F492974
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1320 | 591 | 1222 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0153619|Ga0495686_0153619_254_733 |
| Length | 159 |
| Sequence | MDTGSPEENASKQESKFVRIKQGTSNVDQMFSKWQPAALSLFRFITGLLLFQYGVAKIFKFPVLPYFADIPPLIVAAGLIELVLGALLMIGLFTRPVAFILAGEMAFAYFMGHMFKSGAPVFLPLLNGGTAAILFCFACLYLATSGGGPISVDGMRGKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 8 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 9 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 10 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 11 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 12 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 13 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 14 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 15 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 16 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 17 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 18 | 2791355199 | |||
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 21 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 22 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 23 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 24 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 25 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 26 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 27 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 28 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 29 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 30 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 31 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 32 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 33 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 34 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 35 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 36 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 37 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 38 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 39 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 40 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 41 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 42 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 43 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 44 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 45 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 46 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 47 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 48 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 49 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 50 | 2904699407 | |||
| 51 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 52 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 53 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 54 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 55 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 56 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 57 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 58 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 59 | 2922425934 | |||
| 60 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 61 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 62 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 63 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 64 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 65 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 66 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 67 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 68 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 69 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 70 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 71 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 72 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 73 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 74 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 75 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 76 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 77 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 78 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 79 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 80 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 81 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 82 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 83 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 84 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 85 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 86 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 87 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 88 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 89 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 90 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 92 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 93 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 96 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 97 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 100 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 102 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 106 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 108 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 115 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 129 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 130 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 131 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 136 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 138 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 140 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 144 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 146 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 147 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 148 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 150 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 151 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 152 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 153 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 154 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 155 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 156 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 157 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 158 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 159 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 160 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 161 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 162 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 163 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 165 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 166 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 167 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 168 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 169 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 170 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 171 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 172 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 173 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 174 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 175 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 176 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 178 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 179 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 180 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 181 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 182 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 183 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 184 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 186 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 187 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 188 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 189 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 190 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 204 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 220 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 221 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 222 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 223 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 224 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 225 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 226 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 227 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 228 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 231 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 234 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 298 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 299 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 300 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 306 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 307 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 308 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 309 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 310 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 311 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 312 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 313 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 314 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 315 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 316 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 317 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 318 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 319 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 320 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 321 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 322 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 323 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 324 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 325 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 326 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 327 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 328 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 329 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 330 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 331 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 332 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 333 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 334 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 335 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 336 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 337 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 338 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 339 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 340 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 341 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 342 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 343 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 344 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 345 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 346 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 347 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 348 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 349 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 350 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 351 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 352 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 353 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 354 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 355 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 356 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 357 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 358 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 359 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 439 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 440 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 441 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 442 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 443 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 444 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 445 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 446 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 447 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 448 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 449 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 450 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 451 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 452 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 453 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 454 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 455 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 456 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 457 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 458 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 459 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 460 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 461 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 462 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 494 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 495 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 496 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 497 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 498 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 499 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 500 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 501 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 508 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 511 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 515 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 516 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 517 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 518 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 519 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 520 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 521 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 522 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 523 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 524 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 525 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 526 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 527 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 528 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 529 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 530 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 531 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 532 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 533 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 534 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 535 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 536 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 537 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 538 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 539 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 540 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 541 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 542 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 543 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 544 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 545 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 546 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 547 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 548 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 549 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 550 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 551 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 552 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 553 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 554 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 555 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 556 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 557 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 558 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 559 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 560 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 561 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 562 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 563 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 564 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 565 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 566 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 567 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 568 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 569 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 570 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 571 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 572 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 573 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 574 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 575 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 576 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 577 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 578 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 579 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 580 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 581 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 582 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 583 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 584 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 585 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 586 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 587 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 588 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 589 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 590 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 591 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.48 |
| Metatranscriptomes | 0.3 |
| Isolates | 7.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.88 |
| Nodule | 5.76 |
| Rhizoplane | 3.86 |
| Rhizosphere | 63.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1028333 | 3300000549 | Bacteria | 654 |
| 2 | JGI24750J21931_1007657 | 3300002070 | Bacteria | 1362 |
| 3 | JGI24742J22300_10012428 | 3300002244 | Bacteria | 1419 |
| 4 | JGI25153J46596_10000472 | 3300003215 | Bacteria | 25779 |
| 5 | JGI25153J46596_10005441 | 3300003215 | Bacteria | 6683 |
| 6 | JGI25153J46596_10009052 | 3300003215 | Bacteria | 4677 |
| 7 | JGI25153J46596_10009819 | 3300003215 | Bacteria | 4396 |
| 8 | JGI25153J46596_10011461 | 3300003215 | Bacteria | 3917 |
| 9 | JGI25160J50197_1002192 | 3300003354 | Bacteria | 9182 |
| 10 | JGI25160J50197_1008449 | 3300003354 | Bacteria | 3921 |
| 11 | JGI25160J50197_1013575 | 3300003354 | Bacteria | 2769 |
| 12 | JGI25404J52841_10022340 | 3300003659 | Bacteria | 1367 |
| 13 | JGI25404J52841_10053954 | 3300003659 | Bacteria | 844 |
| 14 | Ga0055526_1009092 | 3300003771 | Bacteria | 4846 |
| 15 | Ga0055531_10014195 | 3300003794 | Bacteria | 3607 |
| 16 | JGI25405J52794_10014185 | 3300003911 | Bacteria | 1553 |
| 17 | Ga0055543_1015878 | 3300004625 | Bacteria | 1440 |
| 18 | Ga0065165_1003559 | 3300005262 | Bacteria | 10766 |
| 19 | Ga0065165_1003853 | 3300005262 | Bacteria | 9962 |
| 20 | Ga0065165_1018994 | 3300005262 | Bacteria | 2469 |
| 21 | Ga0065165_1079852 | 3300005262 | Bacteria | 851 |
| 22 | Ga0065165_1114374 | 3300005262 | Bacteria | 660 |
| 23 | Ga0065707_10273588 | 3300005295 | Bacteria | 1065 |
| 24 | Ga0070676_10662571 | 3300005328 | Bacteria | 759 |
| 25 | Ga0070683_100850693 | 3300005329 | Bacteria | 875 |
| 26 | Ga0070690_100452997 | 3300005330 | Bacteria | 952 |
| 27 | Ga0070670_100170963 | 3300005331 | Bacteria | 1885 |
| 28 | Ga0070670_100572531 | 3300005331 | Bacteria | 1009 |
| 29 | Ga0070670_100620259 | 3300005331 | Bacteria | 969 |
| 30 | Ga0070670_102227136 | 3300005331 | Bacteria | 505 |
| 31 | Ga0068869_100042838 | 3300005334 | Bacteria | 3248 |
| 32 | Ga0068869_100085418 | 3300005334 | Bacteria | 2364 |
| 33 | Ga0068869_100154070 | 3300005334 | Bacteria | 1784 |
| 34 | Ga0068869_100761395 | 3300005334 | Bacteria | 830 |
| 35 | Ga0068869_100900581 | 3300005334 | Bacteria | 765 |
| 36 | Ga0068869_101045167 | 3300005334 | Bacteria | 713 |
| 37 | Ga0070666_10053315 | 3300005335 | Bacteria | 2727 |
| 38 | Ga0070666_10102740 | 3300005335 | Bacteria | 1971 |
| 39 | Ga0070680_100110473 | 3300005336 | Bacteria | 2289 |
| 40 | Ga0070680_101749694 | 3300005336 | Bacteria | 539 |
| 41 | Ga0070682_100247304 | 3300005337 | Bacteria | 1284 |
| 42 | Ga0068868_100153850 | 3300005338 | Bacteria | 1895 |
| 43 | Ga0068868_100574773 | 3300005338 | Bacteria | 996 |
| 44 | Ga0070660_100578933 | 3300005339 | Bacteria | 938 |
| 45 | Ga0070660_100814677 | 3300005339 | Bacteria | 786 |
| 46 | Ga0070689_101023400 | 3300005340 | Bacteria | 736 |
| 47 | Ga0070691_10513533 | 3300005341 | Bacteria | 694 |
| 48 | Ga0070661_100288474 | 3300005344 | Bacteria | 1275 |
| 49 | Ga0070661_100405317 | 3300005344 | Bacteria | 1079 |
| 50 | Ga0070661_100638715 | 3300005344 | Bacteria | 863 |
| 51 | Ga0070661_101675607 | 3300005344 | Bacteria | 538 |
| 52 | Ga0070668_100093470 | 3300005347 | Bacteria | 2373 |
| 53 | Ga0070668_100214062 | 3300005347 | Bacteria | 1586 |
| 54 | Ga0070668_100250748 | 3300005347 | Bacteria | 1469 |
| 55 | Ga0070668_100548748 | 3300005347 | Bacteria | 1006 |
| 56 | Ga0070668_100601784 | 3300005347 | Bacteria | 962 |
| 57 | Ga0070668_100658320 | 3300005347 | Bacteria | 921 |
| 58 | Ga0070669_100369757 | 3300005353 | Bacteria | 1167 |
| 59 | Ga0070674_100771291 | 3300005356 | Bacteria | 828 |
| 60 | Ga0070674_100997199 | 3300005356 | Bacteria | 735 |
| 61 | Ga0070673_100252154 | 3300005364 | Bacteria | 1539 |
| 62 | Ga0070688_100283257 | 3300005365 | Bacteria | 1192 |
| 63 | Ga0070659_100401645 | 3300005366 | Bacteria | 1157 |
| 64 | Ga0070659_100426481 | 3300005366 | Bacteria | 1122 |
| 65 | Ga0070659_100927812 | 3300005366 | Bacteria | 762 |
| 66 | Ga0070659_101526241 | 3300005366 | Bacteria | 596 |
| 67 | Ga0070667_100073038 | 3300005367 | Bacteria | 2924 |
| 68 | Ga0070667_101525634 | 3300005367 | Bacteria | 628 |
| 69 | Ga0070709_10018262 | 3300005434 | Bacteria | 4035 |
| 70 | Ga0070709_10056927 | 3300005434 | Bacteria | 2474 |
| 71 | Ga0070714_100045655 | 3300005435 | Bacteria | 3714 |
| 72 | Ga0070714_100160138 | 3300005435 | Bacteria | 2036 |
| 73 | Ga0070714_100186990 | 3300005435 | Bacteria | 1888 |
| 74 | Ga0070713_100052649 | 3300005436 | Bacteria | 3371 |
| 75 | Ga0070713_100273740 | 3300005436 | Bacteria | 1547 |
| 76 | Ga0070713_101247974 | 3300005436 | Bacteria | 720 |
| 77 | Ga0070710_10006722 | 3300005437 | Bacteria | 5543 |
| 78 | Ga0070710_10225180 | 3300005437 | Bacteria | 1195 |
| 79 | Ga0070701_10088778 | 3300005438 | Bacteria | 1689 |
