F493003

General Info

Members Datasets Scaffolds Average Seq Length
1323 417 2646 188

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0000518|Ga0495597_0000518_11135_11779
Length 214
Sequence MYTPRRSRPANWLSEKTNMPKLQHHEQIIKGREVVADDWTVLRLEPEDSSGGETPENVVIPAGKVIVPLKVWQAQREALIGRAGTNGQVGVWFAPDELAHTVKDDLGQFAVIAVDFPKFTDGRGYSIAFNLRKRFGYTGELRAIGDVLRDQLFQMHRCGFDAYATRQDRSIIDALKGLTVFSETYQASVDDPLPLYRRHQRDVPLEHSDIGAGI

Samples

Sample ID Description Type Environment
1 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
139 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
140 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
141 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
158 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
163 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
164 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
165 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
166 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
264 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
265 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
266 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
267 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
272 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
289 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
293 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
302 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
303 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
318 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
319 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
322 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
331 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
332 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
333 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
334 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
335 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
363 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
364 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
365 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
366 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
367 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
368 2643221556 Massilia sp. Root1485 Isolate Unclassified
369 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
370 2643221638 Duganella sp. Root336D2 Isolate Unclassified
371 2643221645 Massilia sp. Root351 Isolate Unclassified
372 2643221664 Massilia sp. Root418 Isolate Unclassified
373 2643221684 Massilia sp. Root133 Isolate Unclassified
374 2738541280 Massilia sp. GV090 Isolate Unclassified
375 2738541297 Duganella sp. GV083 Isolate Unclassified
376 2738541300 Massilia sp. GV016 Isolate Unclassified
377 2738541357 Duganella sp. GV053 Isolate Unclassified
378 2738543003 Duganella sp. GV066 Isolate Unclassified
379 2738543018 Massilia sp. GV045 Isolate Unclassified
380 2738543026 Duganella sp. GV089 Isolate Unclassified
381 2738543029 Duganella sp. GV039 Isolate Unclassified
382 2738543030 Massilia sp. GV097 Isolate Unclassified
383 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
384 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
385 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
386 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
387 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
388 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
389 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
390 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
391 2818991436 Collimonas arenae 515 Isolate Unclassified
392 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
393 2821131069 Duganella sp. 1224 Isolate Unclassified
394 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
395 2842711865 Duganella sp. R-73148 Isolate Unclassified
396 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
397 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
398 2857553236 Duganella sp. R-74557 Isolate Unclassified
399 2857558681 Duganella sp. R-74565 Isolate Unclassified
400 2857564685 Duganella sp. R-74599 Isolate Unclassified
401 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
402 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
403 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
404 2904424332 Duganella sp. 1411 Isolate Rhizosphere
405 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
406 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
407 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
408 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
409 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
410 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
411 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
412 2919476304 Duganella sp. 3397 Isolate Unclassified
413 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
414 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
415 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
416 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
417 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.08
Metatranscriptomes 4.76
Isolates 4.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.99
Nodule 0.38
Rhizoplane 3.78
Rhizosphere 80.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495597_0000518 3300046542 Bacteria 31973
2 JGI25155J39150_1001397 3300002704 Bacteria 1762
3 JGI25162J39368_1000941 3300002737 Bacteria 18693
4 JGI25154J39366_1002325 3300002738 Bacteria 5058
5 JGI25158J39367_1005047 3300002739 Bacteria 1952
6 JGI25157J39369_1008404 3300002741 Bacteria 1436
7 JGI25164J39214_1006552 3300002772 Bacteria 1217
8 JGI25150J39212_1000878 3300002774 Bacteria 9898
9 JGI25159J45721_1001607 3300002987 Bacteria 9233
10 JGI25159J45721_1034026 3300002987 Bacteria 792
11 JGI25159J45721_1035050 3300002987 Bacteria 771
12 JGI25151J46595_10095729 3300003187 Bacteria 813
13 JGI25165J46597_1001005 3300003214 Bacteria 18693
14 JGI25153J46596_10017520 3300003215 Bacteria 2819
15 rootL2_10117451 3300003322 Bacteria 1864
16 rootL2_10235950 3300003322 Bacteria 1695
17 JGI25160J50197_1005858 3300003354 Bacteria 5057
18 JGI25160J50197_1064757 3300003354 Bacteria 716
19 JGI25161J50226_1004319 3300003374 Bacteria 3001
20 JGI25161J50226_1016428 3300003374 Bacteria 792
21 JGI25161J50226_1016966 3300003374 Bacteria 771
22 Ga0007417J51691_1040873 3300003544 Bacteria 5536
23 Ga0007410J51695_1025360 3300003574 Bacteria 4253
24 Ga0007410J51695_1053297 3300003574 Bacteria 2483
25 Ga0007409J51694_1024193 3300003575 Bacteria 3230
26 Ga0007416J51690_1036363 3300003577 Bacteria 6197
27 Ga0032354_1073879 3300003693 Bacteria 3029
28 Ga0055538_1000368 3300003751 Bacteria 18693
29 Ga0055539_1000040 3300003752 Bacteria 200831
30 Ga0055539_1000374 3300003752 Bacteria 18693
31 Ga0055533_1000050 3300003756 Bacteria 200831
32 Ga0055533_1000368 3300003756 Bacteria 18693
33 Ga0055525_1000029 3300003759 Bacteria 320663
34 Ga0055525_1000060 3300003759 Bacteria 200831
35 Ga0055525_1000516 3300003759 Bacteria 18693
36 Ga0055542_1004564 3300003762 Bacteria 3326
37 Ga0055529_1000342 3300003763 Bacteria 52150
38 Ga0055526_1000010 3300003771 Bacteria 241512
39 Ga0055526_1002173 3300003771 Bacteria 13450
40 Ga0055526_1017836 3300003771 Bacteria 2686
41 Ga0055537_1000937 3300003773 Bacteria 13565
42 Ga0055537_1005281 3300003773 Bacteria 3498
43 Ga0055524_1000025 3300003775 Bacteria 216427
44 Ga0055524_1004938 3300003775 Bacteria 6046
45 Ga0055524_1005784 3300003775 Bacteria 5464
46 Ga0055524_1009626 3300003775 Bacteria 3908
47 Ga0055534_1000428 3300003784 Bacteria 25148
48 Ga0055528_1000298 3300003790 Bacteria 42146
49 Ga0055528_1005927 3300003790 Bacteria 5606
50 Ga0055530_10008929 3300003791 Bacteria 3928
51 Ga0055531_10024084 3300003794 Bacteria 2258
52 Ga0055541_1000027 3300003841 Bacteria 200831
53 Ga0055541_1000258 3300003841 Bacteria 18693
54 Ga0055543_1000252 3300004625 Bacteria 40605
55 Ga0055543_1005048 3300004625 Bacteria 3442
56 Ga0065165_1002897 3300005262 Bacteria 13172
57 Ga0065165_1003747 3300005262 Bacteria 10222
58 Ga0065165_1010725 3300005262 Bacteria 3916
59 Ga0065165_1017590 3300005262 Bacteria 2626
60 Ga0065165_1022171 3300005262 Bacteria 2186
61 Ga0065715_10021568 3300005293 Bacteria 1402
62 Ga0070658_10202939 3300005327 Bacteria 1673
63 Ga0070683_100297656 3300005329 Bacteria 1535
64 Ga0070670_100504101 3300005331 Bacteria 1077
65 Ga0070682_100438684 3300005337 Bacteria 997
66 Ga0070660_100037845 3300005339 Bacteria 3658
67 Ga0070661_100366360 3300005344 Bacteria 1133
68 Ga0070674_100792003 3300005356 Bacteria 818
69 Ga0070659_100073903 3300005366 Bacteria 2714
70 Ga0070659_100882377 3300005366 Bacteria 781
71 Ga0070662_100159866 3300005457 Bacteria 1761
72 Ga0070662_100355814 3300005457 Bacteria 1200
73 Ga0068853_100292144 3300005539 Bacteria 1505
74 Ga0068855_100002757 3300005563 Bacteria 21625
75 Ga0068855_100102314 3300005563 Bacteria 3297
76 Ga0068855_100283601 3300005563 Bacteria 1838
77 Ga0070664_100491215 3300005564 Bacteria 1131
78 Ga0070664_100770866 3300005564 Bacteria 898
79 Ga0068857_100703916 3300005577 Bacteria 960
80 Ga0068854_100051659 3300005578 Bacteria 2945
81 Ga0068854_100130581 3300005578 Bacteria 1918
82 Ga0068856_100395310 3300005614 Bacteria 1402
83 Ga0068852_100062205 3300005616 Bacteria 3246
84 Ga0068851_10454509 3300005834 Bacteria 762
85 Ga0070717_10201325 3300006028 Bacteria 1744
86 Ga0070712_100223669 3300006175 Bacteria 1491
87 Ga0070712_100344393 3300006175 Bacteria 1218
88 Ga0075362_10003942 3300006177 Bacteria 5272
89 Ga0075370_10296173 3300006353 Bacteria 962
90 Ga0068865_100117622 3300006881 Bacteria 1971
91 Ga0079104_1010402 3300006946 Bacteria 3067
92 Ga0079104_1046848 3300006946 Bacteria 981
93 Ga0099826_10000005 3300006948 Bacteria 465206
94 Ga0105244_10000745 3300009036 Bacteria 27842
95 Ga0105244_10012212 3300009036 Bacteria 5092
96 Ga0105244_10116061 3300009036 Bacteria 1299
97 Ga0105244_10191878 3300009036 Bacteria 966
98 Ga0105240_10054750 3300009093 Bacteria 4998
99 Ga0105240_10082061 3300009093 Bacteria 3960
100 Ga0105245_10631442 3300009098 Bacteria 1100
101 Ga0105243_10102799 3300009148 Bacteria 2375
102 Ga0105241_10143786 3300009174 Bacteria 1945
103 Ga0105241_11124248 3300009174 Bacteria 741
104 Ga0105237_10022239 3300009545 Bacteria 6506
105 Ga0105237_10290937 3300009545 Bacteria 1636
106 Ga0105238_10000194 3300009551 Bacteria 67211
107 Ga0105238_10427171 3300009551 Bacteria 1320
108 Ga0105239_10053126 3300010375 Bacteria 4445
109 Ga0105239_10245680 3300010375 Bacteria 2009
110 Ga0105246_10563406 3300011119 Bacteria 978
111 Ga0157371_10000014 3300013102 Bacteria 347490
112 Ga0157374_10344507 3300013296 Bacteria 1480
113 Ga0157378_10134421 3300013297 Bacteria 2292
114 Ga0157375_11083406 3300013308 Bacteria 937
115 Ga0182008_10000724 3300014497 Bacteria 23482
116 Ga0157376_10361913 3300014969 Bacteria 1391
117 Ga0182006_1000004 3300015261 Bacteria 622190
118 Ga0182006_1000290 3300015261 Bacteria 44220
119 Ga0182007_10000017 3300015262 Bacteria 199097
120 Ga0182007_10008736 3300015262 Bacteria 4136
121 Ga0182007_10049313 3300015262 Bacteria 1391
122 Ga0182005_1000005 3300015265 Bacteria 537378
123 Ga0182005_1000030 3300015265 Bacteria 213092
124 Ga0182005_1001465 3300015265 Bacteria 9464
125 Ga0163161_10037365 3300017792 Bacteria 3481
126 Ga0163161_10247346 3300017792 Bacteria 1389
127 Ga0163161_10302148 3300017792 Bacteria 1260
128 Ga0206351_10506011 3300020077 Bacteria 2402
129 Ga0206350_11236533 3300020080 Bacteria 731
130 Ga0154015_1389132 3300020610 Bacteria 881
131 Ga0213872_10000283 3300021361 Bacteria 43308
132 Ga0213872_10000448 3300021361 Bacteria 33688
133 Ga0213872_10004436 3300021361 Bacteria 7456
134 Ga0213872_10077914 3300021361 Bacteria 1489
135 Ga0213872_10125793 3300021361 Bacteria 1131
136 Ga0209760_102043 3300025207 Bacteria 1953
137 Ga0209436_100676 3300025208 Bacteria 14517
138 Ga0209436_101244 3300025208 Bacteria 9168
139 Ga0209436_112780 3300025208 Bacteria 1409
140 Ga0209436_115894 3300025208 Bacteria 1146
141 Ga0209784_100005 3300025224 Bacteria 1040422
142 Ga0209784_100020 3300025224 Bacteria 412353
143 Ga0209566_100005 3300025225 Bacteria 1040422
144 Ga0209566_100020 3300025225 Bacteria 412353
145 Ga0209674_100009 3300025226 Bacteria 1040422
146 Ga0209674_100035 3300025226 Bacteria 412353
147 Ga0209672_107956 3300025228 Bacteria 1601
148 Ga0209563_100003 3300025230 Bacteria 1932942
149 Ga0209563_100012 3300025230 Bacteria 1040422
