga0495582_0044946_854_1270 132
507 3300046475 Ga0495639_0010400 Ga0495639_0010400_190_606 132
508 3300046476 Ga0495662_0135393 Ga0495662_0135393_180_596 132
509 3300046477 Ga0495664_0024884 Ga0495664_0024884_2869_3285 132
510 3300046517 Ga0495630_0147529 Ga0495630_0147529_1255_1671 132
511 3300046522 Ga0495643_0165258 Ga0495643_0165258_349_753 132
512 3300046524 Ga0495648_0254745 Ga0495648_0254745_40_444 132
513 3300046526 Ga0495666_0234605 Ga0495666_0234605_25_441 132
514 3300046529 Ga0495652_0362537 Ga0495652_0362537_247_663 132
515 3300046531 Ga0495665_0031748 Ga0495665_0031748_2104_2520 132
516 3300046533 Ga0495640_0027019 Ga0495640_0027019_939_1355 132
517 3300046557 Ga0495622_0018402 Ga0495622_0018402_408_815 132
518 3300046557 Ga0495622_0097730 Ga0495622_0097730_33_449 132
519 3300046615 Ga0495656_0312677 Ga0495656_0312677_68_466 132
520 3300046663 Ga0495635_0057029 Ga0495635_0057029_324_740 132
521 3300046674 Ga0495588_0183773 Ga0495588_0183773_367_783 132
522 3300046678 Ga0495599_0218843 Ga0495599_0218843_537_941 132
523 3300046679 Ga0495623_0177519 Ga0495623_0177519_122_538 132
524 3300046680 Ga0495646_0022475 Ga0495646_0022475_1244_1660 132
525 3300046681 Ga0495647_0226105 Ga0495647_0226105_263_679 132
526 3300046690 Ga0495624_0023114 Ga0495624_0023114_1370_1786 132
527 3300046690 Ga0495624_0696746 Ga0495624_0696746_150_557 132
528 3300046691 Ga0495670_0784625 Ga0495670_0784625_69_473 132
529 3300047315 Ga0495581_0012239 Ga0495581_0012239_3578_3994 132
530 3300047320 Ga0495672_0010334 Ga0495672_0010334_3931_4338 132
531 3300047472 Ga0495686_0018484 Ga0495686_0018484_3274_3678 132
532 3300047472 Ga0495686_0143251 Ga0495686_0143251_907_1311 132
533 3300047472 Ga0495686_0172030 Ga0495686_0172030_23_427 132
534 3300047673 Ga0495593_0015060 Ga0495593_0015060_3924_4340 132
535 3300048088 Ga0495602_0179814 Ga0495602_0179814_534_938 132
536 3300048089 Ga0495614_0073888 Ga0495614_0073888_174_590 132
537 3300048907 Ga0496104_0828957 Ga0496104_0828957_63_467 132
538 3300048909 Ga0496106_0036778 Ga0496106_0036778_932_1339 132
539 3300048910 Ga0496107_0585362 Ga0496107_0585362_361_768 132
540 3300048911 Ga0496108_0113908 Ga0496108_0113908_1412_1816 132
541 3300048919 Ga0496116_0187055 Ga0496116_0187055_145_552 132
542 3300048920 Ga0496117_0004259 Ga0496117_0004259_3652_4059 132
543 3300048921 Ga0496118_0003088 Ga0496118_0003088_2142_2549 132
544 3300048924 Ga0496121_0016621 Ga0496121_0016621_6682_7089 132
545 3300048924 Ga0496121_0117679 Ga0496121_0117679_540_944 132
546 3300048924 Ga0496121_0252348 Ga0496121_0252348_10_414 132
547 3300048924 Ga0496121_0314016 Ga0496121_0314016_617_1015 132
548 3300048925 Ga0496122_0039256 Ga0496122_0039256_3001_3399 132
549 3300048925 Ga0496122_0089136 Ga0496122_0089136_1562_1978 132
550 3300048926 Ga0496123_0151656 Ga0496123_0151656_231_629 132
551 3300048927 Ga0496124_0010613 Ga0496124_0010613_8245_8652 132
552 3300048927 Ga0496124_0348366 Ga0496124_0348366_480_878 132
553 3300048928 Ga0496125_0000576 Ga0496125_0000576_9030_9446 132
554 3300048928 Ga0496125_0019582 Ga0496125_0019582_5326_5745 132
555 3300048928 Ga0496125_0202652 Ga0496125_0202652_99_506 132
556 3300048929 Ga0496126_0058272 Ga0496126_0058272_1480_1884 132
557 3300048929 Ga0496126_0213502 Ga0496126_0213502_1038_1445 132
558 3300048929 Ga0496126_0374307 Ga0496126_0374307_423_821 132
559 3300048929 Ga0496126_0718546 Ga0496126_0718546_321_725 132
560 3300049571 Ga0501034_0421400 Ga0501034_0421400_31_438 132
561 3300049571 Ga0501034_0681412 Ga0501034_0681412_114_518 132
562 3300049579 Ga0501043_0214826 Ga0501043_0214826_123_530 132
563 3300050490 nmdc:mga03n38_128213_c1 nmdc:mga03n38_128213_c1_768_1178 132
564 3300050491 nmdc:mga00v17_107752_c1 nmdc:mga00v17_107752_c1_350_769 132
565 3300050492 nmdc:mga0yw44_39479_c1 nmdc:mga0yw44_39479_c1_1255_1659 132
566 3300050492 nmdc:mga0yw44_62329_c1 nmdc:mga0yw44_62329_c1_1287_1706 132
567 3300050493 nmdc:mga0k408_51282_c2 nmdc:mga0k408_51282_c2_147_566 132
568 3300050493 nmdc:mga0k408_71835_c1 nmdc:mga0k408_71835_c1_994_1413 132
569 3300050494 nmdc:mga06z11_74470_c1 nmdc:mga06z11_74470_c1_865_1284 132
570 3300050495 nmdc:mga04h51_250762_c1 nmdc:mga04h51_250762_c1_90_509 132
571 3300050496 nmdc:mga07m45_33961_c1 nmdc:mga07m45_33961_c1_1894_2313 132
572 3300050516 nmdc:mga0sz30_288030_c1 nmdc:mga0sz30_288030_c1_253_672 132
573 3300050516 nmdc:mga0sz30_49993_c1 nmdc:mga0sz30_49993_c1_1101_1505 132
574 3300050516 nmdc:mga0sz30_81144_c1 nmdc:mga0sz30_81144_c1_84_503 132
575 3300053077 Ga0495601_0183577 Ga0495601_0183577_924_1340 132
576 3300053078 Ga0495612_0102346 Ga0495612_0102346_639_1055 132
577 3300053080 Ga0500635_0358177 Ga0500635_0358177_124_531 132
578 3300053085 Ga0495619_0751323 Ga0495619_0751323_214_630 132
579 3300053086 Ga0500578_0374869 Ga0500578_0374869_180_584 132
580 3300053087 Ga0500643_000015 Ga0500643_000015_135891_136295 132
581 3300053090 Ga0500646_0086683 Ga0500646_0086683_493_897 132
582 3300053091 Ga0500647_0185946 Ga0500647_0185946_460_867 132
583 3300053092 Ga0500583_0012287 Ga0500583_0012287_2271_2675 132
584 3300053093 Ga0500651_0023742 Ga0500651_0023742_3068_3472 132
585 3300053094 Ga0500566_0287934 Ga0500566_0287934_49_456 132
586 3300053096 Ga0500641_0055443 Ga0500641_0055443_553_957 132
587 3300053097 Ga0500648_287578 Ga0500648_287578_274_681 132
588 3300053098 Ga0500650_0072474 Ga0500650_0072474_916_1320 132
589 3300053103 Ga0500555_002428 Ga0500555_002428_2373_2777 132
590 3300053109 Ga0500569_009023 Ga0500569_009023_1422_1868 132
591 3300053116 Ga0500592_003427 Ga0500592_003427_52_456 132
592 3300053118 Ga0500594_0053683 Ga0500594_0053683_11_415 132
593 3300053119 Ga0500595_019337 Ga0500595_019337_1243_1647 132
594 3300053119 Ga0500595_036295 Ga0500595_036295_754_1161 132
595 3300053119 Ga0500595_056065 Ga0500595_056065_437_841 132
596 3300053120 Ga0500597_134524 Ga0500597_134524_419_826 132
597 3300053126 Ga0500621_160597 Ga0500621_160597_170_574 132
598 3300053130 Ga0500642_0046985 Ga0500642_0046985_235_639 132
599 3300053134 Ga0500658_0043797 Ga0500658_0043797_889_1293 132
600 3300053136 Ga0500559_0206860 Ga0500559_0206860_175_582 132
601 3300053139 Ga0500568_0008824 Ga0500568_0008824_1626_2030 132
602 3300053140 Ga0500573_0210077 Ga0500573_0210077_274_681 132
603 3300053142 Ga0500577_0287116 Ga0500577_0287116_218_622 132
604 3300053147 Ga0500589_217020 Ga0500589_217020_189_593 132
605 3300053148 Ga0500590_063474 Ga0500590_063474_34_438 132
606 3300053148 Ga0500590_113165 Ga0500590_113165_247_654 132