| 80 | Ga0070701_11261695 | 3300005438 | Bacteria | 527 |
| 81 | Ga0070711_100002267 | 3300005439 | Bacteria | 10903 |
| 82 | Ga0070711_100007952 | 3300005439 | Bacteria | 6466 |
| 83 | Ga0070711_100055202 | 3300005439 | Bacteria | 2743 |
| 84 | Ga0070711_100136144 | 3300005439 | Bacteria | 1836 |
| 85 | Ga0070705_100321880 | 3300005440 | Bacteria | 1117 |
| 86 | Ga0070705_100993488 | 3300005440 | Bacteria | 681 |
| 87 | Ga0070700_100129410 | 3300005441 | Bacteria | 1701 |
| 88 | Ga0070663_100036074 | 3300005455 | Bacteria | 3434 |
| 89 | Ga0070663_100043119 | 3300005455 | Bacteria | 3173 |
| 90 | Ga0070663_100046224 | 3300005455 | Bacteria | 3079 |
| 91 | Ga0070663_100060665 | 3300005455 | Bacteria | 2721 |
| 92 | Ga0070663_100208731 | 3300005455 | Bacteria | 1528 |
| 93 | Ga0070663_100435037 | 3300005455 | Bacteria | 1078 |
| 94 | Ga0070663_101030048 | 3300005455 | Bacteria | 717 |
| 95 | Ga0070678_100080216 | 3300005456 | Bacteria | 2471 |
| 96 | Ga0070678_100322956 | 3300005456 | Bacteria | 1319 |
| 97 | Ga0070678_100381895 | 3300005456 | Bacteria | 1219 |
| 98 | Ga0070678_100567313 | 3300005456 | Bacteria | 1009 |
| 99 | Ga0070678_100613113 | 3300005456 | Bacteria | 973 |
| 100 | Ga0070662_100088795 | 3300005457 | Bacteria | 2317 |
| 101 | Ga0070662_100570354 | 3300005457 | Bacteria | 950 |
| 102 | Ga0070681_10093689 | 3300005458 | Bacteria | 2952 |
| 103 | Ga0070681_10196417 | 3300005458 | Bacteria | 1936 |
| 104 | Ga0068867_100373787 | 3300005459 | Bacteria | 1195 |
| 105 | Ga0068867_100462130 | 3300005459 | Bacteria | 1084 |
| 106 | Ga0070685_10210776 | 3300005466 | Bacteria | 1268 |
| 107 | Ga0070685_10211748 | 3300005466 | Bacteria | 1265 |
| 108 | Ga0070706_100153508 | 3300005467 | Bacteria | 2150 |
| 109 | Ga0070707_100151016 | 3300005468 | Bacteria | 2262 |
| 110 | Ga0070698_100049606 | 3300005471 | Bacteria | 4283 |
| 111 | Ga0070698_100108450 | 3300005471 | Bacteria | 2743 |
| 112 | Ga0070699_100085031 | 3300005518 | Bacteria | 2760 |
| 113 | Ga0070684_100254342 | 3300005535 | Bacteria | 1606 |
| 114 | Ga0070697_100346345 | 3300005536 | Bacteria | 1283 |
| 115 | Ga0068853_100039389 | 3300005539 | Bacteria | 4030 |
| 116 | Ga0068853_100089715 | 3300005539 | Bacteria | 2700 |
| 117 | Ga0068853_100362898 | 3300005539 | Bacteria | 1350 |
| 118 | Ga0068853_100436045 | 3300005539 | Bacteria | 1231 |
| 119 | Ga0068853_100547786 | 3300005539 | Bacteria | 1096 |
| 120 | Ga0070672_100246702 | 3300005543 | Bacteria | 1503 |
| 121 | Ga0070672_101011848 | 3300005543 | Bacteria | 737 |
| 122 | Ga0070695_100449823 | 3300005545 | Bacteria | 987 |
| 123 | Ga0070696_100096905 | 3300005546 | Bacteria | 2108 |
| 124 | Ga0070693_100034898 | 3300005547 | Bacteria | 2785 |
| 125 | Ga0070693_100091598 | 3300005547 | Bacteria | 1834 |
| 126 | Ga0070693_100296525 | 3300005547 | Bacteria | 1088 |
| 127 | Ga0070665_100145669 | 3300005548 | Bacteria | 2371 |
| 128 | Ga0070665_100199162 | 3300005548 | Bacteria | 2003 |
| 129 | Ga0070665_100212898 | 3300005548 | Bacteria | 1933 |
| 130 | Ga0070665_100263003 | 3300005548 | Bacteria | 1726 |
| 131 | Ga0070665_100375948 | 3300005548 | Bacteria | 1428 |
| 132 | Ga0070665_100388288 | 3300005548 | Bacteria | 1403 |
| 133 | Ga0070665_100496407 | 3300005548 | Bacteria | 1232 |
| 134 | Ga0070665_100835770 | 3300005548 | Bacteria | 934 |
| 135 | Ga0070665_101315364 | 3300005548 | Bacteria | 732 |
| 136 | Ga0068855_100420616 | 3300005563 | Bacteria | 1462 |
| 137 | Ga0070664_101125925 | 3300005564 | Bacteria | 740 |
| 138 | Ga0068857_100081351 | 3300005577 | Bacteria | 2892 |
| 139 | Ga0068857_100414741 | 3300005577 | Bacteria | 1255 |
| 140 | Ga0068854_100051014 | 3300005578 | Bacteria | 2963 |
| 141 | Ga0068854_100117527 | 3300005578 | Bacteria | 2014 |
| 142 | Ga0068854_100132481 | 3300005578 | Bacteria | 1905 |
| 143 | Ga0068854_100486767 | 3300005578 | Bacteria | 1037 |
| 144 | Ga0068854_101109823 | 3300005578 | Bacteria | 705 |
| 145 | Ga0068856_100449393 | 3300005614 | Bacteria | 1309 |
| 146 | Ga0068856_101300487 | 3300005614 | Bacteria | 742 |
| 147 | Ga0070702_100152071 | 3300005615 | Bacteria | 1487 |
| 148 | Ga0068852_100037914 | 3300005616 | Bacteria | 4046 |
| 149 | Ga0068852_100258731 | 3300005616 | Bacteria | 1670 |
| 150 | Ga0068852_100655479 | 3300005616 | Bacteria | 1057 |
| 151 | Ga0068852_101462316 | 3300005616 | Bacteria | 706 |
| 152 | Ga0068859_100058789 | 3300005617 | Bacteria | 3873 |
| 153 | Ga0068859_100627225 | 3300005617 | Bacteria | 1167 |
| 154 | Ga0068864_101511805 | 3300005618 | Bacteria | 674 |
| 155 | Ga0068864_101760038 | 3300005618 | Bacteria | 625 |
| 156 | Ga0068866_10558304 | 3300005718 | Bacteria | 767 |
| 157 | Ga0068861_100139922 | 3300005719 | Bacteria | 1974 |
| 158 | Ga0068861_100167241 | 3300005719 | Bacteria | 1819 |
| 159 | Ga0068861_100371601 | 3300005719 | Bacteria | 1260 |
| 160 | Ga0068851_10221768 | 3300005834 | Bacteria | 1063 |
| 161 | Ga0068870_10421258 | 3300005840 | Bacteria | 874 |
| 162 | Ga0068863_100035315 | 3300005841 | Bacteria | 4762 |
| 163 | Ga0068863_100636971 | 3300005841 | Bacteria | 1057 |
| 164 | Ga0068863_101638617 | 3300005841 | Bacteria | 653 |
| 165 | Ga0068858_100207233 | 3300005842 | Bacteria | 1855 |
| 166 | Ga0068858_100388636 | 3300005842 | Bacteria | 1339 |
| 167 | Ga0068858_100676498 | 3300005842 | Bacteria | 1003 |
| 168 | Ga0068858_101293741 | 3300005842 | Bacteria | 717 |
| 169 | Ga0068860_100000503 | 3300005843 | Bacteria | 48508 |
| 170 | Ga0068860_100093721 | 3300005843 | Bacteria | 2862 |
| 171 | Ga0068860_100237968 | 3300005843 | Bacteria | 1770 |
| 172 | Ga0068860_100569987 | 3300005843 | Bacteria | 1135 |
| 173 | Ga0068860_101526264 | 3300005843 | Bacteria | 690 |
| 174 | Ga0068860_102159872 | 3300005843 | Bacteria | 578 |
| 175 | Ga0068862_100276166 | 3300005844 | Bacteria | 1538 |
| 176 | Ga0068862_100336751 | 3300005844 | Bacteria | 1396 |
| 177 | Ga0081455_10003167 | 3300005937 | Bacteria | 19102 |
| 178 | Ga0081455_10059660 | 3300005937 | Bacteria | 3220 |
| 179 | Ga0081455_10175758 | 3300005937 | Bacteria | 1626 |
| 180 | Ga0081540_1003216 | 3300005983 | Bacteria | 13018 |
| 181 | Ga0081540_1021572 | 3300005983 | Bacteria | 3829 |
| 182 | Ga0081540_1023528 | 3300005983 | Bacteria | 3599 |
| 183 | Ga0081540_1027471 | 3300005983 | Bacteria | 3223 |
| 184 | Ga0081540_1041474 | 3300005983 | Bacteria | 2386 |
| 185 | Ga0081540_1055339 | 3300005983 | Bacteria | 1933 |
| 186 | Ga0081540_1075802 | 3300005983 | Bacteria | 1536 |
| 187 | Ga0081539_10034639 | 3300005985 | Bacteria | 3048 |
| 188 | Ga0070717_10009967 | 3300006028 | Bacteria | 7148 |
| 189 | Ga0070717_10024153 | 3300006028 | Bacteria | 4823 |
| 190 | Ga0070717_10890816 | 3300006028 | Bacteria | 810 |
| 191 | Ga0075365_10016403 | 3300006038 | Bacteria | 4506 |
| 192 | Ga0075365_10018977 | 3300006038 | Bacteria | 4236 |
| 193 | Ga0075365_10040534 | 3300006038 | Bacteria | 3037 |
| 194 | Ga0075365_10040718 | 3300006038 | Bacteria | 3031 |
| 195 | Ga0075365_10053601 | 3300006038 | Bacteria | 2672 |
| 196 | Ga0075365_10188859 | 3300006038 | Bacteria | 1441 |
| 197 | Ga0075365_10273209 | 3300006038 | Bacteria | 1189 |
| 198 | Ga0075368_10017827 | 3300006042 | Bacteria | 2661 |
| 199 | Ga0075368_10113852 | 3300006042 | Bacteria | 1117 |
| 200 | Ga0075363_100001995 | 3300006048 | Bacteria | 8127 |
| 201 | Ga0075363_100135024 | 3300006048 | Bacteria | 1386 |
| 202 | Ga0075363_100200315 | 3300006048 | Bacteria | 1140 |
| 203 | Ga0075363_100428206 | 3300006048 | Bacteria | 780 |
| 204 | Ga0075364_10042281 | 3300006051 | Bacteria | 2960 |
| 205 | Ga0075364_10122450 | 3300006051 | Bacteria | 1742 |
| 206 | Ga0075364_10248096 | 3300006051 | Bacteria | 1210 |
| 207 | Ga0075364_10640988 | 3300006051 | Bacteria | 726 |
| 208 | Ga0075364_10703525 | 3300006051 | Bacteria | 689 |
| 209 | Ga0075432_10398365 | 3300006058 | Bacteria | 594 |
| 210 | Ga0070715_10002384 | 3300006163 | Bacteria | 5754 |
| 211 | Ga0070716_100004420 | 3300006173 | Bacteria | 6721 |
| 212 | Ga0070716_100100668 | 3300006173 | Bacteria | 1771 |
| 213 | Ga0070716_100926553 | 3300006173 | Bacteria | 684 |
| 214 | Ga0070712_100085114 | 3300006175 | Bacteria | 2301 |
| 215 | Ga0070712_100117731 | 3300006175 | Bacteria | 1994 |
| 216 | Ga0070712_100139184 | 3300006175 | Bacteria | 1850 |
| 217 | Ga0070712_100701470 | 3300006175 | Bacteria | 863 |
| 218 | Ga0070712_100885590 | 3300006175 | Bacteria | 769 |
| 219 | Ga0070712_101069452 | 3300006175 | Bacteria | 699 |
| 220 | Ga0070712_101087861 | 3300006175 | Bacteria | 693 |
| 221 | Ga0075362_10072311 | 3300006177 | Bacteria | 1577 |
| 222 | Ga0075362_10096087 | 3300006177 | Bacteria | 1380 |
| 223 | Ga0075362_10133368 | 3300006177 | Bacteria | 1183 |
| 224 | Ga0075362_10154916 | 3300006177 | Bacteria | 1101 |
| 225 | Ga0075362_10293239 | 3300006177 | Bacteria | 806 |
| 226 | Ga0075367_10069655 | 3300006178 | Bacteria | 2112 |
| 227 | Ga0075367_10082850 | 3300006178 | Bacteria | 1942 |
| 228 | Ga0075367_10098442 | 3300006178 | Bacteria | 1785 |
| 229 | Ga0075369_10018548 | 3300006186 | Bacteria | 2834 |
| 230 | Ga0075369_10030019 | 3300006186 | Bacteria | 2287 |
| 231 | Ga0075369_10042859 | 3300006186 | Bacteria | 1940 |
| 232 | Ga0075369_10249895 | 3300006186 | Bacteria | 823 |
| 233 | Ga0075369_10354305 | 3300006186 | Bacteria | 689 |
| 234 | Ga0075366_10085420 | 3300006195 | Bacteria | 1887 |
| 235 | Ga0075366_10099715 | 3300006195 | Bacteria | 1743 |
| 236 | Ga0075366_10187259 | 3300006195 | Bacteria | 1257 |
| 237 | Ga0075366_10215140 | 3300006195 | Bacteria | 1170 |
| 238 | Ga0075366_10438606 | 3300006195 | Bacteria | 805 |
| 239 | Ga0097621_100924090 | 3300006237 | Bacteria | 813 |
| 240 | Ga0075370_10007496 | 3300006353 | Bacteria | 5561 |
| 241 | Ga0075370_10030019 | 3300006353 | Bacteria | 3032 |
| 242 | Ga0075370_10039239 | 3300006353 | Bacteria | 2667 |
| 243 | Ga0075370_10039847 | 3300006353 | Bacteria | 2648 |
| 244 | Ga0075370_10046929 | 3300006353 | Bacteria | 2445 |
| 245 | Ga0075370_10246684 | 3300006353 | Bacteria | 1058 |
| 246 | Ga0075370_10286893 | 3300006353 | Bacteria | 978 |
| 247 | Ga0068871_100657870 | 3300006358 | Bacteria | 957 |
| 248 | Ga0075428_100597564 | 3300006844 | Bacteria | 1179 |
| 249 | Ga0075428_101069328 | 3300006844 | Bacteria | 853 |
| 250 | Ga0075433_10964081 | 3300006852 | Bacteria | 743 |
| 251 | Ga0075434_100041162 | 3300006871 | Bacteria | 4576 |
| 252 | Ga0068865_100494700 | 3300006881 | Bacteria | 1018 |
| 253 | Ga0075436_100341501 | 3300006914 | Bacteria | 1078 |
| 254 | Ga0097620_100058780 | 3300006931 | Bacteria | 3873 |
| 255 | Ga0097620_100627259 | 3300006931 | Bacteria | 1167 |
| 256 | Ga0099824_1020528 | 3300006942 | Bacteria | 4838 |
| 257 | Ga0099823_1098135 | 3300006944 | Bacteria | 920 |
| 258 | Ga0075435_100024687 | 3300007076 | Bacteria | 4668 |
| 259 | Ga0075435_100409607 | 3300007076 | Bacteria | 1167 |
| 260 | Ga0099794_10075643 | 3300007265 | Bacteria | 1655 |
| 261 | Ga0099794_10120394 | 3300007265 | Bacteria | 1320 |
| 262 | Ga0099794_10174216 | 3300007265 | Bacteria | 1097 |
| 263 | Ga0099794_10548499 | 3300007265 | Bacteria | 610 |
| 264 | Ga0099795_10005436 | 3300007788 | Bacteria | 3387 |
| 265 | Ga0099795_10048777 | 3300007788 | Bacteria | 1535 |
| 266 | Ga0099795_10134430 | 3300007788 | Bacteria | 1001 |
| 267 | Ga0099795_10537966 | 3300007788 | Bacteria | 549 |
| 268 | Ga0105250_10084364 | 3300009092 | Bacteria | 1289 |
| 269 | Ga0105240_10004957 | 3300009093 | Bacteria | 20021 |
| 270 | Ga0105240_10478615 | 3300009093 | Bacteria | 1388 |
| 271 | Ga0111539_10331760 | 3300009094 | Bacteria | 1771 |
| 272 | Ga0111539_10591812 | 3300009094 | Bacteria | 1292 |
| 273 | Ga0105245_10073773 | 3300009098 | Bacteria | 3104 |
| 274 | Ga0105245_10299958 | 3300009098 | Bacteria | 1576 |
| 275 | Ga0105245_10406223 | 3300009098 | Bacteria | 1362 |
| 276 | Ga0105245_11114991 | 3300009098 | Bacteria | 835 |
| 277 | Ga0105247_10038734 | 3300009101 | Bacteria | 2911 |
| 278 | Ga0105247_10133584 | 3300009101 | Bacteria | 1619 |
| 279 | Ga0105247_10257549 | 3300009101 | Bacteria | 1195 |
| 280 | Ga0105247_10269622 | 3300009101 | Bacteria | 1170 |
| 281 | Ga0105247_10830123 | 3300009101 | Bacteria | 708 |
| 282 | Ga0114129_10388114 | 3300009147 | Bacteria | 1842 |
| 283 | Ga0105243_10144795 | 3300009148 | Bacteria | 2032 |
| 284 | Ga0105243_10774814 | 3300009148 | Bacteria | 943 |
| 285 | Ga0105243_12221593 | 3300009148 | Bacteria | 585 |
| 286 | Ga0105241_10037913 | 3300009174 | Bacteria | 3633 |
| 287 | Ga0105241_10069592 | 3300009174 | Bacteria | 2729 |
| 288 | Ga0105241_10430170 | 3300009174 | Bacteria | 1164 |
| 289 | Ga0105241_10577725 | 3300009174 | Bacteria | 1013 |
| 290 | Ga0105241_10632054 | 3300009174 | Bacteria | 970 |
| 291 | Ga0105241_10757570 | 3300009174 | Bacteria | 891 |
| 292 | Ga0105241_11138663 | 3300009174 | Bacteria | 736 |
| 293 | Ga0105242_10238944 | 3300009176 | Bacteria | 1632 |
| 294 | Ga0105248_10302395 | 3300009177 | Bacteria | 1801 |
| 295 | Ga0105248_10485881 | 3300009177 | Bacteria | 1392 |
| 296 | Ga0105248_10667596 | 3300009177 | Bacteria | 1173 |
| 297 | Ga0105248_12619949 | 3300009177 | Bacteria | 575 |
| 298 | Ga0105237_10053382 | 3300009545 | Bacteria | 4054 |
| 299 | Ga0105237_10059303 | 3300009545 | Bacteria | 3829 |
| 300 | Ga0105237_10123798 | 3300009545 | Bacteria | 2580 |
| 301 | Ga0105237_10134788 | 3300009545 | Bacteria | 2464 |
| 302 | Ga0105237_10800229 | 3300009545 | Bacteria | 949 |
| 303 | Ga0105237_11478147 | 3300009545 | Bacteria | 686 |
| 304 | Ga0105237_12093761 | 3300009545 | Bacteria | 575 |
| 305 | Ga0105238_10124009 | 3300009551 | Bacteria | 2563 |
| 306 | Ga0105238_10196717 | 3300009551 | Bacteria | 1992 |
| 307 | Ga0105238_10299288 | 3300009551 | Bacteria | 1592 |
| 308 | Ga0105238_10442170 | 3300009551 | Bacteria | 1297 |
| 309 | Ga0105238_11681726 | 3300009551 | Bacteria | 665 |
| 310 | Ga0105249_10578856 | 3300009553 | Bacteria | 1176 |
| 311 | Ga0105249_10647491 | 3300009553 | Bacteria | 1114 |
| 312 | Ga0105249_11584354 | 3300009553 | Bacteria | 727 |
| 313 | Ga0105249_12469386 | 3300009553 | Bacteria | 592 |
| 314 | Ga0099796_10149631 | 3300010159 | Bacteria | 918 |
| 315 | Ga0099796_10210429 | 3300010159 | Bacteria | 793 |
| 316 | Ga0099796_10222055 | 3300010159 | Bacteria | 775 |
| 317 | Ga0105239_10020953 | 3300010375 | Bacteria | 7212 |
| 318 | Ga0105239_10095960 | 3300010375 | Bacteria | 3275 |
| 319 | Ga0105239_10142500 | 3300010375 | Bacteria | 2672 |
| 320 | Ga0105239_10267715 | 3300010375 | Bacteria | 1921 |
| 321 | Ga0105239_10371171 | 3300010375 | Bacteria | 1617 |
| 322 | Ga0105239_10421858 | 3300010375 | Bacteria | 1511 |
| 323 | Ga0105239_10568010 | 3300010375 | Bacteria | 1292 |
| 324 | Ga0105239_10972499 | 3300010375 | Bacteria | 976 |
| 325 | Ga0105246_10130279 | 3300011119 | Bacteria | 1878 |
| 326 | Ga0105246_10146770 | 3300011119 | Bacteria | 1781 |
| 327 | Ga0105246_10234181 | 3300011119 | Bacteria | 1448 |
| 328 | Ga0105246_10401838 | 3300011119 | Bacteria | 1138 |
| 329 | Ga0105246_11046461 | 3300011119 | Bacteria | 742 |
| 330 | Ga0105246_11715491 | 3300011119 | Bacteria | 597 |
| 331 | Ga0157373_10312320 | 3300013100 | Bacteria | 1117 |
| 332 | Ga0157371_10203224 | 3300013102 | Bacteria | 1421 |
| 333 | Ga0157371_10812842 | 3300013102 | Bacteria | 705 |
| 334 | Ga0157370_11104193 | 3300013104 | Bacteria | 717 |
| 335 | Ga0157369_10247516 | 3300013105 | Bacteria | 1861 |
| 336 | Ga0157369_10300439 | 3300013105 | Bacteria | 1670 |
| 337 | Ga0157378_10169593 | 3300013297 | Bacteria | 2046 |
| 338 | Ga0157378_10202436 | 3300013297 | Bacteria | 1878 |
| 339 | Ga0163162_10029409 | 3300013306 | Bacteria | 5437 |
| 340 | Ga0163162_10107603 | 3300013306 | Bacteria | 2884 |
| 341 | Ga0163162_10869235 | 3300013306 | Bacteria | 1016 |
| 342 | Ga0163162_11024028 | 3300013306 | Bacteria | 934 |
| 343 | Ga0163162_11314237 | 3300013306 | Bacteria | 822 |
| 344 | Ga0157372_10335864 | 3300013307 | Bacteria | 1760 |
| 345 | Ga0157372_10958274 | 3300013307 | Bacteria | 992 |
| 346 | Ga0157375_10270624 | 3300013308 | Bacteria | 1861 |
| 347 | Ga0157375_10350117 | 3300013308 | Bacteria | 1643 |
| 348 | Ga0157375_10352711 | 3300013308 | Bacteria | 1637 |
| 349 | Ga0157375_10410748 | 3300013308 | Bacteria | 1520 |
| 350 | Ga0157375_11575902 | 3300013308 | Bacteria | 776 |
| 351 | Ga0163163_10038380 | 3300014325 | Bacteria | 4668 |
| 352 | Ga0163163_10226083 | 3300014325 | Bacteria | 1920 |
| 353 | Ga0157380_10211406 | 3300014326 | Bacteria | 1729 |
| 354 | Ga0157380_10368602 | 3300014326 | Bacteria | 1351 |
| 355 | Ga0157380_11003074 | 3300014326 | Bacteria | 868 |
| 356 | Ga0157379_10034808 | 3300014968 | Bacteria | 4492 |
| 357 | Ga0157379_10363314 | 3300014968 | Bacteria | 1327 |
| 358 | Ga0157379_10487787 | 3300014968 | Bacteria | 1141 |
| 359 | Ga0157379_11615089 | 3300014968 | Bacteria | 633 |
| 360 | Ga0157376_10358122 | 3300014969 | Bacteria | 1398 |
| 361 | Ga0157376_11031207 | 3300014969 | Bacteria | 846 |
| 362 | Ga0157376_11418883 | 3300014969 | Bacteria | 726 |
| 363 | Ga0163161_10213857 | 3300017792 | Bacteria | 1490 |
| 364 | Ga0163161_10791532 | 3300017792 | Bacteria | 796 |
| 365 | Ga0206350_11469909 | 3300020080 | Bacteria | 879 |
| 366 | Ga0206353_11783555 | 3300020082 | Bacteria | 664 |
| 367 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 368 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 369 | Ga0214542_1037264 | 3300021321 | Bacteria | 1394 |
| 370 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 371 | Ga0214545_1029177 | 3300021324 | Bacteria | 2525 |
| 372 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 373 | Ga0213873_10065597 | 3300021358 | Bacteria | 991 |
| 374 | Ga0213874_10069360 | 3300021377 | Bacteria | 1121 |
| 375 | Ga0224712_10207107 | 3300022467 | Bacteria | 893 |
| 376 | Ga0224712_10215445 | 3300022467 | Bacteria | 877 |
| 377 | Ga0209677_104330 | 3300025253 | Bacteria | 4146 |
| 378 | Ga0209233_1002725 | 3300025261 | Bacteria | 6362 |
| 379 | Ga0209233_1011472 | 3300025261 | Bacteria | 2609 |
| 380 | Ga0209673_1032716 | 3300025273 | Bacteria | 1598 |
| 381 | Ga0209564_1002508 | 3300025295 | Bacteria | 14250 |
| 382 | Ga0209564_1004524 | 3300025295 | Bacteria | 8457 |
| 383 | Ga0209564_1009791 | 3300025295 | Bacteria | 4504 |
| 384 | Ga0209564_1010831 | 3300025295 | Bacteria | 4154 |
| 385 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 386 | Ga0209758_1001632 | 3300025297 | Bacteria | 25487 |
| 387 | Ga0209758_1002055 | 3300025297 | Bacteria | 21535 |
| 388 | Ga0209758_1003008 | 3300025297 | Bacteria | 16134 |
| 389 | Ga0209758_1030454 | 3300025297 | Bacteria | 2234 |
| 390 | Ga0209758_1033155 | 3300025297 | Bacteria | 2081 |
| 391 | Ga0209758_1037034 | 3300025297 | Bacteria | 1892 |
| 392 | Ga0209758_1037482 | 3300025297 | Bacteria | 1873 |
| 393 | Ga0209256_1006522 | 3300025299 | Bacteria | 6132 |
| 394 | Ga0209256_1061217 | 3300025299 | Bacteria | 876 |
| 395 | Ga0207426_1000960 | 3300025302 | Bacteria | 28422 |
| 396 | Ga0207426_1004043 | 3300025302 | Bacteria | 7425 |
| 397 | Ga0207426_1015353 | 3300025302 | Bacteria | 2779 |
| 398 | Ga0209257_1002332 | 3300025304 | Bacteria | 19132 |
| 399 | Ga0207697_10270992 | 3300025315 | Bacteria | 752 |
| 400 | Ga0207697_10358614 | 3300025315 | Bacteria | 647 |
| 401 | Ga0207656_10045214 | 3300025321 | Bacteria | 1884 |
| 402 | Ga0207656_10515633 | 3300025321 | Bacteria | 607 |
| 403 | Ga0207692_10000524 | 3300025898 | Bacteria | 13610 |
| 404 | Ga0207642_10286486 | 3300025899 | Bacteria | 949 |
| 405 | Ga0207710_10011733 | 3300025900 | Bacteria | 3686 |
| 406 | Ga0207710_10503422 | 3300025900 | Bacteria | 629 |
| 407 | Ga0207710_10582223 | 3300025900 | Bacteria | 584 |
| 408 | Ga0207688_10220794 | 3300025901 | Bacteria | 1141 |
| 409 | Ga0207688_10383730 | 3300025901 | Bacteria | 869 |
| 410 | Ga0207680_10161396 | 3300025903 | Bacteria | 1503 |
| 411 | Ga0207680_10183540 | 3300025903 | Bacteria | 1416 |
| 412 | Ga0207647_10378875 | 3300025904 | Bacteria | 799 |
| 413 | Ga0207685_10059983 | 3300025905 | Bacteria | 1503 |
| 414 | Ga0207699_10065696 | 3300025906 | Bacteria | 2200 |
| 415 | Ga0207699_10149525 | 3300025906 | Bacteria | 1544 |
| 416 | Ga0207645_10110973 | 3300025907 | Bacteria | 1775 |
| 417 | Ga0207643_10025614 | 3300025908 | Bacteria | 3261 |
| 418 | Ga0207684_11214170 | 3300025910 | Bacteria | 624 |
| 419 | Ga0207654_10012909 | 3300025911 | Bacteria | 4285 |
| 420 | Ga0207654_10079790 | 3300025911 | Bacteria | 1966 |
| 421 | Ga0207654_10113935 | 3300025911 | Bacteria | 1687 |
| 422 | Ga0207654_10599118 | 3300025911 | Bacteria | 786 |
| 423 | Ga0207707_10015827 | 3300025912 | Bacteria | 6577 |
| 424 | Ga0207707_10020204 | 3300025912 | Bacteria | 5815 |
| 425 | Ga0207695_10000378 | 3300025913 | Bacteria | 101352 |
| 426 | Ga0207695_10350381 | 3300025913 | Bacteria | 1364 |
| 427 | Ga0207695_10922659 | 3300025913 | Bacteria | 753 |
| 428 | Ga0207671_10005974 | 3300025914 | Bacteria | 11019 |
| 429 | Ga0207671_10072553 | 3300025914 | Bacteria | 2570 |
| 430 | Ga0207671_10554433 | 3300025914 | Bacteria | 916 |
| 431 | Ga0207671_10906402 | 3300025914 | Bacteria | 697 |
| 432 | Ga0207693_10005027 | 3300025915 | Bacteria | 11102 |
| 433 | Ga0207693_10014111 | 3300025915 | Bacteria | 6433 |
| 434 | Ga0207693_10085310 | 3300025915 | Bacteria | 2474 |
| 435 | Ga0207663_10000451 | 3300025916 | Bacteria | 17854 |
| 436 | Ga0207663_10047963 | 3300025916 | Bacteria | 2640 |
| 437 | Ga0207663_10082366 | 3300025916 | Bacteria | 2110 |
| 438 | Ga0207660_11155839 | 3300025917 | Bacteria | 630 |
| 439 | Ga0207657_10181427 | 3300025919 | Bacteria | 1702 |
| 440 | Ga0207657_10197663 | 3300025919 | Bacteria | 1619 |
| 441 | Ga0207657_10551261 | 3300025919 | Bacteria | 901 |
| 442 | Ga0207649_10105400 | 3300025920 | Bacteria | 1874 |
| 443 | Ga0207649_10188764 | 3300025920 | Bacteria | 1448 |
| 444 | Ga0207649_11138891 | 3300025920 | Bacteria | 616 |
| 445 | Ga0207681_10198440 | 3300025923 | Bacteria | 1539 |
| 446 | Ga0207694_10096891 | 3300025924 | Bacteria | 2333 |
| 447 | Ga0207694_10182459 | 3300025924 | Bacteria | 1702 |
| 448 | Ga0207694_10644244 | 3300025924 | Bacteria | 892 |
| 449 | Ga0207650_10067668 | 3300025925 | Bacteria | 2680 |
| 450 | Ga0207659_11751403 | 3300025926 | Bacteria | 528 |
| 451 | Ga0207687_10794440 | 3300025927 | Bacteria | 807 |
| 452 | Ga0207700_10002015 | 3300025928 | Bacteria | 11604 |
| 453 | Ga0207700_10298619 | 3300025928 | Bacteria | 1390 |
| 454 | Ga0207700_10720495 | 3300025928 | Bacteria | 891 |
| 455 | Ga0207664_10017534 | 3300025929 | Bacteria | 5252 |
| 456 | Ga0207664_10247165 | 3300025929 | Bacteria | 1555 |
| 457 | Ga0207664_11398112 | 3300025929 | Bacteria | 620 |
| 458 | Ga0207644_10059761 | 3300025931 | Bacteria | 2757 |
| 459 | Ga0207690_10406778 | 3300025932 | Bacteria | 1086 |
| 460 | Ga0207690_10451486 | 3300025932 | Bacteria | 1033 |
| 461 | Ga0207686_10046010 | 3300025934 | Bacteria | 2689 |
| 462 | Ga0207709_10046312 | 3300025935 | Bacteria | 2639 |
| 463 | Ga0207709_10366681 | 3300025935 | Bacteria | 1092 |
| 464 | Ga0207670_10313965 | 3300025936 | Bacteria | 1231 |
| 465 | Ga0207670_11385169 | 3300025936 | Bacteria | 597 |
| 466 | Ga0207669_10030199 | 3300025937 | Bacteria | 3008 |
| 467 | Ga0207704_10302268 | 3300025938 | Bacteria | 1226 |
| 468 | Ga0207665_10002128 | 3300025939 | Bacteria | 13402 |
| 469 | Ga0207665_10348260 | 3300025939 | Bacteria | 1118 |
| 470 | Ga0207665_11200319 | 3300025939 | Bacteria | 605 |
| 471 | Ga0207691_10091375 | 3300025940 | Bacteria | 2727 |
| 472 | Ga0207691_10643762 | 3300025940 | Bacteria | 896 |
| 473 | Ga0207691_11428757 | 3300025940 | Bacteria | 568 |
| 474 | Ga0207711_10337214 | 3300025941 | Bacteria | 1395 |