150 Ga0209563_100038 3300025230 Bacteria 412353
151 Ga0207427_101044 3300025231 Bacteria 11509
152 Ga0209437_100066 3300025233 Bacteria 327883
153 Ga0207425_1000017 3300025245 Bacteria 423851
154 Ga0207425_1000207 3300025245 Bacteria 46813
155 Ga0207425_1001019 3300025245 Bacteria 13102
156 Ga0209646_1000036 3300025246 Bacteria 358864
157 Ga0209026_1003311 3300025250 Bacteria 5368
158 Ga0209677_100006 3300025253 Bacteria 1040422
159 Ga0209677_100031 3300025253 Bacteria 329719
160 Ga0209148_1000716 3300025254 Bacteria 26382
161 Ga0209129_1000039 3300025258 Bacteria 322444
162 Ga0209233_1000060 3300025261 Bacteria 412379
163 Ga0209565_1000068 3300025263 Bacteria 171201
164 Ga0209565_1006462 3300025263 Bacteria 3284
165 Ga0209565_1006693 3300025263 Bacteria 3202
166 Ga0209455_1000047 3300025272 Bacteria 379709
167 Ga0209673_1000119 3300025273 Bacteria 171203
168 Ga0209673_1004774 3300025273 Bacteria 7121
169 Ga0209130_1000057 3300025284 Bacteria 210593
170 Ga0209130_1000491 3300025284 Bacteria 40619
171 Ga0209130_1002491 3300025284 Bacteria 9129
172 Ga0209130_1022423 3300025284 Bacteria 1409
173 Ga0209675_1000068 3300025291 Bacteria 171202
174 Ga0209675_1001374 3300025291 Bacteria 14247
175 Ga0209675_1045372 3300025291 Bacteria 935
176 Ga0209675_1058720 3300025291 Bacteria 767
177 Ga0209025_1002795 3300025294 Bacteria 17583
178 Ga0209564_1000060 3300025295 Bacteria 325890
179 Ga0209564_1000141 3300025295 Bacteria 179852
180 Ga0209564_1000149 3300025295 Bacteria 170958
181 Ga0209564_1002252 3300025295 Bacteria 15819
182 Ga0209564_1015501 3300025295 Bacteria 3093
183 Ga0209758_1000192 3300025297 Bacteria 136933
184 Ga0209758_1001203 3300025297 Bacteria 32670
185 Ga0209050_1000762 3300025298 Bacteria 46324
186 Ga0209050_1008259 3300025298 Bacteria 5612
187 Ga0209256_1000040 3300025299 Bacteria 366839
188 Ga0209256_1000651 3300025299 Bacteria 47267
189 Ga0209256_1000744 3300025299 Bacteria 42676
190 Ga0209256_1001036 3300025299 Bacteria 32591
191 Ga0207426_1002755 3300025302 Bacteria 10630
192 Ga0207426_1040942 3300025302 Bacteria 1440
193 Ga0209051_1006195 3300025303 Bacteria 6781
194 Ga0209257_1000501 3300025304 Bacteria 69426
195 Ga0207655_1006610 3300025728 Bacteria 7647
196 Ga0207705_10002800 3300025909 Bacteria 13337
197 Ga0207654_10037957 3300025911 Bacteria 2700
198 Ga0207695_10000851 3300025913 Bacteria 56040
199 Ga0207695_10188300 3300025913 Bacteria 1982
200 Ga0207671_10005917 3300025914 Bacteria 11093
201 Ga0207693_10085895 3300025915 Bacteria 2465
202 Ga0207660_10043233 3300025917 Bacteria 3166
203 Ga0207657_10075164 3300025919 Bacteria 2852
204 Ga0207657_10087205 3300025919 Bacteria 2611
205 Ga0207694_10002153 3300025924 Bacteria 16174
206 Ga0207650_10236193 3300025925 Bacteria 1476
207 Ga0207690_10116410 3300025932 Bacteria 1933
208 Ga0207706_10129576 3300025933 Bacteria 2219
209 Ga0207706_10173071 3300025933 Bacteria 1897
210 Ga0207686_10489218 3300025934 Bacteria 953
211 Ga0207709_10056555 3300025935 Bacteria 2428
212 Ga0207679_10166724 3300025945 Bacteria 1809
213 Ga0207679_10206297 3300025945 Bacteria 1645
214 Ga0207667_10000073 3300025949 Bacteria 174391
215 Ga0207667_10000076 3300025949 Bacteria 166704
216 Ga0207667_10098172 3300025949 Bacteria 3023
217 Ga0207667_10165091 3300025949 Bacteria 2277
218 Ga0207667_10191529 3300025949 Bacteria 2098
219 Ga0207640_10024135 3300025981 Bacteria 3664
220 Ga0207640_10252959 3300025981 Bacteria 1368
221 Ga0207639_10033519 3300026041 Bacteria 3789
222 Ga0207678_10087167 3300026067 Bacteria 2668
223 Ga0207702_10043762 3300026078 Bacteria 3761
224 Ga0207702_10542866 3300026078 Bacteria 1136
225 Ga0207702_11495134 3300026078 Bacteria 669
226 Ga0207674_10240909 3300026116 Bacteria 1756
227 Ga0207698_10857750 3300026142 Bacteria 913
228 Ga0209282_1000003 3300027666 Bacteria 856377
229 Ga0307515_10119315 3300028794 Bacteria 3002
230 Ga0316180_1008266 3300030736 Bacteria 2798
231 Ga0316183_1154518 3300030742 Bacteria 775
232 Ga0316181_1283885 3300030744 Bacteria 1348
233 Ga0316181_1285192 3300030744 Bacteria 2449
234 Ga0316182_1064365 3300030745 Bacteria 1634
235 Ga0307408_100000709 3300031548 Bacteria 27106
236 Ga0307408_100004480 3300031548 Bacteria 9482
237 Ga0307408_100267981 3300031548 Bacteria 1416
238 Ga0307408_100270566 3300031548 Bacteria 1410
239 Ga0307408_100300425 3300031548 Bacteria 1344
240 Ga0307408_100859421 3300031548 Bacteria 828
241 Ga0265314_10020225 3300031711 Bacteria 5141
242 Ga0307416_100012578 3300032002 Bacteria 5710
243 Ga0307415_101617690 3300032126 Bacteria 623
244 Ga0373936_0213098 3300035113 Bacteria 855
245 Ga0373935_0555947 3300035692 Bacteria 837
246 Ga0373927_0226681 3300035695 Bacteria 1228
247 Ga0373925_0153892 3300037068 Bacteria 1808
248 Ga0395899_0000128 3300037312 Bacteria 119014
249 Ga0395899_0008506 3300037312 Bacteria 7905
250 Ga0395899_0022800 3300037312 Bacteria 4743
251 Ga0395899_0048411 3300037312 Bacteria 3163
252 Ga0395899_0057304 3300037312 Bacteria 2877
253 Ga0395899_0280520 3300037312 Bacteria 1133
254 Ga0395899_0303542 3300037312 Bacteria 1080
255 Ga0395899_0314943 3300037312 Bacteria 1055
256 Ga0395899_0386057 3300037312 Bacteria 930
257 Ga0395899_0720931 3300037312 Bacteria 623
258 Ga0395900_0000123 3300037418 Bacteria 133326
259 Ga0395900_0014613 3300037418 Bacteria 8009
260 Ga0395900_0027294 3300037418 Bacteria 5846
261 Ga0395900_0042657 3300037418 Bacteria 4674
262 Ga0395900_0079638 3300037418 Bacteria 3366
263 Ga0395900_0220729 3300037418 Bacteria 1910
264 Ga0395900_0286961 3300037418 Bacteria 1636
265 Ga0395900_0398736 3300037418 Bacteria 1340
266 Ga0395900_0542624 3300037418 Bacteria 1108
267 Ga0395900_1204882 3300037418 Bacteria 672
268 Ga0395898_0138988 3300037466 Bacteria 2325
269 Ga0395898_0196161 3300037466 Bacteria 1928
270 Ga0395898_0207303 3300037466 Bacteria 1870
271 Ga0395898_0362781 3300037466 Bacteria 1381
272 Ga0395898_0427698 3300037466 Bacteria 1262
273 Ga0395898_0640392 3300037466 Bacteria 1005
274 Ga0395905_0005259 3300037471 Bacteria 13240
275 Ga0395905_0022902 3300037471 Bacteria 5904
276 Ga0395905_0033212 3300037471 Bacteria 4847
277 Ga0395905_0111535 3300037471 Bacteria 2568
278 Ga0395905_0114293 3300037471 Bacteria 2536
279 Ga0395905_0241862 3300037471 Bacteria 1686
280 Ga0395905_0260006 3300037471 Bacteria 1621
281 Ga0395905_0305648 3300037471 Bacteria 1478
282 Ga0395905_0586188 3300037471 Bacteria 1017
283 Ga0395905_1101204 3300037471 Bacteria 697
284 Ga0395901_0000411 3300038443 Bacteria 50643
285 Ga0395901_0005452 3300038443 Bacteria 12875
286 Ga0395901_0047248 3300038443 Bacteria 4469
287 Ga0395901_0252920 3300038443 Bacteria 1835
288 Ga0395901_0337736 3300038443 Bacteria 1556
289 Ga0395901_0395240 3300038443 Bacteria 1421
290 Ga0395901_0445753 3300038443 Bacteria 1324
291 Ga0395901_0475940 3300038443 Bacteria 1274
292 Ga0395901_1061304 3300038443 Bacteria 782
293 Ga0395901_1371008 3300038443 Bacteria 666
294 Ga0436361_0074798 3300039447 Bacteria 5460
295 Ga0436361_0169492 3300039447 Bacteria 795
296 Ga0436361_0473182 3300039447 Bacteria 1363
297 Ga0436361_0519246 3300039447 Bacteria 881
298 Ga0436361_0615250 3300039447 Bacteria 17905
299 Ga0436361_0749276 3300039447 Bacteria 31293
300 Ga0436361_1222095 3300039447 Bacteria 17376
301 Ga0439465_0035484 3300041413 Bacteria 1599
302 Ga0439433_0018004 3300041999 Bacteria 1571
303 Ga0439442_082667 3300042002 Bacteria 688
304 Ga0439448_0013284 3300042005 Bacteria 2472
305 Ga0439449_0102257 3300042007 Bacteria 1059
306 Ga0439455_0010134 3300042012 Bacteria 2063
307 Ga0439455_0177751 3300042012 Bacteria 612
308 Ga0450890_018864 3300042127 Bacteria 926
309 Ga0450903_041946 3300042138 Bacteria 676
310 Ga0450904_000049 3300042139 Bacteria 27407
311 Ga0439458_0028194 3300042157 Bacteria 1328
312 Ga0450893_0017630 3300042532 Bacteria 1214
313 Ga0451577_1178446 3300042876 Bacteria 684
314 Ga0466972_0000037 3300044658 Bacteria 137184
315 Ga0466965_0000474 3300044683 Bacteria 14203
316 Ga0466965_0020181 3300044683 Bacteria 3201
317 Ga0466965_0030284 3300044683 Bacteria 2636
318 Ga0466965_0068005 3300044683 Bacteria 1788
319 Ga0466965_0103094 3300044683 Bacteria 1460
320 Ga0466965_0237262 3300044683 Bacteria 975
321 Ga0466966_0096161 3300044684 Bacteria 1834
322 Ga0466966_0098417 3300044684 Bacteria 1811
323 Ga0466966_0109762 3300044684 Bacteria 1701
324 Ga0466961_0043597 3300044693 Bacteria 2872
325 Ga0466961_0250941 3300044693 Bacteria 1086
326 Ga0466964_0000496 3300044706 Bacteria 12210
327 Ga0466964_0010954 3300044706 Bacteria 3426
328 Ga0466964_0026294 3300044706 Bacteria 2277
329 Ga0466964_0057639 3300044706 Bacteria 1608
330 Ga0466964_0292231 3300044706 Bacteria 818
331 Ga0453684_0114685 3300044712 Bacteria 3266
332 Ga0466971_0061606 3300044719 Bacteria 1696
333 Ga0466971_0238477 3300044719 Bacteria 864
334 Ga0466971_0308035 3300044719 Bacteria 761
335 Ga0466968_0016884 3300044735 Bacteria 2910
336 Ga0466968_0164133 3300044735 Bacteria 1026
337 Ga0466968_0251083 3300044735 Bacteria 840
338 Ga0466970_0040068 3300044765 Bacteria 2487
339 Ga0466970_0109047 3300044765 Bacteria 1511
340 Ga0466970_0391589 3300044765 Bacteria 792
341 Ga0466957_0032481 3300044842 Bacteria 3125
342 Ga0466957_0107698 3300044842 Bacteria 1764
343 Ga0466957_0112865 3300044842 Bacteria 1725
344 Ga0466957_0207361 3300044842 Bacteria 1289
345 Ga0466957_0494223 3300044842 Bacteria 847
346 Ga0466960_0053691 3300044901 Bacteria 1954
347 Ga0466959_0010886 3300045049 Bacteria 6521
348 Ga0466959_0076227 3300045049 Bacteria 2422
349 Ga0466959_0212582 3300045049 Bacteria 1343
350 Ga0466959_0649014 3300045049 Bacteria 708
351 Ga0466958_0373859 3300045836 Bacteria 918
352 Ga0466958_0414356 3300045836 Bacteria 870
353 Ga0466967_0098434 3300045976 Bacteria 2670
354 Ga0466967_0270799 3300045976 Bacteria 1627
355 Ga0466967_0610083 3300045976 Bacteria 1077
356 Ga0466967_1316954 3300045976 Bacteria 719
357 Ga0495617_000005 3300046452 Bacteria 404687
358 Ga0495617_000034 3300046452 Bacteria 147232
359 Ga0495617_008342 3300046452 Bacteria 3573
360 Ga0495617_066666 3300046452 Bacteria 1186
361 Ga0495617_114605 3300046452 Bacteria 870
362 Ga0495617_117817 3300046452 Bacteria 856
363 Ga0495627_000038 3300046453 Bacteria 198316
364 Ga0495627_000208 3300046453 Bacteria 63467
365 Ga0495627_009453 3300046453 Bacteria 3586
366 Ga0495627_024171 3300046453 Bacteria 1983
367 Ga0495627_026329 3300046453 Bacteria 1876
368 Ga0495627_103375 3300046453 Bacteria 812
369 Ga0495627_114683 3300046453 Bacteria 763
370 Ga0495592_0042223 3300046454 Bacteria 3415
371 Ga0495603_0007343 3300046455 Bacteria 6627
372 Ga0495590_0000189 3300046457 Bacteria 35045
373 Ga0495590_0000271 3300046457 Bacteria 28007
374 Ga0495590_0000312 3300046457 Bacteria 25393
375 Ga0495590_0013995 3300046457 Bacteria 2938
376 Ga0495590_0028735 3300046457 Bacteria 1950
377 Ga0495590_0049778 3300046457 Bacteria 1462
378 Ga0495590_0069971 3300046457 Bacteria 1230
379 Ga0495591_000594 3300046458 Bacteria 27373
380 Ga0495591_012883 3300046458 Bacteria 3089
381 Ga0495629_0009511 3300046459 Bacteria 7102
382 Ga0495629_0033319 3300046459 Bacteria 3644
383 Ga0495629_0089891 3300046459 Bacteria 2142
384 Ga0495638_0000765 3300046460 Bacteria 34151
385 Ga0495638_0005494 3300046460 Bacteria 9422
386 Ga0495638_0021349 3300046460 Bacteria 4270
387 Ga0495638_0045819 3300046460 Bacteria 2750
388 Ga0495638_0071582 3300046460 Bacteria 2121
389 Ga0495638_0133467 3300046460 Bacteria 1456
390 Ga0495638_0149634 3300046460 Bacteria 1355
391 Ga0495638_0265987 3300046460 Bacteria 938
392 Ga0495638_0278026 3300046460 Bacteria 911
393 Ga0495638_0320262 3300046460 Bacteria 829
394 Ga0495651_0002551 3300046462 Bacteria 14085
395 Ga0495651_0149752 3300046462 Bacteria 1683
396 Ga0495653_0000172 3300046463 Bacteria 53376
397 Ga0495653_0027405 3300046463 Bacteria 4559
398 Ga0495653_0050788 3300046463 Bacteria 3187
399 Ga0495653_0088626 3300046463 Bacteria 2269
400 Ga0495653_0205054 3300046463 Bacteria 1335
401 Ga0495653_0267700 3300046463 Bacteria 1127
402 Ga0495653_0336884 3300046463 Bacteria 973
403 Ga0495650_0000011 3300046471 Bacteria 615329
404 Ga0495650_0000525 3300046471 Bacteria 55920
405 Ga0495650_0001069 3300046471 Bacteria 30311
406 Ga0495650_0001815 3300046471 Bacteria 19178
407 Ga0495650_0003789 3300046471 Bacteria 10772
408 Ga0495650_0011548 3300046471 Bacteria 4827
409 Ga0495650_0029142 3300046471 Bacteria 2521
410 Ga0495650_0030185 3300046471 Bacteria 2458
411 Ga0495650_0035886 3300046471 Bacteria 2177
412 Ga0495650_0088876 3300046471 Bacteria 1178