607 3300053148 Ga0500590_301740 Ga0500590_301740_25_429 132
608 3300053151 Ga0500604_0006501 Ga0500604_0006501_556_960 132
609 3300053158 Ga0500627_0019817 Ga0500627_0019817_353_757 132
610 3300053161 Ga0500634_0111738 Ga0500634_0111738_497_901 132
611 3300053162 Ga0500638_064128 Ga0500638_064128_1057_1464 132
612 3300053163 Ga0500639_100173 Ga0500639_100173_227_634 132
613 3300053177 Ga0500636_0058456 Ga0500636_0058456_695_1102 132
614 3300053177 Ga0500636_0260680 Ga0500636_0260680_274_681 132
615 3300053178 Ga0500637_0036416 Ga0500637_0036416_181_588 132
616 3300053735 Ga0500596_000636 Ga0500596_000636_5998_6405 132
617 3300053735 Ga0500596_017831 Ga0500596_017831_36_440 132
618 3300053737 Ga0500601_000153 Ga0500601_000153_12825_13229 132
619 3300053737 Ga0500601_011643 Ga0500601_011643_423_827 132
620 3300055283 Ga0500661_042965 Ga0500661_042965_180_584 132
621 iso_pu_bacteria 2922361189 2922363536 132
622 3300003771 Ga0055526_1009092 Ga0055526_10090925 133
623 3300005366 Ga0070659_100927812 Ga0070659_1009278122 133
624 3300005434 Ga0070709_10018262 Ga0070709_100182626 133
625 3300005434 Ga0070709_10056927 Ga0070709_100569273 133
626 3300005435 Ga0070714_100045655 Ga0070714_1000456553 133
627 3300005435 Ga0070714_100160138 Ga0070714_1001601383 133
628 3300005437 Ga0070710_10006722 Ga0070710_100067227 133
629 3300005439 Ga0070711_100002267 Ga0070711_1000022677 133
630 3300005439 Ga0070711_100007952 Ga0070711_1000079526 133
631 3300005458 Ga0070681_10196417 Ga0070681_101964173 133
632 3300005468 Ga0070707_100151016 Ga0070707_1001510161 133
633 3300005471 Ga0070698_100049606 Ga0070698_1000496063 133
634 3300005578 Ga0068854_100132481 Ga0068854_1001324813 133
635 3300006028 Ga0070717_10009967 Ga0070717_100099671 133
636 3300006163 Ga0070715_10002384 Ga0070715_100023843 133
637 3300006173 Ga0070716_100004420 Ga0070716_1000044203 133
638 3300006175 Ga0070712_100117731 Ga0070712_1001177313 133
639 3300006175 Ga0070712_100139184 Ga0070712_1001391842 133
640 3300006175 Ga0070712_100885590 Ga0070712_1008855901 133
641 3300006852 Ga0075433_10964081 Ga0075433_109640812 133
642 3300006871 Ga0075434_100041162 Ga0075434_1000411624 133
643 3300006914 Ga0075436_100341501 Ga0075436_1003415012 133
644 3300006944 Ga0099823_1098135 Ga0099823_10981351 133
645 3300007076 Ga0075435_100024687 Ga0075435_1000246872 133
646 3300007265 Ga0099794_10548499 Ga0099794_105484991 133
647 3300009174 Ga0105241_10037913 Ga0105241_100379133 133
648 3300010375 Ga0105239_10020953 Ga0105239_100209533 133
649 3300013306 Ga0163162_10869235 Ga0163162_108692352 133
650 3300013307 Ga0157372_10958274 Ga0157372_109582742 133
651 3300014969 Ga0157376_11031207 Ga0157376_110312072 133
652 3300025295 Ga0209564_1002508 Ga0209564_100250812 133
653 3300025297 Ga0209758_1030454 Ga0209758_10304542 133
654 3300025898 Ga0207692_10000524 Ga0207692_100005245 133
655 3300025905 Ga0207685_10059983 Ga0207685_100599832 133
656 3300025906 Ga0207699_10065696 Ga0207699_100656963 133
657 3300025906 Ga0207699_10149525 Ga0207699_101495253 133
658 3300025911 Ga0207654_10113935 Ga0207654_101139353 133
659 3300025912 Ga0207707_10015827 Ga0207707_100158276 133
660 3300025915 Ga0207693_10005027 Ga0207693_100050273 133
661 3300025916 Ga0207663_10000451 Ga0207663_100004513 133
662 3300025916 Ga0207663_10082366 Ga0207663_100823663 133
663 3300025929 Ga0207664_10017534 Ga0207664_100175342 133
664 3300025929 Ga0207664_11398112 Ga0207664_113981121 133
665 3300025932 Ga0207690_10406778 Ga0207690_104067782 133
666 3300025939 Ga0207665_10002128 Ga0207665_1000212811 133
667 3300026078 Ga0207702_11127863 Ga0207702_111278631 133
668 3300027296 Ga0209389_1000008 Ga0209389_1000008224 133
669 3300027361 Ga0209489_108921 Ga0209489_10892113 133
670 3300028379 Ga0268266_11019194 Ga0268266_110191942 133
671 3300031616 Ga0307508_10015749 Ga0307508_100157492 133
672 3300031616 Ga0307508_10279775 Ga0307508_102797752 133
673 3300031838 Ga0307518_10433115 Ga0307518_104331151 133
674 3300033180 Ga0307510_10122842 Ga0307510_101228422 133
675 3300035111 Ga0373923_0031733 Ga0373923_0031733_1184_1591 133
676 3300035113 Ga0373936_0172676 Ga0373936_0172676_478_885 133
677 3300035113 Ga0373936_0209172 Ga0373936_0209172_330_737 133
678 3300035117 Ga0373953_0003587 Ga0373953_0003587_3238_3645 133
679 3300035118 Ga0373954_0005008 Ga0373954_0005008_2073_2480 133
680 3300035119 Ga0373956_0001696 Ga0373956_0001696_1556_1963 133
681 3300035120 Ga0373957_0120878 Ga0373957_0120878_500_907 133
682 3300035172 Ga0373955_0000654 Ga0373955_0000654_6602_7009 133
683 3300035410 Ga0373924_0013613 Ga0373924_0013613_2472_2879 133
684 3300035692 Ga0373935_0450317 Ga0373935_0450317_505_912 133
685 3300035724 Ga0373933_0001815 Ga0373933_0001815_3340_3747 133
686 3300035724 Ga0373933_0089651 Ga0373933_0089651_201_608 133
687 3300036401 Ga0373937_0009279 Ga0373937_0009279_1129_1536 133
688 3300036401 Ga0373937_0608111 Ga0373937_0608111_582_986 133
689 3300036401 Ga0373937_1565503 Ga0373937_1565503_59_466 133
690 3300037312 Ga0395899_0016993 Ga0395899_0016993_1589_2026 133
691 3300037418 Ga0395900_0000361 Ga0395900_0000361_29659_30096 133
692 3300037418 Ga0395900_0525255 Ga0395900_0525255_494_901 133
693 3300037471 Ga0395905_0127300 Ga0395905_0127300_136_537 133
694 3300037471 Ga0395905_0152640 Ga0395905_0152640_721_1158 133
695 3300037471 Ga0395905_0901021 Ga0395905_0901021_277_678 133
696 3300038443 Ga0395901_0320644 Ga0395901_0320644_559_996 133
697 3300038443 Ga0395901_0582442 Ga0395901_0582442_355_762 133
698 3300044658 Ga0466972_0004782 Ga0466972_0004782_2865_3317 133
699 3300044683 Ga0466965_0295951 Ga0466965_0295951_270_722 133
700 3300044735 Ga0466968_0006041 Ga0466968_0006041_753_1205 133
701 3300044901 Ga0466960_0030663 Ga0466960_0030663_1575_2027 133
702 3300045976 Ga0466967_0106052 Ga0466967_0106052_981_1430 133
703 3300045976 Ga0466967_0128481 Ga0466967_0128481_1483_1887 133
704 3300046454 Ga0495592_0004904 Ga0495592_0004904_1119_1526 133
705 3300046454 Ga0495592_0042264 Ga0495592_0042264_2064_2501 133
706 3300046454 Ga0495592_0398631 Ga0495592_0398631_423_860 133
707 3300046459 Ga0495629_0002829 Ga0495629_0002829_7564_7971 133
708 3300046459 Ga0495629_0003943 Ga0495629_0003943_10596_11033 133
709 3300046462 Ga0495651_0014893 Ga0495651_0014893_2669_3106 133
710 3300046462 Ga0495651_0061893 Ga0495651_0061893_1329_1736 133
711 3300046463 Ga0495653_0120438 Ga0495653_0120438_991_1398 133
712 3300046477 Ga0495664_0042170 Ga0495664_0042170_118_555 133
713 3300046511 Ga0495608_0009394 Ga0495608_0009394_4007_4414 133