| 475 | Ga0207711_10637484 | 3300025941 | Bacteria | 994 |
| 476 | Ga0207689_10052903 | 3300025942 | Bacteria | 3345 |
| 477 | Ga0207689_10121366 | 3300025942 | Bacteria | 2150 |
| 478 | Ga0207689_10136106 | 3300025942 | Bacteria | 2023 |
| 479 | Ga0207689_10150833 | 3300025942 | Bacteria | 1916 |
| 480 | Ga0207661_10192288 | 3300025944 | Bacteria | 1790 |
| 481 | Ga0207679_10241662 | 3300025945 | Bacteria | 1530 |
| 482 | Ga0207679_11805561 | 3300025945 | Bacteria | 559 |
| 483 | Ga0207667_10059382 | 3300025949 | Bacteria | 4005 |
| 484 | Ga0207667_11376610 | 3300025949 | Bacteria | 680 |
| 485 | Ga0207651_10362731 | 3300025960 | Bacteria | 1223 |
| 486 | Ga0207712_10153783 | 3300025961 | Bacteria | 1780 |
| 487 | Ga0207712_10550121 | 3300025961 | Bacteria | 993 |
| 488 | Ga0207712_11840585 | 3300025961 | Bacteria | 542 |
| 489 | Ga0207668_10030893 | 3300025972 | Bacteria | 3523 |
| 490 | Ga0207668_10372625 | 3300025972 | Bacteria | 1199 |
| 491 | Ga0207668_10498091 | 3300025972 | Bacteria | 1047 |
| 492 | Ga0207668_10631885 | 3300025972 | Bacteria | 935 |
| 493 | Ga0207668_10725470 | 3300025972 | Bacteria | 875 |
| 494 | Ga0207640_10612021 | 3300025981 | Bacteria | 923 |
| 495 | Ga0207640_10708859 | 3300025981 | Bacteria | 864 |
| 496 | Ga0207658_10275079 | 3300025986 | Bacteria | 1441 |
| 497 | Ga0207677_10224824 | 3300026023 | Bacteria | 1508 |
| 498 | Ga0207677_10254788 | 3300026023 | Bacteria | 1427 |
| 499 | Ga0207677_11588859 | 3300026023 | Bacteria | 605 |
| 500 | Ga0207703_10072010 | 3300026035 | Bacteria | 2856 |
| 501 | Ga0207703_10161146 | 3300026035 | Bacteria | 1965 |
| 502 | Ga0207703_10331593 | 3300026035 | Bacteria | 1396 |
| 503 | Ga0207639_10161107 | 3300026041 | Bacteria | 1891 |
| 504 | Ga0207678_10013802 | 3300026067 | Bacteria | 7098 |
| 505 | Ga0207678_10016384 | 3300026067 | Bacteria | 6508 |
| 506 | Ga0207678_10058708 | 3300026067 | Bacteria | 3310 |
| 507 | Ga0207678_10067068 | 3300026067 | Bacteria | 3080 |
| 508 | Ga0207678_10089215 | 3300026067 | Bacteria | 2635 |
| 509 | Ga0207678_10232622 | 3300026067 | Bacteria | 1578 |
| 510 | Ga0207678_10480488 | 3300026067 | Bacteria | 1082 |
| 511 | Ga0207678_10987030 | 3300026067 | Bacteria | 745 |
| 512 | Ga0207708_10244927 | 3300026075 | Bacteria | 1443 |
| 513 | Ga0207708_10458128 | 3300026075 | Bacteria | 1063 |
| 514 | Ga0207702_11127863 | 3300026078 | Bacteria | 778 |
| 515 | Ga0207702_11197838 | 3300026078 | Bacteria | 754 |
| 516 | Ga0207702_11738654 | 3300026078 | Bacteria | 616 |
| 517 | Ga0207641_10106255 | 3300026088 | Bacteria | 2481 |
| 518 | Ga0207648_10126701 | 3300026089 | Bacteria | 2246 |
| 519 | Ga0207648_10564642 | 3300026089 | Bacteria | 1046 |
| 520 | Ga0207676_10109436 | 3300026095 | Bacteria | 2309 |
| 521 | Ga0207676_10712042 | 3300026095 | Bacteria | 974 |
| 522 | Ga0207676_11782026 | 3300026095 | Bacteria | 614 |
| 523 | Ga0207674_10213494 | 3300026116 | Bacteria | 1878 |
| 524 | Ga0207674_10427480 | 3300026116 | Bacteria | 1280 |
| 525 | Ga0207674_11502755 | 3300026116 | Bacteria | 643 |
| 526 | Ga0207675_100056996 | 3300026118 | Bacteria | 3645 |
| 527 | Ga0207675_100280601 | 3300026118 | Bacteria | 1619 |
| 528 | Ga0207683_10122121 | 3300026121 | Bacteria | 2339 |
| 529 | Ga0207683_10175687 | 3300026121 | Bacteria | 1941 |
| 530 | Ga0207683_10183642 | 3300026121 | Bacteria | 1897 |
| 531 | Ga0207683_10227290 | 3300026121 | Bacteria | 1701 |
| 532 | Ga0207683_10439855 | 3300026121 | Bacteria | 1202 |
| 533 | Ga0207683_10654423 | 3300026121 | Bacteria | 973 |
| 534 | Ga0207698_10063172 | 3300026142 | Bacteria | 2896 |
| 535 | Ga0207698_10355488 | 3300026142 | Bacteria | 1385 |
| 536 | Ga0209389_1000008 | 3300027296 | Bacteria | 227385 |
| 537 | Ga0209389_1000121 | 3300027296 | Bacteria | 70490 |
| 538 | Ga0209589_1002735 | 3300027357 | Bacteria | 30739 |
| 539 | Ga0209489_103445 | 3300027361 | Bacteria | 30849 |
| 540 | Ga0209489_108921 | 3300027361 | Bacteria | 13078 |
| 541 | Ga0209179_1007263 | 3300027512 | Bacteria | 1823 |
| 542 | Ga0209179_1070409 | 3300027512 | Bacteria | 766 |
| 543 | Ga0209588_1138592 | 3300027671 | Bacteria | 774 |
| 544 | Ga0209588_1216911 | 3300027671 | Bacteria | 592 |
| 545 | Ga0268266_10002224 | 3300028379 | Bacteria | 21181 |
| 546 | Ga0268266_10052951 | 3300028379 | Bacteria | 3486 |
| 547 | Ga0268266_10139753 | 3300028379 | Bacteria | 2173 |
| 548 | Ga0268266_10257040 | 3300028379 | Bacteria | 1617 |
| 549 | Ga0268266_10386215 | 3300028379 | Bacteria | 1321 |
| 550 | Ga0268266_10513966 | 3300028379 | Bacteria | 1144 |
| 551 | Ga0268266_10603548 | 3300028379 | Bacteria | 1054 |
| 552 | Ga0268266_11019194 | 3300028379 | Bacteria | 801 |
| 553 | Ga0268266_11050413 | 3300028379 | Bacteria | 788 |
| 554 | Ga0268266_11441573 | 3300028379 | Bacteria | 664 |
| 555 | Ga0268266_12368435 | 3300028379 | Bacteria | 502 |
| 556 | Ga0268265_10124749 | 3300028380 | Bacteria | 2128 |
| 557 | Ga0268265_10471195 | 3300028380 | Bacteria | 1177 |
| 558 | Ga0268265_10624895 | 3300028380 | Bacteria | 1032 |
| 559 | Ga0268265_11801547 | 3300028380 | Bacteria | 618 |
| 560 | Ga0268264_10000185 | 3300028381 | Bacteria | 131374 |
| 561 | Ga0268264_10370321 | 3300028381 | Bacteria | 1369 |
| 562 | Ga0307515_10225691 | 3300028794 | Bacteria | 1679 |
| 563 | Ga0307515_10493440 | 3300028794 | Bacteria | 836 |
| 564 | Ga0265338_10274306 | 3300028800 | Bacteria | 1235 |
| 565 | Ga0265339_10008628 | 3300031249 | Bacteria | 6470 |
| 566 | Ga0307509_10004249 | 3300031507 | Bacteria | 20876 |
| 567 | Ga0307508_10015749 | 3300031616 | Bacteria | 6891 |
| 568 | Ga0307508_10029469 | 3300031616 | Bacteria | 4961 |
| 569 | Ga0307508_10279775 | 3300031616 | Bacteria | 1262 |
| 570 | Ga0265314_10083597 | 3300031711 | Bacteria | 2098 |
| 571 | Ga0265314_10085444 | 3300031711 | Bacteria | 2068 |
| 572 | Ga0265342_10007736 | 3300031712 | Bacteria | 7825 |
| 573 | Ga0307516_10145109 | 3300031730 | Bacteria | 2139 |
| 574 | Ga0307516_10275546 | 3300031730 | Bacteria | 1366 |
| 575 | Ga0307516_10542889 | 3300031730 | Bacteria | 816 |
| 576 | Ga0307518_10433115 | 3300031838 | Bacteria | 714 |
| 577 | Ga0307409_101517604 | 3300031995 | Bacteria | 698 |
| 578 | Ga0307414_11565880 | 3300032004 | Bacteria | 614 |
| 579 | Ga0307411_11304611 | 3300032005 | Bacteria | 661 |
| 580 | Ga0307507_10005195 | 3300033179 | Bacteria | 21749 |
| 581 | Ga0307510_10035891 | 3300033180 | Bacteria | 5527 |
| 582 | Ga0307510_10122842 | 3300033180 | Bacteria | 2295 |
| 583 | Ga0373926_0033177 | 3300035083 | Bacteria | 1824 |
| 584 | Ga0373934_0014244 | 3300035086 | Bacteria | 3013 |
| 585 | Ga0373923_0031733 | 3300035111 | Bacteria | 2131 |
| 586 | Ga0373923_0085647 | 3300035111 | Bacteria | 1372 |
| 587 | Ga0373936_0106474 | 3300035113 | Bacteria | 1187 |
| 588 | Ga0373936_0122315 | 3300035113 | Bacteria | 1113 |
| 589 | Ga0373936_0172676 | 3300035113 | Bacteria | 945 |
| 590 | Ga0373936_0209172 | 3300035113 | Bacteria | 863 |
| 591 | Ga0373945_0005241 | 3300035116 | Bacteria | 4145 |
| 592 | Ga0373953_0002113 | 3300035117 | Bacteria | 5935 |
| 593 | Ga0373953_0003587 | 3300035117 | Bacteria | 4854 |
| 594 | Ga0373953_0186763 | 3300035117 | Bacteria | 895 |
| 595 | Ga0373953_0347058 | 3300035117 | Bacteria | 650 |
| 596 | Ga0373954_0005008 | 3300035118 | Bacteria | 5720 |
| 597 | Ga0373954_0005085 | 3300035118 | Bacteria | 5673 |
| 598 | Ga0373954_0009691 | 3300035118 | Bacteria | 4240 |
| 599 | Ga0373956_0001696 | 3300035119 | Bacteria | 9086 |
| 600 | Ga0373956_0039561 | 3300035119 | Bacteria | 2090 |
| 601 | Ga0373957_0006803 | 3300035120 | Bacteria | 3622 |
| 602 | Ga0373957_0114970 | 3300035120 | Bacteria | 1086 |
| 603 | Ga0373957_0120878 | 3300035120 | Bacteria | 1060 |
| 604 | Ga0373943_0155773 | 3300035170 | Bacteria | 1240 |
| 605 | Ga0373943_0221746 | 3300035170 | Bacteria | 1053 |
| 606 | Ga0373955_0000654 | 3300035172 | Bacteria | 14784 |
| 607 | Ga0373955_0001917 | 3300035172 | Bacteria | 8980 |
| 608 | Ga0373955_0016162 | 3300035172 | Bacteria | 3669 |
| 609 | Ga0373955_0364492 | 3300035172 | Bacteria | 876 |
| 610 | Ga0373924_0001605 | 3300035410 | Bacteria | 7413 |
| 611 | Ga0373924_0013613 | 3300035410 | Bacteria | 3058 |
| 612 | Ga0373924_0043558 | 3300035410 | Bacteria | 1843 |
| 613 | Ga0373935_0010545 | 3300035692 | Bacteria | 5544 |
| 614 | Ga0373935_0032760 | 3300035692 | Bacteria | 3230 |
| 615 | Ga0373935_0034676 | 3300035692 | Bacteria | 3147 |
| 616 | Ga0373935_0450317 | 3300035692 | Bacteria | 930 |
| 617 | Ga0373927_0018507 | 3300035695 | Bacteria | 4577 |
| 618 | Ga0373927_0028939 | 3300035695 | Bacteria | 3613 |
| 619 | Ga0373927_0079859 | 3300035695 | Bacteria | 2119 |
| 620 | Ga0373933_0001815 | 3300035724 | Bacteria | 12375 |
| 621 | Ga0373933_0007396 | 3300035724 | Bacteria | 5989 |
| 622 | Ga0373933_0089651 | 3300035724 | Bacteria | 1896 |
| 623 | Ga0373947_0007178 | 3300035725 | Bacteria | 6458 |
| 624 | Ga0373947_0153153 | 3300035725 | Bacteria | 1486 |
| 625 | Ga0373937_0009279 | 3300036401 | Bacteria | 8541 |
| 626 | Ga0373937_0123998 | 3300036401 | Bacteria | 2409 |
| 627 | Ga0373937_0608111 | 3300036401 | Bacteria | 1038 |
| 628 | Ga0373937_0968470 | 3300036401 | Bacteria | 799 |
| 629 | Ga0373937_1565503 | 3300036401 | Bacteria | 606 |
| 630 | Ga0373925_0006804 | 3300037068 | Bacteria | 8373 |
| 631 | Ga0373925_0036806 | 3300037068 | Bacteria | 3611 |
| 632 | Ga0373925_0156327 | 3300037068 | Bacteria | 1794 |
| 633 | Ga0373925_0770609 | 3300037068 | Bacteria | 793 |
| 634 | Ga0373925_1412806 | 3300037068 | Bacteria | 570 |
| 635 | Ga0395899_0016993 | 3300037312 | Bacteria | 5545 |
| 636 | Ga0395900_0000361 | 3300037418 | Bacteria | 65918 |
| 637 | Ga0395900_0525255 | 3300037418 | Bacteria | 1131 |
| 638 | Ga0395905_0127300 | 3300037471 | Bacteria | 2395 |
| 639 | Ga0395905_0152640 | 3300037471 | Bacteria | 2173 |
| 640 | Ga0395905_0217899 | 3300037471 | Bacteria | 1787 |
| 641 | Ga0395905_0901021 | 3300037471 | Bacteria | 787 |
| 642 | Ga0395901_0320644 | 3300038443 | Bacteria | 1603 |
| 643 | Ga0395901_0582442 | 3300038443 | Bacteria | 1130 |
| 644 | Ga0395901_0624625 | 3300038443 | Bacteria | 1084 |
| 645 | Ga0436365_1146796 | 3300039437 | Bacteria | 1452 |
| 646 | Ga0436365_1716705 | 3300039437 | Bacteria | 4808 |
| 647 | Ga0436360_0420359 | 3300039438 | Bacteria | 2244 |
| 648 | Ga0436361_0051433 | 3300039447 | Bacteria | 883 |
| 649 | Ga0436363_0234286 | 3300039450 | Bacteria | 1433 |
| 650 | Ga0436362_0373664 | 3300039453 | Bacteria | 694 |
| 651 | Ga0436362_0439870 | 3300039453 | Bacteria | 2660 |
| 652 | Ga0451789_0382349 | 3300041443 | Bacteria | 1331 |
| 653 | Ga0451789_0487446 | 3300041443 | Bacteria | 529 |
| 654 | Ga0451807_1616728 | 3300041486 | Bacteria | 1406 |
| 655 | Ga0451807_2559663 | 3300041486 | Bacteria | 568 |
| 656 | Ga0451833_0292474 | 3300041491 | Bacteria | 503 |
| 657 | Ga0451841_1457417 | 3300041498 | Bacteria | 895 |
| 658 | Ga0451853_3923295 | 3300041512 | Bacteria | 504 |
| 659 | Ga0450905_106040 | 3300042142 | Bacteria | 508 |
| 660 | Ga0466972_0004782 | 3300044658 | Bacteria | 6785 |
| 661 | Ga0466965_0051814 | 3300044683 | Bacteria | 2037 |
| 662 | Ga0466965_0295951 | 3300044683 | Bacteria | 877 |
| 663 | Ga0466963_0150967 | 3300044694 | Bacteria | 1613 |
| 664 | Ga0466968_0006041 | 3300044735 | Bacteria | 4546 |
| 665 | Ga0466968_0139862 | 3300044735 | Bacteria | 1107 |
| 666 | Ga0466960_0030663 | 3300044901 | Bacteria | 2476 |
| 667 | Ga0466960_0391756 | 3300044901 | Bacteria | 799 |
| 668 | Ga0466959_0056697 | 3300045049 | Bacteria | 2858 |
| 669 | Ga0466967_0106052 | 3300045976 | Bacteria | 2575 |
| 670 | Ga0466967_0128481 | 3300045976 | Bacteria | 2350 |
| 671 | Ga0466967_2493582 | 3300045976 | Bacteria | 512 |
| 672 | Ga0495592_0004099 | 3300046454 | Bacteria | 10596 |
| 673 | Ga0495592_0004904 | 3300046454 | Bacteria | 9849 |
| 674 | Ga0495592_0042264 | 3300046454 | Bacteria | 3414 |
| 675 | Ga0495592_0092975 | 3300046454 | Bacteria | 2161 |
| 676 | Ga0495592_0398631 | 3300046454 | Bacteria | 872 |
| 677 | Ga0495603_0438745 | 3300046455 | Bacteria | 748 |
| 678 | Ga0495629_0002829 | 3300046459 | Bacteria | 13259 |
| 679 | Ga0495629_0003943 | 3300046459 | Bacteria | 11161 |
| 680 | Ga0495638_0036102 | 3300046460 | Bacteria | 3149 |
| 681 | Ga0495638_0188969 | 3300046460 | Bacteria | 1170 |
| 682 | Ga0495651_0014893 | 3300046462 | Bacteria | 6012 |
| 683 | Ga0495651_0045237 | 3300046462 | Bacteria | 3410 |
| 684 | Ga0495651_0061893 | 3300046462 | Bacteria | 2864 |
| 685 | Ga0495651_0373216 | 3300046462 | Bacteria | 937 |
| 686 | Ga0495653_0054219 | 3300046463 | Bacteria | 3064 |
| 687 | Ga0495653_0120438 | 3300046463 | Bacteria | 1871 |
| 688 | Ga0495653_0316077 | 3300046463 | Bacteria | 1014 |
| 689 | Ga0495650_0286449 | 3300046471 | Bacteria | 554 |
| 690 | Ga0495582_0044946 | 3300046473 | Bacteria | 2432 |
| 691 | Ga0495639_0010400 | 3300046475 | Bacteria | 4007 |
| 692 | Ga0495662_0135393 | 3300046476 | Bacteria | 1212 |
| 693 | Ga0495664_0009901 | 3300046477 | Bacteria | 5348 |
| 694 | Ga0495664_0024884 | 3300046477 | Bacteria | 3482 |
| 695 | Ga0495664_0042170 | 3300046477 | Bacteria | 2702 |
| 696 | Ga0495664_0904159 | 3300046477 | Bacteria | 516 |
| 697 | Ga0495584_0257724 | 3300046491 | Bacteria | 887 |
| 698 | Ga0495584_0262518 | 3300046491 | Bacteria | 878 |
| 699 | Ga0495584_0375987 | 3300046491 | Bacteria | 722 |
| 700 | Ga0495607_0012688 | 3300046501 | Bacteria | 5550 |
| 701 | Ga0495583_0179494 | 3300046506 | Bacteria | 867 |
| 702 | Ga0495583_0184866 | 3300046506 | Bacteria | 852 |
| 703 | Ga0495606_0028417 | 3300046507 | Bacteria | 3946 |
| 704 | Ga0495608_0009394 | 3300046511 | Bacteria | 6837 |
| 705 | Ga0495608_0036761 | 3300046511 | Bacteria | 3295 |
| 706 | Ga0495608_0058675 | 3300046511 | Bacteria | 2537 |
| 707 | Ga0495608_0683821 | 3300046511 | Bacteria | 611 |
| 708 | Ga0495610_0370755 | 3300046512 | Bacteria | 534 |
| 709 | Ga0495616_0152525 | 3300046513 | Bacteria | 1044 |
| 710 | Ga0495618_0018145 | 3300046514 | Bacteria | 4319 |
| 711 | Ga0495618_0064513 | 3300046514 | Bacteria | 2327 |
| 712 | Ga0495618_0274739 | 3300046514 | Bacteria | 1052 |
| 713 | Ga0495620_0013635 | 3300046515 | Bacteria | 4156 |
| 714 | Ga0495620_0179984 | 3300046515 | Bacteria | 818 |
| 715 | Ga0495628_0025979 | 3300046516 | Bacteria | 4781 |
| 716 | Ga0495628_0083128 | 3300046516 | Bacteria | 2486 |
| 717 | Ga0495630_0101653 | 3300046517 | Bacteria | 2175 |
| 718 | Ga0495630_0147529 | 3300046517 | Bacteria | 1789 |
| 719 | Ga0495630_0321072 | 3300046517 | Bacteria | 1184 |
| 720 | Ga0495630_0472982 | 3300046517 | Bacteria | 961 |
| 721 | Ga0495630_0508298 | 3300046517 | Bacteria | 924 |
| 722 | Ga0495631_0031182 | 3300046518 | Bacteria | 2414 |
| 723 | Ga0495637_0272737 | 3300046520 | Bacteria | 605 |
| 724 | Ga0495643_0042298 | 3300046522 | Bacteria | 2482 |
| 725 | Ga0495643_0165258 | 3300046522 | Bacteria | 1086 |
| 726 | Ga0495643_0233447 | 3300046522 | Bacteria | 866 |
| 727 | Ga0495643_0468242 | 3300046522 | Bacteria | 546 |
| 728 | Ga0495648_0052162 | 3300046524 | Bacteria | 2486 |
| 729 | Ga0495648_0254745 | 3300046524 | Bacteria | 845 |
| 730 | Ga0495666_0234605 | 3300046526 | Bacteria | 838 |
| 731 | Ga0495642_0501820 | 3300046528 | Bacteria | 537 |
| 732 | Ga0495652_0007665 | 3300046529 | Bacteria | 9941 |
| 733 | Ga0495652_0014289 | 3300046529 | Bacteria | 7130 |
| 734 | Ga0495652_0059728 | 3300046529 | Bacteria | 3225 |
| 735 | Ga0495652_0362537 | 3300046529 | Bacteria | 1035 |
| 736 | Ga0495652_0622364 | 3300046529 | Bacteria | 734 |
| 737 | Ga0495654_0003707 | 3300046530 | Bacteria | 9272 |
| 738 | Ga0495654_0163143 | 3300046530 | Bacteria | 977 |
| 739 | Ga0495665_0031748 | 3300046531 | Bacteria | 2826 |
| 740 | Ga0495640_0019557 | 3300046533 | Bacteria | 4995 |
| 741 | Ga0495640_0027019 | 3300046533 | Bacteria | 4143 |
| 742 | Ga0495640_0033150 | 3300046533 | Bacteria | 3671 |
| 743 | Ga0495640_0101686 | 3300046533 | Bacteria | 1886 |
| 744 | Ga0495640_0407900 | 3300046533 | Bacteria | 833 |
| 745 | Ga0495586_0277416 | 3300046535 | Bacteria | 959 |
| 746 | Ga0495587_0015651 | 3300046536 | Bacteria | 4731 |
| 747 | Ga0495587_0029595 | 3300046536 | Bacteria | 3324 |
| 748 | Ga0495587_0046610 | 3300046536 | Bacteria | 2572 |
| 749 | Ga0495587_0152951 | 3300046536 | Bacteria | 1315 |
| 750 | Ga0495609_0354632 | 3300046538 | Bacteria | 591 |
| 751 | Ga0495621_0130457 | 3300046539 | Bacteria | 977 |
| 752 | Ga0495645_0004447 | 3300046543 | Bacteria | 9568 |
| 753 | Ga0495645_0012169 | 3300046543 | Bacteria | 6059 |
| 754 | Ga0495645_0723136 | 3300046543 | Bacteria | 603 |
| 755 | Ga0495622_0018402 | 3300046557 | Bacteria | 3253 |
| 756 | Ga0495622_0021843 | 3300046557 | Bacteria | 2981 |
| 757 | Ga0495622_0028791 | 3300046557 | Bacteria | 2595 |
| 758 | Ga0495622_0097730 | 3300046557 | Bacteria | 1347 |
| 759 | Ga0495667_0008508 | 3300046559 | Bacteria | 6965 |
| 760 | Ga0495667_0029608 | 3300046559 | Bacteria | 3685 |
| 761 | Ga0495667_0072740 | 3300046559 | Bacteria | 2240 |
| 762 | Ga0495667_0209255 | 3300046559 | Bacteria | 1247 |
| 763 | Ga0495656_0011388 | 3300046615 | Bacteria | 3264 |
| 764 | Ga0495656_0312677 | 3300046615 | Bacteria | 807 |
| 765 | Ga0495656_0406056 | 3300046615 | Bacteria | 713 |
| 766 | Ga0495668_0123568 | 3300046616 | Bacteria | 1416 |
| 767 | Ga0495668_0146713 | 3300046616 | Bacteria | 1292 |
| 768 | Ga0495668_0224708 | 3300046616 | Bacteria | 1028 |
| 769 | Ga0495634_0012048 | 3300046642 | Bacteria | 6269 |
| 770 | Ga0495634_0014729 | 3300046642 | Bacteria | 5628 |
| 771 | Ga0495611_0055070 | 3300046648 | Bacteria | 1799 |
| 772 | Ga0495625_0061291 | 3300046660 | Bacteria | 2662 |
| 773 | Ga0495625_0418917 | 3300046660 | Bacteria | 833 |
| 774 | Ga0495635_0001593 | 3300046663 | Bacteria | 15272 |
| 775 | Ga0495635_0004356 | 3300046663 | Bacteria | 9798 |
| 776 | Ga0495635_0017629 | 3300046663 | Bacteria | 4987 |
| 777 | Ga0495635_0057029 | 3300046663 | Bacteria | 2688 |
| 778 | Ga0495659_0378675 | 3300046664 | Bacteria | 608 |
| 779 | Ga0495588_0183773 | 3300046674 | Bacteria | 1105 |
| 780 | Ga0495588_0339262 | 3300046674 | Bacteria | 790 |
| 781 | Ga0495657_0005903 | 3300046675 | Bacteria | 9622 |
| 782 | Ga0495657_0017156 | 3300046675 | Bacteria | 5261 |
| 783 | Ga0495657_0053555 | 3300046675 | Bacteria | 2699 |
| 784 | Ga0495657_0100112 | 3300046675 | Bacteria | 1847 |
| 785 | Ga0495599_0003578 | 3300046678 | Bacteria | 9109 |
| 786 | Ga0495599_0007978 | 3300046678 | Bacteria | 6423 |
| 787 | Ga0495599_0045761 | 3300046678 | Bacteria | 2744 |
| 788 | Ga0495599_0218843 | 3300046678 | Bacteria | 1166 |
| 789 | Ga0495623_0014466 | 3300046679 | Bacteria | 5106 |
| 790 | Ga0495623_0019902 | 3300046679 | Bacteria | 4339 |
| 791 | Ga0495623_0033232 | 3300046679 | Bacteria | 3310 |
| 792 | Ga0495623_0177519 | 3300046679 | Bacteria | 1240 |
| 793 | Ga0495646_0002355 | 3300046680 | Bacteria | 11571 |
| 794 | Ga0495646_0019861 | 3300046680 | Bacteria | 4249 |
| 795 | Ga0495646_0022475 | 3300046680 | Bacteria | 3979 |
| 796 | Ga0495647_0226105 | 3300046681 | Bacteria | 827 |
| 797 | Ga0495658_0250499 | 3300046683 | Bacteria | 1114 |
| 798 | Ga0495669_0166830 | 3300046684 | Bacteria | 1046 |
| 799 | Ga0495669_0372153 | 3300046684 | Bacteria | 691 |
| 800 | Ga0495613_0023828 | 3300046689 | Bacteria | 4561 |
| 801 | Ga0495613_0047589 | 3300046689 | Bacteria | 3168 |
| 802 | Ga0495624_0023114 | 3300046690 | Bacteria | 4102 |
| 803 | Ga0495624_0047452 | 3300046690 | Bacteria | 2729 |
| 804 | Ga0495624_0205745 | 3300046690 | Bacteria | 1195 |
| 805 | Ga0495624_0696746 | 3300046690 | Bacteria | 603 |
| 806 | Ga0495670_0013251 | 3300046691 | Bacteria | 4055 |
| 807 | Ga0495670_0447970 | 3300046691 | Bacteria | 699 |
| 808 | Ga0495670_0784625 | 3300046691 | Bacteria | 520 |
| 809 | Ga0495671_0292761 | 3300046692 | Bacteria | 783 |
| 810 | Ga0495671_0362376 | 3300046692 | Bacteria | 695 |
| 811 | Ga0495671_0437897 | 3300046692 | Bacteria | 625 |
| 812 | Ga0495649_0039388 | 3300046694 | Bacteria | 2591 |
| 813 | Ga0495649_0141799 | 3300046694 | Bacteria | 1265 |
| 814 | Ga0495649_0433860 | 3300046694 | Bacteria | 657 |
| 815 | Ga0495600_0004104 | 3300046809 | Bacteria | 8664 |
| 816 | Ga0495600_0007598 | 3300046809 | Bacteria | 6640 |
| 817 | Ga0495600_0010963 | 3300046809 | Bacteria | 5639 |
| 818 | Ga0495660_0164086 | 3300046810 | Bacteria | 1087 |
| 819 | Ga0495660_0262527 | 3300046810 | Bacteria | 797 |
| 820 | Ga0495581_0012239 | 3300047315 | Bacteria | 4969 |
| 821 | Ga0495581_0087214 | 3300047315 | Bacteria | 1809 |
| 822 | Ga0495581_0197835 | 3300047315 | Bacteria | 1176 |
| 823 | Ga0495604_0007639 | 3300047317 | Bacteria | 8562 |
| 824 | Ga0495604_0011675 | 3300047317 | Bacteria | 6985 |
| 825 | Ga0495604_0041114 | 3300047317 | Bacteria | 3626 |
| 826 | Ga0495604_0049040 | 3300047317 | Bacteria | 3282 |
| 827 | Ga0495674_0052222 | 3300047319 | Bacteria | 3598 |
| 828 | Ga0495674_0760262 | 3300047319 | Bacteria | 756 |
| 829 | Ga0495672_0010334 | 3300047320 | Bacteria | 6664 |
| 830 | Ga0495672_0025612 | 3300047320 | Bacteria | 3771 |
| 831 | Ga0495672_0181881 | 3300047320 | Bacteria | 1064 |
| 832 | Ga0495676_0025669 | 3300047321 | Bacteria | 5084 |
| 833 | Ga0495680_0017276 | 3300047322 | Bacteria | 6164 |
| 834 | Ga0495680_0021605 | 3300047322 | Bacteria | 5385 |
| 835 | Ga0495680_0022137 | 3300047322 | Bacteria | 5306 |
| 836 | Ga0495680_0806161 | 3300047322 | Bacteria | 613 |
| 837 | Ga0495683_0194879 | 3300047323 | Bacteria | 917 |
| 838 | Ga0495675_0002949 | 3300047444 | Bacteria | 10219 |
| 839 | Ga0495675_0016494 | 3300047444 | Bacteria | 4672 |
| 840 | Ga0495677_0089100 | 3300047445 | Bacteria | 1162 |
| 841 | Ga0495673_0068536 | 3300047469 | Bacteria | 1499 |
| 842 | Ga0495673_0184252 | 3300047469 | Bacteria | 789 |
| 843 | Ga0495673_0264715 | 3300047469 | Bacteria | 624 |
| 844 | Ga0495684_0002455 | 3300047471 | Bacteria | 14793 |
| 845 | Ga0495684_0022863 | 3300047471 | Bacteria | 4809 |
| 846 | Ga0495686_0018484 | 3300047472 | Bacteria | 4675 |
| 847 | Ga0495686_0047566 | 3300047472 | Bacteria | 2708 |
| 848 | Ga0495686_0143251 | 3300047472 | Bacteria | 1409 |
| 849 | Ga0495686_0153619 | 3300047472 | Bacteria | 1350 |
| 850 | Ga0495686_0172030 | 3300047472 | Bacteria | 1259 |
| 851 | Ga0495686_0410331 | 3300047472 | Bacteria | 725 |
| 852 | Ga0495593_0015060 | 3300047673 | Bacteria | 4393 |
| 853 | Ga0495593_0015312 | 3300047673 | Bacteria | 4346 |
| 854 | Ga0495593_0021021 | 3300047673 | Bacteria | 3649 |
| 855 | Ga0495593_0266740 | 3300047673 | Bacteria | 857 |
| 856 | Ga0495602_0020088 | 3300048088 | Bacteria | 6607 |
| 857 | Ga0495602_0130045 | 3300048088 | Bacteria | 2009 |
| 858 | Ga0495602_0179814 | 3300048088 | Bacteria | 1633 |
| 859 | Ga0495602_0391038 | 3300048088 | Bacteria | 994 |
| 860 | Ga0495614_0073888 | 3300048089 | Bacteria | 1472 |
| 861 | Ga0495626_0310434 | 3300048091 | Bacteria | 622 |
| 862 | Ga0495626_0326718 | 3300048091 | Bacteria | 602 |
| 863 | Ga0496100_0138598 | 3300048903 | Bacteria | 1721 |
| 864 | Ga0496100_0275646 | 3300048903 | Bacteria | 1252 |
| 865 | Ga0496101_0736192 | 3300048904 | Bacteria | 778 |
| 866 | Ga0496101_0888107 | 3300048904 | Bacteria | 702 |
| 867 | Ga0496102_0063011 | 3300048905 | Bacteria | 3395 |
| 868 | Ga0496102_0106121 | 3300048905 | Bacteria | 2614 |
| 869 | Ga0496102_0294186 | 3300048905 | Bacteria | 1530 |
| 870 | Ga0496102_0685502 | 3300048905 | Bacteria | 948 |
| 871 | Ga0496103_0386385 | 3300048906 | Bacteria | 899 |
| 872 | Ga0496104_0010283 | 3300048907 | Bacteria | 8355 |
| 873 | Ga0496104_0126851 | 3300048907 | Bacteria | 2450 |
| 874 | Ga0496104_0247603 | 3300048907 | Bacteria | 1695 |
| 875 | Ga0496104_0828957 | 3300048907 | Bacteria | 831 |