413 Ga0495580_0009618 3300046472 Bacteria 7592
414 Ga0495580_0385589 3300046472 Bacteria 946
415 Ga0495582_0071576 3300046473 Bacteria 1918
416 Ga0495582_0207890 3300046473 Bacteria 1118
417 Ga0495605_0000029 3300046474 Bacteria 215329
418 Ga0495605_0000151 3300046474 Bacteria 89442
419 Ga0495605_0000612 3300046474 Bacteria 27908
420 Ga0495605_0005809 3300046474 Bacteria 7140
421 Ga0495605_0014900 3300046474 Bacteria 4241
422 Ga0495605_0033959 3300046474 Bacteria 2586
423 Ga0495605_0040395 3300046474 Bacteria 2330
424 Ga0495605_0043053 3300046474 Bacteria 2240
425 Ga0495605_0043300 3300046474 Bacteria 2232
426 Ga0495605_0144411 3300046474 Bacteria 1065
427 Ga0495605_0351085 3300046474 Bacteria 618
428 Ga0495639_0042232 3300046475 Bacteria 2056
429 Ga0495584_0000007 3300046491 Bacteria 294820
430 Ga0495584_0000428 3300046491 Bacteria 28971
431 Ga0495584_0001326 3300046491 Bacteria 15011
432 Ga0495584_0004529 3300046491 Bacteria 7461
433 Ga0495584_0005462 3300046491 Bacteria 6733
434 Ga0495584_0006970 3300046491 Bacteria 5903
435 Ga0495584_0012230 3300046491 Bacteria 4384
436 Ga0495584_0027295 3300046491 Bacteria 2893
437 Ga0495584_0027858 3300046491 Bacteria 2862
438 Ga0495584_0029009 3300046491 Bacteria 2804
439 Ga0495584_0058537 3300046491 Bacteria 1938
440 Ga0495584_0073840 3300046491 Bacteria 1714
441 Ga0495584_0099104 3300046491 Bacteria 1472
442 Ga0495584_0100589 3300046491 Bacteria 1461
443 Ga0495584_0102969 3300046491 Bacteria 1443
444 Ga0495584_0123320 3300046491 Bacteria 1312
445 Ga0495584_0133913 3300046491 Bacteria 1258
446 Ga0495584_0165074 3300046491 Bacteria 1125
447 Ga0495584_0306542 3300046491 Bacteria 806
448 Ga0495585_0000737 3300046492 Bacteria 29182
449 Ga0495585_0001834 3300046492 Bacteria 16091
450 Ga0495585_0002067 3300046492 Bacteria 14761
451 Ga0495585_0003005 3300046492 Bacteria 11640
452 Ga0495585_0003373 3300046492 Bacteria 10812
453 Ga0495585_0006129 3300046492 Bacteria 7506
454 Ga0495585_0006176 3300046492 Bacteria 7469
455 Ga0495585_0008447 3300046492 Bacteria 6240
456 Ga0495585_0012312 3300046492 Bacteria 5039
457 Ga0495585_0028688 3300046492 Bacteria 3172
458 Ga0495585_0034645 3300046492 Bacteria 2854
459 Ga0495585_0051582 3300046492 Bacteria 2279
460 Ga0495585_0058349 3300046492 Bacteria 2129
461 Ga0495585_0062307 3300046492 Bacteria 2048
462 Ga0495585_0110996 3300046492 Bacteria 1458
463 Ga0495585_0141316 3300046492 Bacteria 1260
464 Ga0495585_0161999 3300046492 Bacteria 1160
465 Ga0495585_0174131 3300046492 Bacteria 1109
466 Ga0495585_0200109 3300046492 Bacteria 1017
467 Ga0495585_0265891 3300046492 Bacteria 851
468 Ga0495594_0001260 3300046499 Bacteria 13275
469 Ga0495594_0004863 3300046499 Bacteria 6915
470 Ga0495594_0009850 3300046499 Bacteria 4951
471 Ga0495594_0013523 3300046499 Bacteria 4263
472 Ga0495594_0050844 3300046499 Bacteria 2280
473 Ga0495594_0067878 3300046499 Bacteria 1980
474 Ga0495594_0198917 3300046499 Bacteria 1142
475 Ga0495596_0000530 3300046500 Bacteria 23944
476 Ga0495596_0001401 3300046500 Bacteria 13831
477 Ga0495596_0002167 3300046500 Bacteria 10702
478 Ga0495596_0002608 3300046500 Bacteria 9578
479 Ga0495596_0008609 3300046500 Bacteria 4531
480 Ga0495596_0011442 3300046500 Bacteria 3829
481 Ga0495596_0013575 3300046500 Bacteria 3449
482 Ga0495596_0017436 3300046500 Bacteria 2971
483 Ga0495596_0030976 3300046500 Bacteria 2139
484 Ga0495596_0034306 3300046500 Bacteria 2015
485 Ga0495596_0060757 3300046500 Bacteria 1472
486 Ga0495596_0063008 3300046500 Bacteria 1442
487 Ga0495596_0065313 3300046500 Bacteria 1415
488 Ga0495596_0138125 3300046500 Bacteria 946
489 Ga0495596_0199009 3300046500 Bacteria 778
490 Ga0495607_0002820 3300046501 Bacteria 13799
491 Ga0495607_0003795 3300046501 Bacteria 11414
492 Ga0495607_0021369 3300046501 Bacteria 4073
493 Ga0495607_0024184 3300046501 Bacteria 3791
494 Ga0495607_0027265 3300046501 Bacteria 3534
495 Ga0495607_0027983 3300046501 Bacteria 3480
496 Ga0495607_0044857 3300046501 Bacteria 2603
497 Ga0495607_0054165 3300046501 Bacteria 2312
498 Ga0495607_0074643 3300046501 Bacteria 1881
499 Ga0495607_0080680 3300046501 Bacteria 1788
500 Ga0495607_0083620 3300046501 Bacteria 1748
501 Ga0495607_0094447 3300046501 Bacteria 1613
502 Ga0495607_0099958 3300046501 Bacteria 1555
503 Ga0495607_0102604 3300046501 Bacteria 1529
504 Ga0495607_0260150 3300046501 Bacteria 831
505 Ga0495607_0390026 3300046501 Bacteria 635
506 Ga0495583_0000228 3300046506 Bacteria 93924
507 Ga0495583_0000337 3300046506 Bacteria 73928
508 Ga0495583_0000569 3300046506 Bacteria 50860
509 Ga0495583_0003815 3300046506 Bacteria 11184
510 Ga0495583_0003904 3300046506 Bacteria 11039
511 Ga0495583_0003906 3300046506 Bacteria 11034
512 Ga0495583_0012258 3300046506 Bacteria 4864
513 Ga0495583_0015352 3300046506 Bacteria 4169
514 Ga0495583_0016181 3300046506 Bacteria 4020
515 Ga0495583_0019684 3300046506 Bacteria 3516
516 Ga0495583_0025899 3300046506 Bacteria 2920
517 Ga0495583_0036055 3300046506 Bacteria 2356
518 Ga0495583_0047446 3300046506 Bacteria 1975
519 Ga0495583_0053939 3300046506 Bacteria 1822
520 Ga0495583_0146091 3300046506 Bacteria 982
521 Ga0495583_0213460 3300046506 Bacteria 781
522 Ga0495606_0000077 3300046507 Bacteria 166824
523 Ga0495606_0000622 3300046507 Bacteria 55871
524 Ga0495606_0001807 3300046507 Bacteria 27215
525 Ga0495606_0002440 3300046507 Bacteria 21605
526 Ga0495606_0006073 3300046507 Bacteria 11286
527 Ga0495606_0006229 3300046507 Bacteria 11080
528 Ga0495606_0006875 3300046507 Bacteria 10371
529 Ga0495606_0017797 3300046507 Bacteria 5353
530 Ga0495606_0030864 3300046507 Bacteria 3736
531 Ga0495606_0036098 3300046507 Bacteria 3371
532 Ga0495606_0044688 3300046507 Bacteria 2943
533 Ga0495606_0068768 3300046507 Bacteria 2239
534 Ga0495606_0086621 3300046507 Bacteria 1935
535 Ga0495606_0156447 3300046507 Bacteria 1333
536 Ga0495606_0157257 3300046507 Bacteria 1329
537 Ga0495606_0183394 3300046507 Bacteria 1205
538 Ga0495606_0213473 3300046507 Bacteria 1091
539 Ga0495606_0213776 3300046507 Bacteria 1090
540 Ga0495608_0013499 3300046511 Bacteria 5665
541 Ga0495608_0015283 3300046511 Bacteria 5326
542 Ga0495610_0000038 3300046512 Bacteria 181669
543 Ga0495610_0002303 3300046512 Bacteria 16138
544 Ga0495610_0011762 3300046512 Bacteria 5316
545 Ga0495610_0036765 3300046512 Bacteria 2499
546 Ga0495610_0044411 3300046512 Bacteria 2205
547 Ga0495610_0110197 3300046512 Bacteria 1220
548 Ga0495610_0137585 3300046512 Bacteria 1054
549 Ga0495616_0000380 3300046513 Bacteria 34689
550 Ga0495616_0000551 3300046513 Bacteria 28291
551 Ga0495616_0000809 3300046513 Bacteria 22839
552 Ga0495616_0001733 3300046513 Bacteria 14866
553 Ga0495616_0002449 3300046513 Bacteria 12316
554 Ga0495616_0003895 3300046513 Bacteria 9511
555 Ga0495616_0025324 3300046513 Bacteria 3171
556 Ga0495616_0027496 3300046513 Bacteria 3017
557 Ga0495616_0034682 3300046513 Bacteria 2617
558 Ga0495616_0040687 3300046513 Bacteria 2373
559 Ga0495616_0063801 3300046513 Bacteria 1799
560 Ga0495616_0072007 3300046513 Bacteria 1669
561 Ga0495616_0074285 3300046513 Bacteria 1638
562 Ga0495616_0120000 3300046513 Bacteria 1215
563 Ga0495616_0124381 3300046513 Bacteria 1187
564 Ga0495616_0134880 3300046513 Bacteria 1128
565 Ga0495616_0150532 3300046513 Bacteria 1053
566 Ga0495616_0178267 3300046513 Bacteria 946
567 Ga0495618_0024623 3300046514 Bacteria 3729
568 Ga0495620_0004290 3300046515 Bacteria 8063
569 Ga0495628_0000767 3300046516 Bacteria 29619
570 Ga0495628_0028463 3300046516 Bacteria 4540
571 Ga0495628_0730552 3300046516 Bacteria 697
572 Ga0495630_0061254 3300046517 Bacteria 2826
573 Ga0495631_0001405 3300046518 Bacteria 14635
574 Ga0495631_0003152 3300046518 Bacteria 9073
575 Ga0495631_0017573 3300046518 Bacteria 3379
576 Ga0495631_0020046 3300046518 Bacteria 3128
577 Ga0495631_0029054 3300046518 Bacteria 2518
578 Ga0495631_0036236 3300046518 Bacteria 2203
579 Ga0495631_0036935 3300046518 Bacteria 2178
580 Ga0495631_0039776 3300046518 Bacteria 2085
581 Ga0495631_0045099 3300046518 Bacteria 1941
582 Ga0495631_0046944 3300046518 Bacteria 1897
583 Ga0495631_0062031 3300046518 Bacteria 1620
584 Ga0495631_0071302 3300046518 Bacteria 1501
585 Ga0495631_0099263 3300046518 Bacteria 1253
586 Ga0495631_0100011 3300046518 Bacteria 1248
587 Ga0495631_0113219 3300046518 Bacteria 1166
588 Ga0495631_0156305 3300046518 Bacteria 978
589 Ga0495631_0275321 3300046518 Bacteria 717
590 Ga0495632_0000027 3300046519 Bacteria 173785
591 Ga0495632_0000774 3300046519 Bacteria 28699
592 Ga0495632_0002636 3300046519 Bacteria 13498
593 Ga0495632_0023179 3300046519 Bacteria 3317
594 Ga0495632_0026926 3300046519 Bacteria 3018
595 Ga0495632_0080624 3300046519 Bacteria 1552
596 Ga0495632_0136153 3300046519 Bacteria 1141
597 Ga0495637_0000013 3300046520 Bacteria 244837
598 Ga0495637_0002325 3300046520 Bacteria 10523
599 Ga0495637_0007660 3300046520 Bacteria 5342
600 Ga0495637_0045369 3300046520 Bacteria 1865
601 Ga0495637_0049904 3300046520 Bacteria 1756
602 Ga0495643_0000576 3300046522 Bacteria 45056
603 Ga0495643_0001689 3300046522 Bacteria 19245
604 Ga0495643_0010247 3300046522 Bacteria 5773
605 Ga0495643_0013360 3300046522 Bacteria 4917
606 Ga0495643_0019427 3300046522 Bacteria 3931
607 Ga0495643_0019521 3300046522 Bacteria 3919
608 Ga0495643_0031808 3300046522 Bacteria 2933
609 Ga0495643_0038993 3300046522 Bacteria 2599
610 Ga0495643_0045934 3300046522 Bacteria 2370
611 Ga0495643_0048477 3300046522 Bacteria 2295
612 Ga0495643_0050211 3300046522 Bacteria 2247
613 Ga0495643_0061725 3300046522 Bacteria 1986
614 Ga0495643_0062822 3300046522 Bacteria 1965
615 Ga0495643_0163331 3300046522 Bacteria 1094
616 Ga0495643_0197466 3300046522 Bacteria 967
617 Ga0495643_0245507 3300046522 Bacteria 838
618 Ga0495644_0002932 3300046523 Bacteria 6778
619 Ga0495644_0013134 3300046523 Bacteria 3181
620 Ga0495644_0026824 3300046523 Bacteria 2184
621 Ga0495644_0029536 3300046523 Bacteria 2071
622 Ga0495644_0029690 3300046523 Bacteria 2065
623 Ga0495644_0037517 3300046523 Bacteria 1828
624 Ga0495644_0051119 3300046523 Bacteria 1551
625 Ga0495644_0052681 3300046523 Bacteria 1528
626 Ga0495644_0079468 3300046523 Bacteria 1235
627 Ga0495644_0144041 3300046523 Bacteria 910
628 Ga0495648_0000112 3300046524 Bacteria 99859
629 Ga0495648_0000806 3300046524 Bacteria 33209
630 Ga0495648_0004997 3300046524 Bacteria 11142
631 Ga0495648_0005314 3300046524 Bacteria 10740
632 Ga0495648_0027679 3300046524 Bacteria 3790
633 Ga0495648_0051300 3300046524 Bacteria 2514
634 Ga0495648_0051694 3300046524 Bacteria 2501
635 Ga0495648_0054804 3300046524 Bacteria 2407
636 Ga0495648_0056254 3300046524 Bacteria 2367
637 Ga0495648_0066316 3300046524 Bacteria 2116
638 Ga0495648_0076829 3300046524 Bacteria 1916
639 Ga0495648_0078293 3300046524 Bacteria 1891
640 Ga0495648_0158947 3300046524 Bacteria 1170
641 Ga0495648_0210488 3300046524 Bacteria 966
642 Ga0495648_0256999 3300046524 Bacteria 840
643 Ga0495663_0003539 3300046525 Bacteria 4496
644 Ga0495663_0016801 3300046525 Bacteria 2070
645 Ga0495666_0000464 3300046526 Bacteria 18048
646 Ga0495666_0010305 3300046526 Bacteria 4659
647 Ga0495666_0017617 3300046526 Bacteria 3556
648 Ga0495666_0082266 3300046526 Bacteria 1522
649 Ga0495666_0095491 3300046526 Bacteria 1402
650 Ga0495666_0130288 3300046526 Bacteria 1175
651 Ga0495642_0000127 3300046528 Bacteria 43547
652 Ga0495642_0000327 3300046528 Bacteria 25996
653 Ga0495642_0003630 3300046528 Bacteria 6056
654 Ga0495642_0005288 3300046528 Bacteria 4957
655 Ga0495642_0005863 3300046528 Bacteria 4713
656 Ga0495642_0013199 3300046528 Bacteria 3191
657 Ga0495642_0014942 3300046528 Bacteria 3013
658 Ga0495642_0015072 3300046528 Bacteria 3001
659 Ga0495642_0027438 3300046528 Bacteria 2266
660 Ga0495642_0030080 3300046528 Bacteria 2171
661 Ga0495642_0030201 3300046528 Bacteria 2167
662 Ga0495642_0042630 3300046528 Bacteria 1849
663 Ga0495642_0070278 3300046528 Bacteria 1463
664 Ga0495642_0073502 3300046528 Bacteria 1432
665 Ga0495642_0074999 3300046528 Bacteria 1418
666 Ga0495642_0091949 3300046528 Bacteria 1285
667 Ga0495642_0167418 3300046528 Bacteria 954
668 Ga0495642_0252219 3300046528 Bacteria 771
669 Ga0495652_0003788 3300046529 Bacteria 14764
670 Ga0495652_0024036 3300046529 Bacteria 5398
671 Ga0495652_0083840 3300046529 Bacteria 2622
672 Ga0495652_0139269 3300046529 Bacteria 1910
673 Ga0495654_0000233 3300046530 Bacteria 52038
674 Ga0495654_0021114 3300046530 Bacteria 3390
675 Ga0495654_0022655 3300046530 Bacteria 3259