714 3300046511 Ga0495608_0058675 Ga0495608_0058675_104_541 133
715 3300046511 Ga0495608_0683821 Ga0495608_0683821_160_597 133
716 3300046514 Ga0495618_0064513 Ga0495618_0064513_255_662 133
717 3300046514 Ga0495618_0274739 Ga0495618_0274739_552_989 133
718 3300046516 Ga0495628_0025979 Ga0495628_0025979_1457_1864 133
719 3300046517 Ga0495630_0472982 Ga0495630_0472982_51_488 133
720 3300046517 Ga0495630_0508298 Ga0495630_0508298_129_536 133
721 3300046529 Ga0495652_0007665 Ga0495652_0007665_6983_7390 133
722 3300046529 Ga0495652_0059728 Ga0495652_0059728_1859_2296 133
723 3300046533 Ga0495640_0019557 Ga0495640_0019557_2121_2528 133
724 3300046533 Ga0495640_0101686 Ga0495640_0101686_140_577 133
725 3300046533 Ga0495640_0407900 Ga0495640_0407900_313_750 133
726 3300046536 Ga0495587_0015651 Ga0495587_0015651_3334_3741 133
727 3300046536 Ga0495587_0046610 Ga0495587_0046610_68_505 133
728 3300046536 Ga0495587_0152951 Ga0495587_0152951_354_791 133
729 3300046543 Ga0495645_0012169 Ga0495645_0012169_2589_2996 133
730 3300046557 Ga0495622_0028791 Ga0495622_0028791_163_600 133
731 3300046559 Ga0495667_0008508 Ga0495667_0008508_4135_4542 133
732 3300046559 Ga0495667_0072740 Ga0495667_0072740_1205_1642 133
733 3300046559 Ga0495667_0209255 Ga0495667_0209255_109_546 133
734 3300046616 Ga0495668_0146713 Ga0495668_0146713_825_1262 133
735 3300046642 Ga0495634_0014729 Ga0495634_0014729_1257_1664 133
736 3300046660 Ga0495625_0418917 Ga0495625_0418917_188_625 133
737 3300046663 Ga0495635_0001593 Ga0495635_0001593_10436_10873 133
738 3300046663 Ga0495635_0004356 Ga0495635_0004356_3147_3554 133
739 3300046675 Ga0495657_0005903 Ga0495657_0005903_1312_1719 133
740 3300046675 Ga0495657_0053555 Ga0495657_0053555_470_907 133
741 3300046675 Ga0495657_0100112 Ga0495657_0100112_564_1001 133
742 3300046678 Ga0495599_0007978 Ga0495599_0007978_1882_2289 133
743 3300046678 Ga0495599_0045761 Ga0495599_0045761_2297_2734 133
744 3300046679 Ga0495623_0014466 Ga0495623_0014466_4434_4841 133
745 3300046679 Ga0495623_0019902 Ga0495623_0019902_3582_4019 133
746 3300046680 Ga0495646_0002355 Ga0495646_0002355_6100_6507 133
747 3300046689 Ga0495613_0023828 Ga0495613_0023828_2760_3197 133
748 3300046689 Ga0495613_0047589 Ga0495613_0047589_2718_3125 133
749 3300046690 Ga0495624_0047452 Ga0495624_0047452_1533_1970 133
750 3300046694 Ga0495649_0039388 Ga0495649_0039388_837_1274 133
751 3300046809 Ga0495600_0004104 Ga0495600_0004104_3120_3527 133
752 3300046809 Ga0495600_0007598 Ga0495600_0007598_4669_5106 133
753 3300047315 Ga0495581_0087214 Ga0495581_0087214_396_833 133
754 3300047317 Ga0495604_0007639 Ga0495604_0007639_5263_5670 133
755 3300047317 Ga0495604_0041114 Ga0495604_0041114_247_684 133
756 3300047317 Ga0495604_0049040 Ga0495604_0049040_1361_1798 133
757 3300047319 Ga0495674_0760262 Ga0495674_0760262_206_643 133
758 3300047321 Ga0495676_0025669 Ga0495676_0025669_3803_4240 133
759 3300047322 Ga0495680_0017276 Ga0495680_0017276_2424_2831 133
760 3300047322 Ga0495680_0022137 Ga0495680_0022137_2283_2720 133
761 3300047444 Ga0495675_0002949 Ga0495675_0002949_8822_9229 133
762 3300047469 Ga0495673_0068536 Ga0495673_0068536_520_957 133
763 3300047471 Ga0495684_0002455 Ga0495684_0002455_6963_7370 133
764 3300047472 Ga0495686_0047566 Ga0495686_0047566_456_893 133
765 3300047673 Ga0495593_0015312 Ga0495593_0015312_750_1157 133
766 3300047673 Ga0495593_0266740 Ga0495593_0266740_112_549 133
767 3300048088 Ga0495602_0020088 Ga0495602_0020088_5869_6306 133
768 3300048088 Ga0495602_0130045 Ga0495602_0130045_474_881 133
769 3300048088 Ga0495602_0391038 Ga0495602_0391038_286_693 133
770 3300048907 Ga0496104_0010283 Ga0496104_0010283_4227_4664 133
771 3300048908 Ga0496105_0000723 Ga0496105_0000723_5523_5960 133
772 3300048917 Ga0496114_0110369 Ga0496114_0110369_1820_2257 133
773 3300048918 Ga0496115_0493690 Ga0496115_0493690_275_682 133
774 3300048920 Ga0496117_0308783 Ga0496117_0308783_377_778 133
775 3300048923 Ga0496120_0008406 Ga0496120_0008406_1010_1447 133
776 3300048924 Ga0496121_0243736 Ga0496121_0243736_635_1036 133
777 3300048927 Ga0496124_0084916 Ga0496124_0084916_1060_1497 133
778 3300048928 Ga0496125_0147225 Ga0496125_0147225_320_757 133
779 3300048929 Ga0496126_0152106 Ga0496126_0152106_1031_1468 133
780 3300048929 Ga0496126_0510245 Ga0496126_0510245_212_613 133
781 3300050496 nmdc:mga07m45_445529_c1 nmdc:mga07m45_445529_c1_227_664 133
782 3300050512 nmdc:mga0n895_20634_c1 nmdc:mga0n895_20634_c1_2359_2763 133
783 3300050513 nmdc:mga0rr50_24153_c1 nmdc:mga0rr50_24153_c1_3656_4060 133
784 3300050514 nmdc:mga08x19_78608_c1 nmdc:mga08x19_78608_c1_31_435 133
785 3300050515 nmdc:mga0a205_1122642_c1 nmdc:mga0a205_1122642_c1_175_579 133
786 3300053077 Ga0495601_0027635 Ga0495601_0027635_2586_2993 133
787 3300053084 Ga0495595_0002117 Ga0495595_0002117_3874_4281 133
788 3300053085 Ga0495619_0001733 Ga0495619_0001733_6912_7319 133
789 3300053085 Ga0495619_0505396 Ga0495619_0505396_311_748 133
790 3300053119 Ga0500595_011978 Ga0500595_011978_1019_1456 133
791 3300053130 Ga0500642_0000086 Ga0500642_0000086_35640_36047 133
792 3300053154 Ga0500619_208113 Ga0500619_208113_158_595 133
793 3300053177 Ga0500636_0063116 Ga0500636_0063116_1437_1874 133
794 iso_pu_bacteria 2791355199 2793082509 133
795 3300005262 Ga0065165_1079852 Ga0065165_10798522 134
796 3300005331 Ga0070670_100620259 Ga0070670_1006202592 134
797 3300005347 Ga0070668_100601784 Ga0070668_1006017841 134
798 3300005455 Ga0070663_100043119 Ga0070663_1000431193 134
799 3300005467 Ga0070706_100153508 Ga0070706_1001535082 134
800 3300005548 Ga0070665_100835770 Ga0070665_1008357702 134
801 3300005841 Ga0068863_100035315 Ga0068863_1000353154 134
802 3300005843 Ga0068860_100000503 Ga0068860_1000005033 134
803 3300006038 Ga0075365_10018977 Ga0075365_100189773 134
804 3300006042 Ga0075368_10017827 Ga0075368_100178272 134
805 3300006051 Ga0075364_10122450 Ga0075364_101224503 134
806 3300006173 Ga0070716_100926553 Ga0070716_1009265531 134
807 3300006175 Ga0070712_100701470 Ga0070712_1007014701 134
808 3300006175 Ga0070712_101069452 Ga0070712_1010694521 134
809 3300006186 Ga0075369_10042859 Ga0075369_100428593 134
810 3300006353 Ga0075370_10030019 Ga0075370_100300192 134
811 3300007265 Ga0099794_10075643 Ga0099794_100756432 134
812 3300009551 Ga0105238_11681726 Ga0105238_116817261 134
813 3300025295 Ga0209564_1010831 Ga0209564_10108314 134
814 3300025299 Ga0209256_1061217 Ga0209256_10612171 134
815 3300025915 Ga0207693_10085310 Ga0207693_100853102 134
816 3300025939 Ga0207665_11200319 Ga0207665_112003191 134