| 876 | Ga0496105_0000723 | 3300048908 | Bacteria | 22379 |
| 877 | Ga0496105_0241392 | 3300048908 | Bacteria | 1466 |
| 878 | Ga0496106_0036778 | 3300048909 | Bacteria | 3662 |
| 879 | Ga0496106_0171772 | 3300048909 | Bacteria | 1718 |
| 880 | Ga0496106_0174272 | 3300048909 | Bacteria | 1706 |
| 881 | Ga0496106_0185464 | 3300048909 | Bacteria | 1653 |
| 882 | Ga0496106_0216847 | 3300048909 | Bacteria | 1525 |
| 883 | Ga0496106_0231862 | 3300048909 | Bacteria | 1474 |
| 884 | Ga0496107_0061146 | 3300048910 | Bacteria | 2727 |
| 885 | Ga0496107_0585362 | 3300048910 | Bacteria | 825 |
| 886 | Ga0496108_0087488 | 3300048911 | Bacteria | 2646 |
| 887 | Ga0496108_0113908 | 3300048911 | Bacteria | 2315 |
| 888 | Ga0496108_0175718 | 3300048911 | Bacteria | 1854 |
| 889 | Ga0496109_0034528 | 3300048912 | Bacteria | 4556 |
| 890 | Ga0496109_0235133 | 3300048912 | Bacteria | 1724 |
| 891 | Ga0496109_0728883 | 3300048912 | Bacteria | 929 |
| 892 | Ga0496110_0020924 | 3300048913 | Bacteria | 5527 |
| 893 | Ga0496110_0391225 | 3300048913 | Bacteria | 1267 |
| 894 | Ga0496110_0903848 | 3300048913 | Bacteria | 789 |
| 895 | Ga0496112_0027002 | 3300048915 | Bacteria | 5534 |
| 896 | Ga0496112_0425918 | 3300048915 | Bacteria | 1266 |
| 897 | Ga0496113_0374943 | 3300048916 | Bacteria | 1142 |
| 898 | Ga0496113_0439727 | 3300048916 | Bacteria | 1048 |
| 899 | Ga0496114_0110369 | 3300048917 | Bacteria | 2356 |
| 900 | Ga0496114_0149160 | 3300048917 | Bacteria | 2028 |
| 901 | Ga0496114_0469677 | 3300048917 | Bacteria | 1113 |
| 902 | Ga0496114_1277349 | 3300048917 | Bacteria | 621 |
| 903 | Ga0496115_0026931 | 3300048918 | Bacteria | 4493 |
| 904 | Ga0496115_0098359 | 3300048918 | Bacteria | 2396 |
| 905 | Ga0496115_0134415 | 3300048918 | Bacteria | 2039 |
| 906 | Ga0496115_0493690 | 3300048918 | Bacteria | 985 |
| 907 | Ga0496115_1135447 | 3300048918 | Bacteria | 590 |
| 908 | Ga0496115_1246605 | 3300048918 | Bacteria | 556 |
| 909 | Ga0496116_0004734 | 3300048919 | Bacteria | 12854 |
| 910 | Ga0496116_0187055 | 3300048919 | Bacteria | 1101 |
| 911 | Ga0496117_0004259 | 3300048920 | Bacteria | 15962 |
| 912 | Ga0496117_0095415 | 3300048920 | Bacteria | 1900 |
| 913 | Ga0496117_0152853 | 3300048920 | Bacteria | 1363 |
| 914 | Ga0496117_0179333 | 3300048920 | Bacteria | 1220 |
| 915 | Ga0496117_0308783 | 3300048920 | Bacteria | 834 |
| 916 | Ga0496118_0003088 | 3300048921 | Bacteria | 21359 |
| 917 | Ga0496118_0229661 | 3300048921 | Bacteria | 1072 |
| 918 | Ga0496118_0414948 | 3300048921 | Bacteria | 694 |
| 919 | Ga0496118_0491579 | 3300048921 | Bacteria | 612 |
| 920 | Ga0496119_0084401 | 3300048922 | Bacteria | 1821 |
| 921 | Ga0496120_0008406 | 3300048923 | Bacteria | 7493 |
| 922 | Ga0496120_0095868 | 3300048923 | Bacteria | 1576 |
| 923 | Ga0496120_0212702 | 3300048923 | Bacteria | 929 |
| 924 | Ga0496120_0493749 | 3300048923 | Bacteria | 527 |
| 925 | Ga0496121_0000125 | 3300048924 | Bacteria | 169274 |
| 926 | Ga0496121_0016621 | 3300048924 | Bacteria | 7582 |
| 927 | Ga0496121_0076072 | 3300048924 | Bacteria | 2678 |
| 928 | Ga0496121_0095409 | 3300048924 | Bacteria | 2311 |
| 929 | Ga0496121_0117679 | 3300048924 | Bacteria | 2013 |
| 930 | Ga0496121_0119342 | 3300048924 | Bacteria | 1994 |
| 931 | Ga0496121_0145305 | 3300048924 | Bacteria | 1753 |
| 932 | Ga0496121_0208757 | 3300048924 | Bacteria | 1385 |
| 933 | Ga0496121_0243736 | 3300048924 | Bacteria | 1251 |
| 934 | Ga0496121_0252348 | 3300048924 | Bacteria | 1222 |
| 935 | Ga0496121_0289581 | 3300048924 | Bacteria | 1116 |
| 936 | Ga0496121_0314016 | 3300048924 | Bacteria | 1058 |
| 937 | Ga0496121_0470456 | 3300048924 | Bacteria | 805 |
| 938 | Ga0496122_0039256 | 3300048925 | Bacteria | 3778 |
| 939 | Ga0496122_0073686 | 3300048925 | Bacteria | 2419 |
| 940 | Ga0496122_0089136 | 3300048925 | Bacteria | 2111 |
| 941 | Ga0496123_0016780 | 3300048926 | Bacteria | 5923 |
| 942 | Ga0496123_0151656 | 3300048926 | Bacteria | 1249 |
| 943 | Ga0496124_0010613 | 3300048927 | Bacteria | 9308 |
| 944 | Ga0496124_0082762 | 3300048927 | Bacteria | 2634 |
| 945 | Ga0496124_0084916 | 3300048927 | Bacteria | 2595 |
| 946 | Ga0496124_0201709 | 3300048927 | Bacteria | 1512 |
| 947 | Ga0496124_0216325 | 3300048927 | Bacteria | 1445 |
| 948 | Ga0496124_0348366 | 3300048927 | Bacteria | 1049 |
| 949 | Ga0496124_0378269 | 3300048927 | Bacteria | 991 |
| 950 | Ga0496125_0000576 | 3300048928 | Bacteria | 62844 |
| 951 | Ga0496125_0003556 | 3300048928 | Bacteria | 18769 |
| 952 | Ga0496125_0004044 | 3300048928 | Bacteria | 17188 |
| 953 | Ga0496125_0006115 | 3300048928 | Bacteria | 13131 |
| 954 | Ga0496125_0019582 | 3300048928 | Bacteria | 6377 |
| 955 | Ga0496125_0147225 | 3300048928 | Bacteria | 1625 |
| 956 | Ga0496125_0177747 | 3300048928 | Bacteria | 1422 |
| 957 | Ga0496125_0202652 | 3300048928 | Bacteria | 1297 |
| 958 | Ga0496126_0003482 | 3300048929 | Bacteria | 19864 |
| 959 | Ga0496126_0021101 | 3300048929 | Bacteria | 6369 |
| 960 | Ga0496126_0058272 | 3300048929 | Bacteria | 3482 |
| 961 | Ga0496126_0084458 | 3300048929 | Bacteria | 2800 |
| 962 | Ga0496126_0117484 | 3300048929 | Bacteria | 2310 |
| 963 | Ga0496126_0152106 | 3300048929 | Bacteria | 1982 |
| 964 | Ga0496126_0213502 | 3300048929 | Bacteria | 1623 |
| 965 | Ga0496126_0254709 | 3300048929 | Bacteria | 1461 |
| 966 | Ga0496126_0281491 | 3300048929 | Bacteria | 1377 |
| 967 | Ga0496126_0318254 | 3300048929 | Bacteria | 1280 |
| 968 | Ga0496126_0370003 | 3300048929 | Bacteria | 1169 |
| 969 | Ga0496126_0374307 | 3300048929 | Bacteria | 1161 |
| 970 | Ga0496126_0510245 | 3300048929 | Bacteria | 960 |
| 971 | Ga0496126_0683396 | 3300048929 | Bacteria | 799 |
| 972 | Ga0496126_0712165 | 3300048929 | Bacteria | 779 |
| 973 | Ga0496126_0718546 | 3300048929 | Bacteria | 774 |
| 974 | Ga0496126_1178167 | 3300048929 | Bacteria | 565 |
| 975 | Ga0501031_0005248 | 3300049568 | Bacteria | 8443 |
| 976 | Ga0501031_0070323 | 3300049568 | Bacteria | 2280 |
| 977 | Ga0501031_0884370 | 3300049568 | Bacteria | 572 |
| 978 | Ga0501032_0000030 | 3300049569 | Bacteria | 130405 |
| 979 | Ga0501033_0000060 | 3300049570 | Bacteria | 103159 |
| 980 | Ga0501033_0180436 | 3300049570 | Bacteria | 1513 |
| 981 | Ga0501034_0000117 | 3300049571 | Bacteria | 144865 |
| 982 | Ga0501034_0405086 | 3300049571 | Bacteria | 1286 |
| 983 | Ga0501034_0421400 | 3300049571 | Bacteria | 1256 |
| 984 | Ga0501034_0681412 | 3300049571 | Bacteria | 928 |
| 985 | Ga0501036_0000349 | 3300049572 | Bacteria | 32571 |
| 986 | Ga0501036_0135381 | 3300049572 | Bacteria | 2080 |
| 987 | Ga0501037_0000561 | 3300049573 | Bacteria | 29494 |
| 988 | Ga0501037_0051928 | 3300049573 | Bacteria | 2998 |
| 989 | Ga0501038_0000570 | 3300049574 | Bacteria | 32618 |
| 990 | Ga0501038_0106827 | 3300049574 | Bacteria | 2322 |
| 991 | Ga0501038_0960887 | 3300049574 | Bacteria | 629 |
| 992 | Ga0501039_0003520 | 3300049575 | Bacteria | 11726 |
| 993 | Ga0501039_0389670 | 3300049575 | Bacteria | 1094 |
| 994 | Ga0501040_0995952 | 3300049576 | Bacteria | 608 |
| 995 | Ga0501041_0508070 | 3300049577 | Bacteria | 767 |
| 996 | Ga0501042_0607144 | 3300049578 | Bacteria | 795 |
| 997 | Ga0501043_0000972 | 3300049579 | Bacteria | 25318 |
| 998 | Ga0501043_0025570 | 3300049579 | Bacteria | 4632 |
| 999 | Ga0501043_0214826 | 3300049579 | Bacteria | 1490 |
| 1000 | Ga0501046_0000214 | 3300049580 | Bacteria | 60379 |
| 1001 | Ga0501046_0218198 | 3300049580 | Bacteria | 1413 |
| 1002 | Ga0501047_0000246 | 3300049581 | Bacteria | 64361 |
| 1003 | Ga0501047_0434997 | 3300049581 | Bacteria | 1142 |
| 1004 | Ga0501048_0007131 | 3300049582 | Bacteria | 8491 |
| 1005 | Ga0501048_0317846 | 3300049582 | Bacteria | 1109 |
| 1006 | Ga0501067_0000398 | 3300049583 | Bacteria | 23734 |
| 1007 | Ga0501067_0021099 | 3300049583 | Bacteria | 3605 |
| 1008 | Ga0501067_0028749 | 3300049583 | Bacteria | 3081 |
| 1009 | Ga0501068_0001432 | 3300049584 | Bacteria | 12656 |
| 1010 | Ga0501068_0377014 | 3300049584 | Bacteria | 913 |
| 1011 | Ga0501069_0007157 | 3300049585 | Bacteria | 5849 |
| 1012 | Ga0501070_0373496 | 3300049586 | Bacteria | 1156 |
| 1013 | Ga0501071_0182245 | 3300049587 | Bacteria | 1574 |
| 1014 | Ga0501071_0527049 | 3300049587 | Bacteria | 907 |
| 1015 | Ga0501071_0935589 | 3300049587 | Bacteria | 669 |
| 1016 | Ga0501072_0006414 | 3300049588 | Bacteria | 8963 |
| 1017 | Ga0501073_0000203 | 3300049589 | Bacteria | 39315 |
| 1018 | Ga0501073_0450723 | 3300049589 | Bacteria | 889 |
| 1019 | Ga0501074_0000410 | 3300049590 | Bacteria | 25626 |
| 1020 | Ga0501074_0445567 | 3300049590 | Bacteria | 918 |
| 1021 | Ga0501076_0329381 | 3300049592 | Bacteria | 1253 |
| 1022 | Ga0501076_0586650 | 3300049592 | Bacteria | 919 |
| 1023 | Ga0501076_0945503 | 3300049592 | Bacteria | 710 |
| 1024 | Ga0501079_0009370 | 3300049741 | Bacteria | 7420 |
| 1025 | Ga0501079_1164711 | 3300049741 | Bacteria | 607 |
| 1026 | Ga0501080_0003578 | 3300049742 | Bacteria | 13678 |
| 1027 | Ga0501080_0256097 | 3300049742 | Bacteria | 1595 |
| 1028 | Ga0501081_1144058 | 3300049743 | Bacteria | 589 |
| 1029 | Ga0501081_1229650 | 3300049743 | Bacteria | 568 |
| 1030 | Ga0501083_0008773 | 3300049744 | Bacteria | 7134 |
| 1031 | Ga0501035_0000212 | 3300049822 | Bacteria | 69856 |
| 1032 | Ga0501035_0276363 | 3300049822 | Bacteria | 1420 |
| 1033 | Ga0501044_0001196 | 3300049823 | Bacteria | 30769 |
| 1034 | Ga0501044_0231507 | 3300049823 | Bacteria | 1795 |
| 1035 | Ga0501044_0311849 | 3300049823 | Bacteria | 1499 |
| 1036 | Ga0501044_1469526 | 3300049823 | Bacteria | 547 |
| 1037 | Ga0501045_0030829 | 3300049824 | Bacteria | 3882 |
| 1038 | Ga0501045_0368137 | 3300049824 | Bacteria | 1070 |
| 1039 | nmdc:mga03683_135432_c1 | 3300050489 | Bacteria | 1104 |
| 1040 | nmdc:mga03683_210903_c1 | 3300050489 | Bacteria | 894 |
| 1041 | nmdc:mga03n38_106575_c1 | 3300050490 | Bacteria | 1359 |
| 1042 | nmdc:mga03n38_128213_c1 | 3300050490 | Bacteria | 1254 |
| 1043 | nmdc:mga03n38_1553_c1 | 3300050490 | Bacteria | 6660 |
| 1044 | nmdc:mga00v17_107752_c1 | 3300050491 | Bacteria | 1765 |
| 1045 | nmdc:mga00v17_34577_c2 | 3300050491 | Bacteria | 1609 |
| 1046 | nmdc:mga00v17_73996_c1 | 3300050491 | Bacteria | 2116 |
| 1047 | nmdc:mga0yw44_166105_c1 | 3300050492 | Bacteria | 1447 |
| 1048 | nmdc:mga0yw44_16655_c1 | 3300050492 | Bacteria | 3978 |
| 1049 | nmdc:mga0yw44_38547_c1 | 3300050492 | Bacteria | 2829 |
| 1050 | nmdc:mga0yw44_39479_c1 | 3300050492 | Bacteria | 2800 |
| 1051 | nmdc:mga0yw44_485355_c1 | 3300050492 | Bacteria | 838 |
| 1052 | nmdc:mga0yw44_62329_c1 | 3300050492 | Bacteria | 2290 |
| 1053 | nmdc:mga0k408_303365_c1 | 3300050493 | Bacteria | 953 |
| 1054 | nmdc:mga0k408_304361_c1 | 3300050493 | Bacteria | 951 |
| 1055 | nmdc:mga0k408_51282_c2 | 3300050493 | Bacteria | 1535 |
| 1056 | nmdc:mga0k408_584712_c1 | 3300050493 | Bacteria | 659 |
| 1057 | nmdc:mga0k408_71835_c1 | 3300050493 | Bacteria | 2020 |
| 1058 | nmdc:mga0k408_88359_c1 | 3300050493 | Bacteria | 1820 |
| 1059 | nmdc:mga06z11_143684_c1 | 3300050494 | Bacteria | 1351 |
| 1060 | nmdc:mga06z11_46228_c1 | 3300050494 | Bacteria | 2205 |
| 1061 | nmdc:mga06z11_74470_c1 | 3300050494 | Bacteria | 1805 |
| 1062 | nmdc:mga04h51_250762_c1 | 3300050495 | Bacteria | 709 |
| 1063 | nmdc:mga07m45_205815_c1 | 3300050496 | Bacteria | 1145 |
| 1064 | nmdc:mga07m45_25003_c1 | 3300050496 | Bacteria | 3274 |
| 1065 | nmdc:mga07m45_33961_c1 | 3300050496 | Bacteria | 2834 |
| 1066 | nmdc:mga07m45_445529_c1 | 3300050496 | Bacteria | 751 |
| 1067 | nmdc:mga07m45_46988_c1 | 3300050496 | Bacteria | 2426 |
| 1068 | nmdc:mga05p37_371810_c1 | 3300050507 | Bacteria | 1677 |
| 1069 | nmdc:mga08y16_1404688_c1 | 3300050511 | Bacteria | 661 |
| 1070 | nmdc:mga08y16_372766_c1 | 3300050511 | Bacteria | 1464 |
| 1071 | nmdc:mga0n895_20634_c1 | 3300050512 | Bacteria | 6149 |
| 1072 | nmdc:mga0n895_454825_c1 | 3300050512 | Bacteria | 1292 |
| 1073 | nmdc:mga0rr50_24153_c1 | 3300050513 | Bacteria | 4206 |
| 1074 | nmdc:mga08x19_517253_c1 | 3300050514 | Bacteria | 843 |
| 1075 | nmdc:mga08x19_78608_c1 | 3300050514 | Bacteria | 2162 |
| 1076 | nmdc:mga0a205_1122642_c1 | 3300050515 | Bacteria | 634 |
| 1077 | nmdc:mga0sz30_137399_c1 | 3300050516 | Bacteria | 1079 |
| 1078 | nmdc:mga0sz30_288030_c1 | 3300050516 | Bacteria | 732 |
| 1079 | nmdc:mga0sz30_49993_c1 | 3300050516 | Bacteria | 1772 |
| 1080 | nmdc:mga0sz30_81144_c1 | 3300050516 | Bacteria | 1404 |
| 1081 | Ga0495601_0016203 | 3300053077 | Bacteria | 4514 |
| 1082 | Ga0495601_0027635 | 3300053077 | Bacteria | 3508 |
| 1083 | Ga0495601_0183577 | 3300053077 | Bacteria | 1367 |
| 1084 | Ga0495601_0349956 | 3300053077 | Bacteria | 961 |
| 1085 | Ga0495601_0448400 | 3300053077 | Bacteria | 835 |
| 1086 | Ga0495601_0524562 | 3300053077 | Bacteria | 763 |
| 1087 | Ga0495612_0005217 | 3300053078 | Bacteria | 5369 |
| 1088 | Ga0495612_0102346 | 3300053078 | Bacteria | 1220 |
| 1089 | Ga0500635_0358177 | 3300053080 | Bacteria | 577 |
| 1090 | Ga0495655_0262183 | 3300053083 | Bacteria | 584 |
| 1091 | Ga0495655_0331778 | 3300053083 | Bacteria | 529 |
| 1092 | Ga0495655_0346184 | 3300053083 | Bacteria | 519 |
| 1093 | Ga0495595_0002117 | 3300053084 | Bacteria | 7710 |
| 1094 | Ga0495595_0092174 | 3300053084 | Bacteria | 1454 |
| 1095 | Ga0495619_0001733 | 3300053085 | Bacteria | 14473 |
| 1096 | Ga0495619_0262163 | 3300053085 | Bacteria | 1197 |
| 1097 | Ga0495619_0505396 | 3300053085 | Bacteria | 831 |
| 1098 | Ga0495619_0751323 | 3300053085 | Bacteria | 661 |
| 1099 | Ga0500578_0066268 | 3300053086 | Bacteria | 2303 |
| 1100 | Ga0500578_0299349 | 3300053086 | Bacteria | 954 |
| 1101 | Ga0500578_0374869 | 3300053086 | Bacteria | 826 |
| 1102 | Ga0500643_000015 | 3300053087 | Bacteria | 310312 |
| 1103 | Ga0500643_087682 | 3300053087 | Bacteria | 850 |
| 1104 | Ga0500644_0128415 | 3300053088 | Bacteria | 995 |
| 1105 | Ga0500581_250031 | 3300053089 | Bacteria | 744 |
| 1106 | Ga0500646_0086683 | 3300053090 | Bacteria | 963 |
| 1107 | Ga0500647_0133268 | 3300053091 | Bacteria | 1170 |
| 1108 | Ga0500647_0185946 | 3300053091 | Bacteria | 950 |
| 1109 | Ga0500583_0012287 | 3300053092 | Bacteria | 3260 |
| 1110 | Ga0500583_0139672 | 3300053092 | Bacteria | 1203 |
| 1111 | Ga0500651_0022319 | 3300053093 | Bacteria | 3952 |
| 1112 | Ga0500651_0023742 | 3300053093 | Bacteria | 3841 |
| 1113 | Ga0500566_0000103 | 3300053094 | Bacteria | 43464 |
| 1114 | Ga0500566_0001736 | 3300053094 | Bacteria | 12790 |
| 1115 | Ga0500566_0287934 | 3300053094 | Bacteria | 779 |
| 1116 | Ga0500640_002395 | 3300053095 | Bacteria | 6191 |
| 1117 | Ga0500641_0025996 | 3300053096 | Bacteria | 2269 |
| 1118 | Ga0500641_0055443 | 3300053096 | Bacteria | 1641 |
| 1119 | Ga0500648_287578 | 3300053097 | Bacteria | 734 |
| 1120 | Ga0500650_0031343 | 3300053098 | Bacteria | 2416 |
| 1121 | Ga0500650_0072474 | 3300053098 | Bacteria | 1610 |
| 1122 | Ga0500650_0519080 | 3300053098 | Bacteria | 505 |
| 1123 | Ga0500554_116101 | 3300053102 | Bacteria | 901 |
| 1124 | Ga0500555_002428 | 3300053103 | Bacteria | 5405 |
| 1125 | Ga0500556_0000045 | 3300053104 | Bacteria | 130653 |
| 1126 | Ga0500556_0064236 | 3300053104 | Bacteria | 1359 |
| 1127 | Ga0500562_130270 | 3300053108 | Bacteria | 685 |
| 1128 | Ga0500569_005518 | 3300053109 | Bacteria | 2721 |
| 1129 | Ga0500569_009023 | 3300053109 | Bacteria | 2303 |
| 1130 | Ga0500572_001623 | 3300053111 | Bacteria | 5915 |
| 1131 | Ga0500591_015321 | 3300053115 | Bacteria | 3688 |
| 1132 | Ga0500592_003427 | 3300053116 | Bacteria | 2533 |
| 1133 | Ga0500593_164244 | 3300053117 | Bacteria | 845 |
| 1134 | Ga0500594_0034252 | 3300053118 | Bacteria | 1355 |
| 1135 | Ga0500594_0053683 | 3300053118 | Bacteria | 1142 |
| 1136 | Ga0500595_006846 | 3300053119 | Bacteria | 4797 |
| 1137 | Ga0500595_011978 | 3300053119 | Bacteria | 3369 |
| 1138 | Ga0500595_019337 | 3300053119 | Bacteria | 2472 |
| 1139 | Ga0500595_032978 | 3300053119 | Bacteria | 1722 |
| 1140 | Ga0500595_036295 | 3300053119 | Bacteria | 1616 |
| 1141 | Ga0500595_056065 | 3300053119 | Bacteria | 1205 |
| 1142 | Ga0500597_134524 | 3300053120 | Bacteria | 1067 |
| 1143 | Ga0500607_060416 | 3300053121 | Bacteria | 1988 |
| 1144 | Ga0500608_001250 | 3300053122 | Bacteria | 9043 |
| 1145 | Ga0500614_011202 | 3300053123 | Bacteria | 1937 |
| 1146 | Ga0500621_160597 | 3300053126 | Bacteria | 834 |
| 1147 | Ga0500642_0000024 | 3300053130 | Bacteria | 134373 |
| 1148 | Ga0500642_0000086 | 3300053130 | Bacteria | 48427 |
| 1149 | Ga0500642_0001352 | 3300053130 | Bacteria | 7009 |
| 1150 | Ga0500642_0046985 | 3300053130 | Bacteria | 1889 |
| 1151 | Ga0500642_0341662 | 3300053130 | Bacteria | 666 |
| 1152 | Ga0500652_000135 | 3300053131 | Bacteria | 27760 |
| 1153 | Ga0500655_061228 | 3300053133 | Bacteria | 759 |
| 1154 | Ga0500658_0043797 | 3300053134 | Bacteria | 1803 |
| 1155 | Ga0500559_0000414 | 3300053136 | Bacteria | 30678 |
| 1156 | Ga0500559_0000500 | 3300053136 | Bacteria | 27488 |
| 1157 | Ga0500559_0065394 | 3300053136 | Bacteria | 1629 |
| 1158 | Ga0500559_0182128 | 3300053136 | Bacteria | 990 |
| 1159 | Ga0500559_0206860 | 3300053136 | Bacteria | 925 |
| 1160 | Ga0500564_236436 | 3300053138 | Bacteria | 731 |
| 1161 | Ga0500568_0000469 | 3300053139 | Bacteria | 29931 |
| 1162 | Ga0500568_0008824 | 3300053139 | Bacteria | 4833 |
| 1163 | Ga0500568_0016080 | 3300053139 | Bacteria | 3334 |
| 1164 | Ga0500568_0021651 | 3300053139 | Bacteria | 2762 |
| 1165 | Ga0500568_0087431 | 3300053139 | Bacteria | 1178 |
| 1166 | Ga0500573_0210077 | 3300053140 | Bacteria | 1027 |
| 1167 | Ga0500577_0000773 | 3300053142 | Bacteria | 8234 |
| 1168 | Ga0500577_0156795 | 3300053142 | Bacteria | 968 |
| 1169 | Ga0500577_0287116 | 3300053142 | Bacteria | 717 |
| 1170 | Ga0500586_001132 | 3300053145 | Bacteria | 5519 |
| 1171 | Ga0500589_169257 | 3300053147 | Bacteria | 870 |
| 1172 | Ga0500589_217020 | 3300053147 | Bacteria | 723 |
| 1173 | Ga0500590_063474 | 3300053148 | Bacteria | 1852 |
| 1174 | Ga0500590_113165 | 3300053148 | Bacteria | 1284 |
| 1175 | Ga0500590_140210 | 3300053148 | Bacteria | 1105 |
| 1176 | Ga0500590_301740 | 3300053148 | Bacteria | 602 |
| 1177 | Ga0500603_000931 | 3300053150 | Bacteria | 6919 |
| 1178 | Ga0500604_0000270 | 3300053151 | Bacteria | 14474 |
| 1179 | Ga0500604_0006501 | 3300053151 | Bacteria | 3092 |
| 1180 | Ga0500604_0013790 | 3300053151 | Bacteria | 2194 |
| 1181 | Ga0500616_0000054 | 3300053153 | Bacteria | 290186 |
| 1182 | Ga0500616_0016813 | 3300053153 | Bacteria | 4157 |
| 1183 | Ga0500619_049211 | 3300053154 | Bacteria | 1359 |
| 1184 | Ga0500619_208113 | 3300053154 | Bacteria | 655 |
| 1185 | Ga0500622_0002469 | 3300053156 | Bacteria | 13329 |
| 1186 | Ga0500622_0033009 | 3300053156 | Bacteria | 2714 |
| 1187 | Ga0500627_0019817 | 3300053158 | Bacteria | 2687 |
| 1188 | Ga0500627_0056492 | 3300053158 | Bacteria | 1720 |
| 1189 | Ga0500627_0281844 | 3300053158 | Bacteria | 729 |
| 1190 | Ga0500627_0364678 | 3300053158 | Bacteria | 621 |
| 1191 | Ga0500630_006668 | 3300053159 | Bacteria | 5658 |
| 1192 | Ga0500634_0051449 | 3300053161 | Bacteria | 2216 |
| 1193 | Ga0500634_0111738 | 3300053161 | Bacteria | 1347 |
| 1194 | Ga0500634_0366805 | 3300053161 | Bacteria | 543 |
| 1195 | Ga0500638_010502 | 3300053162 | Bacteria | 4059 |
| 1196 | Ga0500638_064128 | 3300053162 | Bacteria | 1762 |
| 1197 | Ga0500638_261295 | 3300053162 | Bacteria | 690 |
| 1198 | Ga0500638_276787 | 3300053162 | Bacteria | 660 |
| 1199 | Ga0500639_000007 | 3300053163 | Bacteria | 152350 |
| 1200 | Ga0500639_100173 | 3300053163 | Bacteria | 1427 |
| 1201 | Ga0500636_0058456 | 3300053177 | Bacteria | 2253 |
| 1202 | Ga0500636_0063116 | 3300053177 | Bacteria | 2160 |
| 1203 | Ga0500636_0260680 | 3300053177 | Bacteria | 877 |
| 1204 | Ga0500637_0036416 | 3300053178 | Bacteria | 2762 |
| 1205 | Ga0500637_0338305 | 3300053178 | Bacteria | 806 |
| 1206 | Ga0500567_142547 | 3300053723 | Bacteria | 914 |
| 1207 | Ga0500570_082856 | 3300053724 | Bacteria | 1435 |
| 1208 | Ga0500611_090914 | 3300053727 | Bacteria | 777 |
| 1209 | Ga0500657_210903 | 3300053728 | Bacteria | 630 |
| 1210 | Ga0500645_071226 | 3300053730 | Bacteria | 997 |
| 1211 | Ga0500609_046246 | 3300053731 | Bacteria | 603 |
| 1212 | Ga0500596_000038 | 3300053735 | Bacteria | 17540 |
| 1213 | Ga0500596_000636 | 3300053735 | Bacteria | 6751 |
| 1214 | Ga0500596_017831 | 3300053735 | Bacteria | 1065 |
| 1215 | Ga0500596_021187 | 3300053735 | Bacteria | 979 |
| 1216 | Ga0500601_000153 | 3300053737 | Bacteria | 14318 |
| 1217 | Ga0500601_011643 | 3300053737 | Bacteria | 989 |
| 1218 | Ga0501084_0002218 | 3300054114 | Bacteria | 15588 |
| 1219 | Ga0501084_1666730 | 3300054114 | Bacteria | 533 |
| 1220 | Ga0500661_030338 | 3300055283 | Bacteria | 954 |
| 1221 | Ga0500661_042965 | 3300055283 | Bacteria | 801 |
| 1222 | Ga0501082_1336114 | 3300060353 | Bacteria | 626 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053728 | Ga0500657_210903 | Ga0500657_210903_290_619 | 107 |
| 2 | 3300048917 | Ga0496114_1277349 | Ga0496114_1277349_254_607 | 115 |
| 3 | iso_pu_bacteria | 2908739725 | 2908740372 | 115 |
| 4 | 3300017792 | Ga0163161_10213857 | Ga0163161_102138573 | 123 |
| 5 | 3300049587 | Ga0501071_0935589 | Ga0501071_0935589_238_639 | 124 |
| 6 | iso_pu_bacteria | 3005718088 | 3005724088 | 124 |
| 7 | 3300047323 | Ga0495683_0194879 | Ga0495683_0194879_513_896 | 125 |
| 8 | 3300048091 | Ga0495626_0326718 | Ga0495626_0326718_108_491 | 125 |
| 9 | 3300053086 | Ga0500578_0066268 | Ga0500578_0066268_818_1201 | 125 |
| 10 | 3300053104 | Ga0500556_0064236 | Ga0500556_0064236_94_477 | 125 |
| 11 | 3300053130 | Ga0500642_0001352 | Ga0500642_0001352_4373_4756 | 125 |
| 12 | 3300053133 | Ga0500655_061228 | Ga0500655_061228_114_497 | 125 |
| 13 | 3300053151 | Ga0500604_0013790 | Ga0500604_0013790_1395_1778 | 125 |
| 14 | 3300053156 | Ga0500622_0033009 | Ga0500622_0033009_753_1136 | 125 |
| 15 | 3300053731 | Ga0500609_046246 | Ga0500609_046246_57_440 | 125 |
| 16 | iso_pu_bacteria | 2906635258 | 2906640305 | 125 |
| 17 | iso_pu_bacteria | 2906660503 | 2906663633 | 125 |
| 18 | iso_pu_bacteria | 2922425934 | 2922427215 | 125 |
| 19 | iso_pu_bacteria | 3005474847 | 3005476393 | 125 |
| 20 | iso_pu_bacteria | 8006926726 | 8006931732 | 125 |
| 21 | iso_pu_bacteria | 8019555841 | 8019560902 | 125 |
| 22 | iso_pu_bacteria | 8019565922 | 8019570985 | 125 |
| 23 | iso_pu_bacteria | 2728368998 | 2728751952 | 126 |
| 24 | 3300047315 | Ga0495581_0197835 | Ga0495581_0197835_518_907 | 127 |
| 25 | 3300005347 | Ga0070668_100548748 | Ga0070668_1005487482 | 128 |
| 26 | 3300005437 | Ga0070710_10225180 | Ga0070710_102251801 | 128 |
| 27 | 3300005439 | Ga0070711_100055202 | Ga0070711_1000552022 | 128 |
| 28 | 3300005457 | Ga0070662_100570354 | Ga0070662_1005703541 | 128 |
| 29 | 3300005545 | Ga0070695_100449823 | Ga0070695_1004498231 | 128 |
| 30 | 3300005578 | Ga0068854_101109823 | Ga0068854_1011098232 | 128 |
| 31 | 3300005616 | Ga0068852_100037914 | Ga0068852_1000379146 | 128 |
| 32 | 3300005843 | Ga0068860_102159872 | Ga0068860_1021598721 | 128 |
| 33 | 3300006175 | Ga0070712_100085114 | Ga0070712_1000851141 | 128 |
| 34 | 3300007788 | Ga0099795_10005436 | Ga0099795_100054363 | 128 |
| 35 | 3300009093 | Ga0105240_10004957 | Ga0105240_100049573 | 128 |
| 36 | 3300009098 | Ga0105245_10299958 | Ga0105245_102999581 | 128 |
| 37 | 3300009553 | Ga0105249_10578856 | Ga0105249_105788562 | 128 |
| 38 | 3300010159 | Ga0099796_10222055 | Ga0099796_102220551 | 128 |
| 39 | 3300010375 | Ga0105239_10267715 | Ga0105239_102677154 | 128 |
| 40 | 3300013306 | Ga0163162_10029409 | Ga0163162_100294092 | 128 |
| 41 | 3300014969 | Ga0157376_11418883 | Ga0157376_114188831 | 128 |
| 42 | 3300017792 | Ga0163161_10791532 | Ga0163161_107915321 | 128 |