676 Ga0495654_0037743 3300046530 Bacteria 2420
677 Ga0495654_0047726 3300046530 Bacteria 2104
678 Ga0495654_0120288 3300046530 Bacteria 1189
679 Ga0495665_0000671 3300046531 Bacteria 17541
680 Ga0495665_0020387 3300046531 Bacteria 3561
681 Ga0495665_0089969 3300046531 Bacteria 1612
682 Ga0495640_0364744 3300046533 Bacteria 890
683 Ga0495586_0003598 3300046535 Bacteria 8302
684 Ga0495586_0009430 3300046535 Bacteria 5195
685 Ga0495586_0079107 3300046535 Bacteria 1804
686 Ga0495587_0018073 3300046536 Bacteria 4372
687 Ga0495587_0041457 3300046536 Bacteria 2746
688 Ga0495587_0282240 3300046536 Bacteria 930
689 Ga0495598_0145679 3300046537 Bacteria 823
690 Ga0495609_0000022 3300046538 Bacteria 279488
691 Ga0495609_0001170 3300046538 Bacteria 18085
692 Ga0495609_0001426 3300046538 Bacteria 15913
693 Ga0495609_0006900 3300046538 Bacteria 5733
694 Ga0495609_0016183 3300046538 Bacteria 3477
695 Ga0495609_0017151 3300046538 Bacteria 3365
696 Ga0495609_0017589 3300046538 Bacteria 3319
697 Ga0495609_0017886 3300046538 Bacteria 3289
698 Ga0495609_0034351 3300046538 Bacteria 2299
699 Ga0495609_0041755 3300046538 Bacteria 2060
700 Ga0495609_0054418 3300046538 Bacteria 1777
701 Ga0495609_0063607 3300046538 Bacteria 1628
702 Ga0495609_0065395 3300046538 Bacteria 1603
703 Ga0495609_0071787 3300046538 Bacteria 1520
704 Ga0495609_0095353 3300046538 Bacteria 1291
705 Ga0495609_0163488 3300046538 Bacteria 942
706 Ga0495597_0002342 3300046542 Bacteria 12249
707 Ga0495597_0003173 3300046542 Bacteria 9829
708 Ga0495597_0012295 3300046542 Bacteria 4130
709 Ga0495597_0012801 3300046542 Bacteria 4037
710 Ga0495597_0018475 3300046542 Bacteria 3272
711 Ga0495597_0025241 3300046542 Bacteria 2736
712 Ga0495597_0027270 3300046542 Bacteria 2619
713 Ga0495597_0037834 3300046542 Bacteria 2165
714 Ga0495597_0101018 3300046542 Bacteria 1216
715 Ga0495597_0110601 3300046542 Bacteria 1152
716 Ga0495597_0122555 3300046542 Bacteria 1083
717 Ga0495597_0125908 3300046542 Bacteria 1065
718 Ga0495597_0137378 3300046542 Bacteria 1010
719 Ga0495597_0141132 3300046542 Bacteria 993
720 Ga0495597_0189832 3300046542 Bacteria 827
721 Ga0495597_0256364 3300046542 Bacteria 686
722 Ga0495645_0029765 3300046543 Bacteria 3974
723 Ga0495645_0079354 3300046543 Bacteria 2358
724 Ga0495645_0081860 3300046543 Bacteria 2316
725 Ga0495622_0000434 3300046557 Bacteria 27206
726 Ga0495622_0001824 3300046557 Bacteria 10502
727 Ga0495622_0005965 3300046557 Bacteria 5660
728 Ga0495622_0009986 3300046557 Bacteria 4391
729 Ga0495622_0041419 3300046557 Bacteria 2142
730 Ga0495622_0063841 3300046557 Bacteria 1703
731 Ga0495622_0113229 3300046557 Bacteria 1241
732 Ga0495633_0000606 3300046558 Bacteria 34316
733 Ga0495633_0003044 3300046558 Bacteria 11418
734 Ga0495633_0004014 3300046558 Bacteria 9524
735 Ga0495633_0006321 3300046558 Bacteria 7055
736 Ga0495633_0011548 3300046558 Bacteria 4754
737 Ga0495633_0012907 3300046558 Bacteria 4421
738 Ga0495633_0019892 3300046558 Bacteria 3386
739 Ga0495633_0032370 3300046558 Bacteria 2527
740 Ga0495633_0039978 3300046558 Bacteria 2236
741 Ga0495633_0048556 3300046558 Bacteria 2004
742 Ga0495633_0105229 3300046558 Bacteria 1309
743 Ga0495633_0112629 3300046558 Bacteria 1261
744 Ga0495633_0153036 3300046558 Bacteria 1065
745 Ga0495633_0176985 3300046558 Bacteria 982
746 Ga0495633_0204845 3300046558 Bacteria 905
747 Ga0495633_0278460 3300046558 Bacteria 761
748 Ga0495667_0515311 3300046559 Bacteria 749
749 Ga0495656_0006072 3300046615 Bacteria 4211
750 Ga0495656_0039733 3300046615 Bacteria 1956
751 Ga0495656_0041942 3300046615 Bacteria 1914
752 Ga0495656_0078527 3300046615 Bacteria 1484
753 Ga0495656_0155009 3300046615 Bacteria 1109
754 Ga0495656_0203267 3300046615 Bacteria 984
755 Ga0495656_0262431 3300046615 Bacteria 875
756 Ga0495668_0000064 3300046616 Bacteria 180583
757 Ga0495668_0000330 3300046616 Bacteria 64685
758 Ga0495668_0000979 3300046616 Bacteria 31250
759 Ga0495668_0001705 3300046616 Bacteria 20303
760 Ga0495668_0003120 3300046616 Bacteria 12802
761 Ga0495668_0003775 3300046616 Bacteria 11102
762 Ga0495668_0004433 3300046616 Bacteria 9967
763 Ga0495668_0009251 3300046616 Bacteria 6060
764 Ga0495668_0021601 3300046616 Bacteria 3688
765 Ga0495668_0059433 3300046616 Bacteria 2109
766 Ga0495668_0062026 3300046616 Bacteria 2060
767 Ga0495668_0071856 3300046616 Bacteria 1901
768 Ga0495668_0076518 3300046616 Bacteria 1837
769 Ga0495668_0082329 3300046616 Bacteria 1766
770 Ga0495668_0084281 3300046616 Bacteria 1743
771 Ga0495668_0113529 3300046616 Bacteria 1481
772 Ga0495668_0125563 3300046616 Bacteria 1404
773 Ga0495668_0216570 3300046616 Bacteria 1048
774 Ga0495668_0250604 3300046616 Bacteria 969
775 Ga0495668_0302995 3300046616 Bacteria 876
776 Ga0495668_0502143 3300046616 Bacteria 669
777 Ga0495634_0143333 3300046642 Bacteria 1515
778 Ga0495634_0197881 3300046642 Bacteria 1250
779 Ga0495611_0000091 3300046648 Bacteria 63099
780 Ga0495611_0002372 3300046648 Bacteria 8678
781 Ga0495611_0004076 3300046648 Bacteria 6358
782 Ga0495611_0009734 3300046648 Bacteria 4063
783 Ga0495611_0011951 3300046648 Bacteria 3687
784 Ga0495611_0032693 3300046648 Bacteria 2293
785 Ga0495611_0034219 3300046648 Bacteria 2245
786 Ga0495611_0036801 3300046648 Bacteria 2173
787 Ga0495611_0058316 3300046648 Bacteria 1751
788 Ga0495611_0075122 3300046648 Bacteria 1548
789 Ga0495611_0116633 3300046648 Bacteria 1244
790 Ga0495611_0259205 3300046648 Bacteria 805
791 Ga0495625_0001154 3300046660 Bacteria 34018
792 Ga0495625_0002821 3300046660 Bacteria 18290
793 Ga0495625_0003568 3300046660 Bacteria 15346
794 Ga0495625_0006715 3300046660 Bacteria 10201
795 Ga0495625_0007042 3300046660 Bacteria 9889
796 Ga0495625_0009471 3300046660 Bacteria 8147
797 Ga0495625_0042233 3300046660 Bacteria 3315
798 Ga0495625_0042705 3300046660 Bacteria 3292
799 Ga0495625_0083737 3300046660 Bacteria 2216
800 Ga0495625_0204893 3300046660 Bacteria 1300
801 Ga0495625_0211260 3300046660 Bacteria 1275
802 Ga0495625_0232515 3300046660 Bacteria 1203
803 Ga0495625_0366973 3300046660 Bacteria 906
804 Ga0495635_0186156 3300046663 Bacteria 1410
805 Ga0495659_0000726 3300046664 Bacteria 11845
806 Ga0495659_0001078 3300046664 Bacteria 9502
807 Ga0495659_0042097 3300046664 Bacteria 1634
808 Ga0495659_0057741 3300046664 Bacteria 1426
809 Ga0495659_0081223 3300046664 Bacteria 1230
810 Ga0495659_0151537 3300046664 Bacteria 931
811 Ga0495661_0000297 3300046665 Bacteria 56358
812 Ga0495661_0000756 3300046665 Bacteria 31283
813 Ga0495661_0001704 3300046665 Bacteria 17816
814 Ga0495661_0003450 3300046665 Bacteria 11672
815 Ga0495661_0003562 3300046665 Bacteria 11462
816 Ga0495661_0015333 3300046665 Bacteria 5116
817 Ga0495661_0037662 3300046665 Bacteria 3017
818 Ga0495661_0042588 3300046665 Bacteria 2798
819 Ga0495661_0052004 3300046665 Bacteria 2471
820 Ga0495661_0058304 3300046665 Bacteria 2301
821 Ga0495661_0081708 3300046665 Bacteria 1861
822 Ga0495661_0117032 3300046665 Bacteria 1477
823 Ga0495661_0166206 3300046665 Bacteria 1180
824 Ga0495661_0205606 3300046665 Bacteria 1028
825 Ga0495661_0241833 3300046665 Bacteria 925
826 Ga0495661_0276691 3300046665 Bacteria 847
827 Ga0495661_0290086 3300046665 Bacteria 822
828 Ga0495588_0000086 3300046674 Bacteria 193241
829 Ga0495588_0014258 3300046674 Bacteria 3801
830 Ga0495588_0020704 3300046674 Bacteria 3236
831 Ga0495588_0021072 3300046674 Bacteria 3208
832 Ga0495588_0036255 3300046674 Bacteria 2501
833 Ga0495588_0047387 3300046674 Bacteria 2206
834 Ga0495588_0054786 3300046674 Bacteria 2058
835 Ga0495588_0085592 3300046674 Bacteria 1648
836 Ga0495588_0122685 3300046674 Bacteria 1370
837 Ga0495588_0139633 3300046674 Bacteria 1279
838 Ga0495588_0152893 3300046674 Bacteria 1219
839 Ga0495588_0161378 3300046674 Bacteria 1185
840 Ga0495588_0218664 3300046674 Bacteria 1006
841 Ga0495599_0027586 3300046678 Bacteria 3558
842 Ga0495599_0076234 3300046678 Bacteria 2094
843 Ga0495623_0049725 3300046679 Bacteria 2656
844 Ga0495623_0179186 3300046679 Bacteria 1232
845 Ga0495623_0181393 3300046679 Bacteria 1223
846 Ga0495623_0299782 3300046679 Bacteria 888
847 Ga0495646_0013855 3300046680 Bacteria 5127
848 Ga0495646_0268880 3300046680 Bacteria 909
849 Ga0495669_0000018 3300046684 Bacteria 127866
850 Ga0495669_0001568 3300046684 Bacteria 9395
851 Ga0495669_0002263 3300046684 Bacteria 7897
852 Ga0495669_0006992 3300046684 Bacteria 4724
853 Ga0495669_0024818 3300046684 Bacteria 2611
854 Ga0495669_0026953 3300046684 Bacteria 2512
855 Ga0495669_0041085 3300046684 Bacteria 2052
856 Ga0495613_0053635 3300046689 Bacteria 2966
857 Ga0495613_0396782 3300046689 Bacteria 941
858 Ga0495613_0426547 3300046689 Bacteria 901
859 Ga0495624_0182727 3300046690 Bacteria 1277
860 Ga0495670_0004185 3300046691 Bacteria 7068
861 Ga0495670_0013040 3300046691 Bacteria 4086
862 Ga0495670_0015536 3300046691 Bacteria 3740
863 Ga0495670_0019228 3300046691 Bacteria 3365
864 Ga0495670_0021179 3300046691 Bacteria 3206
865 Ga0495670_0039572 3300046691 Bacteria 2351
866 Ga0495670_0047383 3300046691 Bacteria 2148
867 Ga0495670_0127444 3300046691 Bacteria 1325
868 Ga0495670_0149239 3300046691 Bacteria 1225
869 Ga0495670_0162329 3300046691 Bacteria 1174
870 Ga0495670_0184006 3300046691 Bacteria 1104
871 Ga0495670_0197720 3300046691 Bacteria 1064
872 Ga0495670_0253499 3300046691 Bacteria 938
873 Ga0495670_0322791 3300046691 Bacteria 829
874 Ga0495671_0000044 3300046692 Bacteria 160337
875 Ga0495671_0000188 3300046692 Bacteria 54628
876 Ga0495671_0002456 3300046692 Bacteria 11703
877 Ga0495671_0002876 3300046692 Bacteria 10764
878 Ga0495671_0011572 3300046692 Bacteria 4847
879 Ga0495671_0023200 3300046692 Bacteria 3243
880 Ga0495671_0054688 3300046692 Bacteria 1978
881 Ga0495671_0060349 3300046692 Bacteria 1872
882 Ga0495671_0122506 3300046692 Bacteria 1268
883 Ga0495671_0159505 3300046692 Bacteria 1097
884 Ga0495671_0224115 3300046692 Bacteria 910
885 Ga0495671_0275849 3300046692 Bacteria 810
886 Ga0495649_0001439 3300046694 Bacteria 17918
887 Ga0495649_0003868 3300046694 Bacteria 9912
888 Ga0495649_0006236 3300046694 Bacteria 7436
889 Ga0495649_0041542 3300046694 Bacteria 2515
890 Ga0495649_0047485 3300046694 Bacteria 2335
891 Ga0495649_0048970 3300046694 Bacteria 2296
892 Ga0495649_0071091 3300046694 Bacteria 1865
893 Ga0495649_0114195 3300046694 Bacteria 1431
894 Ga0495649_0174015 3300046694 Bacteria 1125
895 Ga0495649_0212716 3300046694 Bacteria 1001
896 Ga0495649_0309198 3300046694 Bacteria 803
897 Ga0495589_0000017 3300046794 Bacteria 206113
898 Ga0495589_0000270 3300046794 Bacteria 42191
899 Ga0495589_0000392 3300046794 Bacteria 33543
900 Ga0495589_0001855 3300046794 Bacteria 11980
901 Ga0495589_0011164 3300046794 Bacteria 4660
902 Ga0495589_0039966 3300046794 Bacteria 2343
903 Ga0495589_0040498 3300046794 Bacteria 2326
904 Ga0495589_0060199 3300046794 Bacteria 1865
905 Ga0495589_0068705 3300046794 Bacteria 1733
906 Ga0495589_0094864 3300046794 Bacteria 1447
907 Ga0495589_0097490 3300046794 Bacteria 1424
908 Ga0495589_0311366 3300046794 Bacteria 728
909 Ga0495589_0357720 3300046794 Bacteria 672
910 Ga0495589_0374346 3300046794 Bacteria 655
911 Ga0495600_0005139 3300046809 Bacteria 7865
912 Ga0495600_0058602 3300046809 Bacteria 2515
913 Ga0495600_0186491 3300046809 Bacteria 1335
914 Ga0495600_0223575 3300046809 Bacteria 1204
915 Ga0495660_0000067 3300046810 Bacteria 119390
916 Ga0495660_0001303 3300046810 Bacteria 17256
917 Ga0495660_0002850 3300046810 Bacteria 10869
918 Ga0495660_0003589 3300046810 Bacteria 9568
919 Ga0495660_0007668 3300046810 Bacteria 6340
920 Ga0495660_0015335 3300046810 Bacteria 4427
921 Ga0495660_0054418 3300046810 Bacteria 2168
922 Ga0495660_0054796 3300046810 Bacteria 2160
923 Ga0495660_0056880 3300046810 Bacteria 2112
924 Ga0495660_0059810 3300046810 Bacteria 2048
925 Ga0495660_0081096 3300046810 Bacteria 1701
926 Ga0495660_0129333 3300046810 Bacteria 1268
927 Ga0495660_0149424 3300046810 Bacteria 1155
928 Ga0495581_0028064 3300047315 Bacteria 3262
929 Ga0495581_0065867 3300047315 Bacteria 2095
930 Ga0495604_0004481 3300047317 Bacteria 11061
931 Ga0495604_0019129 3300047317 Bacteria 5484
932 Ga0495604_0076354 3300047317 Bacteria 2520
933 Ga0495604_0099916 3300047317 Bacteria 2134
934 Ga0495604_0570956 3300047317 Bacteria 728
935 Ga0495636_0005995 3300047318 Bacteria 4770
936 Ga0495636_0015536 3300047318 Bacteria 3034
937 Ga0495636_0035192 3300047318 Bacteria 2062
938 Ga0495636_0088381 3300047318 Bacteria 1343
939 Ga0495636_0091671 3300047318 Bacteria 1320
940 Ga0495636_0101868 3300047318 Bacteria 1256