817 3300026067 Ga0207678_10013802 Ga0207678_100138024 134
818 3300026088 Ga0207641_10106255 Ga0207641_101062552 134
819 3300027671 Ga0209588_1216911 Ga0209588_12169111 134
820 3300028381 Ga0268264_10000185 Ga0268264_100001853 134
821 3300032005 Ga0307411_11304611 Ga0307411_113046111 134
822 3300037471 Ga0395905_0217899 Ga0395905_0217899_146_550 134
823 3300038443 Ga0395901_0624625 Ga0395901_0624625_423_827 134
824 3300046460 Ga0495638_0036102 Ga0495638_0036102_12_416 134
825 3300046462 Ga0495651_0373216 Ga0495651_0373216_514_918 134
826 3300046501 Ga0495607_0012688 Ga0495607_0012688_3439_3843 134
827 3300046506 Ga0495583_0179494 Ga0495583_0179494_11_415 134
828 3300046507 Ga0495606_0028417 Ga0495606_0028417_3103_3507 134
829 3300046512 Ga0495610_0370755 Ga0495610_0370755_120_524 134
830 3300046515 Ga0495620_0013635 Ga0495620_0013635_1412_1816 134
831 3300046518 Ga0495631_0031182 Ga0495631_0031182_197_601 134
832 3300046522 Ga0495643_0042298 Ga0495643_0042298_1465_1869 134
833 3300046524 Ga0495648_0052162 Ga0495648_0052162_1497_1901 134
834 3300046529 Ga0495652_0622364 Ga0495652_0622364_291_695 134
835 3300046530 Ga0495654_0003707 Ga0495654_0003707_6522_6926 134
836 3300046538 Ga0495609_0354632 Ga0495609_0354632_64_468 134
837 3300046543 Ga0495645_0723136 Ga0495645_0723136_114_518 134
838 3300046557 Ga0495622_0021843 Ga0495622_0021843_2230_2634 134
839 3300046616 Ga0495668_0224708 Ga0495668_0224708_497_901 134
840 3300046648 Ga0495611_0055070 Ga0495611_0055070_268_672 134
841 3300046660 Ga0495625_0061291 Ga0495625_0061291_585_989 134
842 3300046691 Ga0495670_0013251 Ga0495670_0013251_1357_1761 134
843 3300046692 Ga0495671_0292761 Ga0495671_0292761_88_492 134
844 3300046810 Ga0495660_0164086 Ga0495660_0164086_130_534 134
845 3300047322 Ga0495680_0806161 Ga0495680_0806161_136_540 134
846 3300047445 Ga0495677_0089100 Ga0495677_0089100_486_890 134
847 3300047469 Ga0495673_0264715 Ga0495673_0264715_23_427 134
848 3300047472 Ga0495686_0410331 Ga0495686_0410331_308_712 134
849 3300048091 Ga0495626_0310434 Ga0495626_0310434_77_481 134
850 3300048909 Ga0496106_0171772 Ga0496106_0171772_11_415 134
851 3300048916 Ga0496113_0439727 Ga0496113_0439727_455_859 134
852 3300048918 Ga0496115_1135447 Ga0496115_1135447_28_432 134
853 3300048919 Ga0496116_0004734 Ga0496116_0004734_12194_12598 134
854 3300048920 Ga0496117_0095415 Ga0496117_0095415_507_911 134
855 3300048920 Ga0496117_0152853 Ga0496117_0152853_722_1126 134
856 3300048921 Ga0496118_0229661 Ga0496118_0229661_101_505 134
857 3300048921 Ga0496118_0414948 Ga0496118_0414948_69_473 134
858 3300048921 Ga0496118_0491579 Ga0496118_0491579_101_505 134
859 3300048923 Ga0496120_0095868 Ga0496120_0095868_906_1310 134
860 3300048924 Ga0496121_0095409 Ga0496121_0095409_937_1341 134
861 3300048924 Ga0496121_0470456 Ga0496121_0470456_350_754 134
862 3300048925 Ga0496122_0073686 Ga0496122_0073686_308_712 134
863 3300048926 Ga0496123_0016780 Ga0496123_0016780_4311_4715 134
864 3300048927 Ga0496124_0082762 Ga0496124_0082762_97_501 134
865 3300048928 Ga0496125_0004044 Ga0496125_0004044_7924_8328 134
866 3300048928 Ga0496125_0006115 Ga0496125_0006115_1370_1774 134
867 3300048929 Ga0496126_0003482 Ga0496126_0003482_11953_12357 134
868 3300048929 Ga0496126_0084458 Ga0496126_0084458_1924_2328 134
869 3300048929 Ga0496126_0318254 Ga0496126_0318254_557_961 134
870 3300048929 Ga0496126_0712165 Ga0496126_0712165_300_704 134
871 3300048929 Ga0496126_1178167 Ga0496126_1178167_19_423 134
872 3300050491 nmdc:mga00v17_73996_c1 nmdc:mga00v17_73996_c1_292_696 134
873 3300050492 nmdc:mga0yw44_16655_c1 nmdc:mga0yw44_16655_c1_1562_1966 134
874 3300053077 Ga0495601_0349956 Ga0495601_0349956_203_607 134
875 3300053083 Ga0495655_0331778 Ga0495655_0331778_95_499 134
876 3300053086 Ga0500578_0299349 Ga0500578_0299349_95_499 134
877 3300053087 Ga0500643_087682 Ga0500643_087682_370_774 134
878 3300053088 Ga0500644_0128415 Ga0500644_0128415_580_984 134
879 3300053089 Ga0500581_250031 Ga0500581_250031_137_541 134
880 3300053093 Ga0500651_0022319 Ga0500651_0022319_1259_1663 134
881 3300053094 Ga0500566_0001736 Ga0500566_0001736_3419_3823 134
882 3300053096 Ga0500641_0025996 Ga0500641_0025996_192_596 134
883 3300053098 Ga0500650_0031343 Ga0500650_0031343_548_952 134
884 3300053102 Ga0500554_116101 Ga0500554_116101_477_881 134
885 3300053104 Ga0500556_0000045 Ga0500556_0000045_43406_43810 134
886 3300053108 Ga0500562_130270 Ga0500562_130270_75_479 134
887 3300053109 Ga0500569_005518 Ga0500569_005518_1575_1979 134
888 3300053117 Ga0500593_164244 Ga0500593_164244_237_641 134
889 3300053118 Ga0500594_0034252 Ga0500594_0034252_18_422 134
890 3300053121 Ga0500607_060416 Ga0500607_060416_277_681 134
891 3300053122 Ga0500608_001250 Ga0500608_001250_3545_3949 134
892 3300053130 Ga0500642_0000024 Ga0500642_0000024_47325_47729 134
893 3300053131 Ga0500652_000135 Ga0500652_000135_737_1141 134
894 3300053136 Ga0500559_0000414 Ga0500559_0000414_3240_3644 134
895 3300053136 Ga0500559_0065394 Ga0500559_0065394_74_478 134
896 3300053136 Ga0500559_0182128 Ga0500559_0182128_313_717 134
897 3300053138 Ga0500564_236436 Ga0500564_236436_92_496 134
898 3300053139 Ga0500568_0000469 Ga0500568_0000469_18955_19359 134
899 3300053142 Ga0500577_0000773 Ga0500577_0000773_5364_5768 134
900 3300053142 Ga0500577_0156795 Ga0500577_0156795_235_639 134
901 3300053145 Ga0500586_001132 Ga0500586_001132_2410_2814 134
902 3300053151 Ga0500604_0000270 Ga0500604_0000270_1394_1798 134
903 3300053153 Ga0500616_0000054 Ga0500616_0000054_46321_46725 134
904 3300053154 Ga0500619_049211 Ga0500619_049211_931_1335 134
905 3300053156 Ga0500622_0002469 Ga0500622_0002469_1232_1636 134
906 3300053158 Ga0500627_0056492 Ga0500627_0056492_657_1061 134
907 3300053161 Ga0500634_0051449 Ga0500634_0051449_1393_1797 134
908 3300053178 Ga0500637_0338305 Ga0500637_0338305_137_541 134
909 3300053723 Ga0500567_142547 Ga0500567_142547_418_822 134
910 3300053727 Ga0500611_090914 Ga0500611_090914_92_496 134
911 3300053735 Ga0500596_021187 Ga0500596_021187_37_441 134
912 3300007265 Ga0099794_10120394 Ga0099794_101203942 135
913 3300025910 Ga0207684_11214170 Ga0207684_112141701 135
914 3300027671 Ga0209588_1138592 Ga0209588_11385922 135
915 3300028794 Ga0307515_10493440 Ga0307515_104934402 135
916 3300046491 Ga0495584_0375987 Ga0495584_0375987_169_576 135
917 3300002070 JGI24750J21931_1007657 JGI24750J21931_10076572 136
918 3300002244 JGI24742J22300_10012428 JGI24742J22300_100124282 136
919 3300005295 Ga0065707_10273588 Ga0065707_102735881 136
920 3300005328 Ga0070676_10662571 Ga0070676_106625711 136
921 3300005330 Ga0070690_100452997 Ga0070690_1004529971 136
922 3300005331 Ga0070670_100170963 Ga0070670_1001709633 136
923 3300005334 Ga0068869_100042838 Ga0068869_1000428384 136
924 3300005334 Ga0068869_100085418 Ga0068869_1000854183 136
925 3300005334 Ga0068869_100154070 Ga0068869_1001540702 136
926 3300005334 Ga0068869_100761395 Ga0068869_1007613951 136
927 3300005334 Ga0068869_100900581 Ga0068869_1009005811 136
928 3300005335 Ga0070666_10053315 Ga0070666_100533153 136
929 3300005335 Ga0070666_10102740 Ga0070666_101027402 136
930 3300005336 Ga0070680_100110473 Ga0070680_1001104731 136
931 3300005338 Ga0068868_100153850 Ga0068868_1001538502 136
932 3300005339 Ga0070660_100578933 Ga0070660_1005789332 136
933 3300005340 Ga0070689_101023400 Ga0070689_1010234001 136
934 3300005341 Ga0070691_10513533 Ga0070691_105135331 136
935 3300005344 Ga0070661_100638715 Ga0070661_1006387151 136
936 3300005347 Ga0070668_100093470 Ga0070668_1000934703 136
937 3300005347 Ga0070668_100214062 Ga0070668_1002140622 136
938 3300005347 Ga0070668_100250748 Ga0070668_1002507482 136
939 3300005347 Ga0070668_100658320 Ga0070668_1006583202 136
940 3300005353 Ga0070669_100369757 Ga0070669_1003697571 136
941 3300005356 Ga0070674_100997199 Ga0070674_1009971992 136
942 3300005364 Ga0070673_100252154 Ga0070673_1002521542 136
943 3300005365 Ga0070688_100283257 Ga0070688_1002832571 136
944 3300005366 Ga0070659_100401645 Ga0070659_1004016452 136
945 3300005366 Ga0070659_100426481 Ga0070659_1004264811 136
946 3300005367 Ga0070667_100073038 Ga0070667_1000730384 136
947 3300005367 Ga0070667_101525634 Ga0070667_1015256341 136
948 3300005436 Ga0070713_100052649 Ga0070713_1000526495 136
949 3300005438 Ga0070701_10088778 Ga0070701_100887782 136
950 3300005438 Ga0070701_11261695 Ga0070701_112616951 136
951 3300005440 Ga0070705_100321880 Ga0070705_1003218801 136
952 3300005440 Ga0070705_100993488 Ga0070705_1009934881 136
953 3300005441 Ga0070700_100129410 Ga0070700_1001294101 136
954 3300005455 Ga0070663_100036074 Ga0070663_1000360743 136
955 3300005455 Ga0070663_100208731 Ga0070663_1002087312 136
956 3300005456 Ga0070678_100322956 Ga0070678_1003229563 136
957 3300005456 Ga0070678_100567313 Ga0070678_1005673132 136
958 3300005456 Ga0070678_100613113 Ga0070678_1006131131 136
959 3300005457 Ga0070662_100088795 Ga0070662_1000887952 136
960 3300005458 Ga0070681_10093689 Ga0070681_100936892 136
961 3300005459 Ga0068867_100373787 Ga0068867_1003737871 136
962 3300005466 Ga0070685_10211748 Ga0070685_102117481 136
963 3300005471 Ga0070698_100108450 Ga0070698_1001084502 136
964 3300005518 Ga0070699_100085031 Ga0070699_1000850313 136
965 3300005536 Ga0070697_100346345 Ga0070697_1003463451 136
966 3300005539 Ga0068853_100089715 Ga0068853_1000897152 136
967 3300005539 Ga0068853_100362898 Ga0068853_1003628981 136
968 3300005543 Ga0070672_100246702 Ga0070672_1002467023 136
969 3300005543 Ga0070672_101011848 Ga0070672_1010118481 136
970 3300005546 Ga0070696_100096905 Ga0070696_1000969052 136
971 3300005547 Ga0070693_100034898 Ga0070693_1000348981 136
972 3300005548 Ga0070665_100212898 Ga0070665_1002128985 136
973 3300005548 Ga0070665_100388288 Ga0070665_1003882882 136
974 3300005563 Ga0068855_100420616 Ga0068855_1004206162 136
975 3300005577 Ga0068857_100414741 Ga0068857_1004147412 136
976 3300005615 Ga0070702_100152071 Ga0070702_1001520712 136
977 3300005616 Ga0068852_101462316 Ga0068852_1014623161 136
978 3300005617 Ga0068859_100058789 Ga0068859_1000587895 136
979 3300005617 Ga0068859_100627225 Ga0068859_1006272251 136
980 3300005718 Ga0068866_10558304 Ga0068866_105583042 136
981 3300005719 Ga0068861_100139922 Ga0068861_1001399222 136
982 3300005719 Ga0068861_100167241 Ga0068861_1001672412 136
983 3300005719 Ga0068861_100371601 Ga0068861_1003716012 136
984 3300005840 Ga0068870_10421258 Ga0068870_104212581 136
985 3300005841 Ga0068863_100636971 Ga0068863_1006369711 136
986 3300005841 Ga0068863_101638617 Ga0068863_1016386171 136
987 3300005842 Ga0068858_100388636 Ga0068858_1003886362 136
988 3300005842 Ga0068858_100676498 Ga0068858_1006764982 136
989 3300005842 Ga0068858_101293741 Ga0068858_1012937411 136
990 3300005843 Ga0068860_100093721 Ga0068860_1000937212 136
991 3300005843 Ga0068860_100237968 Ga0068860_1002379682 136
992 3300005843 Ga0068860_100569987 Ga0068860_1005699871 136
993 3300005844 Ga0068862_100276166 Ga0068862_1002761662 136
994 3300005844 Ga0068862_100336751 Ga0068862_1003367513 136
995 3300005983 Ga0081540_1003216 Ga0081540_100321614 136
996 3300005983 Ga0081540_1021572 Ga0081540_10215721 136
997 3300005983 Ga0081540_1041474 Ga0081540_10414743 136
998 3300006028 Ga0070717_10024153 Ga0070717_100241533 136
999 3300006038 Ga0075365_10040534 Ga0075365_100405343 136
1000 3300006038 Ga0075365_10273209 Ga0075365_102732092 136
1001 3300006042 Ga0075368_10113852 Ga0075368_101138522 136
1002 3300006048 Ga0075363_100200315 Ga0075363_1002003152 136
1003 3300006051 Ga0075364_10042281 Ga0075364_100422815 136
1004 3300006051 Ga0075364_10703525 Ga0075364_107035251 136
1005 3300006058 Ga0075432_10398365 Ga0075432_103983651 136
1006 3300006177 Ga0075362_10072311 Ga0075362_100723112 136
1007 3300006177 Ga0075362_10096087 Ga0075362_100960872 136
1008 3300006177 Ga0075362_10133368 Ga0075362_101333682 136
1009 3300006186 Ga0075369_10030019 Ga0075369_100300193 136
1010 3300006186 Ga0075369_10249895 Ga0075369_102498951 136
1011 3300006195 Ga0075366_10215140 Ga0075366_102151402 136
1012 3300006195 Ga0075366_10438606 Ga0075366_104386062 136
1013 3300006237 Ga0097621_100924090 Ga0097621_1009240901 136
1014 3300006844 Ga0075428_100597564 Ga0075428_1005975642 136
1015 3300006844 Ga0075428_101069328 Ga0075428_1010693283 136
1016 3300006881 Ga0068865_100494700 Ga0068865_1004947002 136
1017 3300006931 Ga0097620_100058780 Ga0097620_1000587805 136
1018 3300006931 Ga0097620_100627259 Ga0097620_1006272591 136
1019 3300007076 Ga0075435_100409607 Ga0075435_1004096072 136
1020 3300007265 Ga0099794_10174216 Ga0099794_101742162 136
1021 3300007788 Ga0099795_10048777 Ga0099795_100487772 136
1022 3300007788 Ga0099795_10134430 Ga0099795_101344301 136
1023 3300007788 Ga0099795_10537966 Ga0099795_105379661 136
1024 3300009092 Ga0105250_10084364 Ga0105250_100843641 136
1025 3300009093 Ga0105240_10478615 Ga0105240_104786151 136
1026 3300009094 Ga0111539_10331760 Ga0111539_103317602 136
1027 3300009098 Ga0105245_10073773 Ga0105245_100737733 136
1028 3300009101 Ga0105247_10133584 Ga0105247_101335842 136
1029 3300009101 Ga0105247_10257549 Ga0105247_102575493 136
1030 3300009101 Ga0105247_10269622 Ga0105247_102696222 136
1031 3300009101 Ga0105247_10830123 Ga0105247_108301232 136
1032 3300009148 Ga0105243_10144795 Ga0105243_101447952 136
1033 3300009174 Ga0105241_10069592 Ga0105241_100695923 136
1034 3300009176 Ga0105242_10238944 Ga0105242_102389441 136
1035 3300009177 Ga0105248_10667596 Ga0105248_106675961 136
1036 3300009545 Ga0105237_10059303 Ga0105237_100593033 136
1037 3300009545 Ga0105237_10134788 Ga0105237_101347882 136
1038 3300009545 Ga0105237_11478147 Ga0105237_114781471 136
1039 3300009553 Ga0105249_11584354 Ga0105249_115843542 136
1040 3300010159 Ga0099796_10149631 Ga0099796_101496311 136
1041 3300010159 Ga0099796_10210429 Ga0099796_102104292 136
1042 3300010375 Ga0105239_10095960 Ga0105239_100959602 136
1043 3300010375 Ga0105239_10568010 Ga0105239_105680102 136
1044 3300011119 Ga0105246_10130279 Ga0105246_101302793 136
1045 3300011119 Ga0105246_10401838 Ga0105246_104018382 136
1046 3300011119 Ga0105246_11046461 Ga0105246_110464612 136
1047 3300011119 Ga0105246_11715491 Ga0105246_117154911 136
1048 3300013102 Ga0157371_10812842 Ga0157371_108128422 136
1049 3300013105 Ga0157369_10300439 Ga0157369_103004393 136
1050 3300013297 Ga0157378_10169593 Ga0157378_101695932 136
1051 3300013297 Ga0157378_10202436 Ga0157378_102024363 136
1052 3300013306 Ga0163162_11024028 Ga0163162_110240281 136
1053 3300013306 Ga0163162_11314237 Ga0163162_113142371 136
1054 3300013308 Ga0157375_10270624 Ga0157375_102706242 136
1055 3300013308 Ga0157375_10350117 Ga0157375_103501172 136
1056 3300013308 Ga0157375_10410748 Ga0157375_104107482 136
1057 3300014326 Ga0157380_10211406 Ga0157380_102114062 136
1058 3300014326 Ga0157380_11003074 Ga0157380_110030741 136
1059 3300014968 Ga0157379_10363314 Ga0157379_103633142 136
1060 3300014968 Ga0157379_10487787 Ga0157379_104877872 136
1061 3300014969 Ga0157376_10358122 Ga0157376_103581222 136
1062 3300020080 Ga0206350_11469909 Ga0206350_114699092 136
1063 3300020082 Ga0206353_11783555 Ga0206353_117835552 136
1064 3300022467 Ga0224712_10207107 Ga0224712_102071072 136
1065 3300025297 Ga0209758_1037034 Ga0209758_10370343 136
1066 3300025315 Ga0207697_10270992 Ga0207697_102709922 136
1067 3300025315 Ga0207697_10358614 Ga0207697_103586141 136
1068 3300025899 Ga0207642_10286486 Ga0207642_102864861 136
1069 3300025900 Ga0207710_10011733 Ga0207710_100117333 136
1070 3300025900 Ga0207710_10503422 Ga0207710_105034221 136
1071 3300025900 Ga0207710_10582223 Ga0207710_105822231 136
1072 3300025901 Ga0207688_10220794 Ga0207688_102207941 136
1073 3300025901 Ga0207688_10383730 Ga0207688_103837302 136
1074 3300025903 Ga0207680_10161396 Ga0207680_101613962 136
1075 3300025903 Ga0207680_10183540 Ga0207680_101835401 136
1076 3300025904 Ga0207647_10378875 Ga0207647_103788751 136
1077 3300025907 Ga0207645_10110973 Ga0207645_101109731 136
1078 3300025908 Ga0207643_10025614 Ga0207643_100256142 136
1079 3300025911 Ga0207654_10012909 Ga0207654_100129093 136
1080 3300025912 Ga0207707_10020204 Ga0207707_100202048 136
1081 3300025913 Ga0207695_10350381 Ga0207695_103503812 136
1082 3300025914 Ga0207671_10906402 Ga0207671_109064021 136
1083 3300025919 Ga0207657_10181427 Ga0207657_101814271 136
1084 3300025919 Ga0207657_10197663 Ga0207657_101976632 136
1085 3300025920 Ga0207649_10105400 Ga0207649_101054002 136
1086 3300025923 Ga0207681_10198440 Ga0207681_101984402 136
1087 3300025925 Ga0207650_10067668 Ga0207650_100676683 136
1088 3300025928 Ga0207700_10002015 Ga0207700_1000201513 136
1089 3300025931 Ga0207644_10059761 Ga0207644_100597613 136
1090 3300025932 Ga0207690_10451486 Ga0207690_104514861 136
1091 3300025934 Ga0207686_10046010 Ga0207686_100460103 136
1092 3300025935 Ga0207709_10046312 Ga0207709_100463123 136
1093 3300025936 Ga0207670_10313965 Ga0207670_103139651 136
1094 3300025936 Ga0207670_11385169 Ga0207670_113851691 136
1095 3300025937 Ga0207669_10030199 Ga0207669_100301992 136
1096 3300025938 Ga0207704_10302268 Ga0207704_103022682 136
1097 3300025940 Ga0207691_10091375 Ga0207691_100913753 136
1098 3300025942 Ga0207689_10052903 Ga0207689_100529032 136
1099 3300025942 Ga0207689_10121366 Ga0207689_101213661 136
1100 3300025942 Ga0207689_10136106 Ga0207689_101361063 136
1101 3300025942 Ga0207689_10150833 Ga0207689_101508332 136
1102 3300025945 Ga0207679_10241662 Ga0207679_102416622 136
1103 3300025949 Ga0207667_10059382 Ga0207667_100593823 136
1104 3300025949 Ga0207667_11376610 Ga0207667_113766101 136
1105 3300025960 Ga0207651_10362731 Ga0207651_103627311 136
1106 3300025961 Ga0207712_10153783 Ga0207712_101537832 136
1107 3300025961 Ga0207712_10550121 Ga0207712_105501211 136
1108 3300025972 Ga0207668_10030893 Ga0207668_100308932 136
1109 3300025972 Ga0207668_10372625 Ga0207668_103726251 136
1110 3300025972 Ga0207668_10498091 Ga0207668_104980912 136
1111 3300025972 Ga0207668_10725470 Ga0207668_107254701 136
1112 3300025986 Ga0207658_10275079 Ga0207658_102750792 136
1113 3300026023 Ga0207677_10224824 Ga0207677_102248241 136
1114 3300026023 Ga0207677_10254788 Ga0207677_102547881 136
1115 3300026023 Ga0207677_11588859 Ga0207677_115888591 136
1116 3300026035 Ga0207703_10072010 Ga0207703_100720103 136
1117 3300026035 Ga0207703_10331593 Ga0207703_103315932 136
1118 3300026041 Ga0207639_10161107 Ga0207639_101611072 136
1119 3300026067 Ga0207678_10058708 Ga0207678_100587082 136
1120 3300026067 Ga0207678_10232622 Ga0207678_102326222 136
1121 3300026075 Ga0207708_10244927 Ga0207708_102449272 136
1122 3300026075 Ga0207708_10458128 Ga0207708_104581281 136
1123 3300026089 Ga0207648_10126701 Ga0207648_101267013 136
1124 3300026089 Ga0207648_10564642 Ga0207648_105646422 136
1125 3300026095 Ga0207676_10712042 Ga0207676_107120422 136
1126 3300026116 Ga0207674_10213494 Ga0207674_102134942 136
1127 3300026118 Ga0207675_100056996 Ga0207675_1000569963 136
1128 3300026118 Ga0207675_100280601 Ga0207675_1002806012 136
1129 3300026121 Ga0207683_10175687 Ga0207683_101756872 136
1130 3300026121 Ga0207683_10227290 Ga0207683_102272903 136
1131 3300026121 Ga0207683_10439855 Ga0207683_104398553 136
1132 3300026121 Ga0207683_10654423 Ga0207683_106544231 136
1133 3300027512 Ga0209179_1007263 Ga0209179_10072632 136
1134 3300027512 Ga0209179_1070409 Ga0209179_10704091 136
1135 3300028379 Ga0268266_10386215 Ga0268266_103862152 136
1136 3300028379 Ga0268266_10513966 Ga0268266_105139662 136
1137 3300028379 Ga0268266_10603548 Ga0268266_106035481 136
1138 3300028379 Ga0268266_11441573 Ga0268266_114415732 136
1139 3300028380 Ga0268265_10124749 Ga0268265_101247491 136
1140 3300028380 Ga0268265_10471195 Ga0268265_104711952 136
1141 3300028380 Ga0268265_10624895 Ga0268265_106248952 136
1142 3300028380 Ga0268265_11801547 Ga0268265_118015471 136
1143 3300028381 Ga0268264_10370321 Ga0268264_103703212 136
1144 3300028800 Ga0265338_10274306 Ga0265338_102743062 136
1145 3300031995 Ga0307409_101517604 Ga0307409_1015176041 136
1146 3300032004 Ga0307414_11565880 Ga0307414_115658802 136
1147 3300037068 Ga0373925_0770609 Ga0373925_0770609_274_729 136
1148 3300041443 Ga0451789_0487446 Ga0451789_0487446_99_509 136
1149 3300046491 Ga0495584_0257724 Ga0495584_0257724_351_761 136
1150 3300046491 Ga0495584_0262518 Ga0495584_0262518_260_676 136
1151 3300046506 Ga0495583_0184866 Ga0495583_0184866_191_601 136
1152 3300046513 Ga0495616_0152525 Ga0495616_0152525_89_499 136
1153 3300046515 Ga0495620_0179984 Ga0495620_0179984_78_494 136
1154 3300046520 Ga0495637_0272737 Ga0495637_0272737_62_511 136
1155 3300046522 Ga0495643_0233447 Ga0495643_0233447_139_555 136
1156 3300046522 Ga0495643_0468242 Ga0495643_0468242_80_496 136
1157 3300046539 Ga0495621_0130457 Ga0495621_0130457_456_866 136
1158 3300046615 Ga0495656_0011388 Ga0495656_0011388_883_1293 136
1159 3300046664 Ga0495659_0378675 Ga0495659_0378675_26_442 136
1160 3300046684 Ga0495669_0166830 Ga0495669_0166830_247_657 136
1161 3300046684 Ga0495669_0372153 Ga0495669_0372153_86_502 136
1162 3300046691 Ga0495670_0447970 Ga0495670_0447970_120_530 136
1163 3300046692 Ga0495671_0362376 Ga0495671_0362376_65_481 136
1164 3300046692 Ga0495671_0437897 Ga0495671_0437897_79_489 136
1165 3300046694 Ga0495649_0141799 Ga0495649_0141799_744_1154 136
1166 3300046694 Ga0495649_0433860 Ga0495649_0433860_67_483 136
1167 3300046810 Ga0495660_0262527 Ga0495660_0262527_326_736 136
1168 3300047320 Ga0495672_0181881 Ga0495672_0181881_586_1002 136
1169 3300048903 Ga0496100_0138598 Ga0496100_0138598_1296_1706 136
1170 3300048904 Ga0496101_0736192 Ga0496101_0736192_96_512 136
1171 3300048904 Ga0496101_0888107 Ga0496101_0888107_31_441 136
1172 3300048905 Ga0496102_0106121 Ga0496102_0106121_2063_2473 136
1173 3300048905 Ga0496102_0294186 Ga0496102_0294186_897_1313 136
1174 3300048908 Ga0496105_0241392 Ga0496105_0241392_1020_1430 136
1175 3300048909 Ga0496106_0174272 Ga0496106_0174272_1285_1695 136
1176 3300048909 Ga0496106_0231862 Ga0496106_0231862_143_559 136
1177 3300048912 Ga0496109_0235133 Ga0496109_0235133_875_1291 136
1178 3300048913 Ga0496110_0903848 Ga0496110_0903848_137_553 136
1179 3300048917 Ga0496114_0149160 Ga0496114_0149160_1240_1650 136
1180 3300048918 Ga0496115_1246605 Ga0496115_1246605_31_441 136
1181 3300048920 Ga0496117_0179333 Ga0496117_0179333_79_495 136
1182 3300048922 Ga0496119_0084401 Ga0496119_0084401_1251_1667 136
1183 3300048923 Ga0496120_0212702 Ga0496120_0212702_451_867 136
1184 3300048923 Ga0496120_0493749 Ga0496120_0493749_60_470 136
1185 3300048924 Ga0496121_0076072 Ga0496121_0076072_2188_2604 136
1186 3300048924 Ga0496121_0145305 Ga0496121_0145305_283_699 136
1187 3300048924 Ga0496121_0289581 Ga0496121_0289581_268_684 136
1188 3300048927 Ga0496124_0378269 Ga0496124_0378269_75_491 136
1189 3300048928 Ga0496125_0003556 Ga0496125_0003556_14857_15267 136
1190 3300048928 Ga0496125_0177747 Ga0496125_0177747_304_720 136
1191 3300048929 Ga0496126_0021101 Ga0496126_0021101_2203_2619 136
1192 3300048929 Ga0496126_0281491 Ga0496126_0281491_353_769 136
1193 3300048929 Ga0496126_0683396 Ga0496126_0683396_270_686 136
1194 3300050489 nmdc:mga03683_135432_c1 nmdc:mga03683_135432_c1_210_620 136
1195 3300050489 nmdc:mga03683_210903_c1 nmdc:mga03683_210903_c1_220_636 136
1196 3300050492 nmdc:mga0yw44_38547_c1 nmdc:mga0yw44_38547_c1_1466_1882 136
1197 3300050492 nmdc:mga0yw44_485355_c1 nmdc:mga0yw44_485355_c1_187_597 136
1198 3300050493 nmdc:mga0k408_584712_c1 nmdc:mga0k408_584712_c1_207_617 136
1199 3300050496 nmdc:mga07m45_205815_c1 nmdc:mga07m45_205815_c1_714_1130 136
1200 3300050507 nmdc:mga05p37_371810_c1 nmdc:mga05p37_371810_c1_163_573 136
1201 3300050511 nmdc:mga08y16_1404688_c1 nmdc:mga08y16_1404688_c1_14_430 136
1202 3300050511 nmdc:mga08y16_372766_c1 nmdc:mga08y16_372766_c1_917_1327 136
1203 3300050512 nmdc:mga0n895_454825_c1 nmdc:mga0n895_454825_c1_839_1255 136
1204 3300050514 nmdc:mga08x19_517253_c1 nmdc:mga08x19_517253_c1_200_616 136
1205 3300050516 nmdc:mga0sz30_137399_c1 nmdc:mga0sz30_137399_c1_254_670 136
1206 3300053077 Ga0495601_0448400 Ga0495601_0448400_256_711 136
1207 3300053092 Ga0500583_0139672 Ga0500583_0139672_659_1069 136
1208 3300053098 Ga0500650_0519080 Ga0500650_0519080_63_479 136
1209 3300053119 Ga0500595_032978 Ga0500595_032978_1097_1513 136
1210 3300053130 Ga0500642_0341662 Ga0500642_0341662_46_462 136
1211 3300053139 Ga0500568_0087431 Ga0500568_0087431_27_437 136
1212 3300053147 Ga0500589_169257 Ga0500589_169257_292_708 136
1213 3300053148 Ga0500590_140210 Ga0500590_140210_485_901 136
1214 3300053158 Ga0500627_0281844 Ga0500627_0281844_84_497 136
1215 3300053161 Ga0500634_0366805 Ga0500634_0366805_62_478 136
1216 3300053162 Ga0500638_261295 Ga0500638_261295_70_486 136
1217 3300053730 Ga0500645_071226 Ga0500645_071226_381_797 136
1218 3300003659 JGI25404J52841_10022340 JGI25404J52841_100223402 137
1219 3300003659 JGI25404J52841_10053954 JGI25404J52841_100539541 137
1220 3300003911 JGI25405J52794_10014185 JGI25405J52794_100141852 137
1221 3300005331 Ga0070670_102227136 Ga0070670_1022271361 137
1222 3300005344 Ga0070661_100405317 Ga0070661_1004053172 137
1223 3300005356 Ga0070674_100771291 Ga0070674_1007712912 137
1224 3300005455 Ga0070663_100046224 Ga0070663_1000462243 137
1225 3300005456 Ga0070678_100381895 Ga0070678_1003818952 137
1226 3300005548 Ga0070665_100145669 Ga0070665_1001456692 137
1227 3300005548 Ga0070665_100199162 Ga0070665_1001991623 137
1228 3300005548 Ga0070665_101315364 Ga0070665_1013153642 137
1229 3300005618 Ga0068864_101760038 Ga0068864_1017600381 137
1230 3300005937 Ga0081455_10003167 Ga0081455_1000316711 137
1231 3300005937 Ga0081455_10175758 Ga0081455_101757582 137
1232 3300005983 Ga0081540_1055339 Ga0081540_10553393 137
1233 3300005983 Ga0081540_1075802 Ga0081540_10758023 137
1234 3300006038 Ga0075365_10053601 Ga0075365_100536012 137
1235 3300006038 Ga0075365_10188859 Ga0075365_101888592 137
1236 3300006048 Ga0075363_100001995 Ga0075363_10000199513 137
1237 3300006051 Ga0075364_10640988 Ga0075364_106409881 137
1238 3300006177 Ga0075362_10154916 Ga0075362_101549162 137
1239 3300006177 Ga0075362_10293239 Ga0075362_102932392 137
1240 3300006178 Ga0075367_10069655 Ga0075367_100696553 137
1241 3300006195 Ga0075366_10085420 Ga0075366_100854202 137
1242 3300006353 Ga0075370_10007496 Ga0075370_100074966 137
1243 3300009094 Ga0111539_10591812 Ga0111539_105918122 137
1244 3300009147 Ga0114129_10388114 Ga0114129_103881143 137
1245 3300009174 Ga0105241_10632054 Ga0105241_106320541 137
1246 3300009174 Ga0105241_11138663 Ga0105241_111386631 137
1247 3300009177 Ga0105248_10302395 Ga0105248_103023952 137
1248 3300009177 Ga0105248_10485881 Ga0105248_104858812 137
1249 3300009553 Ga0105249_10647491 Ga0105249_106474911 137
1250 3300011119 Ga0105246_10234181 Ga0105246_102341812 137
1251 3300013308 Ga0157375_11575902 Ga0157375_115759021 137
1252 3300014325 Ga0163163_10226083 Ga0163163_102260832 137
1253 3300014326 Ga0157380_10368602 Ga0157380_103686022 137
1254 3300025297 Ga0209758_1033155 Ga0209758_10331553 137
1255 3300025911 Ga0207654_10599118 Ga0207654_105991181 137
1256 3300025920 Ga0207649_10188764 Ga0207649_101887642 137
1257 3300025940 Ga0207691_11428757 Ga0207691_114287571 137
1258 3300025941 Ga0207711_10337214 Ga0207711_103372142 137
1259 3300025941 Ga0207711_10637484 Ga0207711_106374841 137
1260 3300025981 Ga0207640_10612021 Ga0207640_106120211 137
1261 3300026067 Ga0207678_10067068 Ga0207678_100670683 137
1262 3300026095 Ga0207676_11782026 Ga0207676_117820261 137
1263 3300026121 Ga0207683_10183642 Ga0207683_101836423 137
1264 3300028379 Ga0268266_10002224 Ga0268266_1000222420 137
1265 3300028379 Ga0268266_10052951 Ga0268266_100529513 137
1266 3300028794 Ga0307515_10225691 Ga0307515_102256913 137
1267 3300041491 Ga0451833_0292474 Ga0451833_0292474_57_470 137
1268 3300041512 Ga0451853_3923295 Ga0451853_3923295_67_486 137
1269 3300046471 Ga0495650_0286449 Ga0495650_0286449_49_468 137
1270 3300046616 Ga0495668_0123568 Ga0495668_0123568_202_615 137
1271 3300048905 Ga0496102_0685502 Ga0496102_0685502_378_791 137
1272 3300048906 Ga0496103_0386385 Ga0496103_0386385_162_575 137
1273 3300048907 Ga0496104_0247603 Ga0496104_0247603_967_1380 137
1274 3300048911 Ga0496108_0175718 Ga0496108_0175718_113_526 137
1275 3300048912 Ga0496109_0728883 Ga0496109_0728883_212_625 137
1276 3300048913 Ga0496110_0391225 Ga0496110_0391225_812_1225 137
1277 3300048916 Ga0496113_0374943 Ga0496113_0374943_203_616 137
1278 3300048917 Ga0496114_0469677 Ga0496114_0469677_642_1055 137
1279 3300048918 Ga0496115_0026931 Ga0496115_0026931_2058_2471 137
1280 3300048929 Ga0496126_0370003 Ga0496126_0370003_427_846 137
1281 3300049572 Ga0501036_0135381 Ga0501036_0135381_58_471 137
1282 3300049574 Ga0501038_0960887 Ga0501038_0960887_190_603 137
1283 3300049583 Ga0501067_0021099 Ga0501067_0021099_1701_2114 137
1284 3300049587 Ga0501071_0527049 Ga0501071_0527049_72_485 137
1285 3300049592 Ga0501076_0945503 Ga0501076_0945503_129_542 137
1286 3300049741 Ga0501079_1164711 Ga0501079_1164711_170_583 137
1287 3300049743 Ga0501081_1229650 Ga0501081_1229650_87_500 137
1288 3300050490 nmdc:mga03n38_1553_c1 nmdc:mga03n38_1553_c1_2759_3172 137
1289 3300050491 nmdc:mga00v17_34577_c2 nmdc:mga00v17_34577_c2_51_464 137
1290 3300050492 nmdc:mga0yw44_166105_c1 nmdc:mga0yw44_166105_c1_595_1008 137
1291 3300050493 nmdc:mga0k408_303365_c1 nmdc:mga0k408_303365_c1_241_654 137
1292 3300050493 nmdc:mga0k408_88359_c1 nmdc:mga0k408_88359_c1_956_1369 137
1293 3300050494 nmdc:mga06z11_143684_c1 nmdc:mga06z11_143684_c1_332_745 137
1294 3300050496 nmdc:mga07m45_25003_c1 nmdc:mga07m45_25003_c1_1812_2225 137
1295 3300053083 Ga0495655_0262183 Ga0495655_0262183_100_513 137
1296 3300053083 Ga0495655_0346184 Ga0495655_0346184_41_466 137
1297 3300053158 Ga0500627_0364678 Ga0500627_0364678_179_598 137
1298 3300003215 JGI25153J46596_10005441 JGI25153J46596_100054414 138
1299 3300005331 Ga0070670_100572531 Ga0070670_1005725312 138
1300 3300005338 Ga0068868_100574773 Ga0068868_1005747732 138
1301 3300005456 Ga0070678_100080216 Ga0070678_1000802163 138
1302 3300005539 Ga0068853_100436045 Ga0068853_1004360452 138
1303 3300005548 Ga0070665_100375948 Ga0070665_1003759482 138
1304 3300005937 Ga0081455_10059660 Ga0081455_100596602 138
1305 3300005985 Ga0081539_10034639 Ga0081539_100346391 138
1306 3300006048 Ga0075363_100135024 Ga0075363_1001350242 138
1307 3300006353 Ga0075370_10286893 Ga0075370_102868931 138
1308 3300009098 Ga0105245_11114991 Ga0105245_111149912 138
1309 3300025940 Ga0207691_10643762 Ga0207691_106437622 138
1310 3300026121 Ga0207683_10122121 Ga0207683_101221213 138
1311 3300028379 Ga0268266_11050413 Ga0268266_110504131 138
1312 3300028379 Ga0268266_12368435 Ga0268266_123684351 138
1313 3300046528 Ga0495642_0501820 Ga0495642_0501820_61_477 138
1314 3300050490 nmdc:mga03n38_106575_c1 nmdc:mga03n38_106575_c1_696_1112 138
1315 3300050493 nmdc:mga0k408_304361_c1 nmdc:mga0k408_304361_c1_370_786 138
1316 3300005459 Ga0068867_100462130 Ga0068867_1004621302 139
1317 3300005578 Ga0068854_100117527 Ga0068854_1001175273 142
1318 3300026078 Ga0207702_11738654 Ga0207702_117386542 142
1319 3300047472 Ga0495686_0153619 Ga0495686_0153619_254_733 151
1320 3300000549 LJQas_1028333 LJQas_10283331 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

38

114

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lmf-assembly1.cif.gz_A crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72 0.6151 29 139
3lmf-assembly1.cif.gz_A crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72 0.6016 29 139
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.5693 28 138
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.5323 28 138
5arm-assembly1.cif.gz_A apo-csp3 (copper storage protein 3) from methylosinus 0.5243 30 142
ID Description Score Start End Superfamily
af_I1LYI2_1_138_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.665 29 138 1.20.120.550
af_Q54UK5_2_117_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6183 30 136 1.20.120.550
af_M9NFP0_1_142_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6145 28 153 1.20.120.350
af_P40030_21_129_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.6057 31 129 3.40.605.10
af_A0A6H2EED7_1_133_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5826 19 153 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A7S7TMA1-F1-model_v4 LuxR family transcriptional regulator 0.9136 25 154 GO:0005886
AF-A0A5S4YP41-F1-model_v4 DoxX family protein 0.9134 21 153 GO:0005886
AF-A0A4Q0Q588-F1-model_v4 deleted 0.9114 26 153
AF-A0A4S1XIF3-F1-model_v4 DoxX family protein 0.9063 24 152 GO:0005886
AF-A0A7Y4GYJ9-F1-model_v4 DoxX family protein 0.9061 19 151 GO:0005886

Feature Viewer

pLDDT pTM Quality
75.66 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map