| 43 | 3300025911 | Ga0207654_10079790 | Ga0207654_100797902 | 128 |
| 44 | 3300025913 | Ga0207695_10000378 | Ga0207695_1000037824 | 128 |
| 45 | 3300025914 | Ga0207671_10005974 | Ga0207671_100059744 | 128 |
| 46 | 3300025915 | Ga0207693_10014111 | Ga0207693_100141113 | 128 |
| 47 | 3300025916 | Ga0207663_10047963 | Ga0207663_100479632 | 128 |
| 48 | 3300025927 | Ga0207687_10794440 | Ga0207687_107944401 | 128 |
| 49 | 3300025939 | Ga0207665_10348260 | Ga0207665_103482602 | 128 |
| 50 | 3300025972 | Ga0207668_10631885 | Ga0207668_106318851 | 128 |
| 51 | 3300026142 | Ga0207698_10063172 | Ga0207698_100631723 | 128 |
| 52 | 3300031711 | Ga0265314_10083597 | Ga0265314_100835971 | 128 |
| 53 | 3300033180 | Ga0307510_10035891 | Ga0307510_100358913 | 128 |
| 54 | 3300035725 | Ga0373947_0153153 | Ga0373947_0153153_992_1393 | 128 |
| 55 | 3300039453 | Ga0436362_0373664 | Ga0436362_0373664_282_677 | 128 |
| 56 | 3300041498 | Ga0451841_1457417 | Ga0451841_1457417_469_861 | 128 |
| 57 | 3300046517 | Ga0495630_0321072 | Ga0495630_0321072_127_528 | 128 |
| 58 | 3300046535 | Ga0495586_0277416 | Ga0495586_0277416_410_811 | 128 |
| 59 | 3300048903 | Ga0496100_0275646 | Ga0496100_0275646_207_599 | 128 |
| 60 | 3300048909 | Ga0496106_0185464 | Ga0496106_0185464_1010_1402 | 128 |
| 61 | 3300048927 | Ga0496124_0201709 | Ga0496124_0201709_16_408 | 128 |
| 62 | 3300053077 | Ga0495601_0524562 | Ga0495601_0524562_30_599 | 128 |
| 63 | 3300055283 | Ga0500661_030338 | Ga0500661_030338_278_709 | 128 |
| 64 | 3300005436 | Ga0070713_101247974 | Ga0070713_1012479741 | 129 |
| 65 | 3300006173 | Ga0070716_100100668 | Ga0070716_1001006681 | 129 |
| 66 | 3300009148 | Ga0105243_10774814 | Ga0105243_107748142 | 129 |
| 67 | 3300009551 | Ga0105238_10196717 | Ga0105238_101967172 | 129 |
| 68 | 3300025261 | Ga0209233_1002725 | Ga0209233_10027252 | 129 |
| 69 | 3300025935 | Ga0207709_10366681 | Ga0207709_103666813 | 129 |
| 70 | 3300031711 | Ga0265314_10085444 | Ga0265314_100854443 | 129 |
| 71 | 3300031712 | Ga0265342_10007736 | Ga0265342_100077363 | 129 |
| 72 | 3300039437 | Ga0436365_1146796 | Ga0436365_1146796_791_1180 | 129 |
| 73 | 3300046477 | Ga0495664_0904159 | Ga0495664_0904159_100_504 | 129 |
| 74 | 3300046683 | Ga0495658_0250499 | Ga0495658_0250499_488_883 | 129 |
| 75 | 3300048915 | Ga0496112_0425918 | Ga0496112_0425918_638_1033 | 129 |
| 76 | 3300048918 | Ga0496115_0134415 | Ga0496115_0134415_1573_1968 | 129 |
| 77 | 3300048924 | Ga0496121_0000125 | Ga0496121_0000125_155181_155654 | 129 |
| 78 | 3300048929 | Ga0496126_0254709 | Ga0496126_0254709_253_648 | 129 |
| 79 | 3300049568 | Ga0501031_0005248 | Ga0501031_0005248_5089_5481 | 129 |
| 80 | 3300049569 | Ga0501032_0000030 | Ga0501032_0000030_126278_126670 | 129 |
| 81 | 3300049570 | Ga0501033_0000060 | Ga0501033_0000060_47761_48153 | 129 |
| 82 | 3300049571 | Ga0501034_0000117 | Ga0501034_0000117_82426_82818 | 129 |
| 83 | 3300049572 | Ga0501036_0000349 | Ga0501036_0000349_8437_8829 | 129 |
| 84 | 3300049573 | Ga0501037_0000561 | Ga0501037_0000561_23829_24221 | 129 |
| 85 | 3300049574 | Ga0501038_0000570 | Ga0501038_0000570_23768_24160 | 129 |
| 86 | 3300049575 | Ga0501039_0003520 | Ga0501039_0003520_8536_8928 | 129 |
| 87 | 3300049579 | Ga0501043_0000972 | Ga0501043_0000972_1726_2118 | 129 |
| 88 | 3300049580 | Ga0501046_0000214 | Ga0501046_0000214_27525_27917 | 129 |
| 89 | 3300049581 | Ga0501047_0000246 | Ga0501047_0000246_61975_62367 | 129 |
| 90 | 3300049582 | Ga0501048_0007131 | Ga0501048_0007131_5478_5870 | 129 |
| 91 | 3300049583 | Ga0501067_0000398 | Ga0501067_0000398_4371_4763 | 129 |
| 92 | 3300049584 | Ga0501068_0001432 | Ga0501068_0001432_5058_5450 | 129 |
| 93 | 3300049585 | Ga0501069_0007157 | Ga0501069_0007157_3815_4207 | 129 |
| 94 | 3300049586 | Ga0501070_0373496 | Ga0501070_0373496_686_1075 | 129 |
| 95 | 3300049588 | Ga0501072_0006414 | Ga0501072_0006414_5029_5421 | 129 |
| 96 | 3300049589 | Ga0501073_0000203 | Ga0501073_0000203_4438_4830 | 129 |
| 97 | 3300049590 | Ga0501074_0000410 | Ga0501074_0000410_23824_24216 | 129 |
| 98 | 3300049592 | Ga0501076_0329381 | Ga0501076_0329381_542_934 | 129 |
| 99 | 3300049741 | Ga0501079_0009370 | Ga0501079_0009370_3588_3980 | 129 |
| 100 | 3300049742 | Ga0501080_0003578 | Ga0501080_0003578_8916_9308 | 129 |
| 101 | 3300049743 | Ga0501081_1144058 | Ga0501081_1144058_151_543 | 129 |
| 102 | 3300049744 | Ga0501083_0008773 | Ga0501083_0008773_4730_5122 | 129 |
| 103 | 3300049822 | Ga0501035_0000212 | Ga0501035_0000212_11458_11850 | 129 |
| 104 | 3300049823 | Ga0501044_0001196 | Ga0501044_0001196_7170_7562 | 129 |
| 105 | 3300049823 | Ga0501044_0231507 | Ga0501044_0231507_802_1191 | 129 |
| 106 | 3300049824 | Ga0501045_0030829 | Ga0501045_0030829_673_1065 | 129 |
| 107 | 3300053153 | Ga0500616_0016813 | Ga0500616_0016813_606_1007 | 129 |
| 108 | 3300054114 | Ga0501084_0002218 | Ga0501084_0002218_3322_3714 | 129 |
| 109 | iso_pu_bacteria | 2513237098 | 2513675284 | 129 |
| 110 | iso_pu_bacteria | 2524023210 | 2524469116 | 129 |
| 111 | iso_pu_bacteria | 2885383462 | 2885389500 | 129 |
| 112 | iso_pu_bacteria | 2903768456 | 2903771463 | 129 |
| 113 | iso_pu_bacteria | 8056681323 | 8056681837 | 129 |
| 114 | iso_pu_bacteria | 8056689827 | 8056695477 | 129 |
| 115 | 3300005329 | Ga0070683_100850693 | Ga0070683_1008506932 | 130 |
| 116 | 3300005334 | Ga0068869_101045167 | Ga0068869_1010451671 | 130 |
| 117 | 3300005344 | Ga0070661_101675607 | Ga0070661_1016756071 | 130 |
| 118 | 3300005435 | Ga0070714_100186990 | Ga0070714_1001869901 | 130 |
| 119 | 3300005436 | Ga0070713_100273740 | Ga0070713_1002737402 | 130 |
| 120 | 3300005439 | Ga0070711_100136144 | Ga0070711_1001361442 | 130 |
| 121 | 3300005455 | Ga0070663_101030048 | Ga0070663_1010300481 | 130 |
| 122 | 3300005466 | Ga0070685_10210776 | Ga0070685_102107761 | 130 |
| 123 | 3300005548 | Ga0070665_100496407 | Ga0070665_1004964072 | 130 |
| 124 | 3300005577 | Ga0068857_100081351 | Ga0068857_1000813512 | 130 |
| 125 | 3300005614 | Ga0068856_101300487 | Ga0068856_1013004871 | 130 |
| 126 | 3300005618 | Ga0068864_101511805 | Ga0068864_1015118051 | 130 |
| 127 | 3300005842 | Ga0068858_100207233 | Ga0068858_1002072333 | 130 |
| 128 | 3300005983 | Ga0081540_1027471 | Ga0081540_10274713 | 130 |
| 129 | 3300006028 | Ga0070717_10890816 | Ga0070717_108908162 | 130 |
| 130 | 3300006175 | Ga0070712_101087861 | Ga0070712_1010878612 | 130 |
| 131 | 3300006358 | Ga0068871_100657870 | Ga0068871_1006578701 | 130 |
| 132 | 3300009101 | Ga0105247_10038734 | Ga0105247_100387344 | 130 |
| 133 | 3300009148 | Ga0105243_12221593 | Ga0105243_122215931 | 130 |
| 134 | 3300009174 | Ga0105241_10577725 | Ga0105241_105777252 | 130 |
| 135 | 3300009545 | Ga0105237_10053382 | Ga0105237_100533824 | 130 |
| 136 | 3300009551 | Ga0105238_10124009 | Ga0105238_101240093 | 130 |
| 137 | 3300009553 | Ga0105249_12469386 | Ga0105249_124693861 | 130 |
| 138 | 3300011119 | Ga0105246_10146770 | Ga0105246_101467703 | 130 |
| 139 | 3300013306 | Ga0163162_10107603 | Ga0163162_101076032 | 130 |
| 140 | 3300013308 | Ga0157375_10352711 | Ga0157375_103527112 | 130 |
| 141 | 3300014325 | Ga0163163_10038380 | Ga0163163_100383805 | 130 |
| 142 | 3300014968 | Ga0157379_10034808 | Ga0157379_100348085 | 130 |
| 143 | 3300014968 | Ga0157379_11615089 | Ga0157379_116150891 | 130 |
| 144 | 3300021358 | Ga0213873_10065597 | Ga0213873_100655973 | 130 |
| 145 | 3300021377 | Ga0213874_10069360 | Ga0213874_100693602 | 130 |
| 146 | 3300025914 | Ga0207671_10072553 | Ga0207671_100725533 | 130 |
| 147 | 3300025920 | Ga0207649_11138891 | Ga0207649_111388911 | 130 |
| 148 | 3300025924 | Ga0207694_10096891 | Ga0207694_100968911 | 130 |
| 149 | 3300025926 | Ga0207659_11751403 | Ga0207659_117514031 | 130 |
| 150 | 3300025928 | Ga0207700_10298619 | Ga0207700_102986192 | 130 |
| 151 | 3300025928 | Ga0207700_10720495 | Ga0207700_107204952 | 130 |
| 152 | 3300025929 | Ga0207664_10247165 | Ga0207664_102471651 | 130 |
| 153 | 3300025945 | Ga0207679_11805561 | Ga0207679_118055611 | 130 |
| 154 | 3300025961 | Ga0207712_11840585 | Ga0207712_118405851 | 130 |
| 155 | 3300026035 | Ga0207703_10161146 | Ga0207703_101611462 | 130 |
| 156 | 3300026067 | Ga0207678_10987030 | Ga0207678_109870302 | 130 |
| 157 | 3300026078 | Ga0207702_11197838 | Ga0207702_111978381 | 130 |
| 158 | 3300026095 | Ga0207676_10109436 | Ga0207676_101094361 | 130 |
| 159 | 3300026116 | Ga0207674_10427480 | Ga0207674_104274802 | 130 |
| 160 | 3300026116 | Ga0207674_11502755 | Ga0207674_115027551 | 130 |
| 161 | 3300028379 | Ga0268266_10139753 | Ga0268266_101397533 | 130 |
| 162 | 3300031249 | Ga0265339_10008628 | Ga0265339_100086282 | 130 |
| 163 | 3300035111 | Ga0373923_0085647 | Ga0373923_0085647_337_735 | 130 |
| 164 | 3300035113 | Ga0373936_0122315 | Ga0373936_0122315_366_764 | 130 |
| 165 | 3300035117 | Ga0373953_0002113 | Ga0373953_0002113_1932_2330 | 130 |
| 166 | 3300035117 | Ga0373953_0347058 | Ga0373953_0347058_65_463 | 130 |
| 167 | 3300035118 | Ga0373954_0009691 | Ga0373954_0009691_1576_1974 | 130 |
| 168 | 3300035119 | Ga0373956_0039561 | Ga0373956_0039561_1410_1808 | 130 |
| 169 | 3300035120 | Ga0373957_0006803 | Ga0373957_0006803_970_1368 | 130 |
| 170 | 3300035172 | Ga0373955_0001917 | Ga0373955_0001917_3220_3618 | 130 |
| 171 | 3300035172 | Ga0373955_0364492 | Ga0373955_0364492_340_738 | 130 |
| 172 | 3300035410 | Ga0373924_0001605 | Ga0373924_0001605_1191_1589 | 130 |
| 173 | 3300035692 | Ga0373935_0034676 | Ga0373935_0034676_401_799 | 130 |
| 174 | 3300035695 | Ga0373927_0028939 | Ga0373927_0028939_663_1061 | 130 |
| 175 | 3300036401 | Ga0373937_0123998 | Ga0373937_0123998_1154_1552 | 130 |
| 176 | 3300037068 | Ga0373925_0156327 | Ga0373925_0156327_652_1050 | 130 |
| 177 | 3300037068 | Ga0373925_1412806 | Ga0373925_1412806_144_542 | 130 |
| 178 | 3300039437 | Ga0436365_1716705 | Ga0436365_1716705_490_888 | 130 |
| 179 | 3300039438 | Ga0436360_0420359 | Ga0436360_0420359_1268_1666 | 130 |
| 180 | 3300039447 | Ga0436361_0051433 | Ga0436361_0051433_418_831 | 130 |
| 181 | 3300039450 | Ga0436363_0234286 | Ga0436363_0234286_739_1137 | 130 |
| 182 | 3300039453 | Ga0436362_0439870 | Ga0436362_0439870_2176_2589 | 130 |
| 183 | 3300042142 | Ga0450905_106040 | Ga0450905_106040_54_473 | 130 |
| 184 | 3300044694 | Ga0466963_0150967 | Ga0466963_0150967_79_477 | 130 |
| 185 | 3300044735 | Ga0466968_0139862 | Ga0466968_0139862_61_459 | 130 |
| 186 | 3300045049 | Ga0466959_0056697 | Ga0466959_0056697_2448_2846 | 130 |
| 187 | 3300046454 | Ga0495592_0004099 | Ga0495592_0004099_6848_7246 | 130 |
| 188 | 3300046462 | Ga0495651_0045237 | Ga0495651_0045237_1018_1416 | 130 |
| 189 | 3300046463 | Ga0495653_0054219 | Ga0495653_0054219_644_1042 | 130 |
| 190 | 3300046477 | Ga0495664_0009901 | Ga0495664_0009901_2535_2933 | 130 |
| 191 | 3300046511 | Ga0495608_0036761 | Ga0495608_0036761_970_1368 | 130 |
| 192 | 3300046514 | Ga0495618_0018145 | Ga0495618_0018145_1080_1478 | 130 |
| 193 | 3300046516 | Ga0495628_0083128 | Ga0495628_0083128_1246_1644 | 130 |
| 194 | 3300046517 | Ga0495630_0101653 | Ga0495630_0101653_1203_1601 | 130 |
| 195 | 3300046529 | Ga0495652_0014289 | Ga0495652_0014289_5294_5692 | 130 |
| 196 | 3300046533 | Ga0495640_0033150 | Ga0495640_0033150_1317_1715 | 130 |
| 197 | 3300046536 | Ga0495587_0029595 | Ga0495587_0029595_1358_1756 | 130 |
| 198 | 3300046543 | Ga0495645_0004447 | Ga0495645_0004447_6600_6998 | 130 |
| 199 | 3300046559 | Ga0495667_0029608 | Ga0495667_0029608_2273_2671 | 130 |
| 200 | 3300046615 | Ga0495656_0406056 | Ga0495656_0406056_12_404 | 130 |
| 201 | 3300046642 | Ga0495634_0012048 | Ga0495634_0012048_5353_5751 | 130 |
| 202 | 3300046663 | Ga0495635_0017629 | Ga0495635_0017629_3180_3578 | 130 |
| 203 | 3300046674 | Ga0495588_0339262 | Ga0495588_0339262_249_656 | 130 |
| 204 | 3300046675 | Ga0495657_0017156 | Ga0495657_0017156_2236_2634 | 130 |
| 205 | 3300046678 | Ga0495599_0003578 | Ga0495599_0003578_5777_6175 | 130 |
| 206 | 3300046679 | Ga0495623_0033232 | Ga0495623_0033232_1718_2116 | 130 |
| 207 | 3300046680 | Ga0495646_0019861 | Ga0495646_0019861_338_736 | 130 |
| 208 | 3300046690 | Ga0495624_0205745 | Ga0495624_0205745_58_456 | 130 |
| 209 | 3300046809 | Ga0495600_0010963 | Ga0495600_0010963_1435_1833 | 130 |
| 210 | 3300047317 | Ga0495604_0011675 | Ga0495604_0011675_2149_2547 | 130 |
| 211 | 3300047319 | Ga0495674_0052222 | Ga0495674_0052222_1104_1502 | 130 |
| 212 | 3300047320 | Ga0495672_0025612 | Ga0495672_0025612_532_924 | 130 |
| 213 | 3300047322 | Ga0495680_0021605 | Ga0495680_0021605_2589_2987 | 130 |
| 214 | 3300047444 | Ga0495675_0016494 | Ga0495675_0016494_2700_3098 | 130 |
| 215 | 3300047471 | Ga0495684_0022863 | Ga0495684_0022863_1077_1475 | 130 |
| 216 | 3300047673 | Ga0495593_0021021 | Ga0495593_0021021_1071_1469 | 130 |
| 217 | 3300048905 | Ga0496102_0063011 | Ga0496102_0063011_492_917 | 130 |
| 218 | 3300048907 | Ga0496104_0126851 | Ga0496104_0126851_25_450 | 130 |
| 219 | 3300048909 | Ga0496106_0216847 | Ga0496106_0216847_1009_1434 | 130 |
| 220 | 3300048910 | Ga0496107_0061146 | Ga0496107_0061146_2008_2433 | 130 |
| 221 | 3300048911 | Ga0496108_0087488 | Ga0496108_0087488_579_1004 | 130 |
| 222 | 3300048912 | Ga0496109_0034528 | Ga0496109_0034528_1620_2045 | 130 |
| 223 | 3300048913 | Ga0496110_0020924 | Ga0496110_0020924_271_696 | 130 |
| 224 | 3300048915 | Ga0496112_0027002 | Ga0496112_0027002_4571_4996 | 130 |
| 225 | 3300048918 | Ga0496115_0098359 | Ga0496115_0098359_1978_2376 | 130 |
| 226 | 3300048924 | Ga0496121_0119342 | Ga0496121_0119342_1298_1696 | 130 |
| 227 | 3300048929 | Ga0496126_0117484 | Ga0496126_0117484_1895_2293 | 130 |
| 228 | 3300049568 | Ga0501031_0070323 | Ga0501031_0070323_483_875 | 130 |
| 229 | 3300049568 | Ga0501031_0884370 | Ga0501031_0884370_48_467 | 130 |
| 230 | 3300049570 | Ga0501033_0180436 | Ga0501033_0180436_572_964 | 130 |
| 231 | 3300049571 | Ga0501034_0405086 | Ga0501034_0405086_414_806 | 130 |
| 232 | 3300049573 | Ga0501037_0051928 | Ga0501037_0051928_56_448 | 130 |
| 233 | 3300049574 | Ga0501038_0106827 | Ga0501038_0106827_538_930 | 130 |
| 234 | 3300049575 | Ga0501039_0389670 | Ga0501039_0389670_261_653 | 130 |
| 235 | 3300049576 | Ga0501040_0995952 | Ga0501040_0995952_66_485 | 130 |
| 236 | 3300049577 | Ga0501041_0508070 | Ga0501041_0508070_252_671 | 130 |
| 237 | 3300049578 | Ga0501042_0607144 | Ga0501042_0607144_53_472 | 130 |
| 238 | 3300049579 | Ga0501043_0025570 | Ga0501043_0025570_2599_2991 | 130 |
| 239 | 3300049580 | Ga0501046_0218198 | Ga0501046_0218198_281_673 | 130 |
| 240 | 3300049581 | Ga0501047_0434997 | Ga0501047_0434997_190_582 | 130 |
| 241 | 3300049582 | Ga0501048_0317846 | Ga0501048_0317846_293_685 | 130 |
| 242 | 3300049583 | Ga0501067_0028749 | Ga0501067_0028749_1423_1815 | 130 |
| 243 | 3300049584 | Ga0501068_0377014 | Ga0501068_0377014_43_435 | 130 |
| 244 | 3300049587 | Ga0501071_0182245 | Ga0501071_0182245_1014_1406 | 130 |
| 245 | 3300049589 | Ga0501073_0450723 | Ga0501073_0450723_286_678 | 130 |
| 246 | 3300049590 | Ga0501074_0445567 | Ga0501074_0445567_88_480 | 130 |
| 247 | 3300049592 | Ga0501076_0586650 | Ga0501076_0586650_121_540 | 130 |
| 248 | 3300049742 | Ga0501080_0256097 | Ga0501080_0256097_1137_1529 | 130 |
| 249 | 3300049822 | Ga0501035_0276363 | Ga0501035_0276363_287_679 | 130 |
| 250 | 3300049823 | Ga0501044_0311849 | Ga0501044_0311849_942_1334 | 130 |
| 251 | 3300049823 | Ga0501044_1469526 | Ga0501044_1469526_94_492 | 130 |
| 252 | 3300049824 | Ga0501045_0368137 | Ga0501045_0368137_575_994 | 130 |
| 253 | 3300053077 | Ga0495601_0016203 | Ga0495601_0016203_1850_2248 | 130 |
| 254 | 3300053078 | Ga0495612_0005217 | Ga0495612_0005217_1335_1733 | 130 |
| 255 | 3300053084 | Ga0495595_0092174 | Ga0495595_0092174_375_773 | 130 |
| 256 | 3300053085 | Ga0495619_0262163 | Ga0495619_0262163_520_918 | 130 |
| 257 | 3300053091 | Ga0500647_0133268 | Ga0500647_0133268_572_970 | 130 |
| 258 | 3300053094 | Ga0500566_0000103 | Ga0500566_0000103_3419_3817 | 130 |
| 259 | 3300053095 | Ga0500640_002395 | Ga0500640_002395_2422_2820 | 130 |
| 260 | 3300053111 | Ga0500572_001623 | Ga0500572_001623_2670_3068 | 130 |
| 261 | 3300053115 | Ga0500591_015321 | Ga0500591_015321_2566_2964 | 130 |
| 262 | 3300053123 | Ga0500614_011202 | Ga0500614_011202_977_1375 | 130 |
| 263 | 3300053136 | Ga0500559_0000500 | Ga0500559_0000500_398_796 | 130 |
| 264 | 3300053139 | Ga0500568_0021651 | Ga0500568_0021651_1096_1488 | 130 |
| 265 | 3300053150 | Ga0500603_000931 | Ga0500603_000931_1644_2042 | 130 |
| 266 | 3300053159 | Ga0500630_006668 | Ga0500630_006668_683_1081 | 130 |
| 267 | 3300053162 | Ga0500638_010502 | Ga0500638_010502_3384_3782 | 130 |
| 268 | 3300053163 | Ga0500639_000007 | Ga0500639_000007_141437_141835 | 130 |
| 269 | 3300053735 | Ga0500596_000038 | Ga0500596_000038_2407_2805 | 130 |
| 270 | 3300054114 | Ga0501084_1666730 | Ga0501084_1666730_94_486 | 130 |
| 271 | 3300060353 | Ga0501082_1336114 | Ga0501082_1336114_84_503 | 130 |
| 272 | iso_pu_bacteria | 2507262055 | 2507508680 | 130 |
| 273 | iso_pu_bacteria | 2508501009 | 2508542776 | 130 |
| 274 | iso_pu_bacteria | 2508501042 | 2508691463 | 130 |
| 275 | iso_pu_bacteria | 2508501128 | 2509147922 | 130 |
| 276 | iso_pu_bacteria | 2513237137 | 2513863817 | 130 |
| 277 | iso_pu_bacteria | 2515154112 | 2515628268 | 130 |
| 278 | iso_pu_bacteria | 2602042107 | 2603860482 | 130 |
| 279 | iso_pu_bacteria | 2617270741 | 2617375858 | 130 |
| 280 | iso_pu_bacteria | 2791355196 | 2793062497 | 130 |
| 281 | iso_pu_bacteria | 2824704595 | 2824713648 | 130 |
| 282 | iso_pu_bacteria | 2824732956 | 2824739771 | 130 |
| 283 | iso_pu_bacteria | 2824746037 | 2824751587 | 130 |
| 284 | iso_pu_bacteria | 2824753945 | 2824763188 | 130 |
| 285 | iso_pu_bacteria | 2824763712 | 2824767486 | 130 |
| 286 | iso_pu_bacteria | 2842038055 | 2842039165 | 130 |
| 287 | iso_pu_bacteria | 2842045827 | 2842047888 | 130 |
| 288 | iso_pu_bacteria | 2849076700 | 2849079410 | 130 |
| 289 | iso_pu_bacteria | 2857524615 | 2857525432 | 130 |
| 290 | iso_pu_bacteria | 2874590934 | 2874593417 | 130 |
| 291 | iso_pu_bacteria | 2874628541 | 2874633308 | 130 |
| 292 | iso_pu_bacteria | 2874645413 | 2874648971 | 130 |
| 293 | iso_pu_bacteria | 2876771140 | 2876773166 | 130 |
| 294 | iso_pu_bacteria | 2876818435 | 2876822056 | 130 |
| 295 | iso_pu_bacteria | 2879074833 | 2879077211 | 130 |
| 296 | iso_pu_bacteria | 2879127579 | 2879130020 | 130 |
| 297 | iso_pu_bacteria | 2881665667 | 2881671082 | 130 |
| 298 | iso_pu_bacteria | 2885366525 | 2885370566 | 130 |
| 299 | iso_pu_bacteria | 2888388044 | 2888393902 | 130 |
| 300 | iso_pu_bacteria | 2893066018 | 2893070911 | 130 |
| 301 | iso_pu_bacteria | 2904699407 | 2904706686 | 130 |
| 302 | iso_pu_bacteria | 2904711408 | 2904714512 | 130 |
| 303 | iso_pu_bacteria | 2908775508 | 2908780086 | 130 |
| 304 | iso_pu_bacteria | 2919073203 | 2919074878 | 130 |
| 305 | iso_pu_bacteria | 2935608549 | 2935608791 | 130 |
| 306 | iso_pu_bacteria | 2935648319 | 2935649946 | 130 |
| 307 | iso_pu_bacteria | 2935656913 | 2935661902 | 130 |
| 308 | iso_pu_bacteria | 2935819856 | 2935821952 | 130 |
| 309 | iso_pu_bacteria | 2935847175 | 2935847534 | 130 |
| 310 | iso_pu_bacteria | 2935908558 | 2935909199 | 130 |
| 311 | iso_pu_bacteria | 2935916978 | 2935919920 | 130 |
| 312 | iso_pu_bacteria | 2935926038 | 2935926227 | 130 |
| 313 | iso_pu_bacteria | 2935934488 | 2935934677 | 130 |
| 314 | iso_pu_bacteria | 2935942939 | 2935943127 | 130 |
| 315 | iso_pu_bacteria | 2935951376 | 2935951565 | 130 |
| 316 | iso_pu_bacteria | 2935967501 | 2935967690 | 130 |
| 317 | iso_pu_bacteria | 2935975950 | 2935977112 | 130 |
| 318 | iso_pu_bacteria | 2935984226 | 2935988270 | 130 |
| 319 | iso_pu_bacteria | 2936011229 | 2936012571 | 130 |
| 320 | iso_pu_bacteria | 2936019824 | 2936021135 | 130 |
| 321 | iso_pu_bacteria | 2936028420 | 2936029864 | 130 |
| 322 | iso_pu_bacteria | 2936046547 | 2936047329 | 130 |
| 323 | iso_pu_bacteria | 2936055302 | 2936057513 | 130 |
| 324 | iso_pu_bacteria | 3005506211 | 3005510237 | 130 |
| 325 | iso_pu_bacteria | 8006933436 | 8006937734 | 130 |
| 326 | iso_pu_bacteria | 8006973647 | 8006977765 | 130 |
| 327 | iso_pu_bacteria | 8016630954 | 8016640454 | 130 |
| 328 | iso_pu_bacteria | 8019619141 | 8019628033 | 130 |
| 329 | iso_pu_bacteria | 8019629233 | 8019634567 | 130 |
| 330 | iso_pu_bacteria | 8019638758 | 8019645148 | 130 |
| 331 | iso_pu_bacteria | 8019659431 | 8019662462 | 130 |
| 332 | iso_pu_bacteria | 8019668869 | 8019671960 | 130 |
| 333 | iso_pu_bacteria | 8019687851 | 8019689972 | 130 |
| 334 | 3300005336 | Ga0070680_101749694 | Ga0070680_1017496941 | 131 |
| 335 | 3300005337 | Ga0070682_100247304 | Ga0070682_1002473042 | 131 |
| 336 | 3300005455 | Ga0070663_100435037 | Ga0070663_1004350371 | 131 |
| 337 | 3300005535 | Ga0070684_100254342 | Ga0070684_1002543422 | 131 |
| 338 | 3300005539 | Ga0068853_100039389 | Ga0068853_1000393891 | 131 |
| 339 | 3300005547 | Ga0070693_100091598 | Ga0070693_1000915983 | 131 |
| 340 | 3300005564 | Ga0070664_101125925 | Ga0070664_1011259251 | 131 |
| 341 | 3300005578 | Ga0068854_100486767 | Ga0068854_1004867672 | 131 |
| 342 | 3300005616 | Ga0068852_100655479 | Ga0068852_1006554792 | 131 |
| 343 | 3300006048 | Ga0075363_100428206 | Ga0075363_1004282062 | 131 |
| 344 | 3300006178 | Ga0075367_10082850 | Ga0075367_100828502 | 131 |
| 345 | 3300006353 | Ga0075370_10039239 | Ga0075370_100392394 | 131 |
| 346 | 3300009174 | Ga0105241_10757570 | Ga0105241_107575702 | 131 |
| 347 | 3300009545 | Ga0105237_12093761 | Ga0105237_120937611 | 131 |
| 348 | 3300009551 | Ga0105238_10299288 | Ga0105238_102992881 | 131 |
| 349 | 3300025321 | Ga0207656_10515633 | Ga0207656_105156332 | 131 |
| 350 | 3300025917 | Ga0207660_11155839 | Ga0207660_111558391 | 131 |
| 351 | 3300025924 | Ga0207694_10182459 | Ga0207694_101824593 | 131 |
| 352 | 3300025981 | Ga0207640_10708859 | Ga0207640_107088592 | 131 |
| 353 | 3300026067 | Ga0207678_10089215 | Ga0207678_100892153 | 131 |
| 354 | 3300026142 | Ga0207698_10355488 | Ga0207698_103554882 | 131 |
| 355 | 3300041486 | Ga0451807_2559663 | Ga0451807_2559663_18_419 | 131 |
| 356 | 3300046530 | Ga0495654_0163143 | Ga0495654_0163143_94_495 | 131 |
| 357 | 3300047469 | Ga0495673_0184252 | Ga0495673_0184252_297_698 | 131 |
| 358 | 3300048924 | Ga0496121_0208757 | Ga0496121_0208757_617_1018 | 131 |
| 359 | 3300048927 | Ga0496124_0216325 | Ga0496124_0216325_373_774 | 131 |
| 360 | 3300050494 | nmdc:mga06z11_46228_c1 | nmdc:mga06z11_46228_c1_1189_1590 | 131 |
| 361 | 3300050496 | nmdc:mga07m45_46988_c1 | nmdc:mga07m45_46988_c1_915_1316 | 131 |
| 362 | 3300053119 | Ga0500595_006846 | Ga0500595_006846_2805_3206 | 131 |
| 363 | 3300053139 | Ga0500568_0016080 | Ga0500568_0016080_441_842 | 131 |
| 364 | 3300053162 | Ga0500638_276787 | Ga0500638_276787_198_599 | 131 |
| 365 | 3300053724 | Ga0500570_082856 | Ga0500570_082856_386_787 | 131 |
| 366 | iso_pu_bacteria | 2513237139 | 2513872678 | 131 |
| 367 | iso_pu_bacteria | 2517093001 | 2517101332 | 131 |
| 368 | iso_pu_bacteria | 2524023205 | 2524440470 | 131 |
| 369 | iso_pu_bacteria | 2617270735 | 2617348923 | 131 |
| 370 | iso_pu_bacteria | 2744054633 | 2745075261 | 131 |
| 371 | iso_pu_bacteria | 2802429603 | 2805915424 | 131 |
| 372 | iso_pu_bacteria | 2824600985 | 2824603477 | 131 |
| 373 | iso_pu_bacteria | 2824609381 | 2824614756 | 131 |
| 374 | iso_pu_bacteria | 2824696289 | 2824701711 | 131 |
| 375 | iso_pu_bacteria | 2841957949 | 2841958574 | 131 |
| 376 | iso_pu_bacteria | 2847930680 | 2847936119 | 131 |
| 377 | iso_pu_bacteria | 2847939898 | 2847946471 | 131 |
| 378 | iso_pu_bacteria | 2874620515 | 2874627200 | 131 |
| 379 | iso_pu_bacteria | 2904666416 | 2904671280 | 131 |