941 Ga0495636_0172953 3300047318 Bacteria 977
942 Ga0495674_0001855 3300047319 Bacteria 20817
943 Ga0495672_0000067 3300047320 Bacteria 190335
944 Ga0495672_0000361 3300047320 Bacteria 58121
945 Ga0495672_0000883 3300047320 Bacteria 31542
946 Ga0495672_0001130 3300047320 Bacteria 27027
947 Ga0495672_0001953 3300047320 Bacteria 19502
948 Ga0495672_0002769 3300047320 Bacteria 15681
949 Ga0495672_0003031 3300047320 Bacteria 14761
950 Ga0495672_0047759 3300047320 Bacteria 2543
951 Ga0495672_0081184 3300047320 Bacteria 1806
952 Ga0495672_0091534 3300047320 Bacteria 1669
953 Ga0495672_0096792 3300047320 Bacteria 1608
954 Ga0495672_0172556 3300047320 Bacteria 1102
955 Ga0495676_0000133 3300047321 Bacteria 56165
956 Ga0495676_0006994 3300047321 Bacteria 10356
957 Ga0495676_0028243 3300047321 Bacteria 4794
958 Ga0495676_0136796 3300047321 Bacteria 1761
959 Ga0495676_0191933 3300047321 Bacteria 1424
960 Ga0495680_0069235 3300047322 Bacteria 2693
961 Ga0495680_0096745 3300047322 Bacteria 2204
962 Ga0495683_0000083 3300047323 Bacteria 93743
963 Ga0495683_0000418 3300047323 Bacteria 33979
964 Ga0495683_0000641 3300047323 Bacteria 26026
965 Ga0495683_0056068 3300047323 Bacteria 1961
966 Ga0495683_0069133 3300047323 Bacteria 1735
967 Ga0495683_0086909 3300047323 Bacteria 1519
968 Ga0495683_0105521 3300047323 Bacteria 1350
969 Ga0495683_0168711 3300047323 Bacteria 1007
970 Ga0495683_0177425 3300047323 Bacteria 975
971 Ga0495687_000033 3300047443 Bacteria 263788
972 Ga0495687_000126 3300047443 Bacteria 117879
973 Ga0495687_000252 3300047443 Bacteria 72401
974 Ga0495687_001058 3300047443 Bacteria 27224
975 Ga0495687_001886 3300047443 Bacteria 18083
976 Ga0495687_004618 3300047443 Bacteria 9203
977 Ga0495687_008748 3300047443 Bacteria 5751
978 Ga0495687_018056 3300047443 Bacteria 3498
979 Ga0495687_036730 3300047443 Bacteria 2188
980 Ga0495687_038664 3300047443 Bacteria 2115
981 Ga0495687_046432 3300047443 Bacteria 1875
982 Ga0495687_053895 3300047443 Bacteria 1691
983 Ga0495687_068762 3300047443 Bacteria 1428
984 Ga0495675_0063335 3300047444 Bacteria 2340
985 Ga0495675_0073609 3300047444 Bacteria 2154
986 Ga0495675_0087259 3300047444 Bacteria 1960
987 Ga0495677_0000002 3300047445 Bacteria 346767
988 Ga0495677_0000605 3300047445 Bacteria 14685
989 Ga0495677_0002998 3300047445 Bacteria 6565
990 Ga0495677_0004265 3300047445 Bacteria 5501
991 Ga0495677_0009984 3300047445 Bacteria 3493
992 Ga0495677_0013015 3300047445 Bacteria 3028
993 Ga0495677_0020944 3300047445 Bacteria 2370
994 Ga0495677_0020996 3300047445 Bacteria 2367
995 Ga0495677_0021692 3300047445 Bacteria 2328
996 Ga0495677_0022266 3300047445 Bacteria 2298
997 Ga0495677_0025317 3300047445 Bacteria 2152
998 Ga0495677_0026429 3300047445 Bacteria 2106
999 Ga0495677_0037330 3300047445 Bacteria 1774
1000 Ga0495677_0067925 3300047445 Bacteria 1326
1001 Ga0495677_0111762 3300047445 Bacteria 1039
1002 Ga0495677_0171635 3300047445 Bacteria 839
1003 Ga0495679_001328 3300047446 Bacteria 14342
1004 Ga0495679_003687 3300047446 Bacteria 7301
1005 Ga0495679_007262 3300047446 Bacteria 4641
1006 Ga0495679_019170 3300047446 Bacteria 2410
1007 Ga0495679_023409 3300047446 Bacteria 2095
1008 Ga0495679_042641 3300047446 Bacteria 1399
1009 Ga0495685_000089 3300047447 Bacteria 33778
1010 Ga0495685_015020 3300047447 Bacteria 2637
1011 Ga0495685_018268 3300047447 Bacteria 2405
1012 Ga0495685_022847 3300047447 Bacteria 2152
1013 Ga0495685_023435 3300047447 Bacteria 2126
1014 Ga0495685_051623 3300047447 Bacteria 1394
1015 Ga0495685_081058 3300047447 Bacteria 1080
1016 Ga0495685_092857 3300047447 Bacteria 999
1017 Ga0495685_140373 3300047447 Bacteria 787
1018 Ga0495673_0000085 3300047469 Bacteria 193245
1019 Ga0495673_0000409 3300047469 Bacteria 50226
1020 Ga0495673_0000522 3300047469 Bacteria 40373
1021 Ga0495673_0047424 3300047469 Bacteria 1898
1022 Ga0495673_0050154 3300047469 Bacteria 1833
1023 Ga0495681_0000440 3300047470 Bacteria 31767
1024 Ga0495681_0000885 3300047470 Bacteria 23154
1025 Ga0495681_0002477 3300047470 Bacteria 13169
1026 Ga0495681_0003632 3300047470 Bacteria 10727
1027 Ga0495681_0004226 3300047470 Bacteria 9854
1028 Ga0495681_0010821 3300047470 Bacteria 5491
1029 Ga0495681_0020161 3300047470 Bacteria 3622
1030 Ga0495681_0045318 3300047470 Bacteria 2105
1031 Ga0495681_0117740 3300047470 Bacteria 1143
1032 Ga0495681_0138119 3300047470 Bacteria 1032
1033 Ga0495681_0149137 3300047470 Bacteria 982
1034 Ga0495681_0181413 3300047470 Bacteria 865
1035 Ga0495686_0000228 3300047472 Bacteria 103664
1036 Ga0495686_0001128 3300047472 Bacteria 31556
1037 Ga0495686_0001924 3300047472 Bacteria 20689
1038 Ga0495686_0008586 3300047472 Bacteria 7477
1039 Ga0495686_0064977 3300047472 Bacteria 2257
1040 Ga0495686_0065827 3300047472 Bacteria 2240
1041 Ga0495686_0081696 3300047472 Bacteria 1972
1042 Ga0495686_0092065 3300047472 Bacteria 1839
1043 Ga0495686_0102081 3300047472 Bacteria 1728
1044 Ga0495686_0120326 3300047472 Bacteria 1566
1045 Ga0495686_0142157 3300047472 Bacteria 1415
1046 Ga0495686_0250551 3300047472 Bacteria 995
1047 Ga0495593_0003102 3300047673 Bacteria 9998
1048 Ga0495593_0018415 3300047673 Bacteria 3923
1049 Ga0495593_0081590 3300047673 Bacteria 1672
1050 Ga0495593_0102082 3300047673 Bacteria 1470
1051 Ga0495602_0628741 3300048088 Bacteria 735
1052 Ga0495615_0001328 3300048090 Bacteria 3630
1053 Ga0495626_0000183 3300048091 Bacteria 76227
1054 Ga0495626_0000217 3300048091 Bacteria 68857
1055 Ga0495626_0000258 3300048091 Bacteria 60668
1056 Ga0495626_0004638 3300048091 Bacteria 8355
1057 Ga0495626_0004978 3300048091 Bacteria 7953
1058 Ga0495626_0005737 3300048091 Bacteria 7172
1059 Ga0495626_0007189 3300048091 Bacteria 6225
1060 Ga0495626_0008474 3300048091 Bacteria 5633
1061 Ga0495626_0015446 3300048091 Bacteria 3908
1062 Ga0495626_0036984 3300048091 Bacteria 2322
1063 Ga0495626_0037678 3300048091 Bacteria 2296
1064 Ga0495626_0052981 3300048091 Bacteria 1869
1065 Ga0495626_0053414 3300048091 Bacteria 1859
1066 Ga0495626_0099598 3300048091 Bacteria 1268
1067 Ga0495626_0105522 3300048091 Bacteria 1224
1068 Ga0495626_0128259 3300048091 Bacteria 1085
1069 Ga0496100_0073109 3300048903 Bacteria 2294
1070 Ga0496100_0751453 3300048903 Bacteria 763
1071 Ga0496102_0000313 3300048905 Bacteria 61085
1072 Ga0496102_0000711 3300048905 Bacteria 32978
1073 Ga0496102_0114574 3300048905 Bacteria 2515
1074 Ga0496102_0149011 3300048905 Bacteria 2197
1075 Ga0496102_0242780 3300048905 Bacteria 1698
1076 Ga0496102_0934542 3300048905 Bacteria 788
1077 Ga0496103_0036795 3300048906 Bacteria 2998
1078 Ga0496103_0057425 3300048906 Bacteria 2416
1079 Ga0496103_0141561 3300048906 Bacteria 1538
1080 Ga0496103_0326249 3300048906 Bacteria 987
1081 Ga0496104_0080075 3300048907 Bacteria 3114
1082 Ga0496104_0379476 3300048907 Bacteria 1326
1083 Ga0496105_0104511 3300048908 Bacteria 2339
1084 Ga0496105_0339577 3300048908 Bacteria 1201
1085 Ga0496106_0007265 3300048909 Bacteria 8183
1086 Ga0496106_0122133 3300048909 Bacteria 2037
1087 Ga0496106_1045208 3300048909 Bacteria 641
1088 Ga0496107_0123593 3300048910 Bacteria 1907
1089 Ga0496107_0152335 3300048910 Bacteria 1711
1090 Ga0496107_0164582 3300048910 Bacteria 1644
1091 Ga0496108_0218593 3300048911 Bacteria 1655
1092 Ga0496108_0492318 3300048911 Bacteria 1071
1093 Ga0496109_0268533 3300048912 Bacteria 1607
1094 Ga0496109_0620086 3300048912 Bacteria 1018
1095 Ga0496110_0000212 3300048913 Bacteria 37284
1096 Ga0496110_0139501 3300048913 Bacteria 2191
1097 Ga0496110_0148347 3300048913 Bacteria 2122
1098 Ga0496111_0087630 3300048914 Bacteria 2279
1099 Ga0496111_0103868 3300048914 Bacteria 2090
1100 Ga0496111_0146429 3300048914 Bacteria 1751
1101 Ga0496111_0589328 3300048914 Bacteria 814
1102 Ga0496112_0546845 3300048915 Bacteria 1092
1103 Ga0496112_0955249 3300048915 Bacteria 778
1104 Ga0496113_0024663 3300048916 Bacteria 4278
1105 Ga0496113_0045787 3300048916 Bacteria 3246
1106 Ga0496113_0269824 3300048916 Bacteria 1360
1107 Ga0496113_0349340 3300048916 Bacteria 1186
1108 Ga0496114_0010016 3300048917 Bacteria 7536
1109 Ga0496114_0057021 3300048917 Bacteria 3261
1110 Ga0496114_0200029 3300048917 Bacteria 1750
1111 Ga0496114_0659848 3300048917 Bacteria 919
1112 Ga0496115_0037234 3300048918 Bacteria 3855
1113 Ga0496115_0057151 3300048918 Bacteria 3137
1114 Ga0496115_0188576 3300048918 Bacteria 1704
1115 Ga0496115_0290324 3300048918 Bacteria 1342
1116 Ga0496115_0319265 3300048918 Bacteria 1271
1117 Ga0496115_0700879 3300048918 Bacteria 796
1118 Ga0496116_0030727 3300048919 Bacteria 3855
1119 Ga0496116_0080476 3300048919 Bacteria 2023
1120 Ga0496116_0087654 3300048919 Bacteria 1904
1121 Ga0496116_0147265 3300048919 Bacteria 1314
1122 Ga0496117_0000011 3300048920 Bacteria 610930
1123 Ga0496118_0000010 3300048921 Bacteria 610930
1124 Ga0496121_0006064 3300048924 Bacteria 15219
1125 Ga0496121_0008022 3300048924 Bacteria 12593
1126 Ga0496121_0101190 3300048924 Bacteria 2223
1127 Ga0496121_0208788 3300048924 Bacteria 1385
1128 Ga0496121_0342188 3300048924 Bacteria 999
1129 Ga0496121_0436379 3300048924 Bacteria 848
1130 Ga0496122_0000256 3300048925 Bacteria 120178
1131 Ga0496122_0008347 3300048925 Bacteria 11202
1132 Ga0496122_0071537 3300048925 Bacteria 2471
1133 Ga0496122_0120340 3300048925 Bacteria 1695
1134 Ga0496123_0004154 3300048926 Bacteria 15490
1135 Ga0496123_0004736 3300048926 Bacteria 14081
1136 Ga0496123_0006875 3300048926 Bacteria 10892
1137 Ga0496123_0018007 3300048926 Bacteria 5650
1138 Ga0496123_0054840 3300048926 Bacteria 2620
1139 Ga0496123_0117841 3300048926 Bacteria 1501
1140 Ga0496124_0029886 3300048927 Bacteria 4847
1141 Ga0496124_0057613 3300048927 Bacteria 3273
1142 Ga0496124_0063263 3300048927 Bacteria 3092
1143 Ga0496124_0098471 3300048927 Bacteria 2372
1144 Ga0496124_0149224 3300048927 Bacteria 1836
1145 Ga0496124_0243833 3300048927 Bacteria 1334
1146 Ga0496124_0311707 3300048927 Bacteria 1131
1147 Ga0496124_0437297 3300048927 Bacteria 896
1148 Ga0496124_0442935 3300048927 Bacteria 888
1149 Ga0496124_0443405 3300048927 Bacteria 887
1150 Ga0496124_0675078 3300048927 Bacteria 659
1151 Ga0496124_0680828 3300048927 Bacteria 655
1152 Ga0496125_0001859 3300048928 Bacteria 29095
1153 Ga0496125_0002083 3300048928 Bacteria 26953
1154 Ga0496125_0062955 3300048928 Bacteria 2961
1155 Ga0496125_0167211 3300048928 Bacteria 1484
1156 Ga0496125_0239923 3300048928 Bacteria 1152
1157 Ga0496126_0081363 3300048929 Bacteria 2863
1158 Ga0496126_0463970 3300048929 Bacteria 1017
1159 Ga0501306_000165 3300049127 Bacteria 4270
1160 Ga0501308_004978 3300049128 Bacteria 1305
1161 Ga0501310_001518 3300049130 Bacteria 2116
1162 Ga0501307_024488 3300049162 Bacteria 805
1163 Ga0495678_000001 3300049459 Bacteria 1060340
1164 Ga0495678_000161 3300049459 Bacteria 79941
1165 Ga0495678_000454 3300049459 Bacteria 40665
1166 Ga0495678_001236 3300049459 Bacteria 20809
1167 Ga0495678_002980 3300049459 Bacteria 10794
1168 Ga0495678_003440 3300049459 Bacteria 9806
1169 Ga0495678_005959 3300049459 Bacteria 6589
1170 Ga0495678_017956 3300049459 Bacteria 3191
1171 Ga0495678_027350 3300049459 Bacteria 2420
1172 Ga0495678_034449 3300049459 Bacteria 2083
1173 Ga0495678_054971 3300049459 Bacteria 1521
1174 Ga0495678_069175 3300049459 Bacteria 1299
1175 Ga0495682_0002407 3300049460 Bacteria 8864
1176 Ga0495682_0004701 3300049460 Bacteria 5781
1177 Ga0495682_0018932 3300049460 Bacteria 2591
1178 Ga0495682_0129762 3300049460 Bacteria 901
1179 Ga0495682_0139530 3300049460 Bacteria 866
1180 Ga0495682_0149523 3300049460 Bacteria 833
1181 Ga0495682_0157034 3300049460 Bacteria 810
1182 Ga0495682_0217334 3300049460 Bacteria 677
1183 Ga0501311_005446 3300049527 Bacteria 1395
1184 Ga0501312_037175 3300049528 Bacteria 784
1185 Ga0501315_001804 3300049531 Bacteria 1908
1186 Ga0501315_008595 3300049531 Bacteria 1191
1187 Ga0501316_013519 3300049532 Bacteria 965
1188 Ga0501320_006417 3300049536 Bacteria 1101
1189 Ga0501321_007707 3300049537 Bacteria 1124
1190 Ga0501031_0254434 3300049568 Bacteria 1141
1191 Ga0501032_0001038 3300049569 Bacteria 22303
1192 Ga0501034_0000997 3300049571 Bacteria 40545
1193 Ga0501034_0150615 3300049571 Bacteria 2302
1194 Ga0501034_0261333 3300049571 Bacteria 1674
1195 Ga0501034_0278578 3300049571 Bacteria 1612
1196 Ga0501038_0032987 3300049574 Bacteria 4562
1197 Ga0501039_0672667 3300049575 Bacteria 810
1198 Ga0501047_0501814 3300049581 Bacteria 1040
1199 Ga0501072_0000524 3300049588 Bacteria 27516
1200 Ga0501074_0079826 3300049590 Bacteria 2348
1201 Ga0501230_029288 3300049667 Bacteria 1016
1202 Ga0501238_001426 3300049671 Bacteria 2772
1203 Ga0501249_001374 3300049679 Bacteria 5021
1204 Ga0501080_0093087 3300049742 Bacteria 2799
1205 Ga0501269_000356 3300049766 Bacteria 11512
1206 Ga0501279_002759 3300049775 Bacteria 2292
1207 Ga0501035_0047572 3300049822 Bacteria 3850
1208 Ga0501044_0236778 3300049823 Bacteria 1771
1209 Ga0501044_0423983 3300049823 Bacteria 1240
1210 Ga0501044_0858820 3300049823 Bacteria 784
1211 nmdc:mga03683_27793_c1 3300050489 Bacteria 2244
1212 nmdc:mga07m45_137526_c1 3300050496 Bacteria 1414
1213 Ga0495601_0005458 3300053077 Bacteria 7407
1214 Ga0495601_0188908 3300053077 Bacteria 1347
1215 Ga0500594_0033322 3300053118 Bacteria 1369
1216 Ga0500595_001576 3300053119 Bacteria 12034
1217 Ga0500618_001009 3300053125 Bacteria 14196
1218 Ga0500618_005362 3300053125 Bacteria 3912
1219 Ga0500618_066683 3300053125 Bacteria 808
1220 Ga0500573_0115112 3300053140 Bacteria 1502
1221 Ga0500574_011096 3300053141 Bacteria 2022
1222 Ga0500586_000287 3300053145 Bacteria 10155
1223 Ga0500586_013964 3300053145 Bacteria 2379
1224 Ga0500619_017136 3300053154 Bacteria 2009
1225 Ga0587084_001091 3300059477 Bacteria 2466
1226 Ga0587084_016822 3300059477 Bacteria 1049
1227 Ga0587093_026387 3300059478 Bacteria 811
1228 Ga0587066_015127 3300059490 Bacteria 1195
1229 Ga0587070_031516 3300059491 Bacteria 964
1230 Ga0587073_0014758 3300059492 Bacteria 1397
1231 Ga0587077_000860 3300059493 Bacteria 2972
1232 Ga0587077_004427 3300059493 Bacteria 1847
1233 Ga0587077_018271 3300059493 Bacteria 1205
1234 Ga0587080_007964 3300059503 Bacteria 1503
1235 Ga0587080_030200 3300059503 Bacteria 940
1236 Ga0587082_009026 3300059504 Bacteria 1404
1237 Ga0587083_0012272 3300059505 Bacteria 1434
1238 Ga0587083_0053611 3300059505 Bacteria 887
1239 Ga0587088_002604 3300059508 Bacteria 2079
1240 Ga0587088_008501 3300059508 Bacteria 1454
1241 Ga0587090_009069 3300059510 Bacteria 1350
1242 Ga0587090_020162 3300059510 Bacteria 1035
1243 Ga0587090_027553 3300059510 Bacteria 931
1244 Ga0587091_009002 3300059511 Bacteria 1491
1245 Ga0587091_087235 3300059511 Bacteria 710
1246 Ga0587094_005330 3300059513 Bacteria 1498
1247 Ga0587094_028031 3300059513 Bacteria 858
1248 Ga0587098_000296 3300059604 Bacteria 2792
1249 Ga0587125_000587 3300059607 Bacteria 2223
1250 Ga0587099_012484 3300059622 Bacteria 875
1251 Ga0587101_001922 3300059623 Bacteria 1890
1252 Ga0587101_012686 3300059623 Bacteria 1099
1253 Ga0587115_051391 3300059626 Bacteria 670
1254 Ga0587128_043136 3300059630 Bacteria 797
1255 Ga0587068_000111 3300059641 Bacteria 5462
1256 Ga0587068_009016 3300059641 Bacteria 1460
1257 Ga0587068_047057 3300059641 Bacteria 797
1258 Ga0587069_004531 3300059642 Bacteria 1569
1259 Ga0587072_028585 3300059643 Bacteria 1029
1260 Ga0587076_000670 3300059645 Bacteria 3002
1261 Ga0587076_020573 3300059645 Bacteria 1084
1262 Ga0587079_005885 3300059647 Bacteria 1758
1263 Ga0587079_014317 3300059647 Bacteria 1330
1264 Ga0587079_016675 3300059647 Bacteria 1264
1265 Ga0587105_004348 3300059651 Bacteria 902
1266 Ga0587118_02502 3300059657 Bacteria 1194
1267 Ga0587071_002532 3300060344 Bacteria 2492
1268 Ga0466962_0128227 3300061719 Bacteria 1225
1269 2511383933 2511231026 Bacteria 5225445
1270 2521558990 2521172590 Bacteria 5047645
1271 2553003791 2551306416 Bacteria 6152985
1272 2601669698 2600255292 Bacteria 6300551
1273 2643787995 2643221554 Bacteria 6603920
1274 2643800239 2643221556 Bacteria 7251154
1275 2644027699 2643221603 Bacteria 6147767
1276 2644216405 2643221638 Bacteria 6579467
1277 2644255159 2643221645 Bacteria 7207331
1278 2644359722 2643221664 Bacteria 7272945
1279 2644471979 2643221684 Bacteria 7145183
1280 2738742984 2738541280 Bacteria 6630198
1281 2738827074 2738541297 Bacteria 6549566
1282 2738847067 2738541300 Bacteria 6675882
1283 2739150871 2738541357 Bacteria 6549408
1284 2739192790 2738543003 Bacteria 6549560
1285 2739277837 2738543018 Bacteria 6718814
1286 2739319267 2738543026 Bacteria 6549408
1287 2739337508 2738543029 Bacteria 6549249
1288 2739346880 2738543030 Bacteria 6719714
1289 2765568764 2765235838 Bacteria 5445269
1290 2808973454 2808606384 Bacteria 8474373
1291 2808981503 2808606386 Bacteria 4471946
1292 2809008303 2808606390 Bacteria 8476311
1293 2809015359 2808606391 Bacteria 8308166
1294 2809129085 2808606415 Bacteria 4576710
1295 2809142433 2808606418 Bacteria 6724496
1296 2809148705 2808606419 Bacteria 4576925
1297 2819542936 2818991436 Bacteria 5376622
1298 2819615507 2818991449 Bacteria 5518009
1299 2821134397 2821131069 Bacteria 6108407
1300 2839096353 2839094727 Bacteria 5534556
1301 2842714927 2842711865 Bacteria 7155354
1302 2852621242 2852618963 Bacteria 4577824
1303 2857549821 2857547612 Bacteria 6179999
1304 2857557237 2857553236 Bacteria 6166726
1305 2857564112 2857558681 Bacteria 6617694
1306 2857570187 2857564685 Bacteria 6290584
1307 2858695543 2858688981 Bacteria 8184122
1308 2885080302 2885080285 Bacteria 6355622
1309 2901303859 2901300506 Bacteria 8463898
1310 2904430429 2904424332 Bacteria 7633521
1311 2904444937 2904439833 Bacteria 5931679
1312 2904534769 2904530477 Bacteria 5876334
1313 2904584658 2904584206 Bacteria 6028872
1314 2904591125 2904589729 Bacteria 6113573
1315 2904605247 2904601388 Bacteria 5884906
1316 2919048414 2919046199 Bacteria 5567169
1317 2919081064 2919079590 Bacteria 5946433
1318 2919480990 2919476304 Bacteria 5888696
1319 2923512649 2923510766 Bacteria 5926163
1320 2928132670 2928130867 Bacteria 5467269
1321 2932415900 2932410948 Bacteria 6312192
1322 2932421890 2932416698 Bacteria 6315112
1323 8047674739 8047673197 Bacteria 7395230
1324 Ga0495597_0000518
1325 JGI25155J39150_1001397
1326 JGI25162J39368_1000941
1327 JGI25154J39366_1002325
1328 JGI25158J39367_1005047
1329 JGI25157J39369_1008404
1330 JGI25164J39214_1006552
1331 JGI25150J39212_1000878
1332 JGI25159J45721_1001607
1333 JGI25159J45721_1034026
1334 JGI25159J45721_1035050
1335 JGI25151J46595_10095729
1336 JGI25165J46597_1001005
1337 JGI25153J46596_10017520
1338 rootL2_10117451
1339 rootL2_10235950
1340 JGI25160J50197_1005858
1341 JGI25160J50197_1064757
1342 JGI25161J50226_1004319
1343 JGI25161J50226_1016428
1344 JGI25161J50226_1016966
1345 Ga0007417J51691_1040873
1346 Ga0007410J51695_1025360
1347 Ga0007410J51695_1053297
1348 Ga0007409J51694_1024193
1349 Ga0007416J51690_1036363
1350 Ga0032354_1073879
1351 Ga0055538_1000368
1352 Ga0055539_1000040
1353 Ga0055539_1000374
1354 Ga0055533_1000050
1355 Ga0055533_1000368
1356 Ga0055525_1000029
1357 Ga0055525_1000060
1358 Ga0055525_1000516
1359 Ga0055542_1004564
1360 Ga0055529_1000342
1361 Ga0055526_1000010
1362 Ga0055526_1002173
1363 Ga0055526_1017836
1364 Ga0055537_1000937
1365 Ga0055537_1005281
1366 Ga0055524_1000025
1367 Ga0055524_1004938
1368 Ga0055524_1005784
1369 Ga0055524_1009626
1370 Ga0055534_1000428
1371 Ga0055528_1000298
1372 Ga0055528_1005927
1373 Ga0055530_10008929
1374 Ga0055531_10024084
1375 Ga0055541_1000027
1376 Ga0055541_1000258
1377 Ga0055543_1000252
1378 Ga0055543_1005048
1379 Ga0065165_1002897
1380 Ga0065165_1003747
1381 Ga0065165_1010725
1382 Ga0065165_1017590
1383 Ga0065165_1022171
1384 Ga0065715_10021568
1385 Ga0070658_10202939
1386 Ga0070683_100297656
1387 Ga0070670_100504101
1388 Ga0070682_100438684
1389 Ga0070660_100037845
1390 Ga0070661_100366360
1391 Ga0070674_100792003
1392 Ga0070659_100073903
1393 Ga0070659_100882377
1394 Ga0070662_100159866
1395 Ga0070662_100355814
1396 Ga0068853_100292144
1397 Ga0068855_100002757
1398 Ga0068855_100102314
1399 Ga0068855_100283601
1400 Ga0070664_100491215
1401 Ga0070664_100770866
1402 Ga0068857_100703916
1403 Ga0068854_100051659
1404 Ga0068854_100130581
1405 Ga0068856_100395310
1406 Ga0068852_100062205
1407 Ga0068851_10454509
1408 Ga0070717_10201325
1409 Ga0070712_100223669
1410 Ga0070712_100344393
1411 Ga0075362_10003942
1412 Ga0075370_10296173
1413 Ga0068865_100117622
1414 Ga0079104_1010402
1415 Ga0079104_1046848
1416 Ga0099826_10000005
1417 Ga0105244_10000745
1418 Ga0105244_10012212
1419 Ga0105244_10116061
1420 Ga0105244_10191878
1421 Ga0105240_10054750
1422 Ga0105240_10082061
1423 Ga0105245_10631442
1424 Ga0105243_10102799
1425 Ga0105241_10143786
1426 Ga0105241_11124248
1427 Ga0105237_10022239
1428 Ga0105237_10290937
1429 Ga0105238_10000194
1430 Ga0105238_10427171
1431 Ga0105239_10053126
1432 Ga0105239_10245680
1433 Ga0105246_10563406
1434 Ga0157371_10000014
1435 Ga0157374_10344507
1436 Ga0157378_10134421
1437 Ga0157375_11083406
1438 Ga0182008_10000724
1439 Ga0157376_10361913
1440 Ga0182006_1000004
1441 Ga0182006_1000290
1442 Ga0182007_10000017
1443 Ga0182007_10008736
1444 Ga0182007_10049313
1445 Ga0182005_1000005
1446 Ga0182005_1000030
1447 Ga0182005_1001465
1448 Ga0163161_10037365
1449 Ga0163161_10247346
1450 Ga0163161_10302148
1451 Ga0206351_10506011
1452 Ga0206350_11236533
1453 Ga0154015_1389132
1454 Ga0213872_10000283
1455 Ga0213872_10000448
1456 Ga0213872_10004436
1457 Ga0213872_10077914
1458 Ga0213872_10125793
1459 Ga0209760_102043
1460 Ga0209436_100676
1461 Ga0209436_101244
1462 Ga0209436_112780
1463 Ga0209436_115894
1464 Ga0209784_100005
1465 Ga0209784_100020
1466 Ga0209566_100005
1467 Ga0209566_100020
1468 Ga0209674_100009
1469 Ga0209674_100035
1470 Ga0209672_107956
1471 Ga0209563_100003
1472 Ga0209563_100012
1473 Ga0209563_100038
1474 Ga0207427_101044
1475 Ga0209437_100066
1476 Ga0207425_1000017
1477 Ga0207425_1000207
1478 Ga0207425_1001019
1479 Ga0209646_1000036
1480 Ga0209026_1003311
1481 Ga0209677_100006
1482 Ga0209677_100031
1483 Ga0209148_1000716
1484 Ga0209129_1000039
1485 Ga0209233_1000060
1486 Ga0209565_1000068
1487 Ga0209565_1006462
1488 Ga0209565_1006693
1489 Ga0209455_1000047
1490 Ga0209673_1000119
1491 Ga0209673_1004774
1492 Ga0209130_1000057
1493 Ga0209130_1000491
1494 Ga0209130_1002491
1495 Ga0209130_1022423
1496 Ga0209675_1000068
1497 Ga0209675_1001374
1498 Ga0209675_1045372
1499 Ga0209675_1058720
1500 Ga0209025_1002795
1501 Ga0209564_1000060
1502 Ga0209564_1000141
1503 Ga0209564_1000149
1504 Ga0209564_1002252
1505 Ga0209564_1015501
1506 Ga0209758_1000192
1507 Ga0209758_1001203
1508 Ga0209050_1000762
1509 Ga0209050_1008259
1510 Ga0209256_1000040
1511 Ga0209256_1000651
1512 Ga0209256_1000744
1513 Ga0209256_1001036
1514 Ga0207426_1002755
1515 Ga0207426_1040942
1516 Ga0209051_1006195
1517 Ga0209257_1000501
1518 Ga0207655_1006610
1519 Ga0207705_10002800
1520 Ga0207654_10037957
1521 Ga0207695_10000851
1522 Ga0207695_10188300
1523 Ga0207671_10005917
1524 Ga0207693_10085895
1525 Ga0207660_10043233
1526 Ga0207657_10075164
1527 Ga0207657_10087205
1528 Ga0207694_10002153
1529 Ga0207650_10236193
1530 Ga0207690_10116410
1531 Ga0207706_10129576
1532 Ga0207706_10173071
1533 Ga0207686_10489218
1534 Ga0207709_10056555
1535 Ga0207679_10166724
1536 Ga0207679_10206297
1537 Ga0207667_10000073
1538 Ga0207667_10000076
1539 Ga0207667_10098172
1540 Ga0207667_10165091
1541 Ga0207667_10191529
1542 Ga0207640_10024135
1543 Ga0207640_10252959
1544 Ga0207639_10033519
1545 Ga0207678_10087167
1546 Ga0207702_10043762
1547 Ga0207702_10542866
1548 Ga0207702_11495134
1549 Ga0207674_10240909
1550 Ga0207698_10857750
1551 Ga0209282_1000003
1552 Ga0307515_10119315
1553 Ga0316180_1008266
1554 Ga0316183_1154518
1555 Ga0316181_1283885
1556 Ga0316181_1285192
1557 Ga0316182_1064365
1558 Ga0307408_100000709
1559 Ga0307408_100004480
1560 Ga0307408_100267981
1561 Ga0307408_100270566
1562 Ga0307408_100300425
1563 Ga0307408_100859421
1564 Ga0265314_10020225
1565 Ga0307416_100012578
1566 Ga0307415_101617690
1567 Ga0373936_0213098
1568 Ga0373935_0555947
1569 Ga0373927_0226681
1570 Ga0373925_0153892
1571 Ga0395899_0000128
1572 Ga0395899_0008506
1573 Ga0395899_0022800
1574 Ga0395899_0048411
1575 Ga0395899_0057304
1576 Ga0395899_0280520
1577 Ga0395899_0303542
1578 Ga0395899_0314943
1579 Ga0395899_0386057
1580 Ga0395899_0720931
1581 Ga0395900_0000123
1582 Ga0395900_0014613
1583 Ga0395900_0027294
1584 Ga0395900_0042657
1585 Ga0395900_0079638
1586 Ga0395900_0220729
1587 Ga0395900_0286961
1588 Ga0395900_0398736
1589 Ga0395900_0542624
1590 Ga0395900_1204882
1591 Ga0395898_0138988
1592 Ga0395898_0196161
1593 Ga0395898_0207303
1594 Ga0395898_0362781
1595 Ga0395898_0427698
1596 Ga0395898_0640392
1597 Ga0395905_0005259
1598 Ga0395905_0022902
1599 Ga0395905_0033212
1600 Ga0395905_0111535
1601 Ga0395905_0114293
1602 Ga0395905_0241862
1603 Ga0395905_0260006
1604 Ga0395905_0305648
1605 Ga0395905_0586188
1606 Ga0395905_1101204
1607 Ga0395901_0000411
1608 Ga0395901_0005452
1609 Ga0395901_0047248
1610 Ga0395901_0252920