| 380 | iso_pu_bacteria | 2906643746 | 2906650481 | 131 |
| 381 | iso_pu_bacteria | 2935959822 | 2935966385 | 131 |
| 382 | iso_pu_bacteria | 2941531003 | 2941532664 | 131 |
| 383 | iso_pu_bacteria | 3005483717 | 3005487254 | 131 |
| 384 | 3300003215 | JGI25153J46596_10000472 | JGI25153J46596_1000047217 | 132 |
| 385 | 3300003215 | JGI25153J46596_10009052 | JGI25153J46596_100090522 | 132 |
| 386 | 3300003215 | JGI25153J46596_10009819 | JGI25153J46596_100098193 | 132 |
| 387 | 3300003215 | JGI25153J46596_10011461 | JGI25153J46596_100114613 | 132 |
| 388 | 3300003354 | JGI25160J50197_1002192 | JGI25160J50197_10021924 | 132 |
| 389 | 3300003354 | JGI25160J50197_1008449 | JGI25160J50197_10084493 | 132 |
| 390 | 3300003354 | JGI25160J50197_1013575 | JGI25160J50197_10135751 | 132 |
| 391 | 3300003794 | Ga0055531_10014195 | Ga0055531_100141953 | 132 |
| 392 | 3300004625 | Ga0055543_1015878 | Ga0055543_10158782 | 132 |
| 393 | 3300005262 | Ga0065165_1003559 | Ga0065165_10035599 | 132 |
| 394 | 3300005262 | Ga0065165_1003853 | Ga0065165_100385310 | 132 |
| 395 | 3300005262 | Ga0065165_1018994 | Ga0065165_10189941 | 132 |
| 396 | 3300005262 | Ga0065165_1114374 | Ga0065165_11143741 | 132 |
| 397 | 3300005339 | Ga0070660_100814677 | Ga0070660_1008146772 | 132 |
| 398 | 3300005344 | Ga0070661_100288474 | Ga0070661_1002884741 | 132 |
| 399 | 3300005366 | Ga0070659_101526241 | Ga0070659_1015262411 | 132 |
| 400 | 3300005455 | Ga0070663_100060665 | Ga0070663_1000606652 | 132 |
| 401 | 3300005539 | Ga0068853_100547786 | Ga0068853_1005477861 | 132 |
| 402 | 3300005547 | Ga0070693_100296525 | Ga0070693_1002965251 | 132 |
| 403 | 3300005548 | Ga0070665_100263003 | Ga0070665_1002630031 | 132 |
| 404 | 3300005578 | Ga0068854_100051014 | Ga0068854_1000510143 | 132 |
| 405 | 3300005614 | Ga0068856_100449393 | Ga0068856_1004493931 | 132 |
| 406 | 3300005616 | Ga0068852_100258731 | Ga0068852_1002587311 | 132 |
| 407 | 3300005834 | Ga0068851_10221768 | Ga0068851_102217682 | 132 |
| 408 | 3300005843 | Ga0068860_101526264 | Ga0068860_1015262641 | 132 |
| 409 | 3300005983 | Ga0081540_1023528 | Ga0081540_10235283 | 132 |
| 410 | 3300006038 | Ga0075365_10016403 | Ga0075365_100164032 | 132 |
| 411 | 3300006038 | Ga0075365_10040718 | Ga0075365_100407184 | 132 |
| 412 | 3300006051 | Ga0075364_10248096 | Ga0075364_102480963 | 132 |
| 413 | 3300006178 | Ga0075367_10098442 | Ga0075367_100984423 | 132 |
| 414 | 3300006186 | Ga0075369_10018548 | Ga0075369_100185483 | 132 |
| 415 | 3300006186 | Ga0075369_10354305 | Ga0075369_103543051 | 132 |
| 416 | 3300006195 | Ga0075366_10099715 | Ga0075366_100997153 | 132 |
| 417 | 3300006195 | Ga0075366_10187259 | Ga0075366_101872591 | 132 |
| 418 | 3300006353 | Ga0075370_10039847 | Ga0075370_100398473 | 132 |
| 419 | 3300006353 | Ga0075370_10046929 | Ga0075370_100469291 | 132 |
| 420 | 3300006353 | Ga0075370_10246684 | Ga0075370_102466842 | 132 |
| 421 | 3300006942 | Ga0099824_1020528 | Ga0099824_10205283 | 132 |
| 422 | 3300009098 | Ga0105245_10406223 | Ga0105245_104062232 | 132 |
| 423 | 3300009174 | Ga0105241_10430170 | Ga0105241_104301702 | 132 |
| 424 | 3300009177 | Ga0105248_12619949 | Ga0105248_126199491 | 132 |
| 425 | 3300009545 | Ga0105237_10123798 | Ga0105237_101237983 | 132 |
| 426 | 3300009545 | Ga0105237_10800229 | Ga0105237_108002292 | 132 |
| 427 | 3300009551 | Ga0105238_10442170 | Ga0105238_104421702 | 132 |
| 428 | 3300010375 | Ga0105239_10142500 | Ga0105239_101425002 | 132 |
| 429 | 3300010375 | Ga0105239_10371171 | Ga0105239_103711712 | 132 |
| 430 | 3300010375 | Ga0105239_10421858 | Ga0105239_104218583 | 132 |
| 431 | 3300010375 | Ga0105239_10972499 | Ga0105239_109724991 | 132 |
| 432 | 3300013100 | Ga0157373_10312320 | Ga0157373_103123202 | 132 |
| 433 | 3300013102 | Ga0157371_10203224 | Ga0157371_102032242 | 132 |
| 434 | 3300013104 | Ga0157370_11104193 | Ga0157370_111041932 | 132 |
| 435 | 3300013105 | Ga0157369_10247516 | Ga0157369_102475162 | 132 |
| 436 | 3300013307 | Ga0157372_10335864 | Ga0157372_103358641 | 132 |
| 437 | 3300021320 | Ga0214544_1000002 | Ga0214544_1000002523 | 132 |
| 438 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001873 | 132 |
| 439 | 3300021321 | Ga0214542_1037264 | Ga0214542_10372642 | 132 |
| 440 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001939 | 132 |
| 441 | 3300021324 | Ga0214545_1029177 | Ga0214545_10291773 | 132 |
| 442 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001254 | 132 |
| 443 | 3300022467 | Ga0224712_10215445 | Ga0224712_102154452 | 132 |
| 444 | 3300025253 | Ga0209677_104330 | Ga0209677_1043302 | 132 |
| 445 | 3300025261 | Ga0209233_1011472 | Ga0209233_10114722 | 132 |
| 446 | 3300025273 | Ga0209673_1032716 | Ga0209673_10327162 | 132 |
| 447 | 3300025295 | Ga0209564_1004524 | Ga0209564_10045244 | 132 |
| 448 | 3300025295 | Ga0209564_1009791 | Ga0209564_10097914 | 132 |
| 449 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021607 | 132 |
| 450 | 3300025297 | Ga0209758_1001632 | Ga0209758_100163210 | 132 |
| 451 | 3300025297 | Ga0209758_1002055 | Ga0209758_100205511 | 132 |
| 452 | 3300025297 | Ga0209758_1003008 | Ga0209758_10030088 | 132 |
| 453 | 3300025297 | Ga0209758_1037482 | Ga0209758_10374823 | 132 |
| 454 | 3300025299 | Ga0209256_1006522 | Ga0209256_10065223 | 132 |
| 455 | 3300025302 | Ga0207426_1000960 | Ga0207426_100096013 | 132 |
| 456 | 3300025302 | Ga0207426_1004043 | Ga0207426_10040438 | 132 |
| 457 | 3300025302 | Ga0207426_1015353 | Ga0207426_10153532 | 132 |
| 458 | 3300025304 | Ga0209257_1002332 | Ga0209257_100233211 | 132 |
| 459 | 3300025321 | Ga0207656_10045214 | Ga0207656_100452142 | 132 |
| 460 | 3300025913 | Ga0207695_10922659 | Ga0207695_109226592 | 132 |
| 461 | 3300025914 | Ga0207671_10554433 | Ga0207671_105544331 | 132 |
| 462 | 3300025919 | Ga0207657_10551261 | Ga0207657_105512613 | 132 |
| 463 | 3300025924 | Ga0207694_10644244 | Ga0207694_106442441 | 132 |
| 464 | 3300025944 | Ga0207661_10192288 | Ga0207661_101922882 | 132 |
| 465 | 3300026067 | Ga0207678_10016384 | Ga0207678_100163843 | 132 |
| 466 | 3300026067 | Ga0207678_10480488 | Ga0207678_104804882 | 132 |
| 467 | 3300027296 | Ga0209389_1000121 | Ga0209389_100012150 | 132 |
| 468 | 3300027357 | Ga0209589_1002735 | Ga0209589_10027359 | 132 |
| 469 | 3300027361 | Ga0209489_103445 | Ga0209489_1034459 | 132 |
| 470 | 3300028379 | Ga0268266_10257040 | Ga0268266_102570401 | 132 |
| 471 | 3300031507 | Ga0307509_10004249 | Ga0307509_1000424919 | 132 |
| 472 | 3300031616 | Ga0307508_10029469 | Ga0307508_100294694 | 132 |
| 473 | 3300031730 | Ga0307516_10145109 | Ga0307516_101451093 | 132 |
| 474 | 3300031730 | Ga0307516_10275546 | Ga0307516_102755462 | 132 |
| 475 | 3300031730 | Ga0307516_10542889 | Ga0307516_105428891 | 132 |
| 476 | 3300033179 | Ga0307507_10005195 | Ga0307507_1000519519 | 132 |
| 477 | 3300035083 | Ga0373926_0033177 | Ga0373926_0033177_1292_1708 | 132 |
| 478 | 3300035086 | Ga0373934_0014244 | Ga0373934_0014244_212_628 | 132 |
| 479 | 3300035113 | Ga0373936_0106474 | Ga0373936_0106474_557_973 | 132 |
| 480 | 3300035116 | Ga0373945_0005241 | Ga0373945_0005241_3236_3652 | 132 |
| 481 | 3300035117 | Ga0373953_0186763 | Ga0373953_0186763_182_598 | 132 |
| 482 | 3300035118 | Ga0373954_0005085 | Ga0373954_0005085_4613_5029 | 132 |
| 483 | 3300035120 | Ga0373957_0114970 | Ga0373957_0114970_362_778 | 132 |
| 484 | 3300035170 | Ga0373943_0155773 | Ga0373943_0155773_791_1207 | 132 |
| 485 | 3300035170 | Ga0373943_0221746 | Ga0373943_0221746_469_876 | 132 |
| 486 | 3300035172 | Ga0373955_0016162 | Ga0373955_0016162_922_1338 | 132 |
| 487 | 3300035410 | Ga0373924_0043558 | Ga0373924_0043558_1400_1816 | 132 |
| 488 | 3300035692 | Ga0373935_0010545 | Ga0373935_0010545_2345_2752 | 132 |
| 489 | 3300035692 | Ga0373935_0032760 | Ga0373935_0032760_765_1181 | 132 |
| 490 | 3300035695 | Ga0373927_0018507 | Ga0373927_0018507_1740_2147 | 132 |
| 491 | 3300035695 | Ga0373927_0079859 | Ga0373927_0079859_977_1393 | 132 |
| 492 | 3300035724 | Ga0373933_0007396 | Ga0373933_0007396_2033_2449 | 132 |
| 493 | 3300035725 | Ga0373947_0007178 | Ga0373947_0007178_2424_2840 | 132 |
| 494 | 3300036401 | Ga0373937_0968470 | Ga0373937_0968470_356_772 | 132 |
| 495 | 3300037068 | Ga0373925_0006804 | Ga0373925_0006804_4660_5067 | 132 |
| 496 | 3300037068 | Ga0373925_0036806 | Ga0373925_0036806_1401_1817 | 132 |
| 497 | 3300041443 | Ga0451789_0382349 | Ga0451789_0382349_550_954 | 132 |
| 498 | 3300041486 | Ga0451807_1616728 | Ga0451807_1616728_895_1299 | 132 |
| 499 | 3300044683 | Ga0466965_0051814 | Ga0466965_0051814_840_1244 | 132 |
| 500 | 3300044901 | Ga0466960_0391756 | Ga0466960_0391756_344_748 | 132 |
| 501 | 3300045976 | Ga0466967_2493582 | Ga0466967_2493582_16_420 | 132 |
| 502 | 3300046454 | Ga0495592_0092975 | Ga0495592_0092975_1475_1891 | 132 |
| 503 | 3300046455 | Ga0495603_0438745 | Ga0495603_0438745_246_653 | 132 |
| 504 | 3300046460 | Ga0495638_0188969 | Ga0495638_0188969_458_862 | 132 |
| 505 | 3300046463 | Ga0495653_0316077 | Ga0495653_0316077_225_641 | 132 |
| 506 | 3300046473 | Ga0495582_0044946 | Ga0495582_0044946_854_1270 | 132 |
| 507 | 3300046475 | Ga0495639_0010400 | Ga0495639_0010400_190_606 | 132 |
| 508 | 3300046476 | Ga0495662_0135393 | Ga0495662_0135393_180_596 | 132 |
| 509 | 3300046477 | Ga0495664_0024884 | Ga0495664_0024884_2869_3285 | 132 |
| 510 | 3300046517 | Ga0495630_0147529 | Ga0495630_0147529_1255_1671 | 132 |
| 511 | 3300046522 | Ga0495643_0165258 | Ga0495643_0165258_349_753 | 132 |
| 512 | 3300046524 | Ga0495648_0254745 | Ga0495648_0254745_40_444 | 132 |
| 513 | 3300046526 | Ga0495666_0234605 | Ga0495666_0234605_25_441 | 132 |
| 514 | 3300046529 | Ga0495652_0362537 | Ga0495652_0362537_247_663 | 132 |
| 515 | 3300046531 | Ga0495665_0031748 | Ga0495665_0031748_2104_2520 | 132 |
| 516 | 3300046533 | Ga0495640_0027019 | Ga0495640_0027019_939_1355 | 132 |
| 517 | 3300046557 | Ga0495622_0018402 | Ga0495622_0018402_408_815 | 132 |
| 518 | 3300046557 | Ga0495622_0097730 | Ga0495622_0097730_33_449 | 132 |
| 519 | 3300046615 | Ga0495656_0312677 | Ga0495656_0312677_68_466 | 132 |
| 520 | 3300046663 | Ga0495635_0057029 | Ga0495635_0057029_324_740 | 132 |
| 521 | 3300046674 | Ga0495588_0183773 | Ga0495588_0183773_367_783 | 132 |
| 522 | 3300046678 | Ga0495599_0218843 | Ga0495599_0218843_537_941 | 132 |
| 523 | 3300046679 | Ga0495623_0177519 | Ga0495623_0177519_122_538 | 132 |
| 524 | 3300046680 | Ga0495646_0022475 | Ga0495646_0022475_1244_1660 | 132 |
| 525 | 3300046681 | Ga0495647_0226105 | Ga0495647_0226105_263_679 | 132 |
| 526 | 3300046690 | Ga0495624_0023114 | Ga0495624_0023114_1370_1786 | 132 |
| 527 | 3300046690 | Ga0495624_0696746 | Ga0495624_0696746_150_557 | 132 |
| 528 | 3300046691 | Ga0495670_0784625 | Ga0495670_0784625_69_473 | 132 |
| 529 | 3300047315 | Ga0495581_0012239 | Ga0495581_0012239_3578_3994 | 132 |
| 530 | 3300047320 | Ga0495672_0010334 | Ga0495672_0010334_3931_4338 | 132 |
| 531 | 3300047472 | Ga0495686_0018484 | Ga0495686_0018484_3274_3678 | 132 |
| 532 | 3300047472 | Ga0495686_0143251 | Ga0495686_0143251_907_1311 | 132 |
| 533 | 3300047472 | Ga0495686_0172030 | Ga0495686_0172030_23_427 | 132 |
| 534 | 3300047673 | Ga0495593_0015060 | Ga0495593_0015060_3924_4340 | 132 |
| 535 | 3300048088 | Ga0495602_0179814 | Ga0495602_0179814_534_938 | 132 |
| 536 | 3300048089 | Ga0495614_0073888 | Ga0495614_0073888_174_590 | 132 |
| 537 | 3300048907 | Ga0496104_0828957 | Ga0496104_0828957_63_467 | 132 |
| 538 | 3300048909 | Ga0496106_0036778 | Ga0496106_0036778_932_1339 | 132 |
| 539 | 3300048910 | Ga0496107_0585362 | Ga0496107_0585362_361_768 | 132 |
| 540 | 3300048911 | Ga0496108_0113908 | Ga0496108_0113908_1412_1816 | 132 |
| 541 | 3300048919 | Ga0496116_0187055 | Ga0496116_0187055_145_552 | 132 |
| 542 | 3300048920 | Ga0496117_0004259 | Ga0496117_0004259_3652_4059 | 132 |
| 543 | 3300048921 | Ga0496118_0003088 | Ga0496118_0003088_2142_2549 | 132 |
| 544 | 3300048924 | Ga0496121_0016621 | Ga0496121_0016621_6682_7089 | 132 |
| 545 | 3300048924 | Ga0496121_0117679 | Ga0496121_0117679_540_944 | 132 |
| 546 | 3300048924 | Ga0496121_0252348 | Ga0496121_0252348_10_414 | 132 |
| 547 | 3300048924 | Ga0496121_0314016 | Ga0496121_0314016_617_1015 | 132 |
| 548 | 3300048925 | Ga0496122_0039256 | Ga0496122_0039256_3001_3399 | 132 |
| 549 | 3300048925 | Ga0496122_0089136 | Ga0496122_0089136_1562_1978 | 132 |
| 550 | 3300048926 | Ga0496123_0151656 | Ga0496123_0151656_231_629 | 132 |
| 551 | 3300048927 | Ga0496124_0010613 | Ga0496124_0010613_8245_8652 | 132 |
| 552 | 3300048927 | Ga0496124_0348366 | Ga0496124_0348366_480_878 | 132 |
| 553 | 3300048928 | Ga0496125_0000576 | Ga0496125_0000576_9030_9446 | 132 |
| 554 | 3300048928 | Ga0496125_0019582 | Ga0496125_0019582_5326_5745 | 132 |
| 555 | 3300048928 | Ga0496125_0202652 | Ga0496125_0202652_99_506 | 132 |
| 556 | 3300048929 | Ga0496126_0058272 | Ga0496126_0058272_1480_1884 | 132 |
| 557 | 3300048929 | Ga0496126_0213502 | Ga0496126_0213502_1038_1445 | 132 |
| 558 | 3300048929 | Ga0496126_0374307 | Ga0496126_0374307_423_821 | 132 |
| 559 | 3300048929 | Ga0496126_0718546 | Ga0496126_0718546_321_725 | 132 |
| 560 | 3300049571 | Ga0501034_0421400 | Ga0501034_0421400_31_438 | 132 |
| 561 | 3300049571 | Ga0501034_0681412 | Ga0501034_0681412_114_518 | 132 |
| 562 | 3300049579 | Ga0501043_0214826 | Ga0501043_0214826_123_530 | 132 |
| 563 | 3300050490 | nmdc:mga03n38_128213_c1 | nmdc:mga03n38_128213_c1_768_1178 | 132 |
| 564 | 3300050491 | nmdc:mga00v17_107752_c1 | nmdc:mga00v17_107752_c1_350_769 | 132 |
| 565 | 3300050492 | nmdc:mga0yw44_39479_c1 | nmdc:mga0yw44_39479_c1_1255_1659 | 132 |
| 566 | 3300050492 | nmdc:mga0yw44_62329_c1 | nmdc:mga0yw44_62329_c1_1287_1706 | 132 |
| 567 | 3300050493 | nmdc:mga0k408_51282_c2 | nmdc:mga0k408_51282_c2_147_566 | 132 |
| 568 | 3300050493 | nmdc:mga0k408_71835_c1 | nmdc:mga0k408_71835_c1_994_1413 | 132 |
| 569 | 3300050494 | nmdc:mga06z11_74470_c1 | nmdc:mga06z11_74470_c1_865_1284 | 132 |
| 570 | 3300050495 | nmdc:mga04h51_250762_c1 | nmdc:mga04h51_250762_c1_90_509 | 132 |
| 571 | 3300050496 | nmdc:mga07m45_33961_c1 | nmdc:mga07m45_33961_c1_1894_2313 | 132 |
| 572 | 3300050516 | nmdc:mga0sz30_288030_c1 | nmdc:mga0sz30_288030_c1_253_672 | 132 |
| 573 | 3300050516 | nmdc:mga0sz30_49993_c1 | nmdc:mga0sz30_49993_c1_1101_1505 | 132 |
| 574 | 3300050516 | nmdc:mga0sz30_81144_c1 | nmdc:mga0sz30_81144_c1_84_503 | 132 |
| 575 | 3300053077 | Ga0495601_0183577 | Ga0495601_0183577_924_1340 | 132 |
| 576 | 3300053078 | Ga0495612_0102346 | Ga0495612_0102346_639_1055 | 132 |
| 577 | 3300053080 | Ga0500635_0358177 | Ga0500635_0358177_124_531 | 132 |
| 578 | 3300053085 | Ga0495619_0751323 | Ga0495619_0751323_214_630 | 132 |
| 579 | 3300053086 | Ga0500578_0374869 | Ga0500578_0374869_180_584 | 132 |
| 580 | 3300053087 | Ga0500643_000015 | Ga0500643_000015_135891_136295 | 132 |
| 581 | 3300053090 | Ga0500646_0086683 | Ga0500646_0086683_493_897 | 132 |
| 582 | 3300053091 | Ga0500647_0185946 | Ga0500647_0185946_460_867 | 132 |
| 583 | 3300053092 | Ga0500583_0012287 | Ga0500583_0012287_2271_2675 | 132 |
| 584 | 3300053093 | Ga0500651_0023742 | Ga0500651_0023742_3068_3472 | 132 |
| 585 | 3300053094 | Ga0500566_0287934 | Ga0500566_0287934_49_456 | 132 |
| 586 | 3300053096 | Ga0500641_0055443 | Ga0500641_0055443_553_957 | 132 |
| 587 | 3300053097 | Ga0500648_287578 | Ga0500648_287578_274_681 | 132 |
| 588 | 3300053098 | Ga0500650_0072474 | Ga0500650_0072474_916_1320 | 132 |
| 589 | 3300053103 | Ga0500555_002428 | Ga0500555_002428_2373_2777 | 132 |
| 590 | 3300053109 | Ga0500569_009023 | Ga0500569_009023_1422_1868 | 132 |
| 591 | 3300053116 | Ga0500592_003427 | Ga0500592_003427_52_456 | 132 |
| 592 | 3300053118 | Ga0500594_0053683 | Ga0500594_0053683_11_415 | 132 |
| 593 | 3300053119 | Ga0500595_019337 | Ga0500595_019337_1243_1647 | 132 |
| 594 | 3300053119 | Ga0500595_036295 | Ga0500595_036295_754_1161 | 132 |
| 595 | 3300053119 | Ga0500595_056065 | Ga0500595_056065_437_841 | 132 |
| 596 | 3300053120 | Ga0500597_134524 | Ga0500597_134524_419_826 | 132 |
| 597 | 3300053126 | Ga0500621_160597 | Ga0500621_160597_170_574 | 132 |
| 598 | 3300053130 | Ga0500642_0046985 | Ga0500642_0046985_235_639 | 132 |
| 599 | 3300053134 | Ga0500658_0043797 | Ga0500658_0043797_889_1293 | 132 |
| 600 | 3300053136 | Ga0500559_0206860 | Ga0500559_0206860_175_582 | 132 |
| 601 | 3300053139 | Ga0500568_0008824 | Ga0500568_0008824_1626_2030 | 132 |
| 602 | 3300053140 | Ga0500573_0210077 | Ga0500573_0210077_274_681 | 132 |
| 603 | 3300053142 | Ga0500577_0287116 | Ga0500577_0287116_218_622 | 132 |
| 604 | 3300053147 | Ga0500589_217020 | Ga0500589_217020_189_593 | 132 |
| 605 | 3300053148 | Ga0500590_063474 | Ga0500590_063474_34_438 | 132 |
| 606 | 3300053148 | Ga0500590_113165 | Ga0500590_113165_247_654 | 132 |
| 607 | 3300053148 | Ga0500590_301740 | Ga0500590_301740_25_429 | 132 |
| 608 | 3300053151 | Ga0500604_0006501 | Ga0500604_0006501_556_960 | 132 |
| 609 | 3300053158 | Ga0500627_0019817 | Ga0500627_0019817_353_757 | 132 |
| 610 | 3300053161 | Ga0500634_0111738 | Ga0500634_0111738_497_901 | 132 |
| 611 | 3300053162 | Ga0500638_064128 | Ga0500638_064128_1057_1464 | 132 |
| 612 | 3300053163 | Ga0500639_100173 | Ga0500639_100173_227_634 | 132 |
| 613 | 3300053177 | Ga0500636_0058456 | Ga0500636_0058456_695_1102 | 132 |
| 614 | 3300053177 | Ga0500636_0260680 | Ga0500636_0260680_274_681 | 132 |
| 615 | 3300053178 | Ga0500637_0036416 | Ga0500637_0036416_181_588 | 132 |
| 616 | 3300053735 | Ga0500596_000636 | Ga0500596_000636_5998_6405 | 132 |
| 617 | 3300053735 | Ga0500596_017831 | Ga0500596_017831_36_440 | 132 |
| 618 | 3300053737 | Ga0500601_000153 | Ga0500601_000153_12825_13229 | 132 |
| 619 | 3300053737 | Ga0500601_011643 | Ga0500601_011643_423_827 | 132 |
| 620 | 3300055283 | Ga0500661_042965 | Ga0500661_042965_180_584 | 132 |
| 621 | iso_pu_bacteria | 2922361189 | 2922363536 | 132 |
| 622 | 3300003771 | Ga0055526_1009092 | Ga0055526_10090925 | 133 |
| 623 | 3300005366 | Ga0070659_100927812 | Ga0070659_1009278122 | 133 |
| 624 | 3300005434 | Ga0070709_10018262 | Ga0070709_100182626 | 133 |
| 625 | 3300005434 | Ga0070709_10056927 | Ga0070709_100569273 | 133 |
| 626 | 3300005435 | Ga0070714_100045655 | Ga0070714_1000456553 | 133 |
| 627 | 3300005435 | Ga0070714_100160138 | Ga0070714_1001601383 | 133 |
| 628 | 3300005437 | Ga0070710_10006722 | Ga0070710_100067227 | 133 |
| 629 | 3300005439 | Ga0070711_100002267 | Ga0070711_1000022677 | 133 |
| 630 | 3300005439 | Ga0070711_100007952 | Ga0070711_1000079526 | 133 |
| 631 | 3300005458 | Ga0070681_10196417 | Ga0070681_101964173 | 133 |
| 632 | 3300005468 | Ga0070707_100151016 | Ga0070707_1001510161 | 133 |
| 633 | 3300005471 | Ga0070698_100049606 | Ga0070698_1000496063 | 133 |
| 634 | 3300005578 | Ga0068854_100132481 | Ga0068854_1001324813 | 133 |
| 635 | 3300006028 | Ga0070717_10009967 | Ga0070717_100099671 | 133 |
| 636 | 3300006163 | Ga0070715_10002384 | Ga0070715_100023843 | 133 |
| 637 | 3300006173 | Ga0070716_100004420 | Ga0070716_1000044203 | 133 |
| 638 | 3300006175 | Ga0070712_100117731 | Ga0070712_1001177313 | 133 |
| 639 | 3300006175 | Ga0070712_100139184 | Ga0070712_1001391842 | 133 |
| 640 | 3300006175 | Ga0070712_100885590 | Ga0070712_1008855901 | 133 |
| 641 | 3300006852 | Ga0075433_10964081 | Ga0075433_109640812 | 133 |
| 642 | 3300006871 | Ga0075434_100041162 | Ga0075434_1000411624 | 133 |
| 643 | 3300006914 | Ga0075436_100341501 | Ga0075436_1003415012 | 133 |
| 644 | 3300006944 | Ga0099823_1098135 | Ga0099823_10981351 | 133 |
| 645 | 3300007076 | Ga0075435_100024687 | Ga0075435_1000246872 | 133 |
| 646 | 3300007265 | Ga0099794_10548499 | Ga0099794_105484991 | 133 |
| 647 | 3300009174 | Ga0105241_10037913 | Ga0105241_100379133 | 133 |
| 648 | 3300010375 | Ga0105239_10020953 | Ga0105239_100209533 | 133 |
| 649 | 3300013306 | Ga0163162_10869235 | Ga0163162_108692352 | 133 |
| 650 | 3300013307 | Ga0157372_10958274 | Ga0157372_109582742 | 133 |
| 651 | 3300014969 | Ga0157376_11031207 | Ga0157376_110312072 | 133 |
| 652 | 3300025295 | Ga0209564_1002508 | Ga0209564_100250812 | 133 |
| 653 | 3300025297 | Ga0209758_1030454 | Ga0209758_10304542 | 133 |
| 654 | 3300025898 | Ga0207692_10000524 | Ga0207692_100005245 | 133 |
| 655 | 3300025905 | Ga0207685_10059983 | Ga0207685_100599832 | 133 |
| 656 | 3300025906 | Ga0207699_10065696 | Ga0207699_100656963 | 133 |
| 657 | 3300025906 | Ga0207699_10149525 | Ga0207699_101495253 | 133 |
| 658 | 3300025911 | Ga0207654_10113935 | Ga0207654_101139353 | 133 |
| 659 | 3300025912 | Ga0207707_10015827 | Ga0207707_100158276 | 133 |
| 660 | 3300025915 | Ga0207693_10005027 | Ga0207693_100050273 | 133 |
| 661 | 3300025916 | Ga0207663_10000451 | Ga0207663_100004513 | 133 |
| 662 | 3300025916 | Ga0207663_10082366 | Ga0207663_100823663 | 133 |
| 663 | 3300025929 | Ga0207664_10017534 | Ga0207664_100175342 | 133 |
| 664 | 3300025929 | Ga0207664_11398112 | Ga0207664_113981121 | 133 |
| 665 | 3300025932 | Ga0207690_10406778 | Ga0207690_104067782 | 133 |
| 666 | 3300025939 | Ga0207665_10002128 | Ga0207665_1000212811 | 133 |
| 667 | 3300026078 | Ga0207702_11127863 | Ga0207702_111278631 | 133 |
| 668 | 3300027296 | Ga0209389_1000008 | Ga0209389_1000008224 | 133 |
| 669 | 3300027361 | Ga0209489_108921 | Ga0209489_10892113 | 133 |
| 670 | 3300028379 | Ga0268266_11019194 | Ga0268266_110191942 | 133 |
| 671 | 3300031616 | Ga0307508_10015749 | Ga0307508_100157492 | 133 |
| 672 | 3300031616 | Ga0307508_10279775 | Ga0307508_102797752 | 133 |
| 673 | 3300031838 | Ga0307518_10433115 | Ga0307518_104331151 | 133 |
| 674 | 3300033180 | Ga0307510_10122842 | Ga0307510_101228422 | 133 |
| 675 | 3300035111 | Ga0373923_0031733 | Ga0373923_0031733_1184_1591 | 133 |
| 676 | 3300035113 | Ga0373936_0172676 | Ga0373936_0172676_478_885 | 133 |
| 677 | 3300035113 | Ga0373936_0209172 | Ga0373936_0209172_330_737 | 133 |
| 678 | 3300035117 | Ga0373953_0003587 | Ga0373953_0003587_3238_3645 | 133 |
| 679 | 3300035118 | Ga0373954_0005008 | Ga0373954_0005008_2073_2480 | 133 |
| 680 | 3300035119 | Ga0373956_0001696 | Ga0373956_0001696_1556_1963 | 133 |
| 681 | 3300035120 | Ga0373957_0120878 | Ga0373957_0120878_500_907 | 133 |
| 682 | 3300035172 | Ga0373955_0000654 | Ga0373955_0000654_6602_7009 | 133 |
| 683 | 3300035410 | Ga0373924_0013613 | Ga0373924_0013613_2472_2879 | 133 |
| 684 | 3300035692 | Ga0373935_0450317 | Ga0373935_0450317_505_912 | 133 |
| 685 | 3300035724 | Ga0373933_0001815 | Ga0373933_0001815_3340_3747 | 133 |
| 686 | 3300035724 | Ga0373933_0089651 | Ga0373933_0089651_201_608 | 133 |
| 687 | 3300036401 | Ga0373937_0009279 | Ga0373937_0009279_1129_1536 | 133 |
| 688 | 3300036401 | Ga0373937_0608111 | Ga0373937_0608111_582_986 | 133 |
| 689 | 3300036401 | Ga0373937_1565503 | Ga0373937_1565503_59_466 | 133 |
| 690 | 3300037312 | Ga0395899_0016993 | Ga0395899_0016993_1589_2026 | 133 |
| 691 | 3300037418 | Ga0395900_0000361 | Ga0395900_0000361_29659_30096 | 133 |
| 692 | 3300037418 | Ga0395900_0525255 | Ga0395900_0525255_494_901 | 133 |
| 693 | 3300037471 | Ga0395905_0127300 | Ga0395905_0127300_136_537 | 133 |
| 694 | 3300037471 | Ga0395905_0152640 | Ga0395905_0152640_721_1158 | 133 |
| 695 | 3300037471 | Ga0395905_0901021 | Ga0395905_0901021_277_678 | 133 |
| 696 | 3300038443 | Ga0395901_0320644 | Ga0395901_0320644_559_996 | 133 |
| 697 | 3300038443 | Ga0395901_0582442 | Ga0395901_0582442_355_762 | 133 |
| 698 | 3300044658 | Ga0466972_0004782 | Ga0466972_0004782_2865_3317 | 133 |
| 699 | 3300044683 | Ga0466965_0295951 | Ga0466965_0295951_270_722 | 133 |
| 700 | 3300044735 | Ga0466968_0006041 | Ga0466968_0006041_753_1205 | 133 |
| 701 | 3300044901 | Ga0466960_0030663 | Ga0466960_0030663_1575_2027 | 133 |
| 702 | 3300045976 | Ga0466967_0106052 | Ga0466967_0106052_981_1430 | 133 |