1611 Ga0395901_0337736
1612 Ga0395901_0395240
1613 Ga0395901_0445753
1614 Ga0395901_0475940
1615 Ga0395901_1061304
1616 Ga0395901_1371008
1617 Ga0436361_0074798
1618 Ga0436361_0169492
1619 Ga0436361_0473182
1620 Ga0436361_0519246
1621 Ga0436361_0615250
1622 Ga0436361_0749276
1623 Ga0436361_1222095
1624 Ga0439465_0035484
1625 Ga0439433_0018004
1626 Ga0439442_082667
1627 Ga0439448_0013284
1628 Ga0439449_0102257
1629 Ga0439455_0010134
1630 Ga0439455_0177751
1631 Ga0450890_018864
1632 Ga0450903_041946
1633 Ga0450904_000049
1634 Ga0439458_0028194
1635 Ga0450893_0017630
1636 Ga0451577_1178446
1637 Ga0466972_0000037
1638 Ga0466965_0000474
1639 Ga0466965_0020181
1640 Ga0466965_0030284
1641 Ga0466965_0068005
1642 Ga0466965_0103094
1643 Ga0466965_0237262
1644 Ga0466966_0096161
1645 Ga0466966_0098417
1646 Ga0466966_0109762
1647 Ga0466961_0043597
1648 Ga0466961_0250941
1649 Ga0466964_0000496
1650 Ga0466964_0010954
1651 Ga0466964_0026294
1652 Ga0466964_0057639
1653 Ga0466964_0292231
1654 Ga0453684_0114685
1655 Ga0466971_0061606
1656 Ga0466971_0238477
1657 Ga0466971_0308035
1658 Ga0466968_0016884
1659 Ga0466968_0164133
1660 Ga0466968_0251083
1661 Ga0466970_0040068
1662 Ga0466970_0109047
1663 Ga0466970_0391589
1664 Ga0466957_0032481
1665 Ga0466957_0107698
1666 Ga0466957_0112865
1667 Ga0466957_0207361
1668 Ga0466957_0494223
1669 Ga0466960_0053691
1670 Ga0466959_0010886
1671 Ga0466959_0076227
1672 Ga0466959_0212582
1673 Ga0466959_0649014
1674 Ga0466958_0373859
1675 Ga0466958_0414356
1676 Ga0466967_0098434
1677 Ga0466967_0270799
1678 Ga0466967_0610083
1679 Ga0466967_1316954
1680 Ga0495617_000005
1681 Ga0495617_000034
1682 Ga0495617_008342
1683 Ga0495617_066666
1684 Ga0495617_114605
1685 Ga0495617_117817
1686 Ga0495627_000038
1687 Ga0495627_000208
1688 Ga0495627_009453
1689 Ga0495627_024171
1690 Ga0495627_026329
1691 Ga0495627_103375
1692 Ga0495627_114683
1693 Ga0495592_0042223
1694 Ga0495603_0007343
1695 Ga0495590_0000189
1696 Ga0495590_0000271
1697 Ga0495590_0000312
1698 Ga0495590_0013995
1699 Ga0495590_0028735
1700 Ga0495590_0049778
1701 Ga0495590_0069971
1702 Ga0495591_000594
1703 Ga0495591_012883
1704 Ga0495629_0009511
1705 Ga0495629_0033319
1706 Ga0495629_0089891
1707 Ga0495638_0000765
1708 Ga0495638_0005494
1709 Ga0495638_0021349
1710 Ga0495638_0045819
1711 Ga0495638_0071582
1712 Ga0495638_0133467
1713 Ga0495638_0149634
1714 Ga0495638_0265987
1715 Ga0495638_0278026
1716 Ga0495638_0320262
1717 Ga0495651_0002551
1718 Ga0495651_0149752
1719 Ga0495653_0000172
1720 Ga0495653_0027405
1721 Ga0495653_0050788
1722 Ga0495653_0088626
1723 Ga0495653_0205054
1724 Ga0495653_0267700
1725 Ga0495653_0336884
1726 Ga0495650_0000011
1727 Ga0495650_0000525
1728 Ga0495650_0001069
1729 Ga0495650_0001815
1730 Ga0495650_0003789
1731 Ga0495650_0011548
1732 Ga0495650_0029142
1733 Ga0495650_0030185
1734 Ga0495650_0035886
1735 Ga0495650_0088876
1736 Ga0495580_0009618
1737 Ga0495580_0385589
1738 Ga0495582_0071576
1739 Ga0495582_0207890
1740 Ga0495605_0000029
1741 Ga0495605_0000151
1742 Ga0495605_0000612
1743 Ga0495605_0005809
1744 Ga0495605_0014900
1745 Ga0495605_0033959
1746 Ga0495605_0040395
1747 Ga0495605_0043053
1748 Ga0495605_0043300
1749 Ga0495605_0144411
1750 Ga0495605_0351085
1751 Ga0495639_0042232
1752 Ga0495584_0000007
1753 Ga0495584_0000428
1754 Ga0495584_0001326
1755 Ga0495584_0004529
1756 Ga0495584_0005462
1757 Ga0495584_0006970
1758 Ga0495584_0012230
1759 Ga0495584_0027295
1760 Ga0495584_0027858
1761 Ga0495584_0029009
1762 Ga0495584_0058537
1763 Ga0495584_0073840
1764 Ga0495584_0099104
1765 Ga0495584_0100589
1766 Ga0495584_0102969
1767 Ga0495584_0123320
1768 Ga0495584_0133913
1769 Ga0495584_0165074
1770 Ga0495584_0306542
1771 Ga0495585_0000737
1772 Ga0495585_0001834
1773 Ga0495585_0002067
1774 Ga0495585_0003005
1775 Ga0495585_0003373
1776 Ga0495585_0006129
1777 Ga0495585_0006176
1778 Ga0495585_0008447
1779 Ga0495585_0012312
1780 Ga0495585_0028688
1781 Ga0495585_0034645
1782 Ga0495585_0051582
1783 Ga0495585_0058349
1784 Ga0495585_0062307
1785 Ga0495585_0110996
1786 Ga0495585_0141316
1787 Ga0495585_0161999
1788 Ga0495585_0174131
1789 Ga0495585_0200109
1790 Ga0495585_0265891
1791 Ga0495594_0001260
1792 Ga0495594_0004863
1793 Ga0495594_0009850
1794 Ga0495594_0013523
1795 Ga0495594_0050844
1796 Ga0495594_0067878
1797 Ga0495594_0198917
1798 Ga0495596_0000530
1799 Ga0495596_0001401
1800 Ga0495596_0002167
1801 Ga0495596_0002608
1802 Ga0495596_0008609
1803 Ga0495596_0011442
1804 Ga0495596_0013575
1805 Ga0495596_0017436
1806 Ga0495596_0030976
1807 Ga0495596_0034306
1808 Ga0495596_0060757
1809 Ga0495596_0063008
1810 Ga0495596_0065313
1811 Ga0495596_0138125
1812 Ga0495596_0199009
1813 Ga0495607_0002820
1814 Ga0495607_0003795
1815 Ga0495607_0021369
1816 Ga0495607_0024184
1817 Ga0495607_0027265
1818 Ga0495607_0027983
1819 Ga0495607_0044857
1820 Ga0495607_0054165
1821 Ga0495607_0074643
1822 Ga0495607_0080680
1823 Ga0495607_0083620
1824 Ga0495607_0094447
1825 Ga0495607_0099958
1826 Ga0495607_0102604
1827 Ga0495607_0260150
1828 Ga0495607_0390026
1829 Ga0495583_0000228
1830 Ga0495583_0000337
1831 Ga0495583_0000569
1832 Ga0495583_0003815
1833 Ga0495583_0003904
1834 Ga0495583_0003906
1835 Ga0495583_0012258
1836 Ga0495583_0015352
1837 Ga0495583_0016181
1838 Ga0495583_0019684
1839 Ga0495583_0025899
1840 Ga0495583_0036055
1841 Ga0495583_0047446
1842 Ga0495583_0053939
1843 Ga0495583_0146091
1844 Ga0495583_0213460
1845 Ga0495606_0000077
1846 Ga0495606_0000622
1847 Ga0495606_0001807
1848 Ga0495606_0002440
1849 Ga0495606_0006073
1850 Ga0495606_0006229
1851 Ga0495606_0006875
1852 Ga0495606_0017797
1853 Ga0495606_0030864
1854 Ga0495606_0036098
1855 Ga0495606_0044688
1856 Ga0495606_0068768
1857 Ga0495606_0086621
1858 Ga0495606_0156447
1859 Ga0495606_0157257
1860 Ga0495606_0183394
1861 Ga0495606_0213473
1862 Ga0495606_0213776
1863 Ga0495608_0013499
1864 Ga0495608_0015283
1865 Ga0495610_0000038
1866 Ga0495610_0002303
1867 Ga0495610_0011762
1868 Ga0495610_0036765
1869 Ga0495610_0044411
1870 Ga0495610_0110197
1871 Ga0495610_0137585
1872 Ga0495616_0000380
1873 Ga0495616_0000551
1874 Ga0495616_0000809
1875 Ga0495616_0001733
1876 Ga0495616_0002449
1877 Ga0495616_0003895
1878 Ga0495616_0025324
1879 Ga0495616_0027496
1880 Ga0495616_0034682
1881 Ga0495616_0040687
1882 Ga0495616_0063801
1883 Ga0495616_0072007
1884 Ga0495616_0074285
1885 Ga0495616_0120000
1886 Ga0495616_0124381
1887 Ga0495616_0134880
1888 Ga0495616_0150532
1889 Ga0495616_0178267
1890 Ga0495618_0024623
1891 Ga0495620_0004290
1892 Ga0495628_0000767
1893 Ga0495628_0028463
1894 Ga0495628_0730552
1895 Ga0495630_0061254
1896 Ga0495631_0001405
1897 Ga0495631_0003152
1898 Ga0495631_0017573
1899 Ga0495631_0020046
1900 Ga0495631_0029054
1901 Ga0495631_0036236
1902 Ga0495631_0036935
1903 Ga0495631_0039776
1904 Ga0495631_0045099
1905 Ga0495631_0046944
1906 Ga0495631_0062031
1907 Ga0495631_0071302
1908 Ga0495631_0099263
1909 Ga0495631_0100011
1910 Ga0495631_0113219
1911 Ga0495631_0156305
1912 Ga0495631_0275321
1913 Ga0495632_0000027
1914 Ga0495632_0000774
1915 Ga0495632_0002636
1916 Ga0495632_0023179
1917 Ga0495632_0026926
1918 Ga0495632_0080624
1919 Ga0495632_0136153
1920 Ga0495637_0000013
1921 Ga0495637_0002325
1922 Ga0495637_0007660
1923 Ga0495637_0045369
1924 Ga0495637_0049904
1925 Ga0495643_0000576
1926 Ga0495643_0001689
1927 Ga0495643_0010247
1928 Ga0495643_0013360
1929 Ga0495643_0019427
1930 Ga0495643_0019521
1931 Ga0495643_0031808
1932 Ga0495643_0038993
1933 Ga0495643_0045934
1934 Ga0495643_0048477
1935 Ga0495643_0050211
1936 Ga0495643_0061725
1937 Ga0495643_0062822
1938 Ga0495643_0163331
1939 Ga0495643_0197466
1940 Ga0495643_0245507
1941 Ga0495644_0002932
1942 Ga0495644_0013134
1943 Ga0495644_0026824
1944 Ga0495644_0029536
1945 Ga0495644_0029690
1946 Ga0495644_0037517
1947 Ga0495644_0051119
1948 Ga0495644_0052681
1949 Ga0495644_0079468
1950 Ga0495644_0144041
1951 Ga0495648_0000112
1952 Ga0495648_0000806
1953 Ga0495648_0004997
1954 Ga0495648_0005314
1955 Ga0495648_0027679
1956 Ga0495648_0051300
1957 Ga0495648_0051694
1958 Ga0495648_0054804
1959 Ga0495648_0056254
1960 Ga0495648_0066316
1961 Ga0495648_0076829
1962 Ga0495648_0078293
1963 Ga0495648_0158947
1964 Ga0495648_0210488
1965 Ga0495648_0256999
1966 Ga0495663_0003539
1967 Ga0495663_0016801
1968 Ga0495666_0000464
1969 Ga0495666_0010305
1970 Ga0495666_0017617
1971 Ga0495666_0082266
1972 Ga0495666_0095491
1973 Ga0495666_0130288
1974 Ga0495642_0000127
1975 Ga0495642_0000327
1976 Ga0495642_0003630
1977 Ga0495642_0005288
1978 Ga0495642_0005863
1979 Ga0495642_0013199
1980 Ga0495642_0014942
1981 Ga0495642_0015072
1982 Ga0495642_0027438
1983 Ga0495642_0030080
1984 Ga0495642_0030201
1985 Ga0495642_0042630
1986 Ga0495642_0070278
1987 Ga0495642_0073502
1988 Ga0495642_0074999
1989 Ga0495642_0091949
1990 Ga0495642_0167418
1991 Ga0495642_0252219
1992 Ga0495652_0003788
1993 Ga0495652_0024036
1994 Ga0495652_0083840
1995 Ga0495652_0139269
1996 Ga0495654_0000233
1997 Ga0495654_0021114
1998 Ga0495654_0022655
1999 Ga0495654_0037743
2000 Ga0495654_0047726
2001 Ga0495654_0120288
2002 Ga0495665_0000671
2003 Ga0495665_0020387
2004 Ga0495665_0089969
2005 Ga0495640_0364744
2006 Ga0495586_0003598
2007 Ga0495586_0009430
2008 Ga0495586_0079107
2009 Ga0495587_0018073
2010 Ga0495587_0041457
2011 Ga0495587_0282240
2012 Ga0495598_0145679
2013 Ga0495609_0000022
2014 Ga0495609_0001170
2015 Ga0495609_0001426
2016 Ga0495609_0006900
2017 Ga0495609_0016183
2018 Ga0495609_0017151
2019 Ga0495609_0017589
2020 Ga0495609_0017886
2021 Ga0495609_0034351
2022 Ga0495609_0041755
2023 Ga0495609_0054418
2024 Ga0495609_0063607
2025 Ga0495609_0065395
2026 Ga0495609_0071787
2027 Ga0495609_0095353
2028 Ga0495609_0163488
2029 Ga0495597_0002342
2030 Ga0495597_0003173
2031 Ga0495597_0012295
2032 Ga0495597_0012801
2033 Ga0495597_0018475
2034 Ga0495597_0025241
2035 Ga0495597_0027270
2036 Ga0495597_0037834
2037 Ga0495597_0101018
2038 Ga0495597_0110601
2039 Ga0495597_0122555
2040 Ga0495597_0125908
2041 Ga0495597_0137378
2042 Ga0495597_0141132
2043 Ga0495597_0189832
2044 Ga0495597_0256364
2045 Ga0495645_0029765
2046 Ga0495645_0079354
2047 Ga0495645_0081860
2048 Ga0495622_0000434
2049 Ga0495622_0001824
2050 Ga0495622_0005965
2051 Ga0495622_0009986
2052 Ga0495622_0041419
2053 Ga0495622_0063841
2054 Ga0495622_0113229
2055 Ga0495633_0000606
2056 Ga0495633_0003044
2057 Ga0495633_0004014
2058 Ga0495633_0006321
2059 Ga0495633_0011548
2060 Ga0495633_0012907
2061 Ga0495633_0019892
2062 Ga0495633_0032370
2063 Ga0495633_0039978
2064 Ga0495633_0048556
2065 Ga0495633_0105229
2066 Ga0495633_0112629
2067 Ga0495633_0153036
2068 Ga0495633_0176985
2069 Ga0495633_0204845
2070 Ga0495633_0278460
2071 Ga0495667_0515311
2072 Ga0495656_0006072
2073 Ga0495656_0039733
2074 Ga0495656_0041942
2075 Ga0495656_0078527
2076 Ga0495656_0155009
2077 Ga0495656_0203267
2078 Ga0495656_0262431
2079 Ga0495668_0000064
2080 Ga0495668_0000330
2081 Ga0495668_0000979
2082 Ga0495668_0001705
2083 Ga0495668_0003120
2084 Ga0495668_0003775
2085 Ga0495668_0004433
2086 Ga0495668_0009251
2087 Ga0495668_0021601
2088 Ga0495668_0059433
2089 Ga0495668_0062026
2090 Ga0495668_0071856
2091 Ga0495668_0076518
2092 Ga0495668_0082329
2093 Ga0495668_0084281
2094 Ga0495668_0113529
2095 Ga0495668_0125563
2096 Ga0495668_0216570
2097 Ga0495668_0250604
2098 Ga0495668_0302995
2099 Ga0495668_0502143
2100 Ga0495634_0143333
2101 Ga0495634_0197881
2102 Ga0495611_0000091
2103 Ga0495611_0002372
2104 Ga0495611_0004076
2105 Ga0495611_0009734
2106 Ga0495611_0011951
2107 Ga0495611_0032693
2108 Ga0495611_0034219
2109 Ga0495611_0036801
2110 Ga0495611_0058316
2111 Ga0495611_0075122
2112 Ga0495611_0116633
2113 Ga0495611_0259205
2114 Ga0495625_0001154
2115 Ga0495625_0002821
2116 Ga0495625_0003568
2117 Ga0495625_0006715
2118 Ga0495625_0007042
2119 Ga0495625_0009471
2120 Ga0495625_0042233
2121 Ga0495625_0042705
2122 Ga0495625_0083737
2123 Ga0495625_0204893
2124 Ga0495625_0211260
2125 Ga0495625_0232515
2126 Ga0495625_0366973
2127 Ga0495635_0186156
2128 Ga0495659_0000726
2129 Ga0495659_0001078
2130 Ga0495659_0042097
2131 Ga0495659_0057741
2132 Ga0495659_0081223
2133 Ga0495659_0151537
2134 Ga0495661_0000297
2135 Ga0495661_0000756
2136 Ga0495661_0001704
2137 Ga0495661_0003450
2138 Ga0495661_0003562
2139 Ga0495661_0015333
2140 Ga0495661_0037662
2141 Ga0495661_0042588
2142 Ga0495661_0052004
2143 Ga0495661_0058304
2144 Ga0495661_0081708
2145 Ga0495661_0117032
2146 Ga0495661_0166206
2147 Ga0495661_0205606
2148 Ga0495661_0241833
2149 Ga0495661_0276691
2150 Ga0495661_0290086
2151 Ga0495588_0000086
2152 Ga0495588_0014258
2153 Ga0495588_0020704
2154 Ga0495588_0021072
2155 Ga0495588_0036255
2156 Ga0495588_0047387
2157 Ga0495588_0054786
2158 Ga0495588_0085592
2159 Ga0495588_0122685
2160 Ga0495588_0139633
2161 Ga0495588_0152893
2162 Ga0495588_0161378
2163 Ga0495588_0218664
2164 Ga0495599_0027586
2165 Ga0495599_0076234
2166 Ga0495623_0049725
2167 Ga0495623_0179186
2168 Ga0495623_0181393
2169 Ga0495623_0299782
2170 Ga0495646_0013855
2171 Ga0495646_0268880
2172 Ga0495669_0000018
2173 Ga0495669_0001568
2174 Ga0495669_0002263
2175 Ga0495669_0006992
2176 Ga0495669_0024818
2177 Ga0495669_0026953
2178 Ga0495669_0041085
2179 Ga0495613_0053635
2180 Ga0495613_0396782
2181 Ga0495613_0426547
2182 Ga0495624_0182727
2183 Ga0495670_0004185
2184 Ga0495670_0013040
2185 Ga0495670_0015536
2186 Ga0495670_0019228
2187 Ga0495670_0021179
2188 Ga0495670_0039572
2189 Ga0495670_0047383
2190 Ga0495670_0127444
2191 Ga0495670_0149239
2192 Ga0495670_0162329
2193 Ga0495670_0184006
2194 Ga0495670_0197720
2195 Ga0495670_0253499
2196 Ga0495670_0322791
2197 Ga0495671_0000044
2198 Ga0495671_0000188
2199 Ga0495671_0002456
2200 Ga0495671_0002876
2201 Ga0495671_0011572
2202 Ga0495671_0023200
2203 Ga0495671_0054688
2204 Ga0495671_0060349
2205 Ga0495671_0122506
2206 Ga0495671_0159505
2207 Ga0495671_0224115
2208 Ga0495671_0275849
2209 Ga0495649_0001439
2210 Ga0495649_0003868
2211 Ga0495649_0006236
2212 Ga0495649_0041542
2213 Ga0495649_0047485
2214 Ga0495649_0048970
2215 Ga0495649_0071091
2216 Ga0495649_0114195
2217 Ga0495649_0174015
2218 Ga0495649_0212716
2219 Ga0495649_0309198
2220 Ga0495589_0000017
2221 Ga0495589_0000270
2222 Ga0495589_0000392
2223 Ga0495589_0001855
2224 Ga0495589_0011164
2225 Ga0495589_0039966
2226 Ga0495589_0040498
2227 Ga0495589_0060199
2228 Ga0495589_0068705
2229 Ga0495589_0094864
2230 Ga0495589_0097490
2231 Ga0495589_0311366
2232 Ga0495589_0357720
2233 Ga0495589_0374346
2234 Ga0495600_0005139
2235 Ga0495600_0058602
2236 Ga0495600_0186491
2237 Ga0495600_0223575
2238 Ga0495660_0000067
2239 Ga0495660_0001303
2240 Ga0495660_0002850
2241 Ga0495660_0003589
2242 Ga0495660_0007668
2243 Ga0495660_0015335
2244 Ga0495660_0054418
2245 Ga0495660_0054796
2246 Ga0495660_0056880
2247 Ga0495660_0059810
2248 Ga0495660_0081096
2249 Ga0495660_0129333
2250 Ga0495660_0149424
2251 Ga0495581_0028064
2252 Ga0495581_0065867
2253 Ga0495604_0004481
2254 Ga0495604_0019129
2255 Ga0495604_0076354
2256 Ga0495604_0099916
2257 Ga0495604_0570956
2258 Ga0495636_0005995
2259 Ga0495636_0015536
2260 Ga0495636_0035192
2261 Ga0495636_0088381
2262 Ga0495636_0091671
2263 Ga0495636_0101868
2264 Ga0495636_0172953
2265 Ga0495674_0001855
2266 Ga0495672_0000067
2267 Ga0495672_0000361
2268 Ga0495672_0000883
2269 Ga0495672_0001130
2270 Ga0495672_0001953
2271 Ga0495672_0002769
2272 Ga0495672_0003031
2273 Ga0495672_0047759
2274 Ga0495672_0081184
2275 Ga0495672_0091534
2276 Ga0495672_0096792
2277 Ga0495672_0172556
2278 Ga0495676_0000133
2279 Ga0495676_0006994
2280 Ga0495676_0028243
2281 Ga0495676_0136796
2282 Ga0495676_0191933
2283 Ga0495680_0069235
2284 Ga0495680_0096745
2285 Ga0495683_0000083
2286 Ga0495683_0000418
2287 Ga0495683_0000641
2288 Ga0495683_0056068
2289 Ga0495683_0069133
2290 Ga0495683_0086909
2291 Ga0495683_0105521
2292 Ga0495683_0168711
2293 Ga0495683_0177425
2294 Ga0495687_000033
2295 Ga0495687_000126
2296 Ga0495687_000252
2297 Ga0495687_001058
2298 Ga0495687_001886
2299 Ga0495687_004618
2300 Ga0495687_008748
2301 Ga0495687_018056
2302 Ga0495687_036730
2303 Ga0495687_038664
2304 Ga0495687_046432
2305 Ga0495687_053895
2306 Ga0495687_068762
2307 Ga0495675_0063335
2308 Ga0495675_0073609
2309 Ga0495675_0087259
2310 Ga0495677_0000002
2311 Ga0495677_0000605
2312 Ga0495677_0002998
2313 Ga0495677_0004265
2314 Ga0495677_0009984
2315 Ga0495677_0013015
2316 Ga0495677_0020944
2317 Ga0495677_0020996
2318 Ga0495677_0021692
2319 Ga0495677_0022266
2320 Ga0495677_0025317
2321 Ga0495677_0026429
2322 Ga0495677_0037330
2323 Ga0495677_0067925
2324 Ga0495677_0111762
2325 Ga0495677_0171635
2326 Ga0495679_001328
2327 Ga0495679_003687
2328 Ga0495679_007262
2329 Ga0495679_019170
2330 Ga0495679_023409
2331 Ga0495679_042641
2332 Ga0495685_000089
2333 Ga0495685_015020
2334 Ga0495685_018268
2335 Ga0495685_022847
2336 Ga0495685_023435
2337 Ga0495685_051623
2338 Ga0495685_081058
2339 Ga0495685_092857
2340 Ga0495685_140373
2341 Ga0495673_0000085
2342 Ga0495673_0000409
2343 Ga0495673_0000522
2344 Ga0495673_0047424
2345 Ga0495673_0050154
2346 Ga0495681_0000440
2347 Ga0495681_0000885
2348 Ga0495681_0002477
2349 Ga0495681_0003632
2350 Ga0495681_0004226
2351 Ga0495681_0010821
2352 Ga0495681_0020161
2353 Ga0495681_0045318
2354 Ga0495681_0117740
2355 Ga0495681_0138119
2356 Ga0495681_0149137
2357 Ga0495681_0181413
2358 Ga0495686_0000228
2359 Ga0495686_0001128
2360 Ga0495686_0001924
2361 Ga0495686_0008586
2362 Ga0495686_0064977
2363 Ga0495686_0065827
2364 Ga0495686_0081696
2365 Ga0495686_0092065
2366 Ga0495686_0102081
2367 Ga0495686_0120326
2368 Ga0495686_0142157
2369 Ga0495686_0250551
2370 Ga0495593_0003102
2371 Ga0495593_0018415
2372 Ga0495593_0081590
2373 Ga0495593_0102082
2374 Ga0495602_0628741
2375 Ga0495615_0001328
2376 Ga0495626_0000183
2377 Ga0495626_0000217
2378 Ga0495626_0000258
2379 Ga0495626_0004638
2380 Ga0495626_0004978
2381 Ga0495626_0005737
2382 Ga0495626_0007189
2383 Ga0495626_0008474
2384 Ga0495626_0015446
2385 Ga0495626_0036984
2386 Ga0495626_0037678
2387 Ga0495626_0052981
2388 Ga0495626_0053414
2389 Ga0495626_0099598
2390 Ga0495626_0105522
2391 Ga0495626_0128259
2392 Ga0496100_0073109
2393 Ga0496100_0751453
2394 Ga0496102_0000313
2395 Ga0496102_0000711
2396 Ga0496102_0114574
2397 Ga0496102_0149011
2398 Ga0496102_0242780
2399 Ga0496102_0934542
2400 Ga0496103_0036795
2401 Ga0496103_0057425
2402 Ga0496103_0141561
2403 Ga0496103_0326249
2404 Ga0496104_0080075
2405 Ga0496104_0379476
2406 Ga0496105_0104511
2407 Ga0496105_0339577
2408 Ga0496106_0007265
2409 Ga0496106_0122133
2410 Ga0496106_1045208
2411 Ga0496107_0123593
2412 Ga0496107_0152335
2413 Ga0496107_0164582
2414 Ga0496108_0218593
2415 Ga0496108_0492318
2416 Ga0496109_0268533
2417 Ga0496109_0620086
2418 Ga0496110_0000212
2419 Ga0496110_0139501
2420 Ga0496110_0148347
2421 Ga0496111_0087630
2422 Ga0496111_0103868
2423 Ga0496111_0146429
2424 Ga0496111_0589328
2425 Ga0496112_0546845
2426 Ga0496112_0955249
2427 Ga0496113_0024663
2428 Ga0496113_0045787
2429 Ga0496113_0269824
2430 Ga0496113_0349340
2431 Ga0496114_0010016
2432 Ga0496114_0057021
2433 Ga0496114_0200029
2434 Ga0496114_0659848
2435 Ga0496115_0037234
2436 Ga0496115_0057151
2437 Ga0496115_0188576
2438 Ga0496115_0290324
2439 Ga0496115_0319265
2440 Ga0496115_0700879
2441 Ga0496116_0030727
2442 Ga0496116_0080476
2443 Ga0496116_0087654
2444 Ga0496116_0147265
2445 Ga0496117_0000011
2446 Ga0496118_0000010
2447 Ga0496121_0006064
2448 Ga0496121_0008022
2449 Ga0496121_0101190
2450 Ga0496121_0208788
2451 Ga0496121_0342188
2452 Ga0496121_0436379
2453 Ga0496122_0000256
2454 Ga0496122_0008347
2455 Ga0496122_0071537
2456 Ga0496122_0120340
2457 Ga0496123_0004154
2458 Ga0496123_0004736
2459 Ga0496123_0006875
2460 Ga0496123_0018007
2461 Ga0496123_0054840
2462 Ga0496123_0117841
2463 Ga0496124_0029886
2464 Ga0496124_0057613
2465 Ga0496124_0063263
2466 Ga0496124_0098471
2467 Ga0496124_0149224
2468 Ga0496124_0243833
2469 Ga0496124_0311707
2470 Ga0496124_0437297
2471 Ga0496124_0442935
2472 Ga0496124_0443405
2473 Ga0496124_0675078
2474 Ga0496124_0680828
2475 Ga0496125_0001859
2476 Ga0496125_0002083
2477 Ga0496125_0062955
2478 Ga0496125_0167211
2479 Ga0496125_0239923
2480 Ga0496126_0081363
2481 Ga0496126_0463970
2482 Ga0501306_000165
2483 Ga0501308_004978
2484 Ga0501310_001518
2485 Ga0501307_024488
2486 Ga0495678_000001
2487 Ga0495678_000161
2488 Ga0495678_000454
2489 Ga0495678_001236
2490 Ga0495678_002980
2491 Ga0495678_003440
2492 Ga0495678_005959
2493 Ga0495678_017956
2494 Ga0495678_027350
2495 Ga0495678_034449
2496 Ga0495678_054971
2497 Ga0495678_069175
2498 Ga0495682_0002407
2499 Ga0495682_0004701
2500 Ga0495682_0018932
2501 Ga0495682_0129762
2502 Ga0495682_0139530
2503 Ga0495682_0149523
2504 Ga0495682_0157034
2505 Ga0495682_0217334
2506 Ga0501311_005446
2507 Ga0501312_037175
2508 Ga0501315_001804
2509 Ga0501315_008595
2510 Ga0501316_013519
2511 Ga0501320_006417
2512 Ga0501321_007707
2513 Ga0501031_0254434
2514 Ga0501032_0001038
2515 Ga0501034_0000997
2516 Ga0501034_0150615
2517 Ga0501034_0261333
2518 Ga0501034_0278578
2519 Ga0501038_0032987
2520 Ga0501039_0672667
2521 Ga0501047_0501814
2522 Ga0501072_0000524
2523 Ga0501074_0079826
2524 Ga0501230_029288
2525 Ga0501238_001426
2526 Ga0501249_001374
2527 Ga0501080_0093087
2528 Ga0501269_000356
2529 Ga0501279_002759
2530 Ga0501035_0047572
2531 Ga0501044_0236778
2532 Ga0501044_0423983
2533 Ga0501044_0858820
2534 nmdc:mga03683_27793_c1
2535 nmdc:mga07m45_137526_c1
2536 Ga0495601_0005458
2537 Ga0495601_0188908
2538 Ga0500594_0033322
2539 Ga0500595_001576
2540 Ga0500618_001009
2541 Ga0500618_005362
2542 Ga0500618_066683
2543 Ga0500573_0115112
2544 Ga0500574_011096
2545 Ga0500586_000287
2546 Ga0500586_013964
2547 Ga0500619_017136
2548 Ga0587084_001091
2549 Ga0587084_016822
2550 Ga0587093_026387
2551 Ga0587066_015127
2552 Ga0587070_031516
2553 Ga0587073_0014758
2554 Ga0587077_000860
2555 Ga0587077_004427
2556 Ga0587077_018271
2557 Ga0587080_007964
2558 Ga0587080_030200
2559 Ga0587082_009026
2560 Ga0587083_0012272
2561 Ga0587083_0053611
2562 Ga0587088_002604
2563 Ga0587088_008501
2564 Ga0587090_009069
2565 Ga0587090_020162
2566 Ga0587090_027553
2567 Ga0587091_009002
2568 Ga0587091_087235
2569 Ga0587094_005330
2570 Ga0587094_028031
2571 Ga0587098_000296
2572 Ga0587125_000587
2573 Ga0587099_012484
2574 Ga0587101_001922
2575 Ga0587101_012686
2576 Ga0587115_051391
2577 Ga0587128_043136
2578 Ga0587068_000111
2579 Ga0587068_009016
2580 Ga0587068_047057
2581 Ga0587069_004531
2582 Ga0587072_028585
2583 Ga0587076_000670
2584 Ga0587076_020573
2585 Ga0587079_005885
2586 Ga0587079_014317
2587 Ga0587079_016675
2588 Ga0587105_004348
2589 Ga0587118_02502
2590 Ga0587071_002532
2591 Ga0466962_0128227
2592 2511383933
2593 2521558990
2594 2553003791
2595 2601669698
2596 2643787995
2597 2643800239
2598 2644027699
2599 2644216405
2600 2644255159
2601 2644359722
2602 2644471979
2603 2738742984
2604 2738827074
2605 2738847067
2606 2739150871
2607 2739192790
2608 2739277837
2609 2739319267
2610 2739337508
2611 2739346880
2612 2765568764
2613 2808973454
2614 2808981503
2615 2809008303
2616 2809015359
2617 2809129085
2618 2809142433
2619 2809148705
2620 2819542936
2621 2819615507
2622 2821134397
2623 2839096353
2624 2842714927
2625 2852621242
2626 2857549821
2627 2857557237
2628 2857564112
2629 2857570187
2630 2858695543
2631 2885080302
2632 2901303859
2633 2904430429
2634 2904444937
2635 2904534769
2636 2904584658
2637 2904591125
2638 2904605247
2639 2919048414
2640 2919081064
2641 2919480990
2642 2923512649
2643 2928132670
2644 2932415900
2645 2932421890
2646 8047674739

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06073

DUF934

Bacterial protein of unknown function (DUF934)

90

196

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qbj-assembly2.cif.gz_B bacterial impdh chimera 0.788 74 148
5urq-assembly1.cif.gz_D crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p176 0.7625 74 148
4mz8-assembly1.cif.gz_B crystal structure of the inosine 5'-monophosphate dehydrogenase, with an internal deletion of cbs domain from campylobacter jejuni complexed with inhibitor compound c91 0.7614 74 148
5urq-assembly1.cif.gz_C crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p176 0.7575 74 148
5uqg-assembly1.cif.gz_D crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p200 0.7575 74 148
ID Description Score Start End Superfamily
1nfbA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7602 74 148 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7501 53 168 3.20.20.70
1lrtC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.732 54 146 3.20.20.70
af_P9WI51_4_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7225 53 163 3.20.20.70
af_P39362_1_210_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7176 54 165 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1G3IQK1-F1-model_v4 Oxidoreductase 0.9782 21 164
AF-A0A139D8B0-F1-model_v4 Oxidoreductase 0.9735 77 167
AF-A0A645I1D3-F1-model_v4 Oxidoreductase probably involved in sulfite reduction 0.9734 79 167
AF-A0A244E1P5-F1-model_v4 deleted 0.9718 92 167
AF-A0A086WFX5-F1-model_v4 Oxidoreductase 0.9709 20 171

Map