| 703 | 3300045976 | Ga0466967_0128481 | Ga0466967_0128481_1483_1887 | 133 |
| 704 | 3300046454 | Ga0495592_0004904 | Ga0495592_0004904_1119_1526 | 133 |
| 705 | 3300046454 | Ga0495592_0042264 | Ga0495592_0042264_2064_2501 | 133 |
| 706 | 3300046454 | Ga0495592_0398631 | Ga0495592_0398631_423_860 | 133 |
| 707 | 3300046459 | Ga0495629_0002829 | Ga0495629_0002829_7564_7971 | 133 |
| 708 | 3300046459 | Ga0495629_0003943 | Ga0495629_0003943_10596_11033 | 133 |
| 709 | 3300046462 | Ga0495651_0014893 | Ga0495651_0014893_2669_3106 | 133 |
| 710 | 3300046462 | Ga0495651_0061893 | Ga0495651_0061893_1329_1736 | 133 |
| 711 | 3300046463 | Ga0495653_0120438 | Ga0495653_0120438_991_1398 | 133 |
| 712 | 3300046477 | Ga0495664_0042170 | Ga0495664_0042170_118_555 | 133 |
| 713 | 3300046511 | Ga0495608_0009394 | Ga0495608_0009394_4007_4414 | 133 |
| 714 | 3300046511 | Ga0495608_0058675 | Ga0495608_0058675_104_541 | 133 |
| 715 | 3300046511 | Ga0495608_0683821 | Ga0495608_0683821_160_597 | 133 |
| 716 | 3300046514 | Ga0495618_0064513 | Ga0495618_0064513_255_662 | 133 |
| 717 | 3300046514 | Ga0495618_0274739 | Ga0495618_0274739_552_989 | 133 |
| 718 | 3300046516 | Ga0495628_0025979 | Ga0495628_0025979_1457_1864 | 133 |
| 719 | 3300046517 | Ga0495630_0472982 | Ga0495630_0472982_51_488 | 133 |
| 720 | 3300046517 | Ga0495630_0508298 | Ga0495630_0508298_129_536 | 133 |
| 721 | 3300046529 | Ga0495652_0007665 | Ga0495652_0007665_6983_7390 | 133 |
| 722 | 3300046529 | Ga0495652_0059728 | Ga0495652_0059728_1859_2296 | 133 |
| 723 | 3300046533 | Ga0495640_0019557 | Ga0495640_0019557_2121_2528 | 133 |
| 724 | 3300046533 | Ga0495640_0101686 | Ga0495640_0101686_140_577 | 133 |
| 725 | 3300046533 | Ga0495640_0407900 | Ga0495640_0407900_313_750 | 133 |
| 726 | 3300046536 | Ga0495587_0015651 | Ga0495587_0015651_3334_3741 | 133 |
| 727 | 3300046536 | Ga0495587_0046610 | Ga0495587_0046610_68_505 | 133 |
| 728 | 3300046536 | Ga0495587_0152951 | Ga0495587_0152951_354_791 | 133 |
| 729 | 3300046543 | Ga0495645_0012169 | Ga0495645_0012169_2589_2996 | 133 |
| 730 | 3300046557 | Ga0495622_0028791 | Ga0495622_0028791_163_600 | 133 |
| 731 | 3300046559 | Ga0495667_0008508 | Ga0495667_0008508_4135_4542 | 133 |
| 732 | 3300046559 | Ga0495667_0072740 | Ga0495667_0072740_1205_1642 | 133 |
| 733 | 3300046559 | Ga0495667_0209255 | Ga0495667_0209255_109_546 | 133 |
| 734 | 3300046616 | Ga0495668_0146713 | Ga0495668_0146713_825_1262 | 133 |
| 735 | 3300046642 | Ga0495634_0014729 | Ga0495634_0014729_1257_1664 | 133 |
| 736 | 3300046660 | Ga0495625_0418917 | Ga0495625_0418917_188_625 | 133 |
| 737 | 3300046663 | Ga0495635_0001593 | Ga0495635_0001593_10436_10873 | 133 |
| 738 | 3300046663 | Ga0495635_0004356 | Ga0495635_0004356_3147_3554 | 133 |
| 739 | 3300046675 | Ga0495657_0005903 | Ga0495657_0005903_1312_1719 | 133 |
| 740 | 3300046675 | Ga0495657_0053555 | Ga0495657_0053555_470_907 | 133 |
| 741 | 3300046675 | Ga0495657_0100112 | Ga0495657_0100112_564_1001 | 133 |
| 742 | 3300046678 | Ga0495599_0007978 | Ga0495599_0007978_1882_2289 | 133 |
| 743 | 3300046678 | Ga0495599_0045761 | Ga0495599_0045761_2297_2734 | 133 |
| 744 | 3300046679 | Ga0495623_0014466 | Ga0495623_0014466_4434_4841 | 133 |
| 745 | 3300046679 | Ga0495623_0019902 | Ga0495623_0019902_3582_4019 | 133 |
| 746 | 3300046680 | Ga0495646_0002355 | Ga0495646_0002355_6100_6507 | 133 |
| 747 | 3300046689 | Ga0495613_0023828 | Ga0495613_0023828_2760_3197 | 133 |
| 748 | 3300046689 | Ga0495613_0047589 | Ga0495613_0047589_2718_3125 | 133 |
| 749 | 3300046690 | Ga0495624_0047452 | Ga0495624_0047452_1533_1970 | 133 |
| 750 | 3300046694 | Ga0495649_0039388 | Ga0495649_0039388_837_1274 | 133 |
| 751 | 3300046809 | Ga0495600_0004104 | Ga0495600_0004104_3120_3527 | 133 |
| 752 | 3300046809 | Ga0495600_0007598 | Ga0495600_0007598_4669_5106 | 133 |
| 753 | 3300047315 | Ga0495581_0087214 | Ga0495581_0087214_396_833 | 133 |
| 754 | 3300047317 | Ga0495604_0007639 | Ga0495604_0007639_5263_5670 | 133 |
| 755 | 3300047317 | Ga0495604_0041114 | Ga0495604_0041114_247_684 | 133 |
| 756 | 3300047317 | Ga0495604_0049040 | Ga0495604_0049040_1361_1798 | 133 |
| 757 | 3300047319 | Ga0495674_0760262 | Ga0495674_0760262_206_643 | 133 |
| 758 | 3300047321 | Ga0495676_0025669 | Ga0495676_0025669_3803_4240 | 133 |
| 759 | 3300047322 | Ga0495680_0017276 | Ga0495680_0017276_2424_2831 | 133 |
| 760 | 3300047322 | Ga0495680_0022137 | Ga0495680_0022137_2283_2720 | 133 |
| 761 | 3300047444 | Ga0495675_0002949 | Ga0495675_0002949_8822_9229 | 133 |
| 762 | 3300047469 | Ga0495673_0068536 | Ga0495673_0068536_520_957 | 133 |
| 763 | 3300047471 | Ga0495684_0002455 | Ga0495684_0002455_6963_7370 | 133 |
| 764 | 3300047472 | Ga0495686_0047566 | Ga0495686_0047566_456_893 | 133 |
| 765 | 3300047673 | Ga0495593_0015312 | Ga0495593_0015312_750_1157 | 133 |
| 766 | 3300047673 | Ga0495593_0266740 | Ga0495593_0266740_112_549 | 133 |
| 767 | 3300048088 | Ga0495602_0020088 | Ga0495602_0020088_5869_6306 | 133 |
| 768 | 3300048088 | Ga0495602_0130045 | Ga0495602_0130045_474_881 | 133 |
| 769 | 3300048088 | Ga0495602_0391038 | Ga0495602_0391038_286_693 | 133 |
| 770 | 3300048907 | Ga0496104_0010283 | Ga0496104_0010283_4227_4664 | 133 |
| 771 | 3300048908 | Ga0496105_0000723 | Ga0496105_0000723_5523_5960 | 133 |
| 772 | 3300048917 | Ga0496114_0110369 | Ga0496114_0110369_1820_2257 | 133 |
| 773 | 3300048918 | Ga0496115_0493690 | Ga0496115_0493690_275_682 | 133 |
| 774 | 3300048920 | Ga0496117_0308783 | Ga0496117_0308783_377_778 | 133 |
| 775 | 3300048923 | Ga0496120_0008406 | Ga0496120_0008406_1010_1447 | 133 |
| 776 | 3300048924 | Ga0496121_0243736 | Ga0496121_0243736_635_1036 | 133 |
| 777 | 3300048927 | Ga0496124_0084916 | Ga0496124_0084916_1060_1497 | 133 |
| 778 | 3300048928 | Ga0496125_0147225 | Ga0496125_0147225_320_757 | 133 |
| 779 | 3300048929 | Ga0496126_0152106 | Ga0496126_0152106_1031_1468 | 133 |
| 780 | 3300048929 | Ga0496126_0510245 | Ga0496126_0510245_212_613 | 133 |
| 781 | 3300050496 | nmdc:mga07m45_445529_c1 | nmdc:mga07m45_445529_c1_227_664 | 133 |
| 782 | 3300050512 | nmdc:mga0n895_20634_c1 | nmdc:mga0n895_20634_c1_2359_2763 | 133 |
| 783 | 3300050513 | nmdc:mga0rr50_24153_c1 | nmdc:mga0rr50_24153_c1_3656_4060 | 133 |
| 784 | 3300050514 | nmdc:mga08x19_78608_c1 | nmdc:mga08x19_78608_c1_31_435 | 133 |
| 785 | 3300050515 | nmdc:mga0a205_1122642_c1 | nmdc:mga0a205_1122642_c1_175_579 | 133 |
| 786 | 3300053077 | Ga0495601_0027635 | Ga0495601_0027635_2586_2993 | 133 |
| 787 | 3300053084 | Ga0495595_0002117 | Ga0495595_0002117_3874_4281 | 133 |
| 788 | 3300053085 | Ga0495619_0001733 | Ga0495619_0001733_6912_7319 | 133 |
| 789 | 3300053085 | Ga0495619_0505396 | Ga0495619_0505396_311_748 | 133 |
| 790 | 3300053119 | Ga0500595_011978 | Ga0500595_011978_1019_1456 | 133 |
| 791 | 3300053130 | Ga0500642_0000086 | Ga0500642_0000086_35640_36047 | 133 |
| 792 | 3300053154 | Ga0500619_208113 | Ga0500619_208113_158_595 | 133 |
| 793 | 3300053177 | Ga0500636_0063116 | Ga0500636_0063116_1437_1874 | 133 |
| 794 | iso_pu_bacteria | 2791355199 | 2793082509 | 133 |
| 795 | 3300005262 | Ga0065165_1079852 | Ga0065165_10798522 | 134 |
| 796 | 3300005331 | Ga0070670_100620259 | Ga0070670_1006202592 | 134 |
| 797 | 3300005347 | Ga0070668_100601784 | Ga0070668_1006017841 | 134 |
| 798 | 3300005455 | Ga0070663_100043119 | Ga0070663_1000431193 | 134 |
| 799 | 3300005467 | Ga0070706_100153508 | Ga0070706_1001535082 | 134 |
| 800 | 3300005548 | Ga0070665_100835770 | Ga0070665_1008357702 | 134 |
| 801 | 3300005841 | Ga0068863_100035315 | Ga0068863_1000353154 | 134 |
| 802 | 3300005843 | Ga0068860_100000503 | Ga0068860_1000005033 | 134 |
| 803 | 3300006038 | Ga0075365_10018977 | Ga0075365_100189773 | 134 |
| 804 | 3300006042 | Ga0075368_10017827 | Ga0075368_100178272 | 134 |
| 805 | 3300006051 | Ga0075364_10122450 | Ga0075364_101224503 | 134 |
| 806 | 3300006173 | Ga0070716_100926553 | Ga0070716_1009265531 | 134 |
| 807 | 3300006175 | Ga0070712_100701470 | Ga0070712_1007014701 | 134 |
| 808 | 3300006175 | Ga0070712_101069452 | Ga0070712_1010694521 | 134 |
| 809 | 3300006186 | Ga0075369_10042859 | Ga0075369_100428593 | 134 |
| 810 | 3300006353 | Ga0075370_10030019 | Ga0075370_100300192 | 134 |
| 811 | 3300007265 | Ga0099794_10075643 | Ga0099794_100756432 | 134 |
| 812 | 3300009551 | Ga0105238_11681726 | Ga0105238_116817261 | 134 |
| 813 | 3300025295 | Ga0209564_1010831 | Ga0209564_10108314 | 134 |
| 814 | 3300025299 | Ga0209256_1061217 | Ga0209256_10612171 | 134 |
| 815 | 3300025915 | Ga0207693_10085310 | Ga0207693_100853102 | 134 |
| 816 | 3300025939 | Ga0207665_11200319 | Ga0207665_112003191 | 134 |
| 817 | 3300026067 | Ga0207678_10013802 | Ga0207678_100138024 | 134 |
| 818 | 3300026088 | Ga0207641_10106255 | Ga0207641_101062552 | 134 |
| 819 | 3300027671 | Ga0209588_1216911 | Ga0209588_12169111 | 134 |
| 820 | 3300028381 | Ga0268264_10000185 | Ga0268264_100001853 | 134 |
| 821 | 3300032005 | Ga0307411_11304611 | Ga0307411_113046111 | 134 |
| 822 | 3300037471 | Ga0395905_0217899 | Ga0395905_0217899_146_550 | 134 |
| 823 | 3300038443 | Ga0395901_0624625 | Ga0395901_0624625_423_827 | 134 |
| 824 | 3300046460 | Ga0495638_0036102 | Ga0495638_0036102_12_416 | 134 |
| 825 | 3300046462 | Ga0495651_0373216 | Ga0495651_0373216_514_918 | 134 |
| 826 | 3300046501 | Ga0495607_0012688 | Ga0495607_0012688_3439_3843 | 134 |
| 827 | 3300046506 | Ga0495583_0179494 | Ga0495583_0179494_11_415 | 134 |
| 828 | 3300046507 | Ga0495606_0028417 | Ga0495606_0028417_3103_3507 | 134 |
| 829 | 3300046512 | Ga0495610_0370755 | Ga0495610_0370755_120_524 | 134 |
| 830 | 3300046515 | Ga0495620_0013635 | Ga0495620_0013635_1412_1816 | 134 |
| 831 | 3300046518 | Ga0495631_0031182 | Ga0495631_0031182_197_601 | 134 |
| 832 | 3300046522 | Ga0495643_0042298 | Ga0495643_0042298_1465_1869 | 134 |
| 833 | 3300046524 | Ga0495648_0052162 | Ga0495648_0052162_1497_1901 | 134 |
| 834 | 3300046529 | Ga0495652_0622364 | Ga0495652_0622364_291_695 | 134 |
| 835 | 3300046530 | Ga0495654_0003707 | Ga0495654_0003707_6522_6926 | 134 |
| 836 | 3300046538 | Ga0495609_0354632 | Ga0495609_0354632_64_468 | 134 |
| 837 | 3300046543 | Ga0495645_0723136 | Ga0495645_0723136_114_518 | 134 |
| 838 | 3300046557 | Ga0495622_0021843 | Ga0495622_0021843_2230_2634 | 134 |
| 839 | 3300046616 | Ga0495668_0224708 | Ga0495668_0224708_497_901 | 134 |
| 840 | 3300046648 | Ga0495611_0055070 | Ga0495611_0055070_268_672 | 134 |
| 841 | 3300046660 | Ga0495625_0061291 | Ga0495625_0061291_585_989 | 134 |
| 842 | 3300046691 | Ga0495670_0013251 | Ga0495670_0013251_1357_1761 | 134 |
| 843 | 3300046692 | Ga0495671_0292761 | Ga0495671_0292761_88_492 | 134 |
| 844 | 3300046810 | Ga0495660_0164086 | Ga0495660_0164086_130_534 | 134 |
| 845 | 3300047322 | Ga0495680_0806161 | Ga0495680_0806161_136_540 | 134 |
| 846 | 3300047445 | Ga0495677_0089100 | Ga0495677_0089100_486_890 | 134 |
| 847 | 3300047469 | Ga0495673_0264715 | Ga0495673_0264715_23_427 | 134 |
| 848 | 3300047472 | Ga0495686_0410331 | Ga0495686_0410331_308_712 | 134 |
| 849 | 3300048091 | Ga0495626_0310434 | Ga0495626_0310434_77_481 | 134 |
| 850 | 3300048909 | Ga0496106_0171772 | Ga0496106_0171772_11_415 | 134 |
| 851 | 3300048916 | Ga0496113_0439727 | Ga0496113_0439727_455_859 | 134 |
| 852 | 3300048918 | Ga0496115_1135447 | Ga0496115_1135447_28_432 | 134 |
| 853 | 3300048919 | Ga0496116_0004734 | Ga0496116_0004734_12194_12598 | 134 |
| 854 | 3300048920 | Ga0496117_0095415 | Ga0496117_0095415_507_911 | 134 |
| 855 | 3300048920 | Ga0496117_0152853 | Ga0496117_0152853_722_1126 | 134 |
| 856 | 3300048921 | Ga0496118_0229661 | Ga0496118_0229661_101_505 | 134 |
| 857 | 3300048921 | Ga0496118_0414948 | Ga0496118_0414948_69_473 | 134 |
| 858 | 3300048921 | Ga0496118_0491579 | Ga0496118_0491579_101_505 | 134 |
| 859 | 3300048923 | Ga0496120_0095868 | Ga0496120_0095868_906_1310 | 134 |
| 860 | 3300048924 | Ga0496121_0095409 | Ga0496121_0095409_937_1341 | 134 |
| 861 | 3300048924 | Ga0496121_0470456 | Ga0496121_0470456_350_754 | 134 |
| 862 | 3300048925 | Ga0496122_0073686 | Ga0496122_0073686_308_712 | 134 |
| 863 | 3300048926 | Ga0496123_0016780 | Ga0496123_0016780_4311_4715 | 134 |
| 864 | 3300048927 | Ga0496124_0082762 | Ga0496124_0082762_97_501 | 134 |
| 865 | 3300048928 | Ga0496125_0004044 | Ga0496125_0004044_7924_8328 | 134 |
| 866 | 3300048928 | Ga0496125_0006115 | Ga0496125_0006115_1370_1774 | 134 |
| 867 | 3300048929 | Ga0496126_0003482 | Ga0496126_0003482_11953_12357 | 134 |
| 868 | 3300048929 | Ga0496126_0084458 | Ga0496126_0084458_1924_2328 | 134 |
| 869 | 3300048929 | Ga0496126_0318254 | Ga0496126_0318254_557_961 | 134 |
| 870 | 3300048929 | Ga0496126_0712165 | Ga0496126_0712165_300_704 | 134 |
| 871 | 3300048929 | Ga0496126_1178167 | Ga0496126_1178167_19_423 | 134 |
| 872 | 3300050491 | nmdc:mga00v17_73996_c1 | nmdc:mga00v17_73996_c1_292_696 | 134 |
| 873 | 3300050492 | nmdc:mga0yw44_16655_c1 | nmdc:mga0yw44_16655_c1_1562_1966 | 134 |
| 874 | 3300053077 | Ga0495601_0349956 | Ga0495601_0349956_203_607 | 134 |
| 875 | 3300053083 | Ga0495655_0331778 | Ga0495655_0331778_95_499 | 134 |
| 876 | 3300053086 | Ga0500578_0299349 | Ga0500578_0299349_95_499 | 134 |
| 877 | 3300053087 | Ga0500643_087682 | Ga0500643_087682_370_774 | 134 |
| 878 | 3300053088 | Ga0500644_0128415 | Ga0500644_0128415_580_984 | 134 |
| 879 | 3300053089 | Ga0500581_250031 | Ga0500581_250031_137_541 | 134 |
| 880 | 3300053093 | Ga0500651_0022319 | Ga0500651_0022319_1259_1663 | 134 |
| 881 | 3300053094 | Ga0500566_0001736 | Ga0500566_0001736_3419_3823 | 134 |
| 882 | 3300053096 | Ga0500641_0025996 | Ga0500641_0025996_192_596 | 134 |
| 883 | 3300053098 | Ga0500650_0031343 | Ga0500650_0031343_548_952 | 134 |
| 884 | 3300053102 | Ga0500554_116101 | Ga0500554_116101_477_881 | 134 |
| 885 | 3300053104 | Ga0500556_0000045 | Ga0500556_0000045_43406_43810 | 134 |
| 886 | 3300053108 | Ga0500562_130270 | Ga0500562_130270_75_479 | 134 |
| 887 | 3300053109 | Ga0500569_005518 | Ga0500569_005518_1575_1979 | 134 |
| 888 | 3300053117 | Ga0500593_164244 | Ga0500593_164244_237_641 | 134 |
| 889 | 3300053118 | Ga0500594_0034252 | Ga0500594_0034252_18_422 | 134 |
| 890 | 3300053121 | Ga0500607_060416 | Ga0500607_060416_277_681 | 134 |
| 891 | 3300053122 | Ga0500608_001250 | Ga0500608_001250_3545_3949 | 134 |
| 892 | 3300053130 | Ga0500642_0000024 | Ga0500642_0000024_47325_47729 | 134 |
| 893 | 3300053131 | Ga0500652_000135 | Ga0500652_000135_737_1141 | 134 |
| 894 | 3300053136 | Ga0500559_0000414 | Ga0500559_0000414_3240_3644 | 134 |
| 895 | 3300053136 | Ga0500559_0065394 | Ga0500559_0065394_74_478 | 134 |
| 896 | 3300053136 | Ga0500559_0182128 | Ga0500559_0182128_313_717 | 134 |
| 897 | 3300053138 | Ga0500564_236436 | Ga0500564_236436_92_496 | 134 |
| 898 | 3300053139 | Ga0500568_0000469 | Ga0500568_0000469_18955_19359 | 134 |
| 899 | 3300053142 | Ga0500577_0000773 | Ga0500577_0000773_5364_5768 | 134 |
| 900 | 3300053142 | Ga0500577_0156795 | Ga0500577_0156795_235_639 | 134 |
| 901 | 3300053145 | Ga0500586_001132 | Ga0500586_001132_2410_2814 | 134 |
| 902 | 3300053151 | Ga0500604_0000270 | Ga0500604_0000270_1394_1798 | 134 |
| 903 | 3300053153 | Ga0500616_0000054 | Ga0500616_0000054_46321_46725 | 134 |
| 904 | 3300053154 | Ga0500619_049211 | Ga0500619_049211_931_1335 | 134 |
| 905 | 3300053156 | Ga0500622_0002469 | Ga0500622_0002469_1232_1636 | 134 |
| 906 | 3300053158 | Ga0500627_0056492 | Ga0500627_0056492_657_1061 | 134 |
| 907 | 3300053161 | Ga0500634_0051449 | Ga0500634_0051449_1393_1797 | 134 |
| 908 | 3300053178 | Ga0500637_0338305 | Ga0500637_0338305_137_541 | 134 |
| 909 | 3300053723 | Ga0500567_142547 | Ga0500567_142547_418_822 | 134 |
| 910 | 3300053727 | Ga0500611_090914 | Ga0500611_090914_92_496 | 134 |
| 911 | 3300053735 | Ga0500596_021187 | Ga0500596_021187_37_441 | 134 |
| 912 | 3300007265 | Ga0099794_10120394 | Ga0099794_101203942 | 135 |
| 913 | 3300025910 | Ga0207684_11214170 | Ga0207684_112141701 | 135 |
| 914 | 3300027671 | Ga0209588_1138592 | Ga0209588_11385922 | 135 |
| 915 | 3300028794 | Ga0307515_10493440 | Ga0307515_104934402 | 135 |
| 916 | 3300046491 | Ga0495584_0375987 | Ga0495584_0375987_169_576 | 135 |
| 917 | 3300002070 | JGI24750J21931_1007657 | JGI24750J21931_10076572 | 136 |
| 918 | 3300002244 | JGI24742J22300_10012428 | JGI24742J22300_100124282 | 136 |
| 919 | 3300005295 | Ga0065707_10273588 | Ga0065707_102735881 | 136 |
| 920 | 3300005328 | Ga0070676_10662571 | Ga0070676_106625711 | 136 |
| 921 | 3300005330 | Ga0070690_100452997 | Ga0070690_1004529971 | 136 |
| 922 | 3300005331 | Ga0070670_100170963 | Ga0070670_1001709633 | 136 |
| 923 | 3300005334 | Ga0068869_100042838 | Ga0068869_1000428384 | 136 |
| 924 | 3300005334 | Ga0068869_100085418 | Ga0068869_1000854183 | 136 |
| 925 | 3300005334 | Ga0068869_100154070 | Ga0068869_1001540702 | 136 |
| 926 | 3300005334 | Ga0068869_100761395 | Ga0068869_1007613951 | 136 |
| 927 | 3300005334 | Ga0068869_100900581 | Ga0068869_1009005811 | 136 |
| 928 | 3300005335 | Ga0070666_10053315 | Ga0070666_100533153 | 136 |
| 929 | 3300005335 | Ga0070666_10102740 | Ga0070666_101027402 | 136 |
| 930 | 3300005336 | Ga0070680_100110473 | Ga0070680_1001104731 | 136 |
| 931 | 3300005338 | Ga0068868_100153850 | Ga0068868_1001538502 | 136 |
| 932 | 3300005339 | Ga0070660_100578933 | Ga0070660_1005789332 | 136 |
| 933 | 3300005340 | Ga0070689_101023400 | Ga0070689_1010234001 | 136 |
| 934 | 3300005341 | Ga0070691_10513533 | Ga0070691_105135331 | 136 |
| 935 | 3300005344 | Ga0070661_100638715 | Ga0070661_1006387151 | 136 |
| 936 | 3300005347 | Ga0070668_100093470 | Ga0070668_1000934703 | 136 |
| 937 | 3300005347 | Ga0070668_100214062 | Ga0070668_1002140622 | 136 |
| 938 | 3300005347 | Ga0070668_100250748 | Ga0070668_1002507482 | 136 |
| 939 | 3300005347 | Ga0070668_100658320 | Ga0070668_1006583202 | 136 |
| 940 | 3300005353 | Ga0070669_100369757 | Ga0070669_1003697571 | 136 |
| 941 | 3300005356 | Ga0070674_100997199 | Ga0070674_1009971992 | 136 |
| 942 | 3300005364 | Ga0070673_100252154 | Ga0070673_1002521542 | 136 |
| 943 | 3300005365 | Ga0070688_100283257 | Ga0070688_1002832571 | 136 |
| 944 | 3300005366 | Ga0070659_100401645 | Ga0070659_1004016452 | 136 |
| 945 | 3300005366 | Ga0070659_100426481 | Ga0070659_1004264811 | 136 |
| 946 | 3300005367 | Ga0070667_100073038 | Ga0070667_1000730384 | 136 |
| 947 | 3300005367 | Ga0070667_101525634 | Ga0070667_1015256341 | 136 |
| 948 | 3300005436 | Ga0070713_100052649 | Ga0070713_1000526495 | 136 |
| 949 | 3300005438 | Ga0070701_10088778 | Ga0070701_100887782 | 136 |
| 950 | 3300005438 | Ga0070701_11261695 | Ga0070701_112616951 | 136 |
| 951 | 3300005440 | Ga0070705_100321880 | Ga0070705_1003218801 | 136 |
| 952 | 3300005440 | Ga0070705_100993488 | Ga0070705_1009934881 | 136 |
| 953 | 3300005441 | Ga0070700_100129410 | Ga0070700_1001294101 | 136 |
| 954 | 3300005455 | Ga0070663_100036074 | Ga0070663_1000360743 | 136 |
| 955 | 3300005455 | Ga0070663_100208731 | Ga0070663_1002087312 | 136 |
| 956 | 3300005456 | Ga0070678_100322956 | Ga0070678_1003229563 | 136 |
| 957 | 3300005456 | Ga0070678_100567313 | Ga0070678_1005673132 | 136 |
| 958 | 3300005456 | Ga0070678_100613113 | Ga0070678_1006131131 | 136 |
| 959 | 3300005457 | Ga0070662_100088795 | Ga0070662_1000887952 | 136 |
| 960 | 3300005458 | Ga0070681_10093689 | Ga0070681_100936892 | 136 |
| 961 | 3300005459 | Ga0068867_100373787 | Ga0068867_1003737871 | 136 |
| 962 | 3300005466 | Ga0070685_10211748 | Ga0070685_102117481 | 136 |
| 963 | 3300005471 | Ga0070698_100108450 | Ga0070698_1001084502 | 136 |
| 964 | 3300005518 | Ga0070699_100085031 | Ga0070699_1000850313 | 136 |
| 965 | 3300005536 | Ga0070697_100346345 | Ga0070697_1003463451 | 136 |
| 966 | 3300005539 | Ga0068853_100089715 | Ga0068853_1000897152 | 136 |
| 967 | 3300005539 | Ga0068853_100362898 | Ga0068853_1003628981 | 136 |
| 968 | 3300005543 | Ga0070672_100246702 | Ga0070672_1002467023 | 136 |
| 969 | 3300005543 | Ga0070672_101011848 | Ga0070672_1010118481 | 136 |
| 970 | 3300005546 | Ga0070696_100096905 | Ga0070696_1000969052 | 136 |
| 971 | 3300005547 | Ga0070693_100034898 | Ga0070693_1000348981 | 136 |
| 972 | 3300005548 | Ga0070665_100212898 | Ga0070665_1002128985 | 136 |
| 973 | 3300005548 | Ga0070665_100388288 | Ga0070665_1003882882 | 136 |
| 974 | 3300005563 | Ga0068855_100420616 | Ga0068855_1004206162 | 136 |
| 975 | 3300005577 | Ga0068857_100414741 | Ga0068857_1004147412 | 136 |
| 976 | 3300005615 | Ga0070702_100152071 | Ga0070702_1001520712 | 136 |
| 977 | 3300005616 | Ga0068852_101462316 | Ga0068852_1014623161 | 136 |
| 978 | 3300005617 | Ga0068859_100058789 | Ga0068859_1000587895 | 136 |
| 979 | 3300005617 | Ga0068859_100627225 | Ga0068859_1006272251 | 136 |
| 980 | 3300005718 | Ga0068866_10558304 | Ga0068866_105583042 | 136 |
| 981 | 3300005719 | Ga0068861_100139922 | Ga0068861_1001399222 | 136 |
| 982 | 3300005719 | Ga0068861_100167241 | Ga0068861_1001672412 | 136 |
| 983 | 3300005719 | Ga0068861_100371601 | Ga0068861_1003716012 | 136 |
| 984 | 3300005840 | Ga0068870_10421258 | Ga0068870_104212581 | 136 |
| 985 | 3300005841 | Ga0068863_100636971 | Ga0068863_1006369711 | 136 |
| 986 | 3300005841 | Ga0068863_101638617 | Ga0068863_1016386171 | 136 |
| 987 | 3300005842 | Ga0068858_100388636 | Ga0068858_1003886362 | 136 |
| 988 | 3300005842 | Ga0068858_100676498 | Ga0068858_1006764982 | 136 |
| 989 | 3300005842 | Ga0068858_101293741 | Ga0068858_1012937411 | 136 |
| 990 | 3300005843 | Ga0068860_100093721 | Ga0068860_1000937212 | 136 |
| 991 | 3300005843 | Ga0068860_100237968 | Ga0068860_1002379682 | 136 |
| 992 | 3300005843 | Ga0068860_100569987 | Ga0068860_1005699871 | 136 |
| 993 | 3300005844 | Ga0068862_100276166 | Ga0068862_1002761662 | 136 |
| 994 | 3300005844 | Ga0068862_100336751 | Ga0068862_1003367513 | 136 |
| 995 | 3300005983 | Ga0081540_1003216 | Ga0081540_100321614 | 136 |
| 996 | 3300005983 | Ga0081540_1021572 | Ga0081540_10215721 | 136 |
| 997 | 3300005983 | Ga0081540_1041474 | Ga0081540_10414743 | 136 |
| 998 | 3300006028 | Ga0070717_10024153 | Ga0070717_100241533 | 136 |
| 999 | 3300006038 | Ga0075365_10040534 | Ga0075365_100405343 | 136 |
| 1000 | 3300006038 | Ga0075365_10273209 | Ga0075365_102732092 | 136 |
| 1001 | 3300006042 | Ga0075368_10113852 | Ga0075368_101138522 | 136 |
| 1002 | 3300006048 | Ga0075363_100200315 | Ga0075363_1002003152 | 136 |
| 1003 | 3300006051 | Ga0075364_10042281 | Ga0075364_100422815 | 136 |
| 1004 | 3300006051 | Ga0075364_10703525 | Ga0075364_107035251 | 136 |
| 1005 | 3300006058 | Ga0075432_10398365 | Ga0075432_103983651 | 136 |
| 1006 | 3300006177 | Ga0075362_10072311 | Ga0075362_100723112 | 136 |
| 1007 | 3300006177 | Ga0075362_10096087 | Ga0075362_100960872 | 136 |
| 1008 | 3300006177 | Ga0075362_10133368 | Ga0075362_101333682 | 136 |
| 1009 | 3300006186 | Ga0075369_10030019 | Ga0075369_100300193 | 136 |
| 1010 | 3300006186 | Ga0075369_10249895 | Ga0075369_102498951 | 136 |
| 1011 | 3300006195 | Ga0075366_10215140 | Ga0075366_102151402 | 136 |
| 1012 | 3300006195 | Ga0075366_10438606 | Ga0075366_104386062 | 136 |
| 1013 | 3300006237 | Ga0097621_100924090 | Ga0097621_1009240901 | 136 |
| 1014 | 3300006844 | Ga0075428_100597564 | Ga0075428_1005975642 | 136 |
| 1015 | 3300006844 | Ga0075428_101069328 | Ga0075428_1010693283 | 136 |
| 1016 | 3300006881 | Ga0068865_100494700 | Ga0068865_1004947002 | 136 |
| 1017 | 3300006931 | Ga0097620_100058780 | Ga0097620_1000587805 | 136 |
| 1018 | 3300006931 | Ga0097620_100627259 | Ga0097620_1006272591 | 136 |
| 1019 | 3300007076 | Ga0075435_100409607 | Ga0075435_1004096072 | 136 |
| 1020 | 3300007265 | Ga0099794_10174216 | Ga0099794_101742162 | 136 |
| 1021 | 3300007788 | Ga0099795_10048777 | Ga0099795_100487772 | 136 |
| 1022 | 3300007788 | Ga0099795_10134430 | Ga0099795_101344301 | 136 |
| 1023 | 3300007788 | Ga0099795_10537966 | Ga0099795_105379661 | 136 |
| 1024 | 3300009092 | Ga0105250_10084364 | Ga0105250_100843641 | 136 |
| 1025 | 3300009093 | Ga0105240_10478615 | Ga0105240_104786151 | 136 |
| 1026 | 3300009094 | Ga0111539_10331760 | Ga0111539_103317602 | 136 |
| 1027 | 3300009098 | Ga0105245_10073773 | Ga0105245_100737733 | 136 |
| 1028 | 3300009101 | Ga0105247_10133584 | Ga0105247_101335842 | 136 |
| 1029 | 3300009101 | Ga0105247_10257549 | Ga0105247_102575493 | 136 |
| 1030 | 3300009101 | Ga0105247_10269622 | Ga0105247_102696222 | 136 |
| 1031 | 3300009101 | Ga0105247_10830123 | Ga0105247_108301232 | 136 |
| 1032 | 3300009148 | Ga0105243_10144795 | Ga0105243_101447952 | 136 |
| 1033 | 3300009174 | Ga0105241_10069592 | Ga0105241_100695923 | 136 |
| 1034 | 3300009176 | Ga0105242_10238944 | Ga0105242_102389441 | 136 |
| 1035 | 3300009177 | Ga0105248_10667596 | Ga0105248_106675961 | 136 |
| 1036 | 3300009545 | Ga0105237_10059303 | Ga0105237_100593033 | 136 |
| 1037 | 3300009545 | Ga0105237_10134788 | Ga0105237_101347882 | 136 |
| 1038 | 3300009545 | Ga0105237_11478147 | Ga0105237_114781471 | 136 |
| 1039 | 3300009553 | Ga0105249_11584354 | Ga0105249_115843542 | 136 |
| 1040 | 3300010159 | Ga0099796_10149631 | Ga0099796_101496311 | 136 |
| 1041 | 3300010159 | Ga0099796_10210429 | Ga0099796_102104292 | 136 |
| 1042 | 3300010375 | Ga0105239_10095960 | Ga0105239_100959602 | 136 |
| 1043 | 3300010375 | Ga0105239_10568010 | Ga0105239_105680102 | 136 |
| 1044 | 3300011119 | Ga0105246_10130279 | Ga0105246_101302793 | 136 |
| 1045 | 3300011119 | Ga0105246_10401838 | Ga0105246_104018382 | 136 |
| 1046 | 3300011119 | Ga0105246_11046461 | Ga0105246_110464612 | 136 |
| 1047 | 3300011119 | Ga0105246_11715491 | Ga0105246_117154911 | 136 |
| 1048 | 3300013102 | Ga0157371_10812842 | Ga0157371_108128422 | 136 |
| 1049 | 3300013105 | Ga0157369_10300439 | Ga0157369_103004393 | 136 |
| 1050 | 3300013297 | Ga0157378_10169593 | Ga0157378_101695932 | 136 |
| 1051 | 3300013297 | Ga0157378_10202436 | Ga0157378_102024363 | 136 |
| 1052 | 3300013306 | Ga0163162_11024028 | Ga0163162_110240281 | 136 |
| 1053 | 3300013306 | Ga0163162_11314237 | Ga0163162_113142371 | 136 |
| 1054 | 3300013308 | Ga0157375_10270624 | Ga0157375_102706242 | 136 |
| 1055 | 3300013308 | Ga0157375_10350117 | Ga0157375_103501172 | 136 |
| 1056 | 3300013308 | Ga0157375_10410748 | Ga0157375_104107482 | 136 |
| 1057 | 3300014326 | Ga0157380_10211406 | Ga0157380_102114062 | 136 |
| 1058 | 3300014326 | Ga0157380_11003074 | Ga0157380_110030741 | 136 |
| 1059 | 3300014968 | Ga0157379_10363314 | Ga0157379_103633142 | 136 |
| 1060 | 3300014968 | Ga0157379_10487787 | Ga0157379_104877872 | 136 |
| 1061 | 3300014969 | Ga0157376_10358122 | Ga0157376_103581222 | 136 |
| 1062 | 3300020080 | Ga0206350_11469909 | Ga0206350_114699092 | 136 |
| 1063 | 3300020082 | Ga0206353_11783555 | Ga0206353_117835552 | 136 |
| 1064 | 3300022467 | Ga0224712_10207107 | Ga0224712_102071072 | 136 |
| 1065 | 3300025297 | Ga0209758_1037034 | Ga0209758_10370343 | 136 |
| 1066 | 3300025315 | Ga0207697_10270992 | Ga0207697_102709922 | 136 |
| 1067 | 3300025315 | Ga0207697_10358614 | Ga0207697_103586141 | 136 |
| 1068 | 3300025899 | Ga0207642_10286486 | Ga0207642_102864861 | 136 |
| 1069 | 3300025900 | Ga0207710_10011733 | Ga0207710_100117333 | 136 |
| 1070 | 3300025900 | Ga0207710_10503422 | Ga0207710_105034221 | 136 |
| 1071 | 3300025900 | Ga0207710_10582223 | Ga0207710_105822231 | 136 |
| 1072 | 3300025901 | Ga0207688_10220794 | Ga0207688_102207941 | 136 |
| 1073 | 3300025901 | Ga0207688_10383730 | Ga0207688_103837302 | 136 |
| 1074 | 3300025903 | Ga0207680_10161396 | Ga0207680_101613962 | 136 |
| 1075 | 3300025903 | Ga0207680_10183540 | Ga0207680_101835401 | 136 |
| 1076 | 3300025904 | Ga0207647_10378875 | Ga0207647_103788751 | 136 |
| 1077 | 3300025907 | Ga0207645_10110973 | Ga0207645_101109731 | 136 |
| 1078 | 3300025908 | Ga0207643_10025614 | Ga0207643_100256142 | 136 |
| 1079 | 3300025911 | Ga0207654_10012909 | Ga0207654_100129093 | 136 |
| 1080 | 3300025912 | Ga0207707_10020204 | Ga0207707_100202048 | 136 |
| 1081 | 3300025913 | Ga0207695_10350381 | Ga0207695_103503812 | 136 |
| 1082 | 3300025914 | Ga0207671_10906402 | Ga0207671_109064021 | 136 |
| 1083 | 3300025919 | Ga0207657_10181427 | Ga0207657_101814271 | 136 |
| 1084 | 3300025919 | Ga0207657_10197663 | Ga0207657_101976632 | 136 |
| 1085 | 3300025920 | Ga0207649_10105400 | Ga0207649_101054002 | 136 |
| 1086 | 3300025923 | Ga0207681_10198440 | Ga0207681_101984402 | 136 |
| 1087 | 3300025925 | Ga0207650_10067668 | Ga0207650_100676683 | 136 |
| 1088 | 3300025928 | Ga0207700_10002015 | Ga0207700_1000201513 | 136 |
| 1089 | 3300025931 | Ga0207644_10059761 | Ga0207644_100597613 | 136 |
| 1090 | 3300025932 | Ga0207690_10451486 | Ga0207690_104514861 | 136 |
| 1091 | 3300025934 | Ga0207686_10046010 | Ga0207686_100460103 | 136 |
| 1092 | 3300025935 | Ga0207709_10046312 | Ga0207709_100463123 | 136 |
| 1093 | 3300025936 | Ga0207670_10313965 | Ga0207670_103139651 | 136 |
| 1094 | 3300025936 | Ga0207670_11385169 | Ga0207670_113851691 | 136 |
| 1095 | 3300025937 | Ga0207669_10030199 | Ga0207669_100301992 | 136 |
| 1096 | 3300025938 | Ga0207704_10302268 | Ga0207704_103022682 | 136 |
| 1097 | 3300025940 | Ga0207691_10091375 | Ga0207691_100913753 | 136 |
| 1098 | 3300025942 | Ga0207689_10052903 | Ga0207689_100529032 | 136 |
| 1099 | 3300025942 | Ga0207689_10121366 | Ga0207689_101213661 | 136 |
| 1100 | 3300025942 | Ga0207689_10136106 | Ga0207689_101361063 | 136 |
| 1101 | 3300025942 | Ga0207689_10150833 | Ga0207689_101508332 | 136 |
| 1102 | 3300025945 | Ga0207679_10241662 | Ga0207679_102416622 | 136 |
| 1103 | 3300025949 | Ga0207667_10059382 | Ga0207667_100593823 | 136 |
| 1104 | 3300025949 | Ga0207667_11376610 | Ga0207667_113766101 | 136 |
| 1105 | 3300025960 | Ga0207651_10362731 | Ga0207651_103627311 | 136 |
| 1106 | 3300025961 | Ga0207712_10153783 | Ga0207712_101537832 | 136 |
| 1107 | 3300025961 | Ga0207712_10550121 | Ga0207712_105501211 | 136 |
| 1108 | 3300025972 | Ga0207668_10030893 | Ga0207668_100308932 | 136 |
| 1109 | 3300025972 | Ga0207668_10372625 | Ga0207668_103726251 | 136 |
| 1110 | 3300025972 | Ga0207668_10498091 | Ga0207668_104980912 | 136 |
| 1111 | 3300025972 | Ga0207668_10725470 | Ga0207668_107254701 | 136 |
| 1112 | 3300025986 | Ga0207658_10275079 | Ga0207658_102750792 | 136 |
| 1113 | 3300026023 | Ga0207677_10224824 | Ga0207677_102248241 | 136 |
| 1114 | 3300026023 | Ga0207677_10254788 | Ga0207677_102547881 | 136 |
| 1115 | 3300026023 | Ga0207677_11588859 | Ga0207677_115888591 | 136 |
| 1116 | 3300026035 | Ga0207703_10072010 | Ga0207703_100720103 | 136 |
| 1117 | 3300026035 | Ga0207703_10331593 | Ga0207703_103315932 | 136 |
| 1118 | 3300026041 | Ga0207639_10161107 | Ga0207639_101611072 | 136 |
| 1119 | 3300026067 | Ga0207678_10058708 | Ga0207678_100587082 | 136 |
| 1120 | 3300026067 | Ga0207678_10232622 | Ga0207678_102326222 | 136 |
| 1121 | 3300026075 | Ga0207708_10244927 | Ga0207708_102449272 | 136 |
| 1122 | 3300026075 | Ga0207708_10458128 | Ga0207708_104581281 | 136 |
| 1123 | 3300026089 | Ga0207648_10126701 | Ga0207648_101267013 | 136 |
| 1124 | 3300026089 | Ga0207648_10564642 | Ga0207648_105646422 | 136 |
| 1125 | 3300026095 | Ga0207676_10712042 | Ga0207676_107120422 | 136 |
| 1126 | 3300026116 | Ga0207674_10213494 | Ga0207674_102134942 | 136 |
| 1127 | 3300026118 | Ga0207675_100056996 | Ga0207675_1000569963 | 136 |
| 1128 | 3300026118 | Ga0207675_100280601 | Ga0207675_1002806012 | 136 |
| 1129 | 3300026121 | Ga0207683_10175687 | Ga0207683_101756872 | 136 |
| 1130 | 3300026121 | Ga0207683_10227290 | Ga0207683_102272903 | 136 |
| 1131 | 3300026121 | Ga0207683_10439855 | Ga0207683_104398553 | 136 |
| 1132 | 3300026121 | Ga0207683_10654423 | Ga0207683_106544231 | 136 |
| 1133 | 3300027512 | Ga0209179_1007263 | Ga0209179_10072632 | 136 |
| 1134 | 3300027512 | Ga0209179_1070409 | Ga0209179_10704091 | 136 |
| 1135 | 3300028379 | Ga0268266_10386215 | Ga0268266_103862152 | 136 |
| 1136 | 3300028379 | Ga0268266_10513966 | Ga0268266_105139662 | 136 |
| 1137 | 3300028379 | Ga0268266_10603548 | Ga0268266_106035481 | 136 |
| 1138 | 3300028379 | Ga0268266_11441573 | Ga0268266_114415732 | 136 |
| 1139 | 3300028380 | Ga0268265_10124749 | Ga0268265_101247491 | 136 |
| 1140 | 3300028380 | Ga0268265_10471195 | Ga0268265_104711952 | 136 |
| 1141 | 3300028380 | Ga0268265_10624895 | Ga0268265_106248952 | 136 |
| 1142 | 3300028380 | Ga0268265_11801547 | Ga0268265_118015471 | 136 |
| 1143 | 3300028381 | Ga0268264_10370321 | Ga0268264_103703212 | 136 |
| 1144 | 3300028800 | Ga0265338_10274306 | Ga0265338_102743062 | 136 |
| 1145 | 3300031995 | Ga0307409_101517604 | Ga0307409_1015176041 | 136 |
| 1146 | 3300032004 | Ga0307414_11565880 | Ga0307414_115658802 | 136 |
| 1147 | 3300037068 | Ga0373925_0770609 | Ga0373925_0770609_274_729 | 136 |
| 1148 | 3300041443 | Ga0451789_0487446 | Ga0451789_0487446_99_509 | 136 |
| 1149 | 3300046491 | Ga0495584_0257724 | Ga0495584_0257724_351_761 | 136 |
| 1150 | 3300046491 | Ga0495584_0262518 | Ga0495584_0262518_260_676 | 136 |
| 1151 | 3300046506 | Ga0495583_0184866 | Ga0495583_0184866_191_601 | 136 |
| 1152 | 3300046513 | Ga0495616_0152525 | Ga0495616_0152525_89_499 | 136 |
| 1153 | 3300046515 | Ga0495620_0179984 | Ga0495620_0179984_78_494 | 136 |
| 1154 | 3300046520 | Ga0495637_0272737 | Ga0495637_0272737_62_511 | 136 |
| 1155 | 3300046522 | Ga0495643_0233447 | Ga0495643_0233447_139_555 | 136 |
| 1156 | 3300046522 | Ga0495643_0468242 | Ga0495643_0468242_80_496 | 136 |
| 1157 | 3300046539 | Ga0495621_0130457 | Ga0495621_0130457_456_866 | 136 |
| 1158 | 3300046615 | Ga0495656_0011388 | Ga0495656_0011388_883_1293 | 136 |
| 1159 | 3300046664 | Ga0495659_0378675 | Ga0495659_0378675_26_442 | 136 |
| 1160 | 3300046684 | Ga0495669_0166830 | Ga0495669_0166830_247_657 | 136 |
| 1161 | 3300046684 | Ga0495669_0372153 | Ga0495669_0372153_86_502 | 136 |
| 1162 | 3300046691 | Ga0495670_0447970 | Ga0495670_0447970_120_530 | 136 |
| 1163 | 3300046692 | Ga0495671_0362376 | Ga0495671_0362376_65_481 | 136 |
| 1164 | 3300046692 | Ga0495671_0437897 | Ga0495671_0437897_79_489 | 136 |
| 1165 | 3300046694 | Ga0495649_0141799 | Ga0495649_0141799_744_1154 | 136 |
| 1166 | 3300046694 | Ga0495649_0433860 | Ga0495649_0433860_67_483 | 136 |
| 1167 | 3300046810 | Ga0495660_0262527 | Ga0495660_0262527_326_736 | 136 |
| 1168 | 3300047320 | Ga0495672_0181881 | Ga0495672_0181881_586_1002 | 136 |
| 1169 | 3300048903 | Ga0496100_0138598 | Ga0496100_0138598_1296_1706 | 136 |
| 1170 | 3300048904 | Ga0496101_0736192 | Ga0496101_0736192_96_512 | 136 |
| 1171 | 3300048904 | Ga0496101_0888107 | Ga0496101_0888107_31_441 | 136 |
| 1172 | 3300048905 | Ga0496102_0106121 | Ga0496102_0106121_2063_2473 | 136 |
| 1173 | 3300048905 | Ga0496102_0294186 | Ga0496102_0294186_897_1313 | 136 |
| 1174 | 3300048908 | Ga0496105_0241392 | Ga0496105_0241392_1020_1430 | 136 |
| 1175 | 3300048909 | Ga0496106_0174272 | Ga0496106_0174272_1285_1695 | 136 |
| 1176 | 3300048909 | Ga0496106_0231862 | Ga0496106_0231862_143_559 | 136 |
| 1177 | 3300048912 | Ga0496109_0235133 | Ga0496109_0235133_875_1291 | 136 |
| 1178 | 3300048913 | Ga0496110_0903848 | Ga0496110_0903848_137_553 | 136 |
| 1179 | 3300048917 | Ga0496114_0149160 | Ga0496114_0149160_1240_1650 | 136 |
| 1180 | 3300048918 | Ga0496115_1246605 | Ga0496115_1246605_31_441 | 136 |
| 1181 | 3300048920 | Ga0496117_0179333 | Ga0496117_0179333_79_495 | 136 |
| 1182 | 3300048922 | Ga0496119_0084401 | Ga0496119_0084401_1251_1667 | 136 |
| 1183 | 3300048923 | Ga0496120_0212702 | Ga0496120_0212702_451_867 | 136 |
| 1184 | 3300048923 | Ga0496120_0493749 | Ga0496120_0493749_60_470 | 136 |
| 1185 | 3300048924 | Ga0496121_0076072 | Ga0496121_0076072_2188_2604 | 136 |
| 1186 | 3300048924 | Ga0496121_0145305 | Ga0496121_0145305_283_699 | 136 |
| 1187 | 3300048924 | Ga0496121_0289581 | Ga0496121_0289581_268_684 | 136 |
| 1188 | 3300048927 | Ga0496124_0378269 | Ga0496124_0378269_75_491 | 136 |
| 1189 | 3300048928 | Ga0496125_0003556 | Ga0496125_0003556_14857_15267 | 136 |
| 1190 | 3300048928 | Ga0496125_0177747 | Ga0496125_0177747_304_720 | 136 |
| 1191 | 3300048929 | Ga0496126_0021101 | Ga0496126_0021101_2203_2619 | 136 |
| 1192 | 3300048929 | Ga0496126_0281491 | Ga0496126_0281491_353_769 | 136 |
| 1193 | 3300048929 | Ga0496126_0683396 | Ga0496126_0683396_270_686 | 136 |
| 1194 | 3300050489 | nmdc:mga03683_135432_c1 | nmdc:mga03683_135432_c1_210_620 | 136 |
| 1195 | 3300050489 | nmdc:mga03683_210903_c1 | nmdc:mga03683_210903_c1_220_636 | 136 |
| 1196 | 3300050492 | nmdc:mga0yw44_38547_c1 | nmdc:mga0yw44_38547_c1_1466_1882 | 136 |
| 1197 | 3300050492 | nmdc:mga0yw44_485355_c1 | nmdc:mga0yw44_485355_c1_187_597 | 136 |
| 1198 | 3300050493 | nmdc:mga0k408_584712_c1 | nmdc:mga0k408_584712_c1_207_617 | 136 |
| 1199 | 3300050496 | nmdc:mga07m45_205815_c1 | nmdc:mga07m45_205815_c1_714_1130 | 136 |
| 1200 | 3300050507 | nmdc:mga05p37_371810_c1 | nmdc:mga05p37_371810_c1_163_573 | 136 |
| 1201 | 3300050511 | nmdc:mga08y16_1404688_c1 | nmdc:mga08y16_1404688_c1_14_430 | 136 |
| 1202 | 3300050511 | nmdc:mga08y16_372766_c1 | nmdc:mga08y16_372766_c1_917_1327 | 136 |
| 1203 | 3300050512 | nmdc:mga0n895_454825_c1 | nmdc:mga0n895_454825_c1_839_1255 | 136 |
| 1204 | 3300050514 | nmdc:mga08x19_517253_c1 | nmdc:mga08x19_517253_c1_200_616 | 136 |
| 1205 | 3300050516 | nmdc:mga0sz30_137399_c1 | nmdc:mga0sz30_137399_c1_254_670 | 136 |
| 1206 | 3300053077 | Ga0495601_0448400 | Ga0495601_0448400_256_711 | 136 |
| 1207 | 3300053092 | Ga0500583_0139672 | Ga0500583_0139672_659_1069 | 136 |
| 1208 | 3300053098 | Ga0500650_0519080 | Ga0500650_0519080_63_479 | 136 |
| 1209 | 3300053119 | Ga0500595_032978 | Ga0500595_032978_1097_1513 | 136 |
| 1210 | 3300053130 | Ga0500642_0341662 | Ga0500642_0341662_46_462 | 136 |
| 1211 | 3300053139 | Ga0500568_0087431 | Ga0500568_0087431_27_437 | 136 |
| 1212 | 3300053147 | Ga0500589_169257 | Ga0500589_169257_292_708 | 136 |
| 1213 | 3300053148 | Ga0500590_140210 | Ga0500590_140210_485_901 | 136 |
| 1214 | 3300053158 | Ga0500627_0281844 | Ga0500627_0281844_84_497 | 136 |
| 1215 | 3300053161 | Ga0500634_0366805 | Ga0500634_0366805_62_478 | 136 |
| 1216 | 3300053162 | Ga0500638_261295 | Ga0500638_261295_70_486 | 136 |
| 1217 | 3300053730 | Ga0500645_071226 | Ga0500645_071226_381_797 | 136 |
| 1218 | 3300003659 | JGI25404J52841_10022340 | JGI25404J52841_100223402 | 137 |
| 1219 | 3300003659 | JGI25404J52841_10053954 | JGI25404J52841_100539541 | 137 |
| 1220 | 3300003911 | JGI25405J52794_10014185 | JGI25405J52794_100141852 | 137 |
| 1221 | 3300005331 | Ga0070670_102227136 | Ga0070670_1022271361 | 137 |
| 1222 | 3300005344 | Ga0070661_100405317 | Ga0070661_1004053172 | 137 |
| 1223 | 3300005356 | Ga0070674_100771291 | Ga0070674_1007712912 | 137 |
| 1224 | 3300005455 | Ga0070663_100046224 | Ga0070663_1000462243 | 137 |
| 1225 | 3300005456 | Ga0070678_100381895 | Ga0070678_1003818952 | 137 |
| 1226 | 3300005548 | Ga0070665_100145669 | Ga0070665_1001456692 | 137 |
| 1227 | 3300005548 | Ga0070665_100199162 | Ga0070665_1001991623 | 137 |
| 1228 | 3300005548 | Ga0070665_101315364 | Ga0070665_1013153642 | 137 |
| 1229 | 3300005618 | Ga0068864_101760038 | Ga0068864_1017600381 | 137 |
| 1230 | 3300005937 | Ga0081455_10003167 | Ga0081455_1000316711 | 137 |
| 1231 | 3300005937 | Ga0081455_10175758 | Ga0081455_101757582 | 137 |
| 1232 | 3300005983 | Ga0081540_1055339 | Ga0081540_10553393 | 137 |
| 1233 | 3300005983 | Ga0081540_1075802 | Ga0081540_10758023 | 137 |
| 1234 | 3300006038 | Ga0075365_10053601 | Ga0075365_100536012 | 137 |
| 1235 | 3300006038 | Ga0075365_10188859 | Ga0075365_101888592 | 137 |
| 1236 | 3300006048 | Ga0075363_100001995 | Ga0075363_10000199513 | 137 |
| 1237 | 3300006051 | Ga0075364_10640988 | Ga0075364_106409881 | 137 |
| 1238 | 3300006177 | Ga0075362_10154916 | Ga0075362_101549162 | 137 |
| 1239 | 3300006177 | Ga0075362_10293239 | Ga0075362_102932392 | 137 |
| 1240 | 3300006178 | Ga0075367_10069655 | Ga0075367_100696553 | 137 |
| 1241 | 3300006195 | Ga0075366_10085420 | Ga0075366_100854202 | 137 |
| 1242 | 3300006353 | Ga0075370_10007496 | Ga0075370_100074966 | 137 |
| 1243 | 3300009094 | Ga0111539_10591812 | Ga0111539_105918122 | 137 |
| 1244 | 3300009147 | Ga0114129_10388114 | Ga0114129_103881143 | 137 |
| 1245 | 3300009174 | Ga0105241_10632054 | Ga0105241_106320541 | 137 |
| 1246 | 3300009174 | Ga0105241_11138663 | Ga0105241_111386631 | 137 |
| 1247 | 3300009177 | Ga0105248_10302395 | Ga0105248_103023952 | 137 |
| 1248 | 3300009177 | Ga0105248_10485881 | Ga0105248_104858812 | 137 |
| 1249 | 3300009553 | Ga0105249_10647491 | Ga0105249_106474911 | 137 |
| 1250 | 3300011119 | Ga0105246_10234181 | Ga0105246_102341812 | 137 |
| 1251 | 3300013308 | Ga0157375_11575902 | Ga0157375_115759021 | 137 |
| 1252 | 3300014325 | Ga0163163_10226083 | Ga0163163_102260832 | 137 |
| 1253 | 3300014326 | Ga0157380_10368602 | Ga0157380_103686022 | 137 |
| 1254 | 3300025297 | Ga0209758_1033155 | Ga0209758_10331553 | 137 |
| 1255 | 3300025911 | Ga0207654_10599118 | Ga0207654_105991181 | 137 |
| 1256 | 3300025920 | Ga0207649_10188764 | Ga0207649_101887642 | 137 |
| 1257 | 3300025940 | Ga0207691_11428757 | Ga0207691_114287571 | 137 |
| 1258 | 3300025941 | Ga0207711_10337214 | Ga0207711_103372142 | 137 |
| 1259 | 3300025941 | Ga0207711_10637484 | Ga0207711_106374841 | 137 |
| 1260 | 3300025981 | Ga0207640_10612021 | Ga0207640_106120211 | 137 |
| 1261 | 3300026067 | Ga0207678_10067068 | Ga0207678_100670683 | 137 |
| 1262 | 3300026095 | Ga0207676_11782026 | Ga0207676_117820261 | 137 |
| 1263 | 3300026121 | Ga0207683_10183642 | Ga0207683_101836423 | 137 |
| 1264 | 3300028379 | Ga0268266_10002224 | Ga0268266_1000222420 | 137 |
| 1265 | 3300028379 | Ga0268266_10052951 | Ga0268266_100529513 | 137 |
| 1266 | 3300028794 | Ga0307515_10225691 | Ga0307515_102256913 | 137 |
| 1267 | 3300041491 | Ga0451833_0292474 | Ga0451833_0292474_57_470 | 137 |
| 1268 | 3300041512 | Ga0451853_3923295 | Ga0451853_3923295_67_486 | 137 |
| 1269 | 3300046471 | Ga0495650_0286449 | Ga0495650_0286449_49_468 | 137 |
| 1270 | 3300046616 | Ga0495668_0123568 | Ga0495668_0123568_202_615 | 137 |
| 1271 | 3300048905 | Ga0496102_0685502 | Ga0496102_0685502_378_791 | 137 |
| 1272 | 3300048906 | Ga0496103_0386385 | Ga0496103_0386385_162_575 | 137 |
| 1273 | 3300048907 | Ga0496104_0247603 | Ga0496104_0247603_967_1380 | 137 |
| 1274 | 3300048911 | Ga0496108_0175718 | Ga0496108_0175718_113_526 | 137 |
| 1275 | 3300048912 | Ga0496109_0728883 | Ga0496109_0728883_212_625 | 137 |
| 1276 | 3300048913 | Ga0496110_0391225 | Ga0496110_0391225_812_1225 | 137 |
| 1277 | 3300048916 | Ga0496113_0374943 | Ga0496113_0374943_203_616 | 137 |
| 1278 | 3300048917 | Ga0496114_0469677 | Ga0496114_0469677_642_1055 | 137 |
| 1279 | 3300048918 | Ga0496115_0026931 | Ga0496115_0026931_2058_2471 | 137 |
| 1280 | 3300048929 | Ga0496126_0370003 | Ga0496126_0370003_427_846 | 137 |
| 1281 | 3300049572 | Ga0501036_0135381 | Ga0501036_0135381_58_471 | 137 |
| 1282 | 3300049574 | Ga0501038_0960887 | Ga0501038_0960887_190_603 | 137 |
| 1283 | 3300049583 | Ga0501067_0021099 | Ga0501067_0021099_1701_2114 | 137 |
| 1284 | 3300049587 | Ga0501071_0527049 | Ga0501071_0527049_72_485 | 137 |
| 1285 | 3300049592 | Ga0501076_0945503 | Ga0501076_0945503_129_542 | 137 |
| 1286 | 3300049741 | Ga0501079_1164711 | Ga0501079_1164711_170_583 | 137 |
| 1287 | 3300049743 | Ga0501081_1229650 | Ga0501081_1229650_87_500 | 137 |
| 1288 | 3300050490 | nmdc:mga03n38_1553_c1 | nmdc:mga03n38_1553_c1_2759_3172 | 137 |
| 1289 | 3300050491 | nmdc:mga00v17_34577_c2 | nmdc:mga00v17_34577_c2_51_464 | 137 |
| 1290 | 3300050492 | nmdc:mga0yw44_166105_c1 | nmdc:mga0yw44_166105_c1_595_1008 | 137 |
| 1291 | 3300050493 | nmdc:mga0k408_303365_c1 | nmdc:mga0k408_303365_c1_241_654 | 137 |
| 1292 | 3300050493 | nmdc:mga0k408_88359_c1 | nmdc:mga0k408_88359_c1_956_1369 | 137 |
| 1293 | 3300050494 | nmdc:mga06z11_143684_c1 | nmdc:mga06z11_143684_c1_332_745 | 137 |
| 1294 | 3300050496 | nmdc:mga07m45_25003_c1 | nmdc:mga07m45_25003_c1_1812_2225 | 137 |
| 1295 | 3300053083 | Ga0495655_0262183 | Ga0495655_0262183_100_513 | 137 |
| 1296 | 3300053083 | Ga0495655_0346184 | Ga0495655_0346184_41_466 | 137 |
| 1297 | 3300053158 | Ga0500627_0364678 | Ga0500627_0364678_179_598 | 137 |
| 1298 | 3300003215 | JGI25153J46596_10005441 | JGI25153J46596_100054414 | 138 |
| 1299 | 3300005331 | Ga0070670_100572531 | Ga0070670_1005725312 | 138 |
| 1300 | 3300005338 | Ga0068868_100574773 | Ga0068868_1005747732 | 138 |
| 1301 | 3300005456 | Ga0070678_100080216 | Ga0070678_1000802163 | 138 |
| 1302 | 3300005539 | Ga0068853_100436045 | Ga0068853_1004360452 | 138 |
| 1303 | 3300005548 | Ga0070665_100375948 | Ga0070665_1003759482 | 138 |
| 1304 | 3300005937 | Ga0081455_10059660 | Ga0081455_100596602 | 138 |
| 1305 | 3300005985 | Ga0081539_10034639 | Ga0081539_100346391 | 138 |
| 1306 | 3300006048 | Ga0075363_100135024 | Ga0075363_1001350242 | 138 |
| 1307 | 3300006353 | Ga0075370_10286893 | Ga0075370_102868931 | 138 |
| 1308 | 3300009098 | Ga0105245_11114991 | Ga0105245_111149912 | 138 |
| 1309 | 3300025940 | Ga0207691_10643762 | Ga0207691_106437622 | 138 |
| 1310 | 3300026121 | Ga0207683_10122121 | Ga0207683_101221213 | 138 |
| 1311 | 3300028379 | Ga0268266_11050413 | Ga0268266_110504131 | 138 |
| 1312 | 3300028379 | Ga0268266_12368435 | Ga0268266_123684351 | 138 |
| 1313 | 3300046528 | Ga0495642_0501820 | Ga0495642_0501820_61_477 | 138 |
| 1314 | 3300050490 | nmdc:mga03n38_106575_c1 | nmdc:mga03n38_106575_c1_696_1112 | 138 |
| 1315 | 3300050493 | nmdc:mga0k408_304361_c1 | nmdc:mga0k408_304361_c1_370_786 | 138 |
| 1316 | 3300005459 | Ga0068867_100462130 | Ga0068867_1004621302 | 139 |
| 1317 | 3300005578 | Ga0068854_100117527 | Ga0068854_1001175273 | 142 |
| 1318 | 3300026078 | Ga0207702_11738654 | Ga0207702_117386542 | 142 |
| 1319 | 3300047472 | Ga0495686_0153619 | Ga0495686_0153619_254_733 | 151 |
| 1320 | 3300000549 | LJQas_1028333 | LJQas_10283331 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lmf-assembly1.cif.gz_A | crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72 | 0.6151 | 29 | 139 |
| 3lmf-assembly1.cif.gz_A | crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72 | 0.6016 | 29 | 139 |
| 6q58-assembly1.cif.gz_A | copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) | 0.5693 | 28 | 138 |
| 6q58-assembly1.cif.gz_A | copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) | 0.5323 | 28 | 138 |
| 5arm-assembly1.cif.gz_A | apo-csp3 (copper storage protein 3) from methylosinus | 0.5243 | 30 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LYI2_1_138_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.665 | 29 | 138 | 1.20.120.550 |
| af_Q54UK5_2_117_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6183 | 30 | 136 | 1.20.120.550 |
| af_M9NFP0_1_142_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.6145 | 28 | 153 | 1.20.120.350 |
| af_P40030_21_129_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.6057 | 31 | 129 | 3.40.605.10 |
| af_A0A6H2EED7_1_133_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5826 | 19 | 153 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S7TMA1-F1-model_v4 | LuxR family transcriptional regulator | 0.9136 | 25 | 154 |
GO:0005886
|
| AF-A0A5S4YP41-F1-model_v4 | DoxX family protein | 0.9134 | 21 | 153 |
GO:0005886
|
| AF-A0A4Q0Q588-F1-model_v4 | deleted | 0.9114 | 26 | 153 |
|
| AF-A0A4S1XIF3-F1-model_v4 | DoxX family protein | 0.9063 | 24 | 152 |
GO:0005886
|
| AF-A0A7Y4GYJ9-F1-model_v4 | DoxX family protein | 0.9061 | 19 | 151 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar