F493045
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1327 | 492 | 2654 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300046522|Ga0495643_0069346|Ga0495643_0069346_602_1528 |
| Length | 308 |
| Sequence | VSSRSPAILRQEERKRFCLQPLIQQSSSYRVAFLPPGELAMPRLSALYRYPLKSGKGETLRQVTLDKLGLDGDRRWMLVDEVSGRFLTQRAVAQMSQLSALWNATGGLTLSAPGLSSIDVALPASDAQLRGVTIWRDTLRVPDAGDEAAAWVSEFIGKPTRLVQVPLDRARTTQAGYGNDDDQVAFADGFPLLLIGQASLEDLSKKVGRPLEMLRFRPNLVIDGSEAFAEDGWKRIRIGDVEFRVVKPCSRCILTTIDPQTGERSVDREPFATLQKYRSEADGAMFGQNLVNDSNGRLEVGMPVTILE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 31 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 32 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 33 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 34 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 35 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 36 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 37 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 46 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 53 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 88 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 92 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 94 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 95 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 96 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 97 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 98 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 100 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 101 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 102 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 105 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 106 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 107 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 108 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 109 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 110 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 111 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 112 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 113 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 114 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 115 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 116 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 117 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 118 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 119 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 120 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 121 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 122 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 123 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 124 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 125 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 126 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 127 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 128 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 129 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 130 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 131 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 132 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 133 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 134 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 135 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 136 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 137 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 138 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 139 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 140 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 141 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 142 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 143 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 144 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 145 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 146 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 147 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 148 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 149 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 150 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 252 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 253 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 254 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 258 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 259 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 260 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 261 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 262 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 263 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 264 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 265 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 266 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 267 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 268 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 269 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 270 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 271 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 272 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 273 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 274 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 275 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 276 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 277 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 278 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 279 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 280 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 281 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 282 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 283 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 284 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 285 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 286 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 287 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 288 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 289 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 290 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 291 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 292 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 293 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 294 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 295 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 296 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 297 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 298 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 299 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 300 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 301 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 302 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 303 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 304 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 305 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 306 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 307 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 308 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 309 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 310 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 311 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 312 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 313 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 314 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 315 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 316 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 317 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 318 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 319 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 320 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 321 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 322 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 323 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 324 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 325 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 326 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 327 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 328 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 329 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 330 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 331 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 332 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 333 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 334 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 335 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 336 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 337 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 338 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 339 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 340 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 341 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 342 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 343 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 344 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 345 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 346 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 347 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 348 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 349 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 350 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 351 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 352 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 353 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 354 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 355 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 356 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 357 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 358 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 359 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 360 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 361 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 362 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 363 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 364 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 365 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 366 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 367 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 368 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 369 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 370 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 371 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 372 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 373 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 374 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 375 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 376 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 377 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 378 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 379 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 380 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 381 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 382 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 383 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 384 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 385 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 386 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 387 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 388 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 389 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 390 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 391 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 392 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 393 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 394 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 395 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 396 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 397 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 398 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 399 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 400 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 401 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 402 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 403 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 404 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 405 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 406 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 407 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 408 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 409 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 410 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 411 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 412 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 413 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 414 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 415 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 416 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 417 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 418 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 419 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 420 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 421 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 422 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 423 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 424 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 425 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 426 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 427 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 428 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 429 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 430 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 431 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 432 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 433 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 434 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 435 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 436 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 437 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 438 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 439 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 440 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 441 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 442 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 443 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 444 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 445 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 446 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 447 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 448 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 449 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 450 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 451 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 452 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 453 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 454 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 455 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 456 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 457 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 458 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 459 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 460 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 461 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 462 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 463 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 464 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 465 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 466 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 467 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 468 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 469 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 470 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 471 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 472 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 473 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 474 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 475 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 476 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 477 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 478 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 479 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 480 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 481 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 482 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 483 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 484 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 485 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 486 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 487 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 488 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 489 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 490 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 491 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 492 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.59 |
| Metatranscriptomes | 0 |
| Isolates | 17.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.05 |
| Nodule | 2.03 |
| Rhizoplane | 5.43 |
| Rhizosphere | 77.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495643_0069346 | 3300046522 | Bacteria | 1853 |
| 2 | MRS2a_Contig_10550 | 2124908027 | Bacteria | 1022 |
| 3 | SwRhRL2b_contig_2353446 | 2162886007 | Bacteria | 7321 |
| 4 | LJQas_1001013 | 3300000549 | Unclassified | 4305 |
| 5 | JGI25162J39368_1000077 | 3300002737 | Bacteria | 120042 |
| 6 | JGI25162J39368_1000166 | 3300002737 | Bacteria | 72515 |
| 7 | JGI25163J39215_1000050 | 3300002771 | Bacteria | 53099 |
| 8 | JGI25163J39215_1000126 | 3300002771 | Bacteria | 31582 |
| 9 | JGI25164J39214_1000054 | 3300002772 | Bacteria | 120042 |
| 10 | JGI25164J39214_1000129 | 3300002772 | Bacteria | 72515 |
| 11 | JGI25165J46597_1000141 | 3300003214 | Bacteria | 120042 |
| 12 | JGI25165J46597_1000251 | 3300003214 | Bacteria | 72515 |
| 13 | Ga0055539_1000397 | 3300003752 | Bacteria | 17180 |
| 14 | Ga0055533_1000398 | 3300003756 | Bacteria | 17180 |
| 15 | Ga0055532_1000498 | 3300003758 | Bacteria | 17180 |
| 16 | Ga0055525_1000553 | 3300003759 | Bacteria | 17180 |
| 17 | Ga0055535_1005868 | 3300003761 | Bacteria | 2600 |
| 18 | Ga0055536_1000056 | 3300003781 | Bacteria | 107110 |
| 19 | Ga0055530_10000053 | 3300003791 | Bacteria | 102949 |
| 20 | Ga0055530_10000207 | 3300003791 | Bacteria | 53449 |
| 21 | Ga0055530_10000289 | 3300003791 | Bacteria | 45948 |
| 22 | Ga0055530_10013416 | 3300003791 | Bacteria | 2799 |
| 23 | Ga0055540_1000105 | 3300003792 | Bacteria | 93593 |
| 24 | Ga0055540_1000223 | 3300003792 | Bacteria | 53449 |
| 25 | Ga0055540_1000252 | 3300003792 | Bacteria | 48842 |
| 26 | Ga0055531_10000081 | 3300003794 | Bacteria | 103600 |
| 27 | Ga0055541_1000284 | 3300003841 | Bacteria | 17180 |
| 28 | Ga0065714_10000863 | 3300005288 | Bacteria | 2417 |
| 29 | Ga0065714_10002088 | 3300005288 | Bacteria | 2774 |
| 30 | Ga0065714_10002591 | 3300005288 | Bacteria | 24389 |
| 31 | Ga0065714_10011610 | 3300005288 | Bacteria | 2544 |
| 32 | Ga0065714_10064635 | 3300005288 | Bacteria | 26793 |
| 33 | Ga0065714_10066292 | 3300005288 | Bacteria | 7177 |
| 34 | Ga0065714_10124098 | 3300005288 | Bacteria | 1315 |
| 35 | Ga0065704_10009390 | 3300005289 | Bacteria | 3165 |
| 36 | Ga0065704_10070462 | 3300005289 | Bacteria | 23813 |
| 37 | Ga0065704_10072302 | 3300005289 | Bacteria | 8773 |
| 38 | Ga0065712_10003415 | 3300005290 | Bacteria | 7345 |
| 39 | Ga0065712_10070642 | 3300005290 | Bacteria | 5829 |
| 40 | Ga0070670_100000224 | 3300005331 | Bacteria | 52252 |
| 41 | Ga0070670_100005116 | 3300005331 | Bacteria | 11038 |
| 42 | Ga0070661_100000129 | 3300005344 | Bacteria | 63003 |
| 43 | Ga0070661_100140662 | 3300005344 | Bacteria | 1819 |
| 44 | Ga0070669_100039248 | 3300005353 | Bacteria | 3440 |
| 45 | Ga0070662_100000056 | 3300005457 | Bacteria | 60234 |
| 46 | Ga0070662_100295463 | 3300005457 | Bacteria | 1314 |
| 47 | Ga0068853_100008738 | 3300005539 | Bacteria | 8151 |
| 48 | Ga0070665_100023251 | 3300005548 | Bacteria | 6242 |
| 49 | Ga0070664_100000076 | 3300005564 | Bacteria | 62528 |
| 50 | Ga0068854_100019114 | 3300005578 | Bacteria | 4612 |
| 51 | Ga0068851_10000028 | 3300005834 | Bacteria | 117106 |
| 52 | Ga0075364_10069077 | 3300006051 | Bacteria | 2324 |
| 53 | Ga0075364_10174999 | 3300006051 | Bacteria | 1451 |
| 54 | Ga0075432_10001856 | 3300006058 | Bacteria | 6973 |
| 55 | Ga0075432_10003869 | 3300006058 | Bacteria | 5101 |
| 56 | Ga0075432_10025706 | 3300006058 | Bacteria | 2020 |
| 57 | Ga0075432_10025862 | 3300006058 | Bacteria | 2014 |
| 58 | Ga0075362_10041391 | 3300006177 | Bacteria | 2032 |
| 59 | Ga0075362_10081906 | 3300006177 | Bacteria | 1488 |
| 60 | Ga0075436_100040355 | 3300006914 | Bacteria | 3221 |
| 61 | Ga0075436_100091192 | 3300006914 | Bacteria | 2118 |
| 62 | Ga0079104_1000124 | 3300006946 | Bacteria | 110752 |
| 63 | Ga0079104_1000366 | 3300006946 | Bacteria | 53811 |
| 64 | Ga0079104_1003222 | 3300006946 | Bacteria | 7852 |
| 65 | Ga0099826_10082690 | 3300006948 | Bacteria | 1993 |
| 66 | Ga0105251_10000246 | 3300009011 | Bacteria | 54734 |
| 67 | Ga0105251_10000346 | 3300009011 | Bacteria | 46116 |
| 68 | Ga0105251_10003362 | 3300009011 | Bacteria | 11646 |
| 69 | Ga0105251_10010591 | 3300009011 | Bacteria | 5334 |
| 70 | Ga0105251_10025786 | 3300009011 | Bacteria | 3001 |
| 71 | Ga0105251_10037773 | 3300009011 | Bacteria | 2367 |
| 72 | Ga0105251_10052759 | 3300009011 | Bacteria | 1935 |
| 73 | Ga0105251_10076807 | 3300009011 | Bacteria | 1549 |
| 74 | Ga0105251_10104524 | 3300009011 | Bacteria | 1293 |
| 75 | Ga0105251_10127848 | 3300009011 | Bacteria | 1153 |
| 76 | Ga0105251_10152509 | 3300009011 | Bacteria | 1043 |
| 77 | Ga0105244_10000322 | 3300009036 | Bacteria | 45812 |
| 78 | Ga0105244_10003784 | 3300009036 | Bacteria | 10676 |
| 79 | Ga0105244_10004417 | 3300009036 | Bacteria | 9687 |
| 80 | Ga0105244_10016269 | 3300009036 | Bacteria | 4241 |
| 81 | Ga0105244_10021702 | 3300009036 | Bacteria | 3546 |
| 82 | Ga0105244_10062642 | 3300009036 | Bacteria | 1869 |
| 83 | Ga0105244_10096463 | 3300009036 | Bacteria | 1450 |
| 84 | Ga0105244_10151973 | 3300009036 | Bacteria | 1109 |
| 85 | Ga0105244_10197055 | 3300009036 | Bacteria | 950 |
| 86 | Ga0105250_10000121 | 3300009092 | Bacteria | 68364 |
| 87 | Ga0105250_10000197 | 3300009092 | Bacteria | 51321 |
| 88 | Ga0105250_10003418 | 3300009092 | Bacteria | 7526 |
| 89 | Ga0105250_10005272 | 3300009092 | Bacteria | 5808 |
| 90 | Ga0105250_10039373 | 3300009092 | Bacteria | 1896 |
| 91 | Ga0105250_10047819 | 3300009092 | Bacteria | 1715 |
| 92 | Ga0105250_10091899 | 3300009092 | Bacteria | 1235 |
| 93 | Ga0105243_10000103 | 3300009148 | Bacteria | 97091 |
| 94 | Ga0105243_10000125 | 3300009148 | Bacteria | 86522 |
| 95 | Ga0105242_10000262 | 3300009176 | Bacteria | 41798 |
| 96 | Ga0105242_10266840 | 3300009176 | Bacteria | 1549 |
| 97 | Ga0105237_10004232 | 3300009545 | Bacteria | 16714 |
| 98 | Ga0105249_10156208 | 3300009553 | Bacteria | 2200 |
| 99 | Ga0105246_10000465 | 3300011119 | Bacteria | 21797 |
| 100 | Ga0105246_10044709 | 3300011119 | Bacteria | 3011 |
| 101 | Ga0157345_1000026 | 3300012498 | Bacteria | 37334 |
| 102 | Ga0157345_1003343 | 3300012498 | Bacteria | 1168 |
| 103 | Ga0157373_10008441 | 3300013100 | Bacteria | 7649 |
| 104 | Ga0157373_10011262 | 3300013100 | Bacteria | 6579 |
| 105 | Ga0157373_10011363 | 3300013100 | Bacteria | 6548 |
| 106 | Ga0157373_10012383 | 3300013100 | Bacteria | 6271 |
| 107 | Ga0157373_10094238 | 3300013100 | Bacteria | 2108 |
| 108 | Ga0157373_10148716 | 3300013100 | Bacteria | 1648 |
| 109 | Ga0157373_10148798 | 3300013100 | Bacteria | 1647 |
| 110 | Ga0157371_10000306 | 3300013102 | Bacteria | 64149 |
| 111 | Ga0157371_10000390 | 3300013102 | Bacteria | 55089 |
| 112 | Ga0157371_10194875 | 3300013102 | Bacteria | 1451 |
| 113 | Ga0157370_10033160 | 3300013104 | Bacteria | 5035 |
| 114 | Ga0157370_10083572 | 3300013104 | Bacteria | 3001 |
| 115 | Ga0157370_10113868 | 3300013104 | Bacteria | 2527 |
| 116 | Ga0157370_10183728 | 3300013104 | Bacteria | 1942 |
| 117 | Ga0157370_10275306 | 3300013104 | Bacteria | 1555 |
| 118 | Ga0157370_10384450 | 3300013104 | Bacteria | 1293 |
| 119 | Ga0157369_10001322 | 3300013105 | Bacteria | 30719 |
| 120 | Ga0157369_10003284 | 3300013105 | Bacteria | 19261 |
| 121 | Ga0157369_10009106 | 3300013105 | Bacteria | 11359 |
| 122 | Ga0157369_10017341 | 3300013105 | Bacteria | 8095 |
| 123 | Ga0157369_10044243 | 3300013105 | Bacteria | 4848 |
| 124 | Ga0157369_10053910 | 3300013105 | Bacteria | 4343 |
| 125 | Ga0157369_10409271 | 3300013105 | Bacteria | 1407 |
| 126 | Ga0163162_10166529 | 3300013306 | Bacteria | 2328 |
| 127 | Ga0163162_10851791 | 3300013306 | Bacteria | 1027 |
| 128 | Ga0157375_10014302 | 3300013308 | Bacteria | 7074 |
| 129 | Ga0157375_10019095 | 3300013308 | Bacteria | 6226 |
| 130 | Ga0157375_10378876 | 3300013308 | Bacteria | 1581 |
| 131 | Ga0157375_10600020 | 3300013308 | Bacteria | 1260 |
| 132 | Ga0182008_10000074 | 3300014497 | Bacteria | 78116 |
| 133 | Ga0182008_10002714 | 3300014497 | Bacteria | 10986 |
| 134 | Ga0182008_10006416 | 3300014497 | Bacteria | 6577 |
| 135 | Ga0182008_10008564 | 3300014497 | Bacteria | 5580 |
| 136 | Ga0182008_10010739 | 3300014497 | Bacteria | 4893 |
| 137 | Ga0182008_10033126 | 3300014497 | Bacteria | 2594 |
| 138 | Ga0182008_10055865 | 3300014497 | Bacteria | 1952 |
| 139 | Ga0182008_10100509 | 3300014497 | Bacteria | 1429 |
| 140 | Ga0182008_10106489 | 3300014497 | Bacteria | 1388 |
| 141 | Ga0182006_1000183 | 3300015261 | Bacteria | 65112 |
| 142 | Ga0182006_1000326 | 3300015261 | Bacteria | 41249 |
| 143 | Ga0182006_1016610 | 3300015261 | Bacteria | 3137 |
| 144 | Ga0182006_1021201 | 3300015261 | Bacteria | 2712 |
| 145 | Ga0182006_1034989 | 3300015261 | Bacteria | 2006 |
| 146 | Ga0182007_10000903 | 3300015262 | Bacteria | 16420 |
| 147 | Ga0182007_10028972 | 3300015262 | Bacteria | 1898 |
| 148 | Ga0182007_10036317 | 3300015262 | Bacteria | 1658 |
| 149 | Ga0182005_1006086 | 3300015265 | Bacteria | 3719 |
| 150 | Ga0182005_1013483 | 3300015265 | Bacteria | 2298 |
| 151 | Ga0182005_1016499 | 3300015265 | Bacteria | 2053 |
| 152 | Ga0182005_1047809 | 3300015265 | Bacteria | 1163 |
| 153 | Ga0163161_10000156 | 3300017792 | Bacteria | 63154 |
| 154 | Ga0163161_10001710 | 3300017792 | Bacteria | 16106 |
| 155 | Ga0163161_10005911 | 3300017792 | Bacteria | 8484 |
| 156 | Ga0163161_10007848 | 3300017792 | Bacteria | 7380 |
| 157 | Ga0163161_10018572 | 3300017792 | Bacteria | 4872 |
| 158 | Ga0163161_10057889 | 3300017792 | Bacteria | 2816 |
| 159 | Ga0163161_10103105 | 3300017792 | Bacteria | 2125 |
| 160 | Ga0163161_10204507 | 3300017792 | Bacteria | 1523 |
| 161 | Ga0163161_10207815 | 3300017792 | Bacteria | 1511 |
| 162 | Ga0163161_10221681 | 3300017792 | Bacteria | 1465 |
| 163 | Ga0163161_10310071 | 3300017792 | Bacteria | 1245 |
| 164 | Ga0209760_100043 | 3300025207 | Bacteria | 113964 |
| 165 | Ga0209760_100054 | 3300025207 | Bacteria | 102021 |
| 166 | Ga0209784_100017 | 3300025224 | Bacteria | 472003 |
| 167 | Ga0209566_100014 | 3300025225 | Bacteria | 472003 |
| 168 | Ga0209674_100028 | 3300025226 | Bacteria | 472003 |
| 169 | Ga0209147_100038 | 3300025229 | Bacteria | 314497 |
| 170 | Ga0209563_100032 | 3300025230 | Bacteria | 472003 |
| 171 | Ga0209563_100539 | 3300025230 | Bacteria | 12723 |
| 172 | Ga0207427_100047 | 3300025231 | Bacteria | 240409 |
| 173 | Ga0207427_100074 | 3300025231 | Bacteria | 153455 |
| 174 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 175 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 176 | Ga0209437_102308 | 3300025233 | Bacteria | 3744 |
| 177 | Ga0209258_100828 | 3300025242 | Bacteria | 17186 |
| 178 | Ga0209646_1000171 | 3300025246 | Bacteria | 84951 |
| 179 | Ga0209677_100018 | 3300025253 | Bacteria | 472003 |
| 180 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 181 | Ga0209233_1000105 | 3300025261 | Bacteria | 272035 |
| 182 | Ga0209675_1008919 | 3300025291 | Bacteria | 3605 |
| 183 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 184 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 185 | Ga0209676_1000223 | 3300025292 | Bacteria | 124359 |
| 186 | Ga0209676_1000726 | 3300025292 | Bacteria | 45390 |
| 187 | Ga0209676_1005261 | 3300025292 | Bacteria | 6841 |
| 188 | Ga0209676_1005993 | 3300025292 | Bacteria | 6140 |
| 189 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 190 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 191 | Ga0209050_1000214 | 3300025298 | Bacteria | 129270 |
| 192 | Ga0209050_1000363 | 3300025298 | Bacteria | 86923 |
| 193 | Ga0209051_1000008 | 3300025303 | Bacteria | 706935 |
| 194 | Ga0209051_1000171 | 3300025303 | Bacteria | 118013 |
| 195 | Ga0209051_1000185 | 3300025303 | Bacteria | 110195 |
| 196 | Ga0209051_1003321 | 3300025303 | Bacteria | 10641 |
| 197 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 198 | Ga0209257_1005621 | 3300025304 | Bacteria | 8681 |
| 199 | Ga0207656_10000056 | 3300025321 | Bacteria | 44124 |
| 200 | Ga0207696_1000043 | 3300025711 | Bacteria | 307112 |
| 201 | Ga0207696_1000117 | 3300025711 | Bacteria | 148004 |
| 202 | Ga0207696_1000193 | 3300025711 | Bacteria | 94161 |
| 203 | Ga0207696_1000236 | 3300025711 | Bacteria | 76805 |
| 204 | Ga0207696_1001821 | 3300025711 | Bacteria | 10979 |
| 205 | Ga0207696_1001827 | 3300025711 | Bacteria | 10958 |
| 206 | Ga0207696_1003801 | 3300025711 | Bacteria | 6723 |
| 207 | Ga0207696_1023291 | 3300025711 | Bacteria | 1955 |
| 208 | Ga0207696_1039886 | 3300025711 | Bacteria | 1378 |
| 209 | Ga0207696_1052748 | 3300025711 | Bacteria | 1159 |
| 210 | Ga0207655_1000095 | 3300025728 | Bacteria | 195899 |
| 211 | Ga0207655_1000505 | 3300025728 | Bacteria | 49919 |
| 212 | Ga0207655_1000653 | 3300025728 | Bacteria | 41243 |
| 213 | Ga0207655_1003157 | 3300025728 | Bacteria | 12451 |
| 214 | Ga0207655_1004980 | 3300025728 | Bacteria | 9199 |
| 215 | Ga0207655_1015627 | 3300025728 | Bacteria | 4206 |
| 216 | Ga0207655_1030241 | 3300025728 | Bacteria | 2522 |
| 217 | Ga0207655_1037393 | 3300025728 | Bacteria | 2138 |
| 218 | Ga0207655_1061214 | 3300025728 | Bacteria | 1455 |
| 219 | Ga0207655_1088631 | 3300025728 | Bacteria | 1095 |
| 220 | Ga0207713_1000160 | 3300025735 | Bacteria | 100682 |
| 221 | Ga0207713_1000236 | 3300025735 | Bacteria | 73781 |
| 222 | Ga0207713_1000386 | 3300025735 | Bacteria | 47877 |
| 223 | Ga0207713_1000431 | 3300025735 | Bacteria | 44260 |
| 224 | Ga0207713_1001314 | 3300025735 | Bacteria | 20391 |
| 225 | Ga0207713_1001388 | 3300025735 | Bacteria | 19635 |
| 226 | Ga0207713_1002492 | 3300025735 | Bacteria | 13378 |
| 227 | Ga0207713_1003319 | 3300025735 | Bacteria | 11056 |
| 228 | Ga0207713_1022906 | 3300025735 | Bacteria | 2954 |
| 229 | Ga0207713_1066067 | 3300025735 | Bacteria | 1355 |
| 230 | Ga0207713_1067619 | 3300025735 | Bacteria | 1332 |
| 231 | Ga0207713_1074670 | 3300025735 | Bacteria | 1240 |
| 232 | Ga0207649_10000017 | 3300025920 | Bacteria | 225193 |
| 233 | Ga0207681_10127324 | 3300025923 | Bacteria | 1877 |
| 234 | Ga0207650_10000220 | 3300025925 | Bacteria | 64837 |
| 235 | Ga0207650_10000291 | 3300025925 | Bacteria | 50791 |
| 236 | Ga0207706_10000445 | 3300025933 | Bacteria | 44135 |
| 237 | Ga0207706_10054271 | 3300025933 | Bacteria | 3537 |
| 238 | Ga0207686_10164611 | 3300025934 | Bacteria | 1558 |
| 239 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 240 | Ga0207709_10000282 | 3300025935 | Bacteria | 58269 |
| 241 | Ga0207709_10254821 | 3300025935 | Bacteria | 1284 |
| 242 | Ga0207709_10312264 | 3300025935 | Bacteria | 1173 |
| 243 | Ga0207679_10000005 | 3300025945 | Bacteria | 525011 |
| 244 | Ga0207640_10093340 | 3300025981 | Bacteria | 2090 |
| 245 | Ga0207639_10006034 | 3300026041 | Bacteria | 8217 |
| 246 | Ga0209281_1000018 | 3300027111 | Bacteria | 579091 |
| 247 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 248 | Ga0209281_1005173 | 3300027111 | Bacteria | 3685 |
| 249 | Ga0209281_1006559 | 3300027111 | Bacteria | 3025 |
| 250 | Ga0209371_1000476 | 3300027312 | Bacteria | 39253 |
| 251 | Ga0209371_1000567 | 3300027312 | Bacteria | 33537 |
| 252 | Ga0207428_10026351 | 3300027907 | Bacteria | 4853 |
| 253 | Ga0207428_10104360 | 3300027907 | Bacteria | 2188 |
| 254 | Ga0207428_10108634 | 3300027907 | Bacteria | 2137 |
| 255 | Ga0207428_10126765 | 3300027907 | Bacteria | 1955 |
| 256 | Ga0268266_10288249 | 3300028379 | Bacteria | 1528 |
| 257 | Ga0307517_10037404 | 3300028786 | Bacteria | 5421 |
| 258 | Ga0268256_1000495 | 3300030500 | Bacteria | 33537 |
| 259 | Ga0307511_10111167 | 3300030521 | Bacteria | 1743 |
| 260 | Ga0307511_10178920 | 3300030521 | Bacteria | 1147 |
| 261 | Ga0314311_1023959 | 3300030733 | Bacteria | 2674 |
| 262 | Ga0316178_1101239 | 3300030735 | Bacteria | 23092 |
| 263 | Ga0307408_100000027 | 3300031548 | Bacteria | 261506 |
| 264 | Ga0307408_100000568 | 3300031548 | Bacteria | 31802 |
| 265 | Ga0307408_100002079 | 3300031548 | Bacteria | 14417 |
| 266 | Ga0307408_100004691 | 3300031548 | Bacteria | 9233 |
| 267 | Ga0307408_100091565 | 3300031548 | Bacteria | 2296 |
| 268 | Ga0307516_10326683 | 3300031730 | Bacteria | 1204 |
| 269 | Ga0307405_10000098 | 3300031731 | Bacteria | 36592 |
| 270 | Ga0307405_10000715 | 3300031731 | Bacteria | 12895 |
| 271 | Ga0307405_10014867 | 3300031731 | Bacteria | 4199 |
| 272 | Ga0307405_10018333 | 3300031731 | Bacteria | 3858 |
| 273 | Ga0307413_10003256 | 3300031824 | Bacteria | 6803 |
| 274 | Ga0307406_10104231 | 3300031901 | Bacteria | 1938 |
| 275 | Ga0307407_10010845 | 3300031903 | Bacteria | 4314 |
| 276 | Ga0307407_10036968 | 3300031903 | Bacteria | 2694 |
| 277 | Ga0307412_10000455 | 3300031911 | Bacteria | 24651 |
| 278 | Ga0307412_10001586 | 3300031911 | Bacteria | 12520 |
| 279 | Ga0307412_10002587 | 3300031911 | Bacteria | 10054 |
| 280 | Ga0307412_10316620 | 3300031911 | Bacteria | 1239 |
| 281 | Ga0307409_100009914 | 3300031995 | Bacteria | 5883 |
| 282 | Ga0307409_100420445 | 3300031995 | Bacteria | 1282 |
| 283 | Ga0307414_10001581 | 3300032004 | Bacteria | 11819 |
| 284 | Ga0307414_10071579 | 3300032004 | Bacteria | 2501 |
| 285 | Ga0307414_10150116 | 3300032004 | Bacteria | 1837 |
| 286 | Ga0307414_10150125 | 3300032004 | Bacteria | 1837 |
| 287 | Ga0307411_10008396 | 3300032005 | Bacteria | 5346 |
| 288 | Ga0307510_10036596 | 3300033180 | Bacteria | 5461 |
| 289 | Ga0439438_000117 | 3300041405 | Bacteria | 36333 |
| 290 | Ga0439438_000138 | 3300041405 | Bacteria | 33094 |
| 291 | Ga0439438_000692 | 3300041405 | Bacteria | 15116 |
| 292 | Ga0439438_001443 | 3300041405 | Bacteria | 10468 |
| 293 | Ga0439438_002094 | 3300041405 | Bacteria | 8620 |
| 294 | Ga0439438_004545 | 3300041405 | Bacteria | 5289 |
| 295 | Ga0439438_005070 | 3300041405 | Bacteria | 4911 |
| 296 | Ga0439438_007763 | 3300041405 | Bacteria | 3629 |
| 297 | Ga0439438_034960 | 3300041405 | Bacteria | 1321 |
| 298 | Ga0439447_000258 | 3300041407 | Bacteria | 18640 |
| 299 | Ga0439447_000342 | 3300041407 | Bacteria | 16803 |
| 300 | Ga0439447_001057 | 3300041407 | Bacteria | 10001 |
| 301 | Ga0439447_003181 | 3300041407 | Bacteria | 5846 |
| 302 | Ga0439447_010153 | 3300041407 | Bacteria | 2807 |
| 303 | Ga0439447_012208 | 3300041407 | Bacteria | 2476 |
| 304 | Ga0439447_034074 | 3300041407 | Bacteria | 1267 |
| 305 | Ga0439447_041606 | 3300041407 | Bacteria | 1118 |
| 306 | Ga0439447_050687 | 3300041407 | Bacteria | 991 |
| 307 | Ga0439466_0001610 | 3300041411 | Bacteria | 8806 |
| 308 | Ga0439466_0004106 | 3300041411 | Bacteria | 5622 |
| 309 | Ga0439466_0004348 | 3300041411 | Bacteria | 5465 |
| 310 | Ga0439466_0010175 | 3300041411 | Bacteria | 3498 |
| 311 | Ga0439466_0010758 | 3300041411 | Bacteria | 3396 |
| 312 | Ga0439466_0011397 | 3300041411 | Bacteria | 3288 |
| 313 | Ga0439466_0011933 | 3300041411 | Bacteria | 3209 |
| 314 | Ga0439466_0034528 | 3300041411 | Bacteria | 1714 |
| 315 | Ga0439466_0038887 | 3300041411 | Bacteria | 1596 |
| 316 | Ga0439465_0007875 | 3300041413 | Bacteria | 3376 |
| 317 | Ga0439465_0052045 | 3300041413 | Bacteria | 1343 |
| 318 | Ga0439431_0002171 | 3300041997 | Bacteria | 4321 |
| 319 | Ga0439437_000067 | 3300042000 | Bacteria | 7018 |
| 320 | Ga0439442_026666 | 3300042002 | Bacteria | 1203 |
| 321 | Ga0439445_0065490 | 3300042004 | Bacteria | 999 |
| 322 | Ga0439432_000381 | 3300042006 | Bacteria | 16378 |
| 323 | Ga0439432_000984 | 3300042006 | Bacteria | 10771 |
| 324 | Ga0439432_001089 | 3300042006 | Bacteria | 10321 |
| 325 | Ga0439432_002856 | 3300042006 | Bacteria | 6438 |
| 326 | Ga0439451_001699 | 3300042009 | Bacteria | 4383 |
| 327 | Ga0439451_013712 | 3300042009 | Bacteria | 1637 |
| 328 | Ga0439451_025234 | 3300042009 | Bacteria | 1197 |
| 329 | Ga0439451_025658 | 3300042009 | Bacteria | 1187 |
| 330 | Ga0439452_000091 | 3300042010 | Bacteria | 78007 |
| 331 | Ga0439452_000164 | 3300042010 | Bacteria | 49561 |
| 332 | Ga0439452_000322 | 3300042010 | Bacteria | 30011 |
| 333 | Ga0439452_000524 | 3300042010 | Bacteria | 20546 |
| 334 | Ga0439452_003633 | 3300042010 | Bacteria | 5356 |
| 335 | Ga0439452_006049 | 3300042010 | Bacteria | 3827 |
| 336 | Ga0439452_014757 | 3300042010 | Bacteria | 2160 |
| 337 | Ga0439452_016910 | 3300042010 | Bacteria | 1973 |
| 338 | Ga0439452_041546 | 3300042010 | Bacteria | 1081 |
| 339 | Ga0439456_000045 | 3300042013 | Bacteria | 44106 |
| 340 | Ga0439456_002373 | 3300042013 | Bacteria | 3797 |
| 341 | Ga0439456_003419 | 3300042013 | Bacteria | 3216 |
| 342 | Ga0439456_005531 | 3300042013 | Bacteria | 2565 |
| 343 | Ga0439456_010849 | 3300042013 | Bacteria | 1883 |
| 344 | Ga0439456_011271 | 3300042013 | Bacteria | 1848 |
| 345 | Ga0439456_018992 | 3300042013 | Bacteria | 1444 |
| 346 | Ga0439463_003000 | 3300042016 | Bacteria | 4281 |
| 347 | Ga0439463_003640 | 3300042016 | Bacteria | 3885 |
| 348 | Ga0439463_003941 | 3300042016 | Bacteria | 3736 |
| 349 | Ga0450911_000007 | 3300042115 | Bacteria | 212322 |
| 350 | Ga0450911_000025 | 3300042115 | Bacteria | 83941 |
| 351 | Ga0450911_000285 | 3300042115 | Bacteria | 18702 |
| 352 | Ga0450911_000819 | 3300042115 | Bacteria | 8559 |
| 353 | Ga0450911_005841 | 3300042115 | Bacteria | 1876 |
| 354 | Ga0450911_008028 | 3300042115 | Bacteria | 1515 |
| 355 | Ga0450919_000324 | 3300042121 | Bacteria | 5715 |
| 356 | Ga0450920_000330 | 3300042122 | Bacteria | 7220 |
| 357 | Ga0450922_000316 | 3300042124 | Bacteria | 5098 |
| 358 | Ga0450922_002973 | 3300042124 | Bacteria | 1566 |
| 359 | Ga0450922_004111 | 3300042124 | Bacteria | 1337 |
| 360 | Ga0450888_007247 | 3300042126 | Bacteria | 1222 |
| 361 | Ga0450890_000333 | 3300042127 | Bacteria | 6860 |
| 362 | Ga0450891_004238 | 3300042129 | Bacteria | 1348 |
| 363 | Ga0450900_000440 | 3300042136 | Bacteria | 3247 |
| 364 | Ga0450902_002650 | 3300042137 | Bacteria | 2546 |
| 365 | Ga0450902_003440 | 3300042137 | Bacteria | 2308 |
| 366 | Ga0450902_004563 | 3300042137 | Bacteria | 2065 |
| 367 | Ga0450902_029637 | 3300042137 | Bacteria | 919 |
| 368 | Ga0450903_000963 | 3300042138 | Bacteria | 5530 |
| 369 | Ga0450903_005649 | 3300042138 | Bacteria | 2089 |
| 370 | Ga0450903_005708 | 3300042138 | Bacteria | 2080 |
| 371 | Ga0450903_007957 | 3300042138 | Bacteria | 1737 |
| 372 | Ga0450903_021959 | 3300042138 | Bacteria | 985 |
| 373 | Ga0450904_000540 | 3300042139 | Bacteria | 7178 |
| 374 | Ga0450904_000696 | 3300042139 | Bacteria | 5961 |
| 375 | Ga0450904_002256 | 3300042139 | Bacteria | 2345 |
| 376 | Ga0450905_010401 | 3300042142 | Bacteria | 1288 |
| 377 | Ga0450905_014524 | 3300042142 | Bacteria | 1123 |
| 378 | Ga0450906_001348 | 3300042145 | Bacteria | 5391 |
| 379 | Ga0450906_007455 | 3300042145 | Bacteria | 2160 |
| 380 | Ga0450907_000038 | 3300042146 | Bacteria | 57421 |
| 381 | Ga0450907_000289 | 3300042146 | Bacteria | 16974 |
| 382 | Ga0450907_003900 | 3300042146 | Bacteria | 2604 |
| 383 | Ga0450907_011841 | 3300042146 | Bacteria | 1449 |
| 384 | Ga0450907_029680 | 3300042146 | Bacteria | 929 |
| 385 | Ga0450910_000632 | 3300042147 | Bacteria | 4188 |
| 386 | Ga0450910_000871 | 3300042147 | Bacteria | 3644 |
| 387 | Ga0450910_004054 | 3300042147 | Bacteria | 1968 |
| 388 | Ga0439446_0001125 | 3300042156 | Bacteria | 5924 |
| 389 | Ga0439446_0001583 | 3300042156 | Bacteria | 5230 |
| 390 | Ga0450908_002497 | 3300042184 | Bacteria | 3599 |
| 391 | Ga0450908_005166 | 3300042184 | Bacteria | 2502 |
| 392 | Ga0450909_000109 | 3300042185 | Bacteria | 8188 |
| 393 | Ga0450909_000608 | 3300042185 | Bacteria | 4723 |
| 394 | Ga0450909_005115 | 3300042185 | Bacteria | 1885 |
| 395 | Ga0439434_0001885 | 3300042435 | Bacteria | 6100 |
| 396 | Ga0439434_0003647 | 3300042435 | Bacteria | 4505 |
| 397 | Ga0439459_0025402 | 3300042438 | Bacteria | 1169 |
| 398 | Ga0439464_0006072 | 3300042439 | Bacteria | 3140 |
| 399 | Ga0439464_0009275 | 3300042439 | Bacteria | 2588 |
| 400 | Ga0439464_0080873 | 3300042439 | Bacteria | 970 |
| 401 | Ga0439460_0000015 | 3300042461 | Bacteria | 25118 |
| 402 | Ga0439460_0000042 | 3300042461 | Bacteria | 18550 |
| 403 | Ga0439460_0006105 | 3300042461 | Bacteria | 2976 |
| 404 | Ga0450916_005370 | 3300042530 | Bacteria | 1479 |
| 405 | Ga0450918_001890 | 3300042531 | Bacteria | 4051 |
| 406 | Ga0450893_0001157 | 3300042532 | Bacteria | 3974 |
| 407 | Ga0450893_0009815 | 3300042532 | Bacteria | 1566 |
| 408 | Ga0450901_000820 | 3300042533 | Bacteria | 3644 |
| 409 | Ga0439440_0000863 | 3300042993 | Bacteria | 5293 |
| 410 | Ga0439440_0014781 | 3300042993 | Bacteria | 1689 |
| 411 | Ga0439440_0023122 | 3300042993 | Bacteria | 1414 |
| 412 | Ga0466969_0031529 | 3300044656 | Bacteria | 2697 |
| 413 | Ga0466966_0037958 | 3300044684 | Bacteria | 3104 |
| 414 | Ga0466961_0049036 | 3300044693 | Bacteria | 2699 |
| 415 | Ga0466971_0001483 | 3300044719 | Bacteria | 9907 |
| 416 | Ga0466959_0077728 | 3300045049 | Bacteria | 2394 |
| 417 | Ga0495617_000212 | 3300046452 | Bacteria | 35622 |
| 418 | Ga0495617_003552 | 3300046452 | Bacteria | 5834 |
| 419 | Ga0495617_005182 | 3300046452 | Bacteria | 4652 |
| 420 | Ga0495617_011057 | 3300046452 | Bacteria | 3084 |
| 421 | Ga0495617_017722 | 3300046452 | Bacteria | 2406 |
| 422 | Ga0495617_019279 | 3300046452 | Bacteria | 2306 |
| 423 | Ga0495617_040861 | 3300046452 | Bacteria | 1550 |
| 424 | Ga0495617_041749 | 3300046452 | Bacteria | 1532 |
| 425 | Ga0495617_042418 | 3300046452 | Bacteria | 1521 |
| 426 | Ga0495617_057152 | 3300046452 | Bacteria | 1293 |
| 427 | Ga0495617_069281 | 3300046452 | Bacteria | 1160 |
| 428 | Ga0495617_069838 | 3300046452 | Bacteria | 1155 |
| 429 | Ga0495617_080049 | 3300046452 | Bacteria | 1070 |
| 430 | Ga0495627_000447 | 3300046453 | Bacteria | 35930 |
| 431 | Ga0495627_000546 | 3300046453 | Bacteria | 31074 |
| 432 | Ga0495627_001568 | 3300046453 | Bacteria | 12972 |
| 433 | Ga0495627_026877 | 3300046453 | Bacteria | 1851 |
| 434 | Ga0495627_039052 | 3300046453 | Bacteria | 1465 |
| 435 | Ga0495627_046736 | 3300046453 | Bacteria | 1314 |
| 436 | Ga0495627_048293 | 3300046453 | Bacteria | 1288 |
| 437 | Ga0495592_0019163 | 3300046454 | Bacteria | 5206 |
| 438 | Ga0495603_0011766 | 3300046455 | Bacteria | 5295 |
| 439 | Ga0495603_0017975 | 3300046455 | Bacteria | 4279 |
| 440 | Ga0495603_0111421 | 3300046455 | Bacteria | 1596 |
| 441 | Ga0495603_0179170 | 3300046455 | Bacteria | 1226 |
| 442 | Ga0495590_0000265 | 3300046457 | Bacteria | 28527 |
| 443 | Ga0495590_0002283 | 3300046457 | Bacteria | 7999 |
| 444 | Ga0495590_0004346 | 3300046457 | Bacteria | 5729 |
| 445 | Ga0495590_0014126 | 3300046457 | Bacteria | 2921 |
| 446 | Ga0495590_0022580 | 3300046457 | Bacteria | 2225 |
| 447 | Ga0495590_0032562 | 3300046457 | Bacteria | 1823 |
| 448 | Ga0495590_0059716 | 3300046457 | Bacteria | 1334 |
| 449 | Ga0495590_0068450 | 3300046457 | Bacteria | 1244 |
| 450 | Ga0495591_000107 | 3300046458 | Bacteria | 95742 |
| 451 | Ga0495591_000114 | 3300046458 | Bacteria | 93304 |
| 452 | Ga0495591_000510 | 3300046458 | Bacteria | 30508 |
| 453 | Ga0495591_000564 | 3300046458 | Bacteria | 28477 |
| 454 | Ga0495591_001758 | 3300046458 | Bacteria | 12882 |
| 455 | Ga0495591_006046 | 3300046458 | Bacteria | 5450 |
| 456 | Ga0495591_008531 | 3300046458 | Bacteria | 4189 |
| 457 | Ga0495591_017387 | 3300046458 | Bacteria | 2470 |
| 458 | Ga0495591_026348 | 3300046458 | Bacteria | 1808 |
| 459 | Ga0495591_027187 | 3300046458 | Bacteria | 1767 |
| 460 | Ga0495591_034355 | 3300046458 | Bacteria | 1493 |
| 461 | Ga0495591_038509 | 3300046458 | Bacteria | 1375 |
| 462 | Ga0495591_042044 | 3300046458 | Bacteria | 1294 |
| 463 | Ga0495591_042807 | 3300046458 | Bacteria | 1278 |
| 464 | Ga0495591_043354 | 3300046458 | Bacteria | 1266 |
| 465 | Ga0495629_0028182 | 3300046459 | Bacteria | 3987 |
| 466 | Ga0495629_0358340 | 3300046459 | Bacteria | 994 |
| 467 | Ga0495638_0002379 | 3300046460 | Bacteria | 15411 |
| 468 | Ga0495638_0005160 | 3300046460 | Bacteria | 9765 |
| 469 | Ga0495638_0007927 | 3300046460 | Bacteria | 7575 |
| 470 | Ga0495638_0013146 | 3300046460 | Bacteria | 5649 |
| 471 | Ga0495638_0022609 | 3300046460 | Bacteria | 4126 |
| 472 | Ga0495638_0024227 | 3300046460 | Bacteria | 3960 |
| 473 | Ga0495638_0026757 | 3300046460 | Bacteria | 3737 |
| 474 | Ga0495638_0050191 | 3300046460 | Bacteria | 2606 |
| 475 | Ga0495638_0086245 | 3300046460 | Bacteria | 1897 |
| 476 | Ga0495638_0095658 | 3300046460 | Bacteria | 1783 |
| 477 | Ga0495638_0098502 | 3300046460 | Bacteria | 1751 |
| 478 | Ga0495638_0180063 | 3300046460 | Bacteria | 1206 |
| 479 | Ga0495638_0230563 | 3300046460 | Bacteria | 1030 |
| 480 | Ga0495653_0001538 | 3300046463 | Bacteria | 18033 |
| 481 | Ga0495653_0002108 | 3300046463 | Bacteria | 15682 |
| 482 | Ga0495653_0017431 | 3300046463 | Bacteria | 5841 |
| 483 | Ga0495653_0054646 | 3300046463 | Bacteria | 3050 |
| 484 | Ga0495653_0138609 | 3300046463 | Bacteria | 1713 |
| 485 | Ga0495650_0003005 | 3300046471 | Bacteria | 12748 |
| 486 | Ga0495650_0003809 | 3300046471 | Bacteria | 10735 |
| 487 | Ga0495650_0009106 | 3300046471 | Bacteria | 5691 |
| 488 | Ga0495650_0010804 | 3300046471 | Bacteria | 5064 |
| 489 | Ga0495650_0013393 | 3300046471 | Bacteria | 4338 |
| 490 | Ga0495650_0028350 | 3300046471 | Bacteria | 2572 |
| 491 | Ga0495650_0035896 | 3300046471 | Bacteria | 2176 |
| 492 | Ga0495650_0056508 | 3300046471 | Bacteria | 1592 |
| 493 | Ga0495580_0329938 | 3300046472 | Bacteria | 1036 |
| 494 | Ga0495582_0001299 | 3300046473 | Bacteria | 14039 |
| 495 | Ga0495605_0000527 | 3300046474 | Bacteria | 32320 |
| 496 | Ga0495605_0001722 | 3300046474 | Bacteria | 14020 |
| 497 | Ga0495605_0003443 | 3300046474 | Bacteria | 9408 |
| 498 | Ga0495605_0006505 | 3300046474 | Bacteria | 6709 |
| 499 | Ga0495605_0007072 | 3300046474 | Bacteria | 6395 |
| 500 | Ga0495605_0008406 | 3300046474 | Bacteria | 5836 |
| 501 | Ga0495605_0014756 | 3300046474 | Bacteria | 4266 |
| 502 | Ga0495605_0015319 | 3300046474 | Bacteria | 4174 |
| 503 | Ga0495605_0074079 | 3300046474 | Bacteria | 1603 |
| 504 | Ga0495605_0083761 | 3300046474 | Bacteria | 1488 |
| 505 | Ga0495605_0112119 | 3300046474 | Bacteria | 1243 |
| 506 | Ga0495605_0126318 | 3300046474 | Bacteria | 1156 |
| 507 | Ga0495605_0181683 | 3300046474 | Bacteria | 924 |
| 508 | Ga0495639_0000013 | 3300046475 | Bacteria | 83505 |
| 509 | Ga0495639_0075352 | 3300046475 | Bacteria | 1564 |
| 510 | Ga0495584_0000217 | 3300046491 | Bacteria | 41596 |
| 511 | Ga0495584_0000278 | 3300046491 | Bacteria | 36319 |
| 512 | Ga0495584_0001274 | 3300046491 | Bacteria | 15340 |
| 513 | Ga0495584_0001920 | 3300046491 | Bacteria | 11953 |
| 514 | Ga0495584_0007817 | 3300046491 | Bacteria | 5562 |
| 515 | Ga0495584_0008228 | 3300046491 | Bacteria | 5406 |
| 516 | Ga0495584_0010755 | 3300046491 | Bacteria | 4699 |
| 517 | Ga0495584_0019971 | 3300046491 | Bacteria | 3403 |
| 518 | Ga0495584_0041118 | 3300046491 | Bacteria | 2334 |
| 519 | Ga0495584_0068146 | 3300046491 | Bacteria | 1787 |
| 520 | Ga0495584_0191547 | 3300046491 | Bacteria | 1039 |
| 521 | Ga0495585_0000245 | 3300046492 | Bacteria | 56106 |
| 522 | Ga0495585_0000517 | 3300046492 | Bacteria | 36490 |
| 523 | Ga0495585_0000833 | 3300046492 | Bacteria | 26614 |
| 524 | Ga0495585_0008745 | 3300046492 | Bacteria | 6121 |
| 525 | Ga0495585_0009287 | 3300046492 | Bacteria | 5907 |
| 526 | Ga0495585_0010240 | 3300046492 | Bacteria | 5595 |
| 527 | Ga0495585_0040723 | 3300046492 | Bacteria | 2608 |
| 528 | Ga0495585_0044488 | 3300046492 | Bacteria | 2480 |
| 529 | Ga0495585_0066610 | 3300046492 | Bacteria | 1971 |
| 530 | Ga0495585_0073263 | 3300046492 | Bacteria | 1864 |
| 531 | Ga0495585_0168621 | 3300046492 | Bacteria | 1132 |
| 532 | Ga0495585_0212602 | 3300046492 | Bacteria | 979 |
| 533 | Ga0495594_0013684 | 3300046499 | Bacteria | 4240 |
| 534 | Ga0495594_0017879 | 3300046499 | Bacteria | 3750 |
| 535 | Ga0495596_0000107 | 3300046500 | Bacteria | 59095 |
| 536 | Ga0495596_0057248 | 3300046500 | Bacteria | 1521 |
| 537 | Ga0495596_0059182 | 3300046500 | Bacteria | 1493 |
| 538 | Ga0495607_0000159 | 3300046501 | Bacteria | 71580 |
| 539 | Ga0495607_0000481 | 3300046501 | Bacteria | 39927 |
| 540 | Ga0495607_0004323 | 3300046501 | Bacteria | 10483 |
| 541 | Ga0495607_0007936 | 3300046501 | Bacteria | 7296 |
| 542 | Ga0495607_0010563 | 3300046501 | Bacteria | 6200 |
| 543 | Ga0495607_0011073 | 3300046501 | Bacteria | 6021 |
| 544 | Ga0495607_0011842 | 3300046501 | Bacteria | 5782 |
| 545 | Ga0495607_0012275 | 3300046501 | Bacteria | 5663 |
| 546 | Ga0495607_0094237 | 3300046501 | Bacteria | 1615 |
| 547 | Ga0495607_0102138 | 3300046501 | Bacteria | 1534 |
| 548 | Ga0495607_0121153 | 3300046501 | Bacteria | 1373 |
| 549 | Ga0495607_0177287 | 3300046501 | Bacteria | 1071 |
| 550 | Ga0495583_0000940 | 3300046506 | Bacteria | 33943 |
| 551 | Ga0495583_0001057 | 3300046506 | Bacteria | 30806 |
| 552 | Ga0495583_0005829 | 3300046506 | Bacteria | 8224 |
| 553 | Ga0495583_0008936 | 3300046506 | Bacteria | 6053 |
| 554 | Ga0495583_0012029 | 3300046506 | Bacteria | 4928 |
| 555 | Ga0495583_0091769 | 3300046506 | Bacteria | 1306 |
| 556 | Ga0495583_0105237 | 3300046506 | Bacteria | 1200 |
| 557 | Ga0495606_0001068 | 3300046507 | Bacteria | 39613 |
| 558 | Ga0495606_0001228 | 3300046507 | Bacteria | 35889 |
| 559 | Ga0495606_0001970 | 3300046507 | Bacteria | 25345 |
| 560 | Ga0495606_0005181 | 3300046507 | Bacteria | 12608 |
| 561 | Ga0495606_0006186 | 3300046507 | Bacteria | 11140 |
| 562 | Ga0495606_0009328 | 3300046507 | Bacteria | 8318 |
| 563 | Ga0495606_0014155 | 3300046507 | Bacteria | 6244 |
| 564 | Ga0495606_0014874 | 3300046507 | Bacteria | 6041 |
| 565 | Ga0495606_0133854 | 3300046507 | Bacteria | 1470 |
| 566 | Ga0495606_0177182 | 3300046507 | Bacteria | 1232 |
| 567 | Ga0495606_0201311 | 3300046507 | Bacteria | 1134 |
| 568 | Ga0495610_0000761 | 3300046512 | Bacteria | 30382 |
| 569 | Ga0495610_0001028 | 3300046512 | Bacteria | 25622 |
| 570 | Ga0495610_0004209 | 3300046512 | Bacteria | 10735 |
| 571 | Ga0495610_0008784 | 3300046512 | Bacteria | 6480 |
| 572 | Ga0495610_0021737 | 3300046512 | Bacteria | 3522 |
| 573 | Ga0495610_0045277 | 3300046512 | Bacteria | 2177 |
| 574 | Ga0495610_0063796 | 3300046512 | Bacteria | 1743 |
| 575 | Ga0495610_0084036 | 3300046512 | Bacteria | 1455 |
| 576 | Ga0495610_0092052 | 3300046512 | Bacteria | 1372 |
| 577 | Ga0495610_0104033 | 3300046512 | Bacteria | 1267 |
| 578 | Ga0495610_0148205 | 3300046512 | Bacteria | 1003 |
| 579 | Ga0495616_0000340 | 3300046513 | Bacteria | 37043 |
| 580 | Ga0495616_0000482 | 3300046513 | Bacteria | 30327 |
| 581 | Ga0495616_0003085 | 3300046513 | Bacteria | 10789 |
| 582 | Ga0495616_0004013 | 3300046513 | Bacteria | 9357 |
| 583 | Ga0495616_0004787 | 3300046513 | Bacteria | 8480 |
| 584 | Ga0495616_0008162 | 3300046513 | Bacteria | 6220 |
| 585 | Ga0495616_0038561 | 3300046513 | Bacteria | 2452 |
| 586 | Ga0495616_0041694 | 3300046513 | Bacteria | 2340 |
| 587 | Ga0495616_0052511 | 3300046513 | Bacteria | 2029 |
| 588 | Ga0495616_0133335 | 3300046513 | Bacteria | 1136 |
| 589 | Ga0495620_0002431 | 3300046515 | Bacteria | 10792 |
| 590 | Ga0495620_0002541 | 3300046515 | Bacteria | 10562 |
| 591 | Ga0495620_0003730 | 3300046515 | Bacteria | 8700 |
| 592 | Ga0495620_0006094 | 3300046515 | Bacteria | 6661 |
| 593 | Ga0495620_0006397 | 3300046515 | Bacteria | 6476 |
| 594 | Ga0495620_0007878 | 3300046515 | Bacteria | 5747 |
| 595 | Ga0495620_0009093 | 3300046515 | Bacteria | 5301 |
| 596 | Ga0495620_0032902 | 3300046515 | Bacteria | 2358 |
| 597 | Ga0495620_0035670 | 3300046515 | Bacteria | 2232 |
| 598 | Ga0495628_0117502 | 3300046516 | Bacteria | 2042 |
| 599 | Ga0495630_0016876 | 3300046517 | Bacteria | 5342 |
| 600 | Ga0495630_0380306 | 3300046517 | Bacteria | 1081 |
| 601 | Ga0495630_0541814 | 3300046517 | Bacteria | 892 |
| 602 | Ga0495631_0000020 | 3300046518 | Bacteria | 92958 |
| 603 | Ga0495631_0000384 | 3300046518 | Bacteria | 30478 |
| 604 | Ga0495631_0001218 | 3300046518 | Bacteria | 15891 |
| 605 | Ga0495631_0023273 | 3300046518 | Bacteria | 2872 |
| 606 | Ga0495631_0036625 | 3300046518 | Bacteria | 2190 |
| 607 | Ga0495631_0067125 | 3300046518 | Bacteria | 1552 |
| 608 | Ga0495631_0095450 | 3300046518 | Bacteria | 1280 |
| 609 | Ga0495631_0121549 | 3300046518 | Bacteria | 1123 |
| 610 | Ga0495632_0000436 | 3300046519 | Bacteria | 39746 |
| 611 | Ga0495632_0000790 | 3300046519 | Bacteria | 28178 |
| 612 | Ga0495632_0001749 | 3300046519 | Bacteria | 17563 |
| 613 | Ga0495632_0006326 | 3300046519 | Bacteria | 7639 |
| 614 | Ga0495632_0009407 | 3300046519 | Bacteria | 5896 |
| 615 | Ga0495632_0010362 | 3300046519 | Bacteria | 5526 |
| 616 | Ga0495632_0015019 | 3300046519 | Bacteria | 4357 |
| 617 | Ga0495632_0057077 | 3300046519 | Bacteria | 1906 |
| 618 | Ga0495632_0059776 | 3300046519 | Bacteria | 1853 |
| 619 | Ga0495632_0095753 | 3300046519 | Bacteria | 1402 |
| 620 | Ga0495632_0104075 | 3300046519 | Bacteria | 1336 |
| 621 | Ga0495632_0156500 | 3300046519 | Bacteria | 1051 |
| 622 | Ga0495637_0000420 | 3300046520 | Bacteria | 31089 |
| 623 | Ga0495637_0000447 | 3300046520 | Bacteria | 30138 |
| 624 | Ga0495637_0000616 | 3300046520 | Bacteria | 25212 |
| 625 | Ga0495637_0004512 | 3300046520 | Bacteria | 7204 |
| 626 | Ga0495637_0007849 | 3300046520 | Bacteria | 5265 |
| 627 | Ga0495637_0007946 | 3300046520 | Bacteria | 5227 |
| 628 | Ga0495637_0011163 | 3300046520 | Bacteria | 4321 |
| 629 | Ga0495637_0012083 | 3300046520 | Bacteria | 4135 |
| 630 | Ga0495637_0024469 | 3300046520 | Bacteria | 2732 |
| 631 | Ga0495637_0050887 | 3300046520 | Bacteria | 1736 |
| 632 | Ga0495637_0051817 | 3300046520 | Bacteria | 1715 |
| 633 | Ga0495637_0065186 | 3300046520 | Bacteria | 1483 |
| 634 | Ga0495637_0069073 | 3300046520 | Bacteria | 1430 |
| 635 | Ga0495637_0072952 | 3300046520 | Bacteria | 1381 |
| 636 | Ga0495637_0073142 | 3300046520 | Bacteria | 1379 |
| 637 | Ga0495637_0088557 | 3300046520 | Bacteria | 1224 |
| 638 | Ga0495637_0119652 | 3300046520 | Bacteria | 1014 |
| 639 | Ga0495643_0009226 | 3300046522 | Bacteria | 6153 |
| 640 | Ga0495643_0032663 | 3300046522 | Bacteria | 2887 |
| 641 | Ga0495643_0068930 | 3300046522 | Bacteria | 1860 |
| 642 | Ga0495643_0086265 | 3300046522 | Bacteria | 1626 |
| 643 | Ga0495643_0096026 | 3300046522 | Bacteria | 1524 |
| 644 | Ga0495643_0098837 | 3300046522 | Bacteria | 1498 |
| 645 | Ga0495643_0100343 | 3300046522 | Bacteria | 1484 |
| 646 | Ga0495643_0135672 | 3300046522 | Bacteria | 1231 |
| 647 | Ga0495643_0220944 | 3300046522 | Bacteria | 898 |
| 648 | Ga0495644_0000508 | 3300046523 | Bacteria | 16641 |
| 649 | Ga0495644_0001364 | 3300046523 | Bacteria | 9980 |
| 650 | Ga0495644_0004014 | 3300046523 | Bacteria | 5790 |
| 651 | Ga0495644_0013052 | 3300046523 | Bacteria | 3192 |
| 652 | Ga0495644_0110763 | 3300046523 | Bacteria | 1042 |
| 653 | Ga0495648_0000627 | 3300046524 | Bacteria | 37754 |
| 654 | Ga0495648_0004814 | 3300046524 | Bacteria | 11389 |
| 655 | Ga0495648_0008719 | 3300046524 | Bacteria | 7942 |
| 656 | Ga0495648_0011596 | 3300046524 | Bacteria | 6625 |
| 657 | Ga0495648_0015170 | 3300046524 | Bacteria | 5609 |
| 658 | Ga0495648_0015709 | 3300046524 | Bacteria | 5483 |
| 659 | Ga0495648_0032404 | 3300046524 | Bacteria | 3429 |
| 660 | Ga0495648_0044796 | 3300046524 | Bacteria | 2758 |
| 661 | Ga0495648_0101852 | 3300046524 | Bacteria | 1583 |
| 662 | Ga0495648_0103065 | 3300046524 | Bacteria | 1570 |
| 663 | Ga0495666_0000190 | 3300046526 | Bacteria | 26331 |
| 664 | Ga0495666_0076716 | 3300046526 | Bacteria | 1584 |
| 665 | Ga0495666_0109258 | 3300046526 | Bacteria | 1299 |
| 666 | Ga0495666_0133493 | 3300046526 | Bacteria | 1159 |
| 667 | Ga0495642_0000033 | 3300046528 | Bacteria | 85849 |
| 668 | Ga0495642_0003810 | 3300046528 | Bacteria | 5909 |
| 669 | Ga0495642_0004030 | 3300046528 | Bacteria | 5734 |
| 670 | Ga0495654_0000111 | 3300046530 | Bacteria | 92977 |
| 671 | Ga0495654_0000324 | 3300046530 | Bacteria | 41969 |
| 672 | Ga0495654_0000982 | 3300046530 | Bacteria | 20977 |
| 673 | Ga0495654_0001457 | 3300046530 | Bacteria | 16202 |
| 674 | Ga0495654_0002442 | 3300046530 | Bacteria | 11957 |
| 675 | Ga0495654_0002703 | 3300046530 | Bacteria | 11220 |
| 676 | Ga0495654_0008833 | 3300046530 | Bacteria | 5540 |
| 677 | Ga0495654_0009372 | 3300046530 | Bacteria | 5366 |
| 678 | Ga0495654_0022377 | 3300046530 | Bacteria | 3283 |
| 679 | Ga0495654_0033964 | 3300046530 | Bacteria | 2577 |
| 680 | Ga0495654_0035810 | 3300046530 | Bacteria | 2496 |
| 681 | Ga0495654_0072251 | 3300046530 | Bacteria | 1633 |
| 682 | Ga0495654_0078112 | 3300046530 | Bacteria | 1556 |
| 683 | Ga0495654_0097271 | 3300046530 | Bacteria | 1359 |
| 684 | Ga0495654_0111693 | 3300046530 | Bacteria | 1246 |
| 685 | Ga0495586_0086720 | 3300046535 | Bacteria | 1725 |
| 686 | Ga0495587_0002320 | 3300046536 | Bacteria | 12723 |
| 687 | Ga0495587_0003070 | 3300046536 | Bacteria | 11155 |
| 688 | Ga0495587_0202708 | 3300046536 | Bacteria | 1122 |
| 689 | Ga0495609_0000405 | 3300046538 | Bacteria | 36116 |
| 690 | Ga0495609_0001082 | 3300046538 | Bacteria | 18993 |
| 691 | Ga0495609_0001836 | 3300046538 | Bacteria | 13599 |
| 692 | Ga0495609_0009790 | 3300046538 | Bacteria | 4623 |
| 693 | Ga0495609_0020117 | 3300046538 | Bacteria | 3084 |
| 694 | Ga0495609_0027384 | 3300046538 | Bacteria | 2605 |
| 695 | Ga0495609_0042754 | 3300046538 | Bacteria | 2035 |
| 696 | Ga0495609_0043112 | 3300046538 | Bacteria | 2026 |
| 697 | Ga0495609_0069249 | 3300046538 | Bacteria | 1551 |
| 698 | Ga0495609_0107240 | 3300046538 | Bacteria | 1207 |
| 699 | Ga0495597_0000574 | 3300046542 | Bacteria | 30588 |
| 700 | Ga0495597_0009866 | 3300046542 | Bacteria | 4694 |
| 701 | Ga0495597_0016247 | 3300046542 | Bacteria | 3516 |
| 702 | Ga0495597_0030105 | 3300046542 | Bacteria | 2475 |
| 703 | Ga0495597_0032214 | 3300046542 | Bacteria | 2380 |
| 704 | Ga0495597_0032741 | 3300046542 | Bacteria | 2357 |
| 705 | Ga0495597_0034430 | 3300046542 | Bacteria | 2289 |
| 706 | Ga0495597_0048373 | 3300046542 | Bacteria | 1881 |
| 707 | Ga0495597_0071452 | 3300046542 | Bacteria | 1494 |
| 708 | Ga0495597_0074410 | 3300046542 | Bacteria | 1458 |
| 709 | Ga0495645_0039611 | 3300046543 | Bacteria | 3437 |
| 710 | Ga0495622_0000346 | 3300046557 | Bacteria | 33256 |
| 711 | Ga0495622_0000757 | 3300046557 | Bacteria | 18043 |
| 712 | Ga0495622_0004784 | 3300046557 | Bacteria | 6273 |
| 713 | Ga0495622_0008858 | 3300046557 | Bacteria | 4659 |
| 714 | Ga0495622_0011151 | 3300046557 | Bacteria | 4149 |
| 715 | Ga0495622_0075313 | 3300046557 | Bacteria | 1555 |
| 716 | Ga0495633_0000960 | 3300046558 | Bacteria | 23854 |
| 717 | Ga0495633_0001099 | 3300046558 | Bacteria | 21829 |
| 718 | Ga0495633_0012421 | 3300046558 | Bacteria | 4531 |
| 719 | Ga0495633_0029328 | 3300046558 | Bacteria | 2677 |
| 720 | Ga0495633_0145317 | 3300046558 | Bacteria | 1096 |
| 721 | Ga0495656_0012009 | 3300046615 | Bacteria | 3189 |
| 722 | Ga0495656_0078864 | 3300046615 | Bacteria | 1481 |
| 723 | Ga0495668_0000568 | 3300046616 | Bacteria | 45426 |
| 724 | Ga0495668_0004429 | 3300046616 | Bacteria | 9978 |
| 725 | Ga0495668_0009846 | 3300046616 | Bacteria | 5832 |
| 726 | Ga0495668_0030647 | 3300046616 | Bacteria | 3035 |
| 727 | Ga0495668_0037155 | 3300046616 | Bacteria | 2726 |
| 728 | Ga0495668_0114437 | 3300046616 | Bacteria | 1475 |
| 729 | Ga0495668_0219419 | 3300046616 | Bacteria | 1041 |
| 730 | Ga0495634_0000604 | 3300046642 | Bacteria | 34740 |
| 731 | Ga0495634_0246064 | 3300046642 | Bacteria | 1095 |
| 732 | Ga0495611_0000220 | 3300046648 | Bacteria | 39983 |
| 733 | Ga0495611_0005422 | 3300046648 | Bacteria | 5453 |
| 734 | Ga0495611_0007633 | 3300046648 | Bacteria | 4591 |
| 735 | Ga0495611_0128453 | 3300046648 | Bacteria | 1182 |
| 736 | Ga0495611_0153020 | 3300046648 | Bacteria | 1077 |
| 737 | Ga0495611_0180822 | 3300046648 | Bacteria | 985 |
| 738 | Ga0495625_0001145 | 3300046660 | Bacteria | 34203 |
| 739 | Ga0495625_0001301 | 3300046660 | Bacteria | 31222 |
| 740 | Ga0495625_0002421 | 3300046660 | Bacteria | 20214 |
| 741 | Ga0495625_0003237 | 3300046660 | Bacteria | 16478 |
| 742 | Ga0495625_0013674 | 3300046660 | Bacteria | 6508 |
| 743 | Ga0495625_0028111 | 3300046660 | Bacteria | 4220 |
| 744 | Ga0495625_0030291 | 3300046660 | Bacteria | 4039 |
| 745 | Ga0495625_0144102 | 3300046660 | Bacteria | 1605 |
| 746 | Ga0495625_0163209 | 3300046660 | Bacteria | 1491 |
| 747 | Ga0495625_0193165 | 3300046660 | Bacteria | 1347 |
| 748 | Ga0495625_0206969 | 3300046660 | Bacteria | 1291 |
| 749 | Ga0495625_0267131 | 3300046660 | Bacteria | 1105 |
| 750 | Ga0495635_0000247 | 3300046663 | Bacteria | 34285 |
| 751 | Ga0495635_0004736 | 3300046663 | Bacteria | 9452 |
| 752 | Ga0495659_0000194 | 3300046664 | Bacteria | 26665 |
| 753 | Ga0495659_0003183 | 3300046664 | Bacteria | 5264 |
| 754 | Ga0495659_0006394 | 3300046664 | Bacteria | 3719 |
| 755 | Ga0495661_0000092 | 3300046665 | Bacteria | 109902 |
| 756 | Ga0495661_0001179 | 3300046665 | Bacteria | 22716 |
| 757 | Ga0495661_0021477 | 3300046665 | Bacteria | 4208 |
| 758 | Ga0495661_0026511 | 3300046665 | Bacteria | 3732 |
| 759 | Ga0495661_0034210 | 3300046665 | Bacteria | 3198 |
| 760 | Ga0495661_0037282 | 3300046665 | Bacteria | 3036 |
| 761 | Ga0495661_0039326 | 3300046665 | Bacteria | 2939 |
| 762 | Ga0495661_0055912 | 3300046665 | Bacteria | 2363 |
| 763 | Ga0495661_0096287 | 3300046665 | Bacteria | 1674 |
| 764 | Ga0495661_0103574 | 3300046665 | Bacteria | 1597 |
| 765 | Ga0495661_0127941 | 3300046665 | Bacteria | 1395 |
| 766 | Ga0495661_0158845 | 3300046665 | Bacteria | 1215 |
| 767 | Ga0495661_0182815 | 3300046665 | Bacteria | 1110 |
| 768 | Ga0495661_0206521 | 3300046665 | Bacteria | 1025 |
| 769 | Ga0495661_0252885 | 3300046665 | Bacteria | 898 |
| 770 | Ga0495588_0012820 | 3300046674 | Bacteria | 3974 |
| 771 | Ga0495588_0018747 | 3300046674 | Bacteria | 3379 |
| 772 | Ga0495588_0048483 | 3300046674 | Bacteria | 2182 |
| 773 | Ga0495588_0083703 | 3300046674 | Bacteria | 1666 |
| 774 | Ga0495623_0012220 | 3300046679 | Bacteria | 5562 |
| 775 | Ga0495623_0027127 | 3300046679 | Bacteria | 3683 |
| 776 | Ga0495646_0008670 | 3300046680 | Bacteria | 6463 |
| 777 | Ga0495646_0010598 | 3300046680 | Bacteria | 5855 |
| 778 | Ga0495646_0037792 | 3300046680 | Bacteria | 2984 |
| 779 | Ga0495669_0018217 | 3300046684 | Bacteria | 3017 |
| 780 | Ga0495613_0055097 | 3300046689 | Bacteria | 2922 |
| 781 | Ga0495613_0204421 | 3300046689 | Bacteria | 1391 |
| 782 | Ga0495624_0012400 | 3300046690 | Bacteria | 5829 |
| 783 | Ga0495670_0000115 | 3300046691 | Bacteria | 35545 |
| 784 | Ga0495670_0000146 | 3300046691 | Bacteria | 31027 |
| 785 | Ga0495670_0000969 | 3300046691 | Bacteria | 13911 |
| 786 | Ga0495670_0003679 | 3300046691 | Bacteria | 7539 |
| 787 | Ga0495670_0006674 | 3300046691 | Bacteria | 5675 |
| 788 | Ga0495670_0012275 | 3300046691 | Bacteria | 4211 |
| 789 | Ga0495670_0080045 | 3300046691 | Bacteria | 1663 |
| 790 | Ga0495670_0107368 | 3300046691 | Bacteria | 1442 |
| 791 | Ga0495670_0116802 | 3300046691 | Bacteria | 1384 |
| 792 | Ga0495670_0162745 | 3300046691 | Bacteria | 1173 |
| 793 | Ga0495671_0000380 | 3300046692 | Bacteria | 36521 |
| 794 | Ga0495671_0001253 | 3300046692 | Bacteria | 17350 |
| 795 | Ga0495671_0015238 | 3300046692 | Bacteria | 4124 |
| 796 | Ga0495671_0015765 | 3300046692 | Bacteria | 4043 |
| 797 | Ga0495671_0021034 | 3300046692 | Bacteria | 3432 |
| 798 | Ga0495671_0024084 | 3300046692 | Bacteria | 3174 |
| 799 | Ga0495671_0032954 | 3300046692 | Bacteria | 2641 |
| 800 | Ga0495671_0043795 | 3300046692 | Bacteria | 2246 |
| 801 | Ga0495671_0063988 | 3300046692 | Bacteria | 1811 |
| 802 | Ga0495671_0065909 | 3300046692 | Bacteria | 1782 |
| 803 | Ga0495671_0069094 | 3300046692 | Bacteria | 1736 |
| 804 | Ga0495671_0093617 | 3300046692 | Bacteria | 1470 |
| 805 | Ga0495671_0103000 | 3300046692 | Bacteria | 1394 |
| 806 | Ga0495671_0116006 | 3300046692 | Bacteria | 1307 |
| 807 | Ga0495671_0163042 | 3300046692 | Bacteria | 1084 |
| 808 | Ga0495649_0000598 | 3300046694 | Bacteria | 30066 |
| 809 | Ga0495649_0002300 | 3300046694 | Bacteria | 13562 |
| 810 | Ga0495649_0004112 | 3300046694 | Bacteria | 9559 |
| 811 | Ga0495649_0007111 | 3300046694 | Bacteria | 6878 |
| 812 | Ga0495649_0009309 | 3300046694 | Bacteria | 5845 |
| 813 | Ga0495649_0010481 | 3300046694 | Bacteria | 5466 |
| 814 | Ga0495649_0012380 | 3300046694 | Bacteria | 4965 |
| 815 | Ga0495649_0015732 | 3300046694 | Bacteria | 4301 |
| 816 | Ga0495649_0065843 | 3300046694 | Bacteria | 1944 |
| 817 | Ga0495649_0068391 | 3300046694 | Bacteria | 1905 |
| 818 | Ga0495649_0092784 | 3300046694 | Bacteria | 1607 |
| 819 | Ga0495649_0103543 | 3300046694 | Bacteria | 1511 |
| 820 | Ga0495649_0114654 | 3300046694 | Bacteria | 1427 |
| 821 | Ga0495649_0129358 | 3300046694 | Bacteria | 1332 |
| 822 | Ga0495649_0163848 | 3300046694 | Bacteria | 1165 |
| 823 | Ga0495589_0000127 | 3300046794 | Bacteria | 70424 |
| 824 | Ga0495589_0000238 | 3300046794 | Bacteria | 46015 |
| 825 | Ga0495589_0000399 | 3300046794 | Bacteria | 32701 |
| 826 | Ga0495589_0003009 | 3300046794 | Bacteria | 9270 |
| 827 | Ga0495589_0014655 | 3300046794 | Bacteria | 4033 |
| 828 | Ga0495589_0014971 | 3300046794 | Bacteria | 3990 |
| 829 | Ga0495589_0015263 | 3300046794 | Bacteria | 3953 |
| 830 | Ga0495589_0032240 | 3300046794 | Bacteria | 2634 |
| 831 | Ga0495589_0069132 | 3300046794 | Bacteria | 1727 |
| 832 | Ga0495600_0005093 | 3300046809 | Bacteria | 7899 |
| 833 | Ga0495600_0052371 | 3300046809 | Bacteria | 2665 |
| 834 | Ga0495600_0075091 | 3300046809 | Bacteria | 2207 |
| 835 | Ga0495660_0002832 | 3300046810 | Bacteria | 10901 |
| 836 | Ga0495660_0007236 | 3300046810 | Bacteria | 6533 |
| 837 | Ga0495660_0008843 | 3300046810 | Bacteria | 5880 |
| 838 | Ga0495660_0010227 | 3300046810 | Bacteria | 5454 |
| 839 | Ga0495660_0016867 | 3300046810 | Bacteria | 4208 |
| 840 | Ga0495660_0016961 | 3300046810 | Bacteria | 4194 |
| 841 | Ga0495660_0019848 | 3300046810 | Bacteria | 3856 |
| 842 | Ga0495660_0029741 | 3300046810 | Bacteria | 3080 |
| 843 | Ga0495660_0056982 | 3300046810 | Bacteria | 2109 |
| 844 | Ga0495660_0066373 | 3300046810 | Bacteria | 1924 |
| 845 | Ga0495660_0089474 | 3300046810 | Bacteria | 1603 |
| 846 | Ga0495660_0089816 | 3300046810 | Bacteria | 1599 |
| 847 | Ga0495660_0109703 | 3300046810 | Bacteria | 1409 |
| 848 | Ga0495660_0110311 | 3300046810 | Bacteria | 1404 |
| 849 | Ga0495660_0148327 | 3300046810 | Bacteria | 1160 |
| 850 | Ga0495660_0151093 | 3300046810 | Bacteria | 1146 |
| 851 | Ga0495660_0164253 | 3300046810 | Bacteria | 1086 |
| 852 | Ga0495660_0197923 | 3300046810 | Bacteria | 961 |
| 853 | Ga0495581_0026902 | 3300047315 | Bacteria | 3335 |
| 854 | Ga0495581_0031652 | 3300047315 | Bacteria | 3065 |
| 855 | Ga0495604_0011021 | 3300047317 | Bacteria | 7175 |
| 856 | Ga0495604_0030731 | 3300047317 | Bacteria | 4264 |
| 857 | Ga0495604_0033490 | 3300047317 | Bacteria | 4067 |
| 858 | Ga0495604_0126316 | 3300047317 | Bacteria | 1843 |
| 859 | Ga0495636_0006932 | 3300047318 | Bacteria | 4455 |
| 860 | Ga0495636_0191311 | 3300047318 | Bacteria | 931 |
| 861 | Ga0495674_0099638 | 3300047319 | Bacteria | 2473 |
| 862 | Ga0495672_0000211 | 3300047320 | Bacteria | 83189 |
| 863 | Ga0495672_0000540 | 3300047320 | Bacteria | 42937 |
| 864 | Ga0495672_0000791 | 3300047320 | Bacteria | 34302 |
| 865 | Ga0495672_0001399 | 3300047320 | Bacteria | 23732 |
| 866 | Ga0495672_0005805 | 3300047320 | Bacteria | 9693 |
| 867 | Ga0495672_0008579 | 3300047320 | Bacteria | 7521 |
| 868 | Ga0495672_0012052 | 3300047320 | Bacteria | 6055 |
| 869 | Ga0495672_0012464 | 3300047320 | Bacteria | 5931 |
| 870 | Ga0495672_0013978 | 3300047320 | Bacteria | 5517 |
| 871 | Ga0495672_0014963 | 3300047320 | Bacteria | 5287 |
| 872 | Ga0495672_0023548 | 3300047320 | Bacteria | 3984 |
| 873 | Ga0495672_0027233 | 3300047320 | Bacteria | 3634 |
| 874 | Ga0495672_0039450 | 3300047320 | Bacteria | 2870 |
| 875 | Ga0495672_0044152 | 3300047320 | Bacteria | 2676 |
| 876 | Ga0495672_0054067 | 3300047320 | Bacteria | 2349 |
| 877 | Ga0495672_0081851 | 3300047320 | Bacteria | 1796 |
| 878 | Ga0495672_0146023 | 3300047320 | Bacteria | 1230 |
| 879 | Ga0495672_0148590 | 3300047320 | Bacteria | 1217 |
| 880 | Ga0495672_0182390 | 3300047320 | Bacteria | 1062 |
| 881 | Ga0495676_0000568 | 3300047321 | Bacteria | 30309 |
| 882 | Ga0495676_0078726 | 3300047321 | Bacteria | 2508 |
| 883 | Ga0495680_0003260 | 3300047322 | Bacteria | 16097 |
| 884 | Ga0495680_0012520 | 3300047322 | Bacteria | 7461 |
| 885 | Ga0495680_0019219 | 3300047322 | Bacteria | 5776 |
| 886 | Ga0495680_0133045 | 3300047322 | Bacteria | 1825 |
| 887 | Ga0495683_0000033 | 3300047323 | Bacteria | 149031 |
| 888 | Ga0495683_0000085 | 3300047323 | Bacteria | 93009 |
| 889 | Ga0495683_0000455 | 3300047323 | Bacteria | 32160 |
| 890 | Ga0495683_0007507 | 3300047323 | Bacteria | 5888 |
| 891 | Ga0495683_0015482 | 3300047323 | Bacteria | 3968 |
| 892 | Ga0495683_0019412 | 3300047323 | Bacteria | 3508 |
| 893 | Ga0495683_0036972 | 3300047323 | Bacteria | 2477 |
| 894 | Ga0495683_0042945 | 3300047323 | Bacteria | 2277 |
| 895 | Ga0495683_0049536 | 3300047323 | Bacteria | 2103 |
| 896 | Ga0495683_0071416 | 3300047323 | Bacteria | 1703 |
| 897 | Ga0495683_0086677 | 3300047323 | Bacteria | 1521 |
| 898 | Ga0495683_0107955 | 3300047323 | Bacteria | 1331 |
| 899 | Ga0495683_0136114 | 3300047323 | Bacteria | 1154 |
| 900 | Ga0495687_000375 | 3300047443 | Bacteria | 55715 |
| 901 | Ga0495687_002265 | 3300047443 | Bacteria | 15780 |
| 902 | Ga0495687_002345 | 3300047443 | Bacteria | 15376 |
| 903 | Ga0495687_005462 | 3300047443 | Bacteria | 8091 |
| 904 | Ga0495675_0013057 | 3300047444 | Bacteria | 5238 |
| 905 | Ga0495675_0033716 | 3300047444 | Bacteria | 3267 |
| 906 | Ga0495675_0045154 | 3300047444 | Bacteria | 2806 |
| 907 | Ga0495677_0030130 | 3300047445 | Bacteria | 1974 |
| 908 | Ga0495679_000380 | 3300047446 | Bacteria | 34062 |
| 909 | Ga0495679_000808 | 3300047446 | Bacteria | 19868 |
| 910 | Ga0495679_002964 | 3300047446 | Bacteria | 8378 |
| 911 | Ga0495679_005286 | 3300047446 | Bacteria | 5754 |
| 912 | Ga0495679_007065 | 3300047446 | Bacteria | 4737 |
| 913 | Ga0495679_007169 | 3300047446 | Bacteria | 4685 |
| 914 | Ga0495679_012425 | 3300047446 | Bacteria | 3242 |
| 915 | Ga0495679_027316 | 3300047446 | Bacteria | 1885 |
| 916 | Ga0495679_033752 | 3300047446 | Bacteria | 1632 |
| 917 | Ga0495679_045285 | 3300047446 | Bacteria | 1344 |
| 918 | Ga0495685_008095 | 3300047447 | Bacteria | 3483 |
| 919 | Ga0495673_0000297 | 3300047469 | Bacteria | 66473 |
| 920 | Ga0495673_0000345 | 3300047469 | Bacteria | 58540 |
| 921 | Ga0495673_0000637 | 3300047469 | Bacteria | 34475 |
| 922 | Ga0495673_0000687 | 3300047469 | Bacteria | 33114 |
| 923 | Ga0495673_0000755 | 3300047469 | Bacteria | 30650 |
| 924 | Ga0495673_0006766 | 3300047469 | Bacteria | 6695 |
| 925 | Ga0495673_0007279 | 3300047469 | Bacteria | 6388 |
| 926 | Ga0495673_0028619 | 3300047469 | Bacteria | 2638 |
| 927 | Ga0495673_0029206 | 3300047469 | Bacteria | 2604 |
| 928 | Ga0495673_0049968 | 3300047469 | Bacteria | 1838 |
| 929 | Ga0495673_0055079 | 3300047469 | Bacteria | 1726 |
| 930 | Ga0495673_0087901 | 3300047469 | Bacteria | 1274 |
| 931 | Ga0495673_0089898 | 3300047469 | Bacteria | 1256 |
| 932 | Ga0495673_0092105 | 3300047469 | Bacteria | 1237 |
| 933 | Ga0495673_0092214 | 3300047469 | Bacteria | 1236 |
| 934 | Ga0495673_0097469 | 3300047469 | Bacteria | 1193 |
| 935 | Ga0495673_0102458 | 3300047469 | Bacteria | 1155 |
| 936 | Ga0495681_0000172 | 3300047470 | Bacteria | 54252 |
| 937 | Ga0495681_0000226 | 3300047470 | Bacteria | 47165 |
| 938 | Ga0495681_0000352 | 3300047470 | Bacteria | 35925 |
| 939 | Ga0495681_0000424 | 3300047470 | Bacteria | 32445 |
| 940 | Ga0495681_0000504 | 3300047470 | Bacteria | 29850 |
| 941 | Ga0495681_0000542 | 3300047470 | Bacteria | 28962 |
| 942 | Ga0495681_0002874 | 3300047470 | Bacteria | 12171 |
| 943 | Ga0495681_0004787 | 3300047470 | Bacteria | 9173 |
| 944 | Ga0495681_0006317 | 3300047470 | Bacteria | 7799 |
| 945 | Ga0495681_0008427 | 3300047470 | Bacteria | 6468 |
| 946 | Ga0495681_0008837 | 3300047470 | Bacteria | 6265 |
| 947 | Ga0495681_0026017 | 3300047470 | Bacteria | 3055 |
| 948 | Ga0495681_0054146 | 3300047470 | Bacteria | 1876 |
| 949 | Ga0495681_0055952 | 3300047470 | Bacteria | 1837 |
| 950 | Ga0495681_0065899 | 3300047470 | Bacteria | 1654 |
| 951 | Ga0495681_0092995 | 3300047470 | Bacteria | 1328 |
| 952 | Ga0495681_0101450 | 3300047470 | Bacteria | 1257 |
| 953 | Ga0495681_0106763 | 3300047470 | Bacteria | 1217 |
| 954 | Ga0495681_0119030 | 3300047470 | Bacteria | 1135 |
| 955 | Ga0495684_0009299 | 3300047471 | Bacteria | 7583 |
| 956 | Ga0495684_0174476 | 3300047471 | Bacteria | 1596 |
| 957 | Ga0495686_0010527 | 3300047472 | Bacteria | 6572 |
| 958 | Ga0495686_0011609 | 3300047472 | Bacteria | 6201 |
| 959 | Ga0495686_0013098 | 3300047472 | Bacteria | 5773 |
| 960 | Ga0495686_0107712 | 3300047472 | Bacteria | 1674 |
| 961 | Ga0495686_0113226 | 3300047472 | Bacteria | 1625 |
| 962 | Ga0495686_0140100 | 3300047472 | Bacteria | 1427 |
| 963 | Ga0495686_0218477 | 3300047472 | Bacteria | 1085 |
| 964 | Ga0495593_0007099 | 3300047673 | Bacteria | 6568 |
| 965 | Ga0495593_0054213 | 3300047673 | Bacteria | 2114 |
| 966 | Ga0495593_0105573 | 3300047673 | Bacteria | 1441 |
| 967 | Ga0495593_0117239 | 3300047673 | Bacteria | 1356 |
| 968 | Ga0495602_0026629 | 3300048088 | Bacteria | 5573 |
| 969 | Ga0495602_0273022 | 3300048088 | Bacteria | 1249 |
| 970 | Ga0495626_0000144 | 3300048091 | Bacteria | 89793 |
| 971 | Ga0495626_0000179 | 3300048091 | Bacteria | 77215 |
| 972 | Ga0495626_0000438 | 3300048091 | Bacteria | 42557 |
| 973 | Ga0495626_0000558 | 3300048091 | Bacteria | 36958 |
| 974 | Ga0495626_0000838 | 3300048091 | Bacteria | 27572 |
| 975 | Ga0495626_0002828 | 3300048091 | Bacteria | 11600 |
| 976 | Ga0495626_0003982 | 3300048091 | Bacteria | 9229 |
| 977 | Ga0495626_0017529 | 3300048091 | Bacteria | 3612 |
| 978 | Ga0495626_0019891 | 3300048091 | Bacteria | 3350 |
| 979 | Ga0495626_0021821 | 3300048091 | Bacteria | 3170 |
| 980 | Ga0495626_0037917 | 3300048091 | Bacteria | 2288 |
| 981 | Ga0495626_0087248 | 3300048091 | Bacteria | 1377 |
| 982 | Ga0495626_0093958 | 3300048091 | Bacteria | 1315 |
| 983 | Ga0495626_0095658 | 3300048091 | Bacteria | 1300 |
| 984 | Ga0495626_0098803 | 3300048091 | Bacteria | 1274 |
| 985 | Ga0495626_0104744 | 3300048091 | Bacteria | 1230 |
| 986 | Ga0496102_0000250 | 3300048905 | Bacteria | 70330 |
| 987 | Ga0496103_0009544 | 3300048906 | Bacteria | 5745 |
| 988 | Ga0496110_0030902 | 3300048913 | Bacteria | 4619 |
| 989 | Ga0496110_0061890 | 3300048913 | Bacteria | 3304 |
| 990 | Ga0496111_0053353 | 3300048914 | Bacteria | 2921 |
| 991 | Ga0496114_0025300 | 3300048917 | Bacteria | 4851 |
| 992 | Ga0496116_0000168 | 3300048919 | Bacteria | 132462 |
| 993 | Ga0496116_0000419 | 3300048919 | Bacteria | 60095 |
| 994 | Ga0496116_0001770 | 3300048919 | Bacteria | 23535 |
| 995 | Ga0496116_0016589 | 3300048919 | Bacteria | 5754 |
| 996 | Ga0496116_0017204 | 3300048919 | Bacteria | 5622 |
| 997 | Ga0496117_0000349 | 3300048920 | Bacteria | 81440 |
| 998 | Ga0496117_0005736 | 3300048920 | Bacteria | 12903 |
| 999 | Ga0496117_0006862 | 3300048920 | Bacteria | 11313 |
| 1000 | Ga0496117_0019897 | 3300048920 | Bacteria | 5492 |
| 1001 | Ga0496117_0035195 | 3300048920 | Bacteria | 3762 |
| 1002 | Ga0496117_0037268 | 3300048920 | Bacteria | 3624 |
| 1003 | Ga0496117_0045204 | 3300048920 | Bacteria | 3183 |
| 1004 | Ga0496117_0068382 | 3300048920 | Bacteria | 2398 |
| 1005 | Ga0496117_0266206 | 3300048920 | Bacteria | 926 |
| 1006 | Ga0496118_0003199 | 3300048921 | Bacteria | 20896 |
| 1007 | Ga0496118_0024394 | 3300048921 | Bacteria | 5219 |
| 1008 | Ga0496118_0026764 | 3300048921 | Bacteria | 4903 |
| 1009 | Ga0496118_0036848 | 3300048921 | Bacteria | 3947 |
| 1010 | Ga0496118_0039213 | 3300048921 | Bacteria | 3783 |
| 1011 | Ga0496118_0066157 | 3300048921 | Bacteria | 2639 |
| 1012 | Ga0496118_0142850 | 3300048921 | Bacteria | 1513 |
| 1013 | Ga0496119_0000713 | 3300048922 | Bacteria | 44652 |
| 1014 | Ga0496119_0007971 | 3300048922 | Bacteria | 9419 |
| 1015 | Ga0496119_0031089 | 3300048922 | Bacteria | 3587 |
| 1016 | Ga0496119_0081922 | 3300048922 | Bacteria | 1856 |
| 1017 | Ga0496119_0208907 | 3300048922 | Bacteria | 1005 |
| 1018 | Ga0496119_0266332 | 3300048922 | Bacteria | 858 |
| 1019 | Ga0496120_0001850 | 3300048923 | Bacteria | 23552 |
| 1020 | Ga0496120_0009933 | 3300048923 | Bacteria | 6696 |
| 1021 | Ga0496120_0022821 | 3300048923 | Bacteria | 3932 |
| 1022 | Ga0496121_0000199 | 3300048924 | Bacteria | 132751 |
| 1023 | Ga0496121_0024913 | 3300048924 | Bacteria | 5703 |
| 1024 | Ga0496121_0121443 | 3300048924 | Bacteria | 1972 |
| 1025 | Ga0496121_0172342 | 3300048924 | Bacteria | 1570 |
| 1026 | Ga0496122_0001732 | 3300048925 | Bacteria | 33838 |
| 1027 | Ga0496122_0003605 | 3300048925 | Bacteria | 20172 |
| 1028 | Ga0496122_0024506 | 3300048925 | Bacteria | 5277 |
| 1029 | Ga0496122_0110701 | 3300048925 | Bacteria | 1803 |
| 1030 | Ga0496122_0131001 | 3300048925 | Bacteria | 1593 |
| 1031 | Ga0496122_0148234 | 3300048925 | Bacteria | 1454 |
| 1032 | Ga0496122_0170500 | 3300048925 | Bacteria | 1313 |
| 1033 | Ga0496123_0000869 | 3300048926 | Bacteria | 48057 |
| 1034 | Ga0496123_0019162 | 3300048926 | Bacteria | 5400 |
| 1035 | Ga0496123_0019191 | 3300048926 | Bacteria | 5396 |
| 1036 | Ga0496123_0071817 | 3300048926 | Bacteria | 2157 |
| 1037 | Ga0496123_0125142 | 3300048926 | Bacteria | 1436 |
| 1038 | Ga0496123_0126252 | 3300048926 | Bacteria | 1427 |
| 1039 | Ga0496123_0261550 | 3300048926 | Bacteria | 847 |
| 1040 | Ga0496124_0000259 | 3300048927 | Bacteria | 101764 |
| 1041 | Ga0496124_0006403 | 3300048927 | Bacteria | 12836 |
| 1042 | Ga0496124_0013792 | 3300048927 | Bacteria | 7862 |
| 1043 | Ga0496124_0015684 | 3300048927 | Bacteria | 7247 |
| 1044 | Ga0496124_0026649 | 3300048927 | Bacteria | 5208 |
| 1045 | Ga0496124_0037785 | 3300048927 | Bacteria | 4196 |
| 1046 | Ga0496124_0120274 | 3300048927 | Bacteria | 2099 |
| 1047 | Ga0496124_0163108 | 3300048927 | Bacteria | 1735 |
| 1048 | Ga0496124_0216632 | 3300048927 | Bacteria | 1444 |
| 1049 | Ga0496124_0292136 | 3300048927 | Bacteria | 1182 |
| 1050 | Ga0496125_0001730 | 3300048928 | Bacteria | 30353 |
| 1051 | Ga0496125_0005296 | 3300048928 | Bacteria | 14428 |
| 1052 | Ga0496125_0029951 | 3300048928 | Bacteria | 4878 |
| 1053 | Ga0496125_0053252 | 3300048928 | Bacteria | 3319 |
| 1054 | Ga0496125_0122569 | 3300048928 | Bacteria | 1850 |
| 1055 | Ga0496125_0126149 | 3300048928 | Bacteria | 1813 |
| 1056 | Ga0496125_0153578 | 3300048928 | Bacteria | 1576 |
| 1057 | Ga0496125_0154030 | 3300048928 | Bacteria | 1573 |
| 1058 | Ga0496125_0264691 | 3300048928 | Bacteria | 1075 |
| 1059 | Ga0496125_0266301 | 3300048928 | Bacteria | 1071 |
| 1060 | Ga0496126_0016561 | 3300048929 | Bacteria | 7367 |
| 1061 | Ga0496126_0186568 | 3300048929 | Bacteria | 1758 |
| 1062 | Ga0496126_0575734 | 3300048929 | Bacteria | 890 |
| 1063 | Ga0495678_000802 | 3300049459 | Bacteria | 28143 |
| 1064 | Ga0495678_001726 | 3300049459 | Bacteria | 16327 |
| 1065 | Ga0495678_001732 | 3300049459 | Bacteria | 16267 |
| 1066 | Ga0495678_002779 | 3300049459 | Bacteria | 11434 |
| 1067 | Ga0495678_006573 | 3300049459 | Bacteria | 6163 |
| 1068 | Ga0495678_009222 | 3300049459 | Bacteria | 4905 |
| 1069 | Ga0495678_010113 | 3300049459 | Bacteria | 4603 |
| 1070 | Ga0495678_030927 | 3300049459 | Bacteria | 2236 |
| 1071 | Ga0495678_050256 | 3300049459 | Bacteria | 1617 |
| 1072 | Ga0495678_050741 | 3300049459 | Bacteria | 1606 |
| 1073 | Ga0495678_061573 | 3300049459 | Bacteria | 1408 |
| 1074 | Ga0495678_062994 | 3300049459 | Bacteria | 1386 |
| 1075 | Ga0495678_076955 | 3300049459 | Bacteria | 1207 |
| 1076 | Ga0495678_090048 | 3300049459 | Bacteria | 1082 |
| 1077 | Ga0495682_0000203 | 3300049460 | Bacteria | 47845 |
| 1078 | Ga0495682_0001158 | 3300049460 | Bacteria | 15148 |
| 1079 | Ga0495682_0001358 | 3300049460 | Bacteria | 13484 |
| 1080 | Ga0495682_0008910 | 3300049460 | Bacteria | 3936 |
| 1081 | Ga0495682_0048494 | 3300049460 | Bacteria | 1548 |
| 1082 | Ga0495682_0052081 | 3300049460 | Bacteria | 1488 |
| 1083 | Ga0495682_0052176 | 3300049460 | Bacteria | 1486 |
| 1084 | Ga0495682_0059517 | 3300049460 | Bacteria | 1380 |
| 1085 | Ga0501250_013358 | 3300049680 | Bacteria | 984 |
| 1086 | Ga0501241_000142 | 3300049758 | Bacteria | 15922 |
| 1087 | Ga0501226_000022 | 3300049853 | Bacteria | 111874 |
| 1088 | nmdc:mga03683_155524_c1 | 3300050489 | Bacteria | 1034 |
| 1089 | nmdc:mga08x19_294980_c1 | 3300050514 | Bacteria | 1125 |
| 1090 | nmdc:mga08x19_328466_c1 | 3300050514 | Bacteria | 1065 |
| 1091 | nmdc:mga0sz30_130977_c1 | 3300050516 | Bacteria | 1105 |
| 1092 | Ga0500572_001644 | 3300053111 | Bacteria | 5865 |
| 1093 | Ga0500618_005554 | 3300053125 | Bacteria | 3815 |
| 1094 | Ga0500568_0067904 | 3300053139 | Bacteria | 1369 |
| 1095 | Ga0500586_044741 | 3300053145 | Bacteria | 1512 |
| 1096 | Ga0466962_0003680 | 3300061719 | Bacteria | 7305 |
| 1097 | 2511252823 | 2511231004 | Bacteria | 6669789 |
| 1098 | 2511267741 | 2511231006 | Bacteria | 6794709 |
| 1099 | 2511273113 | 2511231007 | Bacteria | 6306603 |
| 1100 | 2511275778 | 2511231008 | Bacteria | 6624100 |
| 1101 | 2511290617 | 2511231010 | Bacteria | 6373152 |
| 1102 | 2511298320 | 2511231011 | Bacteria | 6149768 |
| 1103 | 2511301057 | 2511231012 | Bacteria | 6738011 |
| 1104 | 2511315674 | 2511231014 | Bacteria | 6462302 |
| 1105 | 2511318283 | 2511231015 | Bacteria | 6598026 |
| 1106 | 2511326143 | 2511231016 | Bacteria | 6704427 |
| 1107 | 2511333941 | 2511231017 | Bacteria | 6503007 |
| 1108 | 2511338996 | 2511231018 | Bacteria | 6436256 |
| 1109 | 2511347200 | 2511231019 | Bacteria | 6520662 |
| 1110 | 2511349868 | 2511231020 | Bacteria | 6115223 |
| 1111 | 2511357819 | 2511231021 | Bacteria | 7302637 |
| 1112 | 2511365705 | 2511231022 | Bacteria | 6719296 |
| 1113 | 2511372347 | 2511231023 | Bacteria | 6808468 |
| 1114 | 2511410893 | 2511231031 | Bacteria | 6558529 |
| 1115 | 2511823727 | 2511231156 | Bacteria | 6845832 |
| 1116 | 2512323961 | 2512047018 | Bacteria | 6663241 |
| 1117 | 2554814335 | 2554235132 | Bacteria | 6772433 |
| 1118 | 2555671209 | 2554235341 | Bacteria | 6867980 |
| 1119 | 2583793634 | 2582580891 | Bacteria | 6800976 |
| 1120 | 2597859293 | 2597489887 | Bacteria | 6666321 |
| 1121 | 2597865087 | 2597489888 | Bacteria | 6179543 |
| 1122 | 2597870941 | 2597489889 | Bacteria | 6297495 |
| 1123 | 2599354632 | 2599185160 | Bacteria | 6844013 |
| 1124 | 2599359655 | 2599185161 | Bacteria | 6960462 |
| 1125 | 2599365977 | 2599185162 | Bacteria | 6957254 |
| 1126 | 2599372767 | 2599185163 | Bacteria | 6995158 |
| 1127 | 2599379739 | 2599185164 | Bacteria | 6841688 |
| 1128 | 2599385282 | 2599185165 | Bacteria | 6843250 |
| 1129 | 2599391626 | 2599185166 | Bacteria | 6959206 |
| 1130 | 2599400214 | 2599185167 | Bacteria | 6353609 |
| 1131 | 2599403392 | 2599185168 | Bacteria | 6997636 |
| 1132 | 2599451456 | 2599185179 | Bacteria | 6611171 |
| 1133 | 2599461466 | 2599185181 | Bacteria | 6844519 |
| 1134 | 2599470009 | 2599185182 | Bacteria | 6883168 |
| 1135 | 2599482124 | 2599185185 | Bacteria | 6652270 |
| 1136 | 2599490485 | 2599185186 | Bacteria | 6831633 |
| 1137 | 2599504520 | 2599185188 | Bacteria | 6164180 |
| 1138 | 2599509435 | 2599185189 | Bacteria | 5862825 |
| 1139 | 2599512628 | 2599185190 | Bacteria | 6285678 |
| 1140 | 2599519979 | 2599185191 | Bacteria | 6297582 |
| 1141 | 2599611585 | 2599185212 | Bacteria | 6765997 |
| 1142 | 2599770320 | 2599185248 | Bacteria | 6696816 |
| 1143 | 2599804158 | 2599185257 | Bacteria | 6492581 |
| 1144 | 2599878431 | 2599185288 | Bacteria | 6666191 |
| 1145 | 2599887471 | 2599185289 | Bacteria | 6778765 |
| 1146 | 2599891304 | 2599185290 | Bacteria | 6289611 |
| 1147 | 2599901782 | 2599185291 | Bacteria | 6775623 |
| 1148 | 2599934312 | 2599185300 | Bacteria | 6062622 |
| 1149 | 2599941745 | 2599185302 | Bacteria | 5954930 |
| 1150 | 2599947634 | 2599185303 | Bacteria | 6512725 |
| 1151 | 2599952735 | 2599185304 | Bacteria | 5951361 |
| 1152 | 2599960626 | 2599185305 | Bacteria | 6748700 |
| 1153 | 2599964920 | 2599185306 | Bacteria | 6637356 |
| 1154 | 2599975967 | 2599185308 | Bacteria | 6621546 |
| 1155 | 2599981914 | 2599185309 | Bacteria | 5969593 |
| 1156 | 2599987823 | 2599185310 | Bacteria | 6014457 |
| 1157 | 2599995318 | 2599185311 | Bacteria | 6354990 |
| 1158 | 2599998285 | 2599185312 | Bacteria | 5912071 |
| 1159 | 2600005450 | 2599185313 | Bacteria | 6658188 |
| 1160 | 2600010152 | 2599185314 | Bacteria | 6621749 |
| 1161 | 2600017333 | 2599185315 | Bacteria | 6771107 |
| 1162 | 2600022556 | 2599185316 | Bacteria | 6320029 |
| 1163 | 2600027576 | 2599185317 | Bacteria | 6435722 |
| 1164 | 2600034360 | 2599185318 | Bacteria | 6961590 |
| 1165 | 2600039856 | 2599185319 | Bacteria | 6637840 |
| 1166 | 2600046153 | 2599185320 | Bacteria | 5963263 |
| 1167 | 2600052156 | 2599185321 | Bacteria | 6764560 |
| 1168 | 2600057533 | 2599185322 | Bacteria | 6763055 |
| 1169 | 2600064694 | 2599185323 | Bacteria | 6688755 |
| 1170 | 2600072270 | 2599185324 | Bacteria | 6590677 |
| 1171 | 2600075831 | 2599185325 | Bacteria | 6324919 |
| 1172 | 2600214084 | 2599185356 | Bacteria | 6843884 |
| 1173 | 2600356715 | 2600254930 | Bacteria | 6431253 |
| 1174 | 2600364201 | 2600254931 | Bacteria | 6734225 |
| 1175 | 2600442370 | 2600254954 | Bacteria | 5100516 |
| 1176 | 2601689654 | 2600255296 | Bacteria | 5784754 |
| 1177 | 2601774250 | 2600255313 | Bacteria | 6842543 |
| 1178 | 2601796213 | 2600255318 | Bacteria | 6383414 |
| 1179 | 2602009665 | 2600255389 | Bacteria | 5275336 |
| 1180 | 2606073362 | 2603880185 | Bacteria | 6379190 |
| 1181 | 2606126992 | 2603880199 | Bacteria | 6377649 |
| 1182 | 2608381727 | 2606217733 | Bacteria | 6360972 |
| 1183 | 2621298354 | 2619619299 | Bacteria | 6649820 |
| 1184 | 2624481862 | 2623620443 | Bacteria | 6427864 |
| 1185 | 2624491053 | 2623620446 | Bacteria | 6500345 |
| 1186 | 2643845564 | 2643221565 | Bacteria | 6216018 |
| 1187 | 2643874312 | 2643221571 | Bacteria | 6228673 |
| 1188 | 2643956439 | 2643221589 | Bacteria | 6250934 |
| 1189 | 2644025519 | 2643221602 | Bacteria | 6249926 |
| 1190 | 2644187408 | 2643221633 | Bacteria | 6733554 |
| 1191 | 2644284814 | 2643221650 | Bacteria | 7029547 |
| 1192 | 2644621922 | 2643221713 | Bacteria | 6554480 |
| 1193 | 2652546519 | 2651869719 | Bacteria | 6047974 |
| 1194 | 2671094372 | 2667528170 | Bacteria | 6786960 |
| 1195 | 2671097213 | 2667528171 | Bacteria | 6900659 |
| 1196 | 2671126054 | 2667528176 | Bacteria | 6724917 |
| 1197 | 2671770274 | 2671180172 | Bacteria | 6495783 |
| 1198 | 2677899875 | 2675903420 | Bacteria | 6247433 |
| 1199 | 2678262660 | 2675903515 | Bacteria | 6580491 |
| 1200 | 2715751165 | 2713897148 | Bacteria | 5883533 |
| 1201 | 2715758165 | 2713897149 | Bacteria | 6506249 |
| 1202 | 2718635111 | 2718217725 | Bacteria | 5758958 |
| 1203 | 2723249840 | 2721755607 | Bacteria | 5841722 |
| 1204 | 2729147418 | 2728369097 | Bacteria | 4333476 |
| 1205 | 2738671261 | 2738541265 | Bacteria | 6594665 |
| 1206 | 2738688372 | 2738541271 | Bacteria | 5657310 |
| 1207 | 2738749655 | 2738541282 | Bacteria | 6593925 |
| 1208 | 2738808486 | 2738541294 | Bacteria | 6925949 |
| 1209 | 2738858695 | 2738541303 | Bacteria | 6591772 |
| 1210 | 2738895846 | 2738541309 | Bacteria | 6926455 |
| 1211 | 2739201903 | 2738543004 | Bacteria | 6381073 |
| 1212 | 2739259295 | 2738543015 | Bacteria | 6750701 |
| 1213 | 2739264104 | 2738543016 | Bacteria | 5657564 |
| 1214 | 2739314126 | 2738543025 | Bacteria | 6600348 |
| 1215 | 2743738826 | 2740892503 | Bacteria | 6855563 |
| 1216 | 2745009000 | 2744054620 | Bacteria | 6551379 |
| 1217 | 2774123387 | 2773857670 | Bacteria | 6407454 |
| 1218 | 2774132770 | 2773857673 | Bacteria | 6513460 |
| 1219 | 2784263416 | 2784132063 | Bacteria | 6262788 |
| 1220 | 2784316071 | 2784132072 | Bacteria | 6596533 |
| 1221 | 2794596463 | 2791355520 | Bacteria | 5948615 |
| 1222 | 2807409255 | 2806310737 | Bacteria | 5751088 |
| 1223 | 2807457557 | 2806310745 | Bacteria | 5742165 |
| 1224 | 2808855128 | 2808606361 | Bacteria | 6136259 |
| 1225 | 2808924405 | 2808606376 | Bacteria | 6248667 |
| 1226 | 2808930555 | 2808606377 | Bacteria | 6646337 |
| 1227 | 2808935784 | 2808606378 | Bacteria | 6177535 |
| 1228 | 2808940522 | 2808606379 | Bacteria | 5022697 |
| 1229 | 2808946497 | 2808606380 | Bacteria | 6248705 |
| 1230 | 2808952677 | 2808606381 | Bacteria | 6646461 |
| 1231 | 2808957328 | 2808606382 | Bacteria | 6841132 |
| 1232 | 2808963521 | 2808606383 | Bacteria | 6138645 |
| 1233 | 2808977798 | 2808606385 | Bacteria | 6711065 |
| 1234 | 2808993278 | 2808606388 | Bacteria | 6706662 |
| 1235 | 2808998521 | 2808606389 | Bacteria | 6138126 |
| 1236 | 2809218716 | 2808606445 | Bacteria | 6057339 |
| 1237 | 2817492497 | 2816332298 | Bacteria | 6852809 |
| 1238 | 2819655605 | 2818991456 | Bacteria | 6123676 |
| 1239 | 2819702310 | 2818991464 | Bacteria | 6907494 |
| 1240 | 2823424486 | 2823421272 | Bacteria | 5372474 |
| 1241 | 2825652975 | 2825651385 | Bacteria | 6715909 |
| 1242 | 2834031904 | 2834028612 | Bacteria | 6354979 |
| 1243 | 2842827684 | 2842826826 | Bacteria | 5974129 |
| 1244 | 2842836456 | 2842832357 | Bacteria | 5959113 |
| 1245 | 2842841015 | 2842837860 | Bacteria | 6066181 |
| 1246 | 2842844570 | 2842843487 | Bacteria | 6004777 |
| 1247 | 2842854713 | 2842854478 | Bacteria | 6143501 |
| 1248 | 2844671750 | 2844665904 | Bacteria | 6817974 |
| 1249 | 2852613131 | 2852612431 | Bacteria | 6885235 |
| 1250 | 2852662396 | 2852657418 | Bacteria | 6472974 |
| 1251 | 2852669134 | 2852667396 | Bacteria | 6885555 |
| 1252 | 2860340743 | 2860339153 | Bacteria | 6846989 |
| 1253 | 2860871593 | 2860867994 | Bacteria | 5645326 |
| 1254 | 2878033846 | 2878029506 | Bacteria | 6418441 |
| 1255 | 2880234471 | 2880230671 | Bacteria | 6140320 |
| 1256 | 2894821620 | 2894817345 | Bacteria | 4892941 |
| 1257 | 2904521390 | 2904518522 | Bacteria | 6068986 |
| 1258 | 2904555567 | 2904550169 | Bacteria | 6221258 |
| 1259 | 2908450998 | 2908446538 | Bacteria | 6829095 |
| 1260 | 2913038638 | 2913036834 | Bacteria | 6704877 |
| 1261 | 2917075070 | 2917070673 | Bacteria | 6868303 |
| 1262 | 2919068831 | 2919063839 | Bacteria | 6302690 |
| 1263 | 2919158400 | 2919155634 | Bacteria | 4860545 |
| 1264 | 2919387938 | 2919385768 | Bacteria | 5897293 |
| 1265 | 2919461126 | 2919456309 | Bacteria | 6586567 |
| 1266 | 2919481915 | 2919481497 | Bacteria | 6907839 |
| 1267 | 2919489879 | 2919487758 | Bacteria | 5929766 |
| 1268 | 2919504215 | 2919501602 | Bacteria | 5286340 |
| 1269 | 2919702067 | 2919697872 | Bacteria | 6553725 |
| 1270 | 2923157898 | 2923153595 | Bacteria | 6870622 |
| 1271 | 2923587250 | 2923586266 | Bacteria | 6565975 |
| 1272 | 2926065212 | 2926063275 | Bacteria | 5285848 |
| 1273 | 2929146092 | 2929144301 | Bacteria | 6622272 |
| 1274 | 2929193630 | 2929189879 | Bacteria | 5930554 |
| 1275 | 2931370570 | 2931369376 | Bacteria | 6847892 |
| 1276 | 2931394947 | 2931390751 | Bacteria | 6273349 |
| 1277 | 2931403296 | 2931396565 | Bacteria | 7251677 |
| 1278 | 2935356058 | 2935353572 | Unclassified | 6955622 |
| 1279 | 2939637680 | 2939636861 | Bacteria | 6297853 |
| 1280 | 2939652888 | 2939651529 | Bacteria | 5895393 |
| 1281 | 2945965004 | 2945961074 | Bacteria | 7342064 |
| 1282 | 2946008554 | 2946006987 | Bacteria | 6705746 |
| 1283 | 2946032096 | 2946027586 | Bacteria | 6049274 |
| 1284 | 2947238925 | 2947233263 | Bacteria | 6439278 |
| 1285 | 2969308621 | 2969304461 | Bacteria | 6601805 |
| 1286 | 2974290005 | 2974289157 | Bacteria | 6080362 |
| 1287 | 2984288283 | 2984286254 | Bacteria | 6702062 |
| 1288 | 2988733622 | 2988728565 | Bacteria | 6124362 |
| 1289 | 2990198934 | 2990196909 | Bacteria | 4054280 |
| 1290 | 2998143926 | 2998139840 | Bacteria | 6073514 |
| 1291 | 3007253370 | 3007252601 | Bacteria | 4559114 |
| 1292 | 3007397208 | 3007395558 | Bacteria | 6755444 |
| 1293 | 3007515627 | 3007511990 | Bacteria | 6481491 |
| 1294 | 3007616926 | 3007614139 | Bacteria | 6053559 |
| 1295 | 3007625631 | 3007619802 | Bacteria | 6411688 |
| 1296 | 3007718853 | 3007718800 | Bacteria | 5971527 |
| 1297 | 3007857832 | 3007855910 | Bacteria | 5637581 |
| 1298 | 3007865355 | 3007861166 | Bacteria | 6045338 |
| 1299 | 3007870212 | 3007866637 | Bacteria | 5899198 |
| 1300 | 3007875539 | 3007872151 | Bacteria | 5268868 |
| 1301 | 637321539 | 637000220 | Bacteria | 7074893 |
| 1302 | 640488431 | 640427133 | Bacteria | 4567418 |
| 1303 | 651176466 | 651053060 | Bacteria | 4689946 |
| 1304 | 8011355474 | 8011350971 | Bacteria | 6158957 |
| 1305 | 8015691996 | 8015687852 | Bacteria | 6613826 |
| 1306 | 8019774454 | 8019769354 | Bacteria | 6924660 |
| 1307 | 8019780914 | 8019775933 | Bacteria | 6858656 |
| 1308 | 8029996951 | 8029995093 | Bacteria | 5990776 |
| 1309 | 8034967081 | 8034962539 | Bacteria | 4884839 |
| 1310 | 8054285646 | 8054285046 | Bacteria | 6919322 |
| 1311 | 8054350783 | 8054347763 | Bacteria | 5901107 |
| 1312 | 8054507457 | 8054503363 | Bacteria | 6101651 |
| 1313 | 8055775205 | 8055770955 | Bacteria | 6827675 |
| 1314 | 8055822400 | 8055817908 | Bacteria | 6609162 |
| 1315 | 8055880667 | 8055878733 | Bacteria | 5907058 |
| 1316 | 8056124324 | 8056120720 | Bacteria | 5758328 |
| 1317 | 8056127632 | 8056125926 | Bacteria | 6228218 |
| 1318 | 8056135862 | 8056131705 | Bacteria | 6107031 |
| 1319 | 8056139183 | 8056137416 | Bacteria | 6147080 |
| 1320 | 8056147201 | 8056143049 | Bacteria | 6307666 |
| 1321 | 8056153181 | 8056148874 | Bacteria | 6479865 |
| 1322 | 8056157254 | 8056155041 | Bacteria | 6486948 |
| 1323 | 8056167350 | 8056166840 | Bacteria | 5820959 |
| 1324 | 8056173334 | 8056172158 | Bacteria | 6133900 |
| 1325 | 8056179529 | 8056177738 | Bacteria | 6748268 |
| 1326 | 8056572669 | 8056569372 | Bacteria | 5997322 |
| 1327 | 8057804018 | 8057798959 | Bacteria | 6713499 |
| 1328 | Ga0495643_0069346 | |||
| 1329 | MRS2a_Contig_10550 | |||
| 1330 | SwRhRL2b_contig_2353446 | |||
| 1331 | LJQas_1001013 | |||
| 1332 | JGI25162J39368_1000077 | |||
| 1333 | JGI25162J39368_1000166 | |||
| 1334 | JGI25163J39215_1000050 | |||
| 1335 | JGI25163J39215_1000126 | |||
| 1336 | JGI25164J39214_1000054 | |||
| 1337 | JGI25164J39214_1000129 | |||
| 1338 | JGI25165J46597_1000141 | |||
| 1339 | JGI25165J46597_1000251 | |||
| 1340 | Ga0055539_1000397 | |||
| 1341 | Ga0055533_1000398 | |||
| 1342 | Ga0055532_1000498 | |||
| 1343 | Ga0055525_1000553 | |||
| 1344 | Ga0055535_1005868 | |||
| 1345 | Ga0055536_1000056 | |||
| 1346 | Ga0055530_10000053 | |||
| 1347 | Ga0055530_10000207 | |||
| 1348 | Ga0055530_10000289 | |||
| 1349 | Ga0055530_10013416 | |||
| 1350 | Ga0055540_1000105 | |||
| 1351 | Ga0055540_1000223 | |||
| 1352 | Ga0055540_1000252 | |||
| 1353 | Ga0055531_10000081 | |||
| 1354 | Ga0055541_1000284 | |||
| 1355 | Ga0065714_10000863 | |||
| 1356 | Ga0065714_10002088 | |||
| 1357 | Ga0065714_10002591 | |||
| 1358 | Ga0065714_10011610 | |||
| 1359 | Ga0065714_10064635 | |||
| 1360 | Ga0065714_10066292 | |||
| 1361 | Ga0065714_10124098 | |||
| 1362 | Ga0065704_10009390 | |||
| 1363 | Ga0065704_10070462 | |||
| 1364 | Ga0065704_10072302 | |||
| 1365 | Ga0065712_10003415 | |||
| 1366 | Ga0065712_10070642 | |||
| 1367 | Ga0070670_100000224 | |||
| 1368 | Ga0070670_100005116 | |||
| 1369 | Ga0070661_100000129 | |||
| 1370 | Ga0070661_100140662 | |||
| 1371 | Ga0070669_100039248 | |||
| 1372 | Ga0070662_100000056 | |||
| 1373 | Ga0070662_100295463 | |||
| 1374 | Ga0068853_100008738 | |||
| 1375 | Ga0070665_100023251 | |||
| 1376 | Ga0070664_100000076 | |||
| 1377 | Ga0068854_100019114 | |||
| 1378 | Ga0068851_10000028 | |||
| 1379 | Ga0075364_10069077 | |||
| 1380 | Ga0075364_10174999 | |||
| 1381 | Ga0075432_10001856 | |||
| 1382 | Ga0075432_10003869 | |||
| 1383 | Ga0075432_10025706 | |||
| 1384 | Ga0075432_10025862 | |||
| 1385 | Ga0075362_10041391 | |||
| 1386 | Ga0075362_10081906 | |||
| 1387 | Ga0075436_100040355 | |||
| 1388 | Ga0075436_100091192 | |||
| 1389 | Ga0079104_1000124 | |||
| 1390 | Ga0079104_1000366 | |||
| 1391 | Ga0079104_1003222 | |||
| 1392 | Ga0099826_10082690 | |||
| 1393 | Ga0105251_10000246 | |||
| 1394 | Ga0105251_10000346 | |||
| 1395 | Ga0105251_10003362 | |||
| 1396 | Ga0105251_10010591 | |||
| 1397 | Ga0105251_10025786 | |||
| 1398 | Ga0105251_10037773 | |||
| 1399 | Ga0105251_10052759 | |||
| 1400 | Ga0105251_10076807 | |||
| 1401 | Ga0105251_10104524 | |||
| 1402 | Ga0105251_10127848 | |||
| 1403 | Ga0105251_10152509 | |||
| 1404 | Ga0105244_10000322 | |||
| 1405 | Ga0105244_10003784 | |||
| 1406 | Ga0105244_10004417 | |||
| 1407 | Ga0105244_10016269 | |||
| 1408 | Ga0105244_10021702 | |||
| 1409 | Ga0105244_10062642 | |||
| 1410 | Ga0105244_10096463 | |||
| 1411 | Ga0105244_10151973 | |||
| 1412 | Ga0105244_10197055 | |||
| 1413 | Ga0105250_10000121 | |||
| 1414 | Ga0105250_10000197 | |||
| 1415 | Ga0105250_10003418 | |||
| 1416 | Ga0105250_10005272 | |||
| 1417 | Ga0105250_10039373 | |||
| 1418 | Ga0105250_10047819 | |||
| 1419 | Ga0105250_10091899 | |||
| 1420 | Ga0105243_10000103 | |||
| 1421 | Ga0105243_10000125 | |||
| 1422 | Ga0105242_10000262 | |||
| 1423 | Ga0105242_10266840 | |||
| 1424 | Ga0105237_10004232 | |||
| 1425 | Ga0105249_10156208 | |||
| 1426 | Ga0105246_10000465 | |||
| 1427 | Ga0105246_10044709 | |||
| 1428 | Ga0157345_1000026 | |||
| 1429 | Ga0157345_1003343 | |||
| 1430 | Ga0157373_10008441 | |||
| 1431 | Ga0157373_10011262 | |||
| 1432 | Ga0157373_10011363 | |||
| 1433 | Ga0157373_10012383 | |||
| 1434 | Ga0157373_10094238 | |||
| 1435 | Ga0157373_10148716 | |||
| 1436 | Ga0157373_10148798 | |||
| 1437 | Ga0157371_10000306 | |||
| 1438 | Ga0157371_10000390 | |||
| 1439 | Ga0157371_10194875 | |||
| 1440 | Ga0157370_10033160 | |||
| 1441 | Ga0157370_10083572 | |||
| 1442 | Ga0157370_10113868 | |||
| 1443 | Ga0157370_10183728 | |||
| 1444 | Ga0157370_10275306 | |||
| 1445 | Ga0157370_10384450 | |||
| 1446 | Ga0157369_10001322 | |||
| 1447 | Ga0157369_10003284 | |||
| 1448 | Ga0157369_10009106 | |||
| 1449 | Ga0157369_10017341 | |||
| 1450 | Ga0157369_10044243 | |||
| 1451 | Ga0157369_10053910 | |||
| 1452 | Ga0157369_10409271 | |||
| 1453 | Ga0163162_10166529 | |||
| 1454 | Ga0163162_10851791 | |||
| 1455 | Ga0157375_10014302 | |||
| 1456 | Ga0157375_10019095 | |||
| 1457 | Ga0157375_10378876 | |||
| 1458 | Ga0157375_10600020 | |||
| 1459 | Ga0182008_10000074 | |||
| 1460 | Ga0182008_10002714 | |||
| 1461 | Ga0182008_10006416 | |||
| 1462 | Ga0182008_10008564 | |||
| 1463 | Ga0182008_10010739 | |||
| 1464 | Ga0182008_10033126 | |||
| 1465 | Ga0182008_10055865 | |||
| 1466 | Ga0182008_10100509 | |||
| 1467 | Ga0182008_10106489 | |||
| 1468 | Ga0182006_1000183 | |||
| 1469 | Ga0182006_1000326 | |||
| 1470 | Ga0182006_1016610 | |||
| 1471 | Ga0182006_1021201 | |||
| 1472 | Ga0182006_1034989 | |||
| 1473 | Ga0182007_10000903 | |||
| 1474 | Ga0182007_10028972 | |||
| 1475 | Ga0182007_10036317 | |||
| 1476 | Ga0182005_1006086 | |||
| 1477 | Ga0182005_1013483 | |||
| 1478 | Ga0182005_1016499 | |||
| 1479 | Ga0182005_1047809 | |||
| 1480 | Ga0163161_10000156 | |||
| 1481 | Ga0163161_10001710 | |||
| 1482 | Ga0163161_10005911 | |||
| 1483 | Ga0163161_10007848 | |||
| 1484 | Ga0163161_10018572 | |||
| 1485 | Ga0163161_10057889 | |||
| 1486 | Ga0163161_10103105 | |||
| 1487 | Ga0163161_10204507 | |||
| 1488 | Ga0163161_10207815 | |||
| 1489 | Ga0163161_10221681 | |||
| 1490 | Ga0163161_10310071 | |||
| 1491 | Ga0209760_100043 | |||
| 1492 | Ga0209760_100054 | |||
| 1493 | Ga0209784_100017 | |||
| 1494 | Ga0209566_100014 | |||
| 1495 | Ga0209674_100028 | |||
| 1496 | Ga0209147_100038 | |||
| 1497 | Ga0209563_100032 | |||
| 1498 | Ga0209563_100539 | |||
| 1499 | Ga0207427_100047 | |||
| 1500 | Ga0207427_100074 | |||
| 1501 | Ga0209437_100006 | |||
| 1502 | Ga0209437_100009 | |||
| 1503 | Ga0209437_102308 | |||
| 1504 | Ga0209258_100828 | |||
| 1505 | Ga0209646_1000171 | |||
| 1506 | Ga0209677_100018 | |||
| 1507 | Ga0209233_1000032 | |||
| 1508 | Ga0209233_1000105 | |||
| 1509 | Ga0209675_1008919 | |||
| 1510 | Ga0209676_1000006 | |||
| 1511 | Ga0209676_1000010 | |||
| 1512 | Ga0209676_1000223 | |||
| 1513 | Ga0209676_1000726 | |||
| 1514 | Ga0209676_1005261 | |||
| 1515 | Ga0209676_1005993 | |||
| 1516 | Ga0209050_1000009 | |||
| 1517 | Ga0209050_1000081 | |||
| 1518 | Ga0209050_1000214 | |||
| 1519 | Ga0209050_1000363 | |||
| 1520 | Ga0209051_1000008 | |||
| 1521 | Ga0209051_1000171 | |||
| 1522 | Ga0209051_1000185 | |||
| 1523 | Ga0209051_1003321 | |||
| 1524 | Ga0209257_1000040 | |||
| 1525 | Ga0209257_1005621 | |||
| 1526 | Ga0207656_10000056 | |||
| 1527 | Ga0207696_1000043 | |||
| 1528 | Ga0207696_1000117 | |||
| 1529 | Ga0207696_1000193 | |||
| 1530 | Ga0207696_1000236 | |||
| 1531 | Ga0207696_1001821 | |||
| 1532 | Ga0207696_1001827 | |||
| 1533 | Ga0207696_1003801 | |||
| 1534 | Ga0207696_1023291 | |||
| 1535 | Ga0207696_1039886 | |||
| 1536 | Ga0207696_1052748 | |||
| 1537 | Ga0207655_1000095 | |||
| 1538 | Ga0207655_1000505 | |||
| 1539 | Ga0207655_1000653 | |||
| 1540 | Ga0207655_1003157 | |||
| 1541 | Ga0207655_1004980 | |||
| 1542 | Ga0207655_1015627 | |||
| 1543 | Ga0207655_1030241 | |||
| 1544 | Ga0207655_1037393 | |||
| 1545 | Ga0207655_1061214 | |||
| 1546 | Ga0207655_1088631 | |||
| 1547 | Ga0207713_1000160 | |||
| 1548 | Ga0207713_1000236 | |||
| 1549 | Ga0207713_1000386 | |||
| 1550 | Ga0207713_1000431 | |||
| 1551 | Ga0207713_1001314 | |||
| 1552 | Ga0207713_1001388 | |||
| 1553 | Ga0207713_1002492 | |||
| 1554 | Ga0207713_1003319 | |||
| 1555 | Ga0207713_1022906 | |||
| 1556 | Ga0207713_1066067 | |||
| 1557 | Ga0207713_1067619 | |||
| 1558 | Ga0207713_1074670 | |||
| 1559 | Ga0207649_10000017 | |||
| 1560 | Ga0207681_10127324 | |||
| 1561 | Ga0207650_10000220 | |||
| 1562 | Ga0207650_10000291 | |||
| 1563 | Ga0207706_10000445 | |||
| 1564 | Ga0207706_10054271 | |||
| 1565 | Ga0207686_10164611 | |||
| 1566 | Ga0207709_10000035 | |||
| 1567 | Ga0207709_10000282 | |||
| 1568 | Ga0207709_10254821 | |||
| 1569 | Ga0207709_10312264 | |||
| 1570 | Ga0207679_10000005 | |||
| 1571 | Ga0207640_10093340 | |||
| 1572 | Ga0207639_10006034 | |||
| 1573 | Ga0209281_1000018 | |||
| 1574 | Ga0209281_1000077 | |||
| 1575 | Ga0209281_1005173 | |||
| 1576 | Ga0209281_1006559 | |||
| 1577 | Ga0209371_1000476 | |||
| 1578 | Ga0209371_1000567 | |||
| 1579 | Ga0207428_10026351 | |||
| 1580 | Ga0207428_10104360 | |||
| 1581 | Ga0207428_10108634 | |||
| 1582 | Ga0207428_10126765 | |||
| 1583 | Ga0268266_10288249 | |||
| 1584 | Ga0307517_10037404 | |||
| 1585 | Ga0268256_1000495 | |||
| 1586 | Ga0307511_10111167 | |||
| 1587 | Ga0307511_10178920 | |||
| 1588 | Ga0314311_1023959 | |||
| 1589 | Ga0316178_1101239 | |||
| 1590 | Ga0307408_100000027 | |||
| 1591 | Ga0307408_100000568 | |||
| 1592 | Ga0307408_100002079 | |||
| 1593 | Ga0307408_100004691 | |||
| 1594 | Ga0307408_100091565 | |||
| 1595 | Ga0307516_10326683 | |||
| 1596 | Ga0307405_10000098 | |||
| 1597 | Ga0307405_10000715 | |||
| 1598 | Ga0307405_10014867 | |||
| 1599 | Ga0307405_10018333 | |||
| 1600 | Ga0307413_10003256 | |||
| 1601 | Ga0307406_10104231 | |||
| 1602 | Ga0307407_10010845 | |||
| 1603 | Ga0307407_10036968 | |||
| 1604 | Ga0307412_10000455 | |||
| 1605 | Ga0307412_10001586 | |||
| 1606 | Ga0307412_10002587 | |||
| 1607 | Ga0307412_10316620 | |||
| 1608 | Ga0307409_100009914 | |||
| 1609 | Ga0307409_100420445 | |||
| 1610 | Ga0307414_10001581 | |||
| 1611 | Ga0307414_10071579 | |||
| 1612 | Ga0307414_10150116 | |||
| 1613 | Ga0307414_10150125 | |||
| 1614 | Ga0307411_10008396 | |||
| 1615 | Ga0307510_10036596 | |||
| 1616 | Ga0439438_000117 | |||
| 1617 | Ga0439438_000138 | |||
| 1618 | Ga0439438_000692 | |||
| 1619 | Ga0439438_001443 | |||
| 1620 | Ga0439438_002094 | |||
| 1621 | Ga0439438_004545 | |||
| 1622 | Ga0439438_005070 | |||
| 1623 | Ga0439438_007763 | |||
| 1624 | Ga0439438_034960 | |||
| 1625 | Ga0439447_000258 | |||
| 1626 | Ga0439447_000342 | |||
| 1627 | Ga0439447_001057 | |||
| 1628 | Ga0439447_003181 | |||
| 1629 | Ga0439447_010153 | |||
| 1630 | Ga0439447_012208 | |||
| 1631 | Ga0439447_034074 | |||
| 1632 | Ga0439447_041606 | |||
| 1633 | Ga0439447_050687 | |||
| 1634 | Ga0439466_0001610 | |||
| 1635 | Ga0439466_0004106 | |||
| 1636 | Ga0439466_0004348 | |||
| 1637 | Ga0439466_0010175 | |||
| 1638 | Ga0439466_0010758 | |||
| 1639 | Ga0439466_0011397 | |||
| 1640 | Ga0439466_0011933 | |||
| 1641 | Ga0439466_0034528 | |||
| 1642 | Ga0439466_0038887 | |||
| 1643 | Ga0439465_0007875 | |||
| 1644 | Ga0439465_0052045 | |||
| 1645 | Ga0439431_0002171 | |||
| 1646 | Ga0439437_000067 | |||
| 1647 | Ga0439442_026666 | |||
| 1648 | Ga0439445_0065490 | |||
| 1649 | Ga0439432_000381 | |||
| 1650 | Ga0439432_000984 | |||
| 1651 | Ga0439432_001089 | |||
| 1652 | Ga0439432_002856 | |||
| 1653 | Ga0439451_001699 | |||
| 1654 | Ga0439451_013712 | |||
| 1655 | Ga0439451_025234 | |||
| 1656 | Ga0439451_025658 | |||
| 1657 | Ga0439452_000091 | |||
| 1658 | Ga0439452_000164 | |||
| 1659 | Ga0439452_000322 | |||
| 1660 | Ga0439452_000524 | |||
| 1661 | Ga0439452_003633 | |||
| 1662 | Ga0439452_006049 | |||
| 1663 | Ga0439452_014757 | |||
| 1664 | Ga0439452_016910 | |||
| 1665 | Ga0439452_041546 | |||
| 1666 | Ga0439456_000045 | |||
| 1667 | Ga0439456_002373 | |||
| 1668 | Ga0439456_003419 | |||
| 1669 | Ga0439456_005531 | |||
| 1670 | Ga0439456_010849 | |||
| 1671 | Ga0439456_011271 | |||
| 1672 | Ga0439456_018992 | |||
| 1673 | Ga0439463_003000 | |||
| 1674 | Ga0439463_003640 | |||
| 1675 | Ga0439463_003941 | |||
| 1676 | Ga0450911_000007 | |||
| 1677 | Ga0450911_000025 | |||
| 1678 | Ga0450911_000285 | |||
| 1679 | Ga0450911_000819 | |||
| 1680 | Ga0450911_005841 | |||
| 1681 | Ga0450911_008028 | |||
| 1682 | Ga0450919_000324 | |||
| 1683 | Ga0450920_000330 | |||
| 1684 | Ga0450922_000316 | |||
| 1685 | Ga0450922_002973 | |||
| 1686 | Ga0450922_004111 | |||
| 1687 | Ga0450888_007247 | |||
| 1688 | Ga0450890_000333 | |||
| 1689 | Ga0450891_004238 | |||
| 1690 | Ga0450900_000440 | |||
| 1691 | Ga0450902_002650 | |||
| 1692 | Ga0450902_003440 | |||
| 1693 | Ga0450902_004563 | |||
| 1694 | Ga0450902_029637 | |||
| 1695 | Ga0450903_000963 | |||
| 1696 | Ga0450903_005649 | |||
| 1697 | Ga0450903_005708 | |||
| 1698 | Ga0450903_007957 | |||
| 1699 | Ga0450903_021959 | |||
| 1700 | Ga0450904_000540 | |||
| 1701 | Ga0450904_000696 | |||
| 1702 | Ga0450904_002256 | |||
| 1703 | Ga0450905_010401 | |||
| 1704 | Ga0450905_014524 | |||
| 1705 | Ga0450906_001348 | |||
| 1706 | Ga0450906_007455 | |||
| 1707 | Ga0450907_000038 | |||
| 1708 | Ga0450907_000289 | |||
| 1709 | Ga0450907_003900 | |||
| 1710 | Ga0450907_011841 | |||
| 1711 | Ga0450907_029680 | |||
| 1712 | Ga0450910_000632 | |||
| 1713 | Ga0450910_000871 | |||
| 1714 | Ga0450910_004054 | |||
| 1715 | Ga0439446_0001125 | |||
| 1716 | Ga0439446_0001583 | |||
| 1717 | Ga0450908_002497 | |||
| 1718 | Ga0450908_005166 | |||
| 1719 | Ga0450909_000109 | |||
| 1720 | Ga0450909_000608 | |||
| 1721 | Ga0450909_005115 | |||
| 1722 | Ga0439434_0001885 | |||
| 1723 | Ga0439434_0003647 | |||
| 1724 | Ga0439459_0025402 | |||
| 1725 | Ga0439464_0006072 | |||
| 1726 | Ga0439464_0009275 | |||
| 1727 | Ga0439464_0080873 | |||
| 1728 | Ga0439460_0000015 | |||
| 1729 | Ga0439460_0000042 | |||
| 1730 | Ga0439460_0006105 | |||
| 1731 | Ga0450916_005370 | |||
| 1732 | Ga0450918_001890 | |||
| 1733 | Ga0450893_0001157 | |||
| 1734 | Ga0450893_0009815 | |||
| 1735 | Ga0450901_000820 | |||
| 1736 | Ga0439440_0000863 | |||
| 1737 | Ga0439440_0014781 | |||
| 1738 | Ga0439440_0023122 | |||
| 1739 | Ga0466969_0031529 | |||
| 1740 | Ga0466966_0037958 | |||
| 1741 | Ga0466961_0049036 | |||
| 1742 | Ga0466971_0001483 | |||
| 1743 | Ga0466959_0077728 | |||
| 1744 | Ga0495617_000212 | |||
| 1745 | Ga0495617_003552 | |||
| 1746 | Ga0495617_005182 | |||
| 1747 | Ga0495617_011057 | |||
| 1748 | Ga0495617_017722 | |||
| 1749 | Ga0495617_019279 | |||
| 1750 | Ga0495617_040861 | |||
| 1751 | Ga0495617_041749 | |||
| 1752 | Ga0495617_042418 | |||
| 1753 | Ga0495617_057152 | |||
| 1754 | Ga0495617_069281 | |||
| 1755 | Ga0495617_069838 | |||
| 1756 | Ga0495617_080049 | |||
| 1757 | Ga0495627_000447 | |||
| 1758 | Ga0495627_000546 | |||
| 1759 | Ga0495627_001568 | |||
| 1760 | Ga0495627_026877 | |||
| 1761 | Ga0495627_039052 | |||
| 1762 | Ga0495627_046736 | |||
| 1763 | Ga0495627_048293 | |||
| 1764 | Ga0495592_0019163 | |||
| 1765 | Ga0495603_0011766 | |||
| 1766 | Ga0495603_0017975 | |||
| 1767 | Ga0495603_0111421 | |||
| 1768 | Ga0495603_0179170 | |||
| 1769 | Ga0495590_0000265 | |||
| 1770 | Ga0495590_0002283 | |||
| 1771 | Ga0495590_0004346 | |||
| 1772 | Ga0495590_0014126 | |||
| 1773 | Ga0495590_0022580 | |||
| 1774 | Ga0495590_0032562 | |||
| 1775 | Ga0495590_0059716 | |||
| 1776 | Ga0495590_0068450 | |||
| 1777 | Ga0495591_000107 | |||
| 1778 | Ga0495591_000114 | |||
| 1779 | Ga0495591_000510 | |||
| 1780 | Ga0495591_000564 | |||
| 1781 | Ga0495591_001758 | |||
| 1782 | Ga0495591_006046 | |||
| 1783 | Ga0495591_008531 | |||
| 1784 | Ga0495591_017387 | |||
| 1785 | Ga0495591_026348 | |||
| 1786 | Ga0495591_027187 | |||
| 1787 | Ga0495591_034355 | |||
| 1788 | Ga0495591_038509 | |||
| 1789 | Ga0495591_042044 | |||
| 1790 | Ga0495591_042807 | |||
| 1791 | Ga0495591_043354 | |||
| 1792 | Ga0495629_0028182 | |||
| 1793 | Ga0495629_0358340 | |||
| 1794 | Ga0495638_0002379 | |||
| 1795 | Ga0495638_0005160 | |||
| 1796 | Ga0495638_0007927 | |||
| 1797 | Ga0495638_0013146 | |||
| 1798 | Ga0495638_0022609 | |||
| 1799 | Ga0495638_0024227 | |||
| 1800 | Ga0495638_0026757 | |||
| 1801 | Ga0495638_0050191 | |||
| 1802 | Ga0495638_0086245 | |||
| 1803 | Ga0495638_0095658 | |||
| 1804 | Ga0495638_0098502 | |||
| 1805 | Ga0495638_0180063 | |||
| 1806 | Ga0495638_0230563 | |||
| 1807 | Ga0495653_0001538 | |||
| 1808 | Ga0495653_0002108 | |||
| 1809 | Ga0495653_0017431 | |||
| 1810 | Ga0495653_0054646 | |||
| 1811 | Ga0495653_0138609 | |||
| 1812 | Ga0495650_0003005 | |||
| 1813 | Ga0495650_0003809 | |||
| 1814 | Ga0495650_0009106 | |||
| 1815 | Ga0495650_0010804 | |||
| 1816 | Ga0495650_0013393 | |||
| 1817 | Ga0495650_0028350 | |||
| 1818 | Ga0495650_0035896 | |||
| 1819 | Ga0495650_0056508 | |||
| 1820 | Ga0495580_0329938 | |||
| 1821 | Ga0495582_0001299 | |||
| 1822 | Ga0495605_0000527 | |||
| 1823 | Ga0495605_0001722 | |||
| 1824 | Ga0495605_0003443 | |||
| 1825 | Ga0495605_0006505 | |||
| 1826 | Ga0495605_0007072 | |||
| 1827 | Ga0495605_0008406 | |||
| 1828 | Ga0495605_0014756 | |||
| 1829 | Ga0495605_0015319 | |||
| 1830 | Ga0495605_0074079 | |||
| 1831 | Ga0495605_0083761 | |||
| 1832 | Ga0495605_0112119 | |||
| 1833 | Ga0495605_0126318 | |||
| 1834 | Ga0495605_0181683 | |||
| 1835 | Ga0495639_0000013 | |||
| 1836 | Ga0495639_0075352 | |||
| 1837 | Ga0495584_0000217 | |||
| 1838 | Ga0495584_0000278 | |||
| 1839 | Ga0495584_0001274 | |||
| 1840 | Ga0495584_0001920 | |||
| 1841 | Ga0495584_0007817 | |||
| 1842 | Ga0495584_0008228 | |||
| 1843 | Ga0495584_0010755 | |||
| 1844 | Ga0495584_0019971 | |||
| 1845 | Ga0495584_0041118 | |||
| 1846 | Ga0495584_0068146 | |||
| 1847 | Ga0495584_0191547 | |||
| 1848 | Ga0495585_0000245 | |||
| 1849 | Ga0495585_0000517 | |||
| 1850 | Ga0495585_0000833 | |||
| 1851 | Ga0495585_0008745 | |||
| 1852 | Ga0495585_0009287 | |||
| 1853 | Ga0495585_0010240 | |||
| 1854 | Ga0495585_0040723 | |||
| 1855 | Ga0495585_0044488 | |||
| 1856 | Ga0495585_0066610 | |||
| 1857 | Ga0495585_0073263 | |||
| 1858 | Ga0495585_0168621 | |||
| 1859 | Ga0495585_0212602 | |||
| 1860 | Ga0495594_0013684 | |||
| 1861 | Ga0495594_0017879 | |||
| 1862 | Ga0495596_0000107 | |||
| 1863 | Ga0495596_0057248 | |||
| 1864 | Ga0495596_0059182 | |||
| 1865 | Ga0495607_0000159 | |||
| 1866 | Ga0495607_0000481 | |||
| 1867 | Ga0495607_0004323 | |||
| 1868 | Ga0495607_0007936 | |||
| 1869 | Ga0495607_0010563 | |||
| 1870 | Ga0495607_0011073 | |||
| 1871 | Ga0495607_0011842 | |||
| 1872 | Ga0495607_0012275 | |||
| 1873 | Ga0495607_0094237 | |||
| 1874 | Ga0495607_0102138 | |||
| 1875 | Ga0495607_0121153 | |||
| 1876 | Ga0495607_0177287 | |||
| 1877 | Ga0495583_0000940 | |||
| 1878 | Ga0495583_0001057 | |||
| 1879 | Ga0495583_0005829 | |||
| 1880 | Ga0495583_0008936 | |||
| 1881 | Ga0495583_0012029 | |||
| 1882 | Ga0495583_0091769 | |||
| 1883 | Ga0495583_0105237 | |||
| 1884 | Ga0495606_0001068 | |||
| 1885 | Ga0495606_0001228 | |||
| 1886 | Ga0495606_0001970 | |||
| 1887 | Ga0495606_0005181 | |||
| 1888 | Ga0495606_0006186 | |||
| 1889 | Ga0495606_0009328 | |||
| 1890 | Ga0495606_0014155 | |||
| 1891 | Ga0495606_0014874 | |||
| 1892 | Ga0495606_0133854 | |||
| 1893 | Ga0495606_0177182 | |||
| 1894 | Ga0495606_0201311 | |||
| 1895 | Ga0495610_0000761 | |||
| 1896 | Ga0495610_0001028 | |||
| 1897 | Ga0495610_0004209 | |||
| 1898 | Ga0495610_0008784 | |||
| 1899 | Ga0495610_0021737 | |||
| 1900 | Ga0495610_0045277 | |||
| 1901 | Ga0495610_0063796 | |||
| 1902 | Ga0495610_0084036 | |||
| 1903 | Ga0495610_0092052 | |||
| 1904 | Ga0495610_0104033 | |||
| 1905 | Ga0495610_0148205 | |||
| 1906 | Ga0495616_0000340 | |||
| 1907 | Ga0495616_0000482 | |||
| 1908 | Ga0495616_0003085 | |||
| 1909 | Ga0495616_0004013 | |||
| 1910 | Ga0495616_0004787 | |||
| 1911 | Ga0495616_0008162 | |||
| 1912 | Ga0495616_0038561 | |||
| 1913 | Ga0495616_0041694 | |||
| 1914 | Ga0495616_0052511 | |||
| 1915 | Ga0495616_0133335 | |||
| 1916 | Ga0495620_0002431 | |||
| 1917 | Ga0495620_0002541 | |||
| 1918 | Ga0495620_0003730 | |||
| 1919 | Ga0495620_0006094 | |||
| 1920 | Ga0495620_0006397 | |||
| 1921 | Ga0495620_0007878 | |||
| 1922 | Ga0495620_0009093 | |||
| 1923 | Ga0495620_0032902 | |||
| 1924 | Ga0495620_0035670 | |||
| 1925 | Ga0495628_0117502 | |||
| 1926 | Ga0495630_0016876 | |||
| 1927 | Ga0495630_0380306 | |||
| 1928 | Ga0495630_0541814 | |||
| 1929 | Ga0495631_0000020 | |||
| 1930 | Ga0495631_0000384 | |||
| 1931 | Ga0495631_0001218 | |||
| 1932 | Ga0495631_0023273 | |||
| 1933 | Ga0495631_0036625 | |||
| 1934 | Ga0495631_0067125 | |||
| 1935 | Ga0495631_0095450 | |||
| 1936 | Ga0495631_0121549 | |||
| 1937 | Ga0495632_0000436 | |||
| 1938 | Ga0495632_0000790 | |||
| 1939 | Ga0495632_0001749 | |||
| 1940 | Ga0495632_0006326 | |||
| 1941 | Ga0495632_0009407 | |||
| 1942 | Ga0495632_0010362 | |||
| 1943 | Ga0495632_0015019 | |||
| 1944 | Ga0495632_0057077 | |||
| 1945 | Ga0495632_0059776 | |||
| 1946 | Ga0495632_0095753 | |||
| 1947 | Ga0495632_0104075 | |||
| 1948 | Ga0495632_0156500 | |||
| 1949 | Ga0495637_0000420 | |||
| 1950 | Ga0495637_0000447 | |||
| 1951 | Ga0495637_0000616 | |||
| 1952 | Ga0495637_0004512 | |||
| 1953 | Ga0495637_0007849 | |||
| 1954 | Ga0495637_0007946 | |||
| 1955 | Ga0495637_0011163 | |||
| 1956 | Ga0495637_0012083 | |||
| 1957 | Ga0495637_0024469 | |||
| 1958 | Ga0495637_0050887 | |||
| 1959 | Ga0495637_0051817 | |||
| 1960 | Ga0495637_0065186 | |||
| 1961 | Ga0495637_0069073 | |||
| 1962 | Ga0495637_0072952 | |||
| 1963 | Ga0495637_0073142 | |||
| 1964 | Ga0495637_0088557 | |||
| 1965 | Ga0495637_0119652 | |||
| 1966 | Ga0495643_0009226 | |||
| 1967 | Ga0495643_0032663 | |||
| 1968 | Ga0495643_0068930 | |||
| 1969 | Ga0495643_0086265 | |||
| 1970 | Ga0495643_0096026 | |||
| 1971 | Ga0495643_0098837 | |||
| 1972 | Ga0495643_0100343 | |||
| 1973 | Ga0495643_0135672 | |||
| 1974 | Ga0495643_0220944 | |||
| 1975 | Ga0495644_0000508 | |||
| 1976 | Ga0495644_0001364 | |||
| 1977 | Ga0495644_0004014 | |||
| 1978 | Ga0495644_0013052 | |||
| 1979 | Ga0495644_0110763 | |||
| 1980 | Ga0495648_0000627 | |||
| 1981 | Ga0495648_0004814 | |||
| 1982 | Ga0495648_0008719 | |||
| 1983 | Ga0495648_0011596 | |||
| 1984 | Ga0495648_0015170 | |||
| 1985 | Ga0495648_0015709 | |||
| 1986 | Ga0495648_0032404 | |||
| 1987 | Ga0495648_0044796 | |||
| 1988 | Ga0495648_0101852 | |||
| 1989 | Ga0495648_0103065 | |||
| 1990 | Ga0495666_0000190 | |||
| 1991 | Ga0495666_0076716 | |||
| 1992 | Ga0495666_0109258 | |||
| 1993 | Ga0495666_0133493 | |||
| 1994 | Ga0495642_0000033 | |||
| 1995 | Ga0495642_0003810 | |||
| 1996 | Ga0495642_0004030 | |||
| 1997 | Ga0495654_0000111 | |||
| 1998 | Ga0495654_0000324 | |||
| 1999 | Ga0495654_0000982 | |||
| 2000 | Ga0495654_0001457 | |||
| 2001 | Ga0495654_0002442 | |||
| 2002 | Ga0495654_0002703 | |||
| 2003 | Ga0495654_0008833 | |||
| 2004 | Ga0495654_0009372 | |||
| 2005 | Ga0495654_0022377 | |||
| 2006 | Ga0495654_0033964 | |||
| 2007 | Ga0495654_0035810 | |||
| 2008 | Ga0495654_0072251 | |||
| 2009 | Ga0495654_0078112 | |||
| 2010 | Ga0495654_0097271 | |||
| 2011 | Ga0495654_0111693 | |||
| 2012 | Ga0495586_0086720 | |||
| 2013 | Ga0495587_0002320 | |||
| 2014 | Ga0495587_0003070 | |||
| 2015 | Ga0495587_0202708 | |||
| 2016 | Ga0495609_0000405 | |||
| 2017 | Ga0495609_0001082 | |||
| 2018 | Ga0495609_0001836 | |||
| 2019 | Ga0495609_0009790 | |||
| 2020 | Ga0495609_0020117 | |||
| 2021 | Ga0495609_0027384 | |||
| 2022 | Ga0495609_0042754 | |||
| 2023 | Ga0495609_0043112 | |||
| 2024 | Ga0495609_0069249 | |||
| 2025 | Ga0495609_0107240 | |||
| 2026 | Ga0495597_0000574 | |||
| 2027 | Ga0495597_0009866 | |||
| 2028 | Ga0495597_0016247 | |||
| 2029 | Ga0495597_0030105 | |||
| 2030 | Ga0495597_0032214 | |||
| 2031 | Ga0495597_0032741 | |||
| 2032 | Ga0495597_0034430 | |||
| 2033 | Ga0495597_0048373 | |||
| 2034 | Ga0495597_0071452 | |||
| 2035 | Ga0495597_0074410 | |||
| 2036 | Ga0495645_0039611 | |||
| 2037 | Ga0495622_0000346 | |||
| 2038 | Ga0495622_0000757 | |||
| 2039 | Ga0495622_0004784 | |||
| 2040 | Ga0495622_0008858 | |||
| 2041 | Ga0495622_0011151 | |||
| 2042 | Ga0495622_0075313 | |||
| 2043 | Ga0495633_0000960 | |||
| 2044 | Ga0495633_0001099 | |||
| 2045 | Ga0495633_0012421 | |||
| 2046 | Ga0495633_0029328 | |||
| 2047 | Ga0495633_0145317 | |||
| 2048 | Ga0495656_0012009 | |||
| 2049 | Ga0495656_0078864 | |||
| 2050 | Ga0495668_0000568 | |||
| 2051 | Ga0495668_0004429 | |||
| 2052 | Ga0495668_0009846 | |||
| 2053 | Ga0495668_0030647 | |||
| 2054 | Ga0495668_0037155 | |||
| 2055 | Ga0495668_0114437 | |||
| 2056 | Ga0495668_0219419 | |||
| 2057 | Ga0495634_0000604 | |||
| 2058 | Ga0495634_0246064 | |||
| 2059 | Ga0495611_0000220 | |||
| 2060 | Ga0495611_0005422 | |||
| 2061 | Ga0495611_0007633 | |||
| 2062 | Ga0495611_0128453 | |||
| 2063 | Ga0495611_0153020 | |||
| 2064 | Ga0495611_0180822 | |||
| 2065 | Ga0495625_0001145 | |||
| 2066 | Ga0495625_0001301 | |||
| 2067 | Ga0495625_0002421 | |||
| 2068 | Ga0495625_0003237 | |||
| 2069 | Ga0495625_0013674 | |||
| 2070 | Ga0495625_0028111 | |||
| 2071 | Ga0495625_0030291 | |||
| 2072 | Ga0495625_0144102 | |||
| 2073 | Ga0495625_0163209 | |||
| 2074 | Ga0495625_0193165 | |||
| 2075 | Ga0495625_0206969 | |||
| 2076 | Ga0495625_0267131 | |||
| 2077 | Ga0495635_0000247 | |||
| 2078 | Ga0495635_0004736 | |||
| 2079 | Ga0495659_0000194 | |||
| 2080 | Ga0495659_0003183 | |||
| 2081 | Ga0495659_0006394 | |||
| 2082 | Ga0495661_0000092 | |||
| 2083 | Ga0495661_0001179 | |||
| 2084 | Ga0495661_0021477 | |||
| 2085 | Ga0495661_0026511 | |||
| 2086 | Ga0495661_0034210 | |||
| 2087 | Ga0495661_0037282 | |||
| 2088 | Ga0495661_0039326 | |||
| 2089 | Ga0495661_0055912 | |||
| 2090 | Ga0495661_0096287 | |||
| 2091 | Ga0495661_0103574 | |||
| 2092 | Ga0495661_0127941 | |||
| 2093 | Ga0495661_0158845 | |||
| 2094 | Ga0495661_0182815 | |||
| 2095 | Ga0495661_0206521 | |||
| 2096 | Ga0495661_0252885 | |||
| 2097 | Ga0495588_0012820 | |||
| 2098 | Ga0495588_0018747 | |||
| 2099 | Ga0495588_0048483 | |||
| 2100 | Ga0495588_0083703 | |||
| 2101 | Ga0495623_0012220 | |||
| 2102 | Ga0495623_0027127 | |||
| 2103 | Ga0495646_0008670 | |||
| 2104 | Ga0495646_0010598 | |||
| 2105 | Ga0495646_0037792 | |||
| 2106 | Ga0495669_0018217 | |||
| 2107 | Ga0495613_0055097 | |||
| 2108 | Ga0495613_0204421 | |||
| 2109 | Ga0495624_0012400 | |||
| 2110 | Ga0495670_0000115 | |||
| 2111 | Ga0495670_0000146 | |||
| 2112 | Ga0495670_0000969 | |||
| 2113 | Ga0495670_0003679 | |||
| 2114 | Ga0495670_0006674 | |||
| 2115 | Ga0495670_0012275 | |||
| 2116 | Ga0495670_0080045 | |||
| 2117 | Ga0495670_0107368 | |||
| 2118 | Ga0495670_0116802 | |||
| 2119 | Ga0495670_0162745 | |||
| 2120 | Ga0495671_0000380 | |||
| 2121 | Ga0495671_0001253 | |||
| 2122 | Ga0495671_0015238 | |||
| 2123 | Ga0495671_0015765 | |||
| 2124 | Ga0495671_0021034 | |||
| 2125 | Ga0495671_0024084 | |||
| 2126 | Ga0495671_0032954 | |||
| 2127 | Ga0495671_0043795 | |||
| 2128 | Ga0495671_0063988 | |||
| 2129 | Ga0495671_0065909 | |||
| 2130 | Ga0495671_0069094 | |||
| 2131 | Ga0495671_0093617 | |||
| 2132 | Ga0495671_0103000 | |||
| 2133 | Ga0495671_0116006 | |||
| 2134 | Ga0495671_0163042 | |||
| 2135 | Ga0495649_0000598 | |||
| 2136 | Ga0495649_0002300 | |||
| 2137 | Ga0495649_0004112 | |||
| 2138 | Ga0495649_0007111 | |||
| 2139 | Ga0495649_0009309 | |||
| 2140 | Ga0495649_0010481 | |||
| 2141 | Ga0495649_0012380 | |||
| 2142 | Ga0495649_0015732 | |||
| 2143 | Ga0495649_0065843 | |||
| 2144 | Ga0495649_0068391 | |||
| 2145 | Ga0495649_0092784 | |||
| 2146 | Ga0495649_0103543 | |||
| 2147 | Ga0495649_0114654 | |||
| 2148 | Ga0495649_0129358 | |||
| 2149 | Ga0495649_0163848 | |||
| 2150 | Ga0495589_0000127 | |||
| 2151 | Ga0495589_0000238 | |||
| 2152 | Ga0495589_0000399 | |||
| 2153 | Ga0495589_0003009 | |||
| 2154 | Ga0495589_0014655 | |||
| 2155 | Ga0495589_0014971 | |||
| 2156 | Ga0495589_0015263 | |||
| 2157 | Ga0495589_0032240 | |||
| 2158 | Ga0495589_0069132 | |||
| 2159 | Ga0495600_0005093 | |||
| 2160 | Ga0495600_0052371 | |||
| 2161 | Ga0495600_0075091 | |||
| 2162 | Ga0495660_0002832 | |||
| 2163 | Ga0495660_0007236 | |||
| 2164 | Ga0495660_0008843 | |||
| 2165 | Ga0495660_0010227 | |||
| 2166 | Ga0495660_0016867 | |||
| 2167 | Ga0495660_0016961 | |||
| 2168 | Ga0495660_0019848 | |||
| 2169 | Ga0495660_0029741 | |||
| 2170 | Ga0495660_0056982 | |||
| 2171 | Ga0495660_0066373 | |||
| 2172 | Ga0495660_0089474 | |||
| 2173 | Ga0495660_0089816 | |||
| 2174 | Ga0495660_0109703 | |||
| 2175 | Ga0495660_0110311 | |||
| 2176 | Ga0495660_0148327 | |||
| 2177 | Ga0495660_0151093 | |||
| 2178 | Ga0495660_0164253 | |||
| 2179 | Ga0495660_0197923 | |||
| 2180 | Ga0495581_0026902 | |||
| 2181 | Ga0495581_0031652 | |||
| 2182 | Ga0495604_0011021 | |||
| 2183 | Ga0495604_0030731 | |||
| 2184 | Ga0495604_0033490 | |||
| 2185 | Ga0495604_0126316 | |||
| 2186 | Ga0495636_0006932 | |||
| 2187 | Ga0495636_0191311 | |||
| 2188 | Ga0495674_0099638 | |||
| 2189 | Ga0495672_0000211 | |||
| 2190 | Ga0495672_0000540 | |||
| 2191 | Ga0495672_0000791 | |||
| 2192 | Ga0495672_0001399 | |||
| 2193 | Ga0495672_0005805 | |||
| 2194 | Ga0495672_0008579 | |||
| 2195 | Ga0495672_0012052 | |||
| 2196 | Ga0495672_0012464 | |||
| 2197 | Ga0495672_0013978 | |||
| 2198 | Ga0495672_0014963 | |||
| 2199 | Ga0495672_0023548 | |||
| 2200 | Ga0495672_0027233 | |||
| 2201 | Ga0495672_0039450 | |||
| 2202 | Ga0495672_0044152 | |||
| 2203 | Ga0495672_0054067 | |||
| 2204 | Ga0495672_0081851 | |||
| 2205 | Ga0495672_0146023 | |||
| 2206 | Ga0495672_0148590 | |||
| 2207 | Ga0495672_0182390 | |||
| 2208 | Ga0495676_0000568 | |||
| 2209 | Ga0495676_0078726 | |||
| 2210 | Ga0495680_0003260 | |||
| 2211 | Ga0495680_0012520 | |||
| 2212 | Ga0495680_0019219 | |||
| 2213 | Ga0495680_0133045 | |||
| 2214 | Ga0495683_0000033 | |||
| 2215 | Ga0495683_0000085 | |||
| 2216 | Ga0495683_0000455 | |||
| 2217 | Ga0495683_0007507 | |||
| 2218 | Ga0495683_0015482 | |||
| 2219 | Ga0495683_0019412 | |||
| 2220 | Ga0495683_0036972 | |||
| 2221 | Ga0495683_0042945 | |||
| 2222 | Ga0495683_0049536 | |||
| 2223 | Ga0495683_0071416 | |||
| 2224 | Ga0495683_0086677 | |||
| 2225 | Ga0495683_0107955 | |||
| 2226 | Ga0495683_0136114 | |||
| 2227 | Ga0495687_000375 | |||
| 2228 | Ga0495687_002265 | |||
| 2229 | Ga0495687_002345 | |||
| 2230 | Ga0495687_005462 | |||
| 2231 | Ga0495675_0013057 | |||
| 2232 | Ga0495675_0033716 | |||
| 2233 | Ga0495675_0045154 | |||
| 2234 | Ga0495677_0030130 | |||
| 2235 | Ga0495679_000380 | |||
| 2236 | Ga0495679_000808 | |||
| 2237 | Ga0495679_002964 | |||
| 2238 | Ga0495679_005286 | |||
| 2239 | Ga0495679_007065 | |||
| 2240 | Ga0495679_007169 | |||
| 2241 | Ga0495679_012425 | |||
| 2242 | Ga0495679_027316 | |||
| 2243 | Ga0495679_033752 | |||
| 2244 | Ga0495679_045285 | |||
| 2245 | Ga0495685_008095 | |||
| 2246 | Ga0495673_0000297 | |||
| 2247 | Ga0495673_0000345 | |||
| 2248 | Ga0495673_0000637 | |||
| 2249 | Ga0495673_0000687 | |||
| 2250 | Ga0495673_0000755 | |||
| 2251 | Ga0495673_0006766 | |||
| 2252 | Ga0495673_0007279 | |||
| 2253 | Ga0495673_0028619 | |||
| 2254 | Ga0495673_0029206 | |||
| 2255 | Ga0495673_0049968 | |||
| 2256 | Ga0495673_0055079 | |||
| 2257 | Ga0495673_0087901 | |||
| 2258 | Ga0495673_0089898 | |||
| 2259 | Ga0495673_0092105 | |||
| 2260 | Ga0495673_0092214 | |||
| 2261 | Ga0495673_0097469 | |||
| 2262 | Ga0495673_0102458 | |||
| 2263 | Ga0495681_0000172 | |||
| 2264 | Ga0495681_0000226 | |||
| 2265 | Ga0495681_0000352 | |||
| 2266 | Ga0495681_0000424 | |||
| 2267 | Ga0495681_0000504 | |||
| 2268 | Ga0495681_0000542 | |||
| 2269 | Ga0495681_0002874 | |||
| 2270 | Ga0495681_0004787 | |||
| 2271 | Ga0495681_0006317 | |||
| 2272 | Ga0495681_0008427 | |||
| 2273 | Ga0495681_0008837 | |||
| 2274 | Ga0495681_0026017 | |||
| 2275 | Ga0495681_0054146 | |||
| 2276 | Ga0495681_0055952 | |||
| 2277 | Ga0495681_0065899 | |||
| 2278 | Ga0495681_0092995 | |||
| 2279 | Ga0495681_0101450 | |||
| 2280 | Ga0495681_0106763 | |||
| 2281 | Ga0495681_0119030 | |||
| 2282 | Ga0495684_0009299 | |||
| 2283 | Ga0495684_0174476 | |||
| 2284 | Ga0495686_0010527 | |||
| 2285 | Ga0495686_0011609 | |||
| 2286 | Ga0495686_0013098 | |||
| 2287 | Ga0495686_0107712 | |||
| 2288 | Ga0495686_0113226 | |||
| 2289 | Ga0495686_0140100 | |||
| 2290 | Ga0495686_0218477 | |||
| 2291 | Ga0495593_0007099 | |||
| 2292 | Ga0495593_0054213 | |||
| 2293 | Ga0495593_0105573 | |||
| 2294 | Ga0495593_0117239 | |||
| 2295 | Ga0495602_0026629 | |||
| 2296 | Ga0495602_0273022 | |||
| 2297 | Ga0495626_0000144 | |||
| 2298 | Ga0495626_0000179 | |||
| 2299 | Ga0495626_0000438 | |||
| 2300 | Ga0495626_0000558 | |||
| 2301 | Ga0495626_0000838 | |||
| 2302 | Ga0495626_0002828 | |||
| 2303 | Ga0495626_0003982 | |||
| 2304 | Ga0495626_0017529 | |||
| 2305 | Ga0495626_0019891 | |||
| 2306 | Ga0495626_0021821 | |||
| 2307 | Ga0495626_0037917 | |||
| 2308 | Ga0495626_0087248 | |||
| 2309 | Ga0495626_0093958 | |||
| 2310 | Ga0495626_0095658 | |||
| 2311 | Ga0495626_0098803 | |||
| 2312 | Ga0495626_0104744 | |||
| 2313 | Ga0496102_0000250 | |||
| 2314 | Ga0496103_0009544 | |||
| 2315 | Ga0496110_0030902 | |||
| 2316 | Ga0496110_0061890 | |||
| 2317 | Ga0496111_0053353 | |||
| 2318 | Ga0496114_0025300 | |||
| 2319 | Ga0496116_0000168 | |||
| 2320 | Ga0496116_0000419 | |||
| 2321 | Ga0496116_0001770 | |||
| 2322 | Ga0496116_0016589 | |||
| 2323 | Ga0496116_0017204 | |||
| 2324 | Ga0496117_0000349 | |||
| 2325 | Ga0496117_0005736 | |||
| 2326 | Ga0496117_0006862 | |||
| 2327 | Ga0496117_0019897 | |||
| 2328 | Ga0496117_0035195 | |||
| 2329 | Ga0496117_0037268 | |||
| 2330 | Ga0496117_0045204 | |||
| 2331 | Ga0496117_0068382 | |||
| 2332 | Ga0496117_0266206 | |||
| 2333 | Ga0496118_0003199 | |||
| 2334 | Ga0496118_0024394 | |||
| 2335 | Ga0496118_0026764 | |||
| 2336 | Ga0496118_0036848 | |||
| 2337 | Ga0496118_0039213 | |||
| 2338 | Ga0496118_0066157 | |||
| 2339 | Ga0496118_0142850 | |||
| 2340 | Ga0496119_0000713 | |||
| 2341 | Ga0496119_0007971 | |||
| 2342 | Ga0496119_0031089 | |||
| 2343 | Ga0496119_0081922 | |||
| 2344 | Ga0496119_0208907 | |||
| 2345 | Ga0496119_0266332 | |||
| 2346 | Ga0496120_0001850 | |||
| 2347 | Ga0496120_0009933 | |||
| 2348 | Ga0496120_0022821 | |||
| 2349 | Ga0496121_0000199 | |||
| 2350 | Ga0496121_0024913 | |||
| 2351 | Ga0496121_0121443 | |||
| 2352 | Ga0496121_0172342 | |||
| 2353 | Ga0496122_0001732 | |||
| 2354 | Ga0496122_0003605 | |||
| 2355 | Ga0496122_0024506 | |||
| 2356 | Ga0496122_0110701 | |||
| 2357 | Ga0496122_0131001 | |||
| 2358 | Ga0496122_0148234 | |||
| 2359 | Ga0496122_0170500 | |||
| 2360 | Ga0496123_0000869 | |||
| 2361 | Ga0496123_0019162 | |||
| 2362 | Ga0496123_0019191 | |||
| 2363 | Ga0496123_0071817 | |||
| 2364 | Ga0496123_0125142 | |||
| 2365 | Ga0496123_0126252 | |||
| 2366 | Ga0496123_0261550 | |||
| 2367 | Ga0496124_0000259 | |||
| 2368 | Ga0496124_0006403 | |||
| 2369 | Ga0496124_0013792 | |||
| 2370 | Ga0496124_0015684 | |||
| 2371 | Ga0496124_0026649 | |||
| 2372 | Ga0496124_0037785 | |||
| 2373 | Ga0496124_0120274 | |||
| 2374 | Ga0496124_0163108 | |||
| 2375 | Ga0496124_0216632 | |||
| 2376 | Ga0496124_0292136 | |||
| 2377 | Ga0496125_0001730 | |||
| 2378 | Ga0496125_0005296 | |||
| 2379 | Ga0496125_0029951 | |||
| 2380 | Ga0496125_0053252 | |||
| 2381 | Ga0496125_0122569 | |||
| 2382 | Ga0496125_0126149 | |||
| 2383 | Ga0496125_0153578 | |||
| 2384 | Ga0496125_0154030 | |||
| 2385 | Ga0496125_0264691 | |||
| 2386 | Ga0496125_0266301 | |||
| 2387 | Ga0496126_0016561 | |||
| 2388 | Ga0496126_0186568 | |||
| 2389 | Ga0496126_0575734 | |||
| 2390 | Ga0495678_000802 | |||
| 2391 | Ga0495678_001726 | |||
| 2392 | Ga0495678_001732 | |||
| 2393 | Ga0495678_002779 | |||
| 2394 | Ga0495678_006573 | |||
| 2395 | Ga0495678_009222 | |||
| 2396 | Ga0495678_010113 | |||
| 2397 | Ga0495678_030927 | |||
| 2398 | Ga0495678_050256 | |||
| 2399 | Ga0495678_050741 | |||
| 2400 | Ga0495678_061573 | |||
| 2401 | Ga0495678_062994 | |||
| 2402 | Ga0495678_076955 | |||
| 2403 | Ga0495678_090048 | |||
| 2404 | Ga0495682_0000203 | |||
| 2405 | Ga0495682_0001158 | |||
| 2406 | Ga0495682_0001358 | |||
| 2407 | Ga0495682_0008910 | |||
| 2408 | Ga0495682_0048494 | |||
| 2409 | Ga0495682_0052081 | |||
| 2410 | Ga0495682_0052176 | |||
| 2411 | Ga0495682_0059517 | |||
| 2412 | Ga0501250_013358 | |||
| 2413 | Ga0501241_000142 | |||
| 2414 | Ga0501226_000022 | |||
| 2415 | nmdc:mga03683_155524_c1 | |||
| 2416 | nmdc:mga08x19_294980_c1 | |||
| 2417 | nmdc:mga08x19_328466_c1 | |||
| 2418 | nmdc:mga0sz30_130977_c1 | |||
| 2419 | Ga0500572_001644 | |||
| 2420 | Ga0500618_005554 | |||
| 2421 | Ga0500568_0067904 | |||
| 2422 | Ga0500586_044741 | |||
| 2423 | Ga0466962_0003680 | |||
| 2424 | 2511252823 | |||
| 2425 | 2511267741 | |||
| 2426 | 2511273113 | |||
| 2427 | 2511275778 | |||
| 2428 | 2511290617 | |||
| 2429 | 2511298320 | |||
| 2430 | 2511301057 | |||
| 2431 | 2511315674 | |||
| 2432 | 2511318283 | |||
| 2433 | 2511326143 | |||
| 2434 | 2511333941 | |||
| 2435 | 2511338996 | |||
| 2436 | 2511347200 | |||
| 2437 | 2511349868 | |||
| 2438 | 2511357819 | |||
| 2439 | 2511365705 | |||
| 2440 | 2511372347 | |||
| 2441 | 2511410893 | |||
| 2442 | 2511823727 | |||
| 2443 | 2512323961 | |||
| 2444 | 2554814335 | |||
| 2445 | 2555671209 | |||
| 2446 | 2583793634 | |||
| 2447 | 2597859293 | |||
| 2448 | 2597865087 | |||
| 2449 | 2597870941 | |||
| 2450 | 2599354632 | |||
| 2451 | 2599359655 | |||
| 2452 | 2599365977 | |||
| 2453 | 2599372767 | |||
| 2454 | 2599379739 | |||
| 2455 | 2599385282 | |||
| 2456 | 2599391626 | |||
| 2457 | 2599400214 | |||
| 2458 | 2599403392 | |||
| 2459 | 2599451456 | |||
| 2460 | 2599461466 | |||
| 2461 | 2599470009 | |||
| 2462 | 2599482124 | |||
| 2463 | 2599490485 | |||
| 2464 | 2599504520 | |||
| 2465 | 2599509435 | |||
| 2466 | 2599512628 | |||
| 2467 | 2599519979 | |||
| 2468 | 2599611585 | |||
| 2469 | 2599770320 | |||
| 2470 | 2599804158 | |||
| 2471 | 2599878431 | |||
| 2472 | 2599887471 | |||
| 2473 | 2599891304 | |||
| 2474 | 2599901782 | |||
| 2475 | 2599934312 | |||
| 2476 | 2599941745 | |||
| 2477 | 2599947634 | |||
| 2478 | 2599952735 | |||
| 2479 | 2599960626 | |||
| 2480 | 2599964920 | |||
| 2481 | 2599975967 | |||
| 2482 | 2599981914 | |||
| 2483 | 2599987823 | |||
| 2484 | 2599995318 | |||
| 2485 | 2599998285 | |||
| 2486 | 2600005450 | |||
| 2487 | 2600010152 | |||
| 2488 | 2600017333 | |||
| 2489 | 2600022556 | |||
| 2490 | 2600027576 | |||
| 2491 | 2600034360 | |||
| 2492 | 2600039856 | |||
| 2493 | 2600046153 | |||
| 2494 | 2600052156 | |||
| 2495 | 2600057533 | |||
| 2496 | 2600064694 | |||
| 2497 | 2600072270 | |||
| 2498 | 2600075831 | |||
| 2499 | 2600214084 | |||
| 2500 | 2600356715 | |||
| 2501 | 2600364201 | |||
| 2502 | 2600442370 | |||
| 2503 | 2601689654 | |||
| 2504 | 2601774250 | |||
| 2505 | 2601796213 | |||
| 2506 | 2602009665 | |||
| 2507 | 2606073362 | |||
| 2508 | 2606126992 | |||
| 2509 | 2608381727 | |||
| 2510 | 2621298354 | |||
| 2511 | 2624481862 | |||
| 2512 | 2624491053 | |||
| 2513 | 2643845564 | |||
| 2514 | 2643874312 | |||
| 2515 | 2643956439 | |||
| 2516 | 2644025519 | |||
| 2517 | 2644187408 | |||
| 2518 | 2644284814 | |||
| 2519 | 2644621922 | |||
| 2520 | 2652546519 | |||
| 2521 | 2671094372 | |||
| 2522 | 2671097213 | |||
| 2523 | 2671126054 | |||
| 2524 | 2671770274 | |||
| 2525 | 2677899875 | |||
| 2526 | 2678262660 | |||
| 2527 | 2715751165 | |||
| 2528 | 2715758165 | |||
| 2529 | 2718635111 | |||
| 2530 | 2723249840 | |||
| 2531 | 2729147418 | |||
| 2532 | 2738671261 | |||
| 2533 | 2738688372 | |||
| 2534 | 2738749655 | |||
| 2535 | 2738808486 | |||
| 2536 | 2738858695 | |||
| 2537 | 2738895846 | |||
| 2538 | 2739201903 | |||
| 2539 | 2739259295 | |||
| 2540 | 2739264104 | |||
| 2541 | 2739314126 | |||
| 2542 | 2743738826 | |||
| 2543 | 2745009000 | |||
| 2544 | 2774123387 | |||
| 2545 | 2774132770 | |||
| 2546 | 2784263416 | |||
| 2547 | 2784316071 | |||
| 2548 | 2794596463 | |||
| 2549 | 2807409255 | |||
| 2550 | 2807457557 | |||
| 2551 | 2808855128 | |||
| 2552 | 2808924405 | |||
| 2553 | 2808930555 | |||
| 2554 | 2808935784 | |||
| 2555 | 2808940522 | |||
| 2556 | 2808946497 | |||
| 2557 | 2808952677 | |||
| 2558 | 2808957328 | |||
| 2559 | 2808963521 | |||
| 2560 | 2808977798 | |||
| 2561 | 2808993278 | |||
| 2562 | 2808998521 | |||
| 2563 | 2809218716 | |||
| 2564 | 2817492497 | |||
| 2565 | 2819655605 | |||
| 2566 | 2819702310 | |||
| 2567 | 2823424486 | |||
| 2568 | 2825652975 | |||
| 2569 | 2834031904 | |||
| 2570 | 2842827684 | |||
| 2571 | 2842836456 | |||
| 2572 | 2842841015 | |||
| 2573 | 2842844570 | |||
| 2574 | 2842854713 | |||
| 2575 | 2844671750 | |||
| 2576 | 2852613131 | |||
| 2577 | 2852662396 | |||
| 2578 | 2852669134 | |||
| 2579 | 2860340743 | |||
| 2580 | 2860871593 | |||
| 2581 | 2878033846 | |||
| 2582 | 2880234471 | |||
| 2583 | 2894821620 | |||
| 2584 | 2904521390 | |||
| 2585 | 2904555567 | |||
| 2586 | 2908450998 | |||
| 2587 | 2913038638 | |||
| 2588 | 2917075070 | |||
| 2589 | 2919068831 | |||
| 2590 | 2919158400 | |||
| 2591 | 2919387938 | |||
| 2592 | 2919461126 | |||
| 2593 | 2919481915 | |||
| 2594 | 2919489879 | |||
| 2595 | 2919504215 | |||
| 2596 | 2919702067 | |||
| 2597 | 2923157898 | |||
| 2598 | 2923587250 | |||
| 2599 | 2926065212 | |||
| 2600 | 2929146092 | |||
| 2601 | 2929193630 | |||
| 2602 | 2931370570 | |||
| 2603 | 2931394947 | |||
| 2604 | 2931403296 | |||
| 2605 | 2935356058 | |||
| 2606 | 2939637680 | |||
| 2607 | 2939652888 | |||
| 2608 | 2945965004 | |||
| 2609 | 2946008554 | |||
| 2610 | 2946032096 | |||
| 2611 | 2947238925 | |||
| 2612 | 2969308621 | |||
| 2613 | 2974290005 | |||
| 2614 | 2984288283 | |||
| 2615 | 2988733622 | |||
| 2616 | 2990198934 | |||
| 2617 | 2998143926 | |||
| 2618 | 3007253370 | |||
| 2619 | 3007397208 | |||
| 2620 | 3007515627 | |||
| 2621 | 3007616926 | |||
| 2622 | 3007625631 | |||
| 2623 | 3007718853 | |||
| 2624 | 3007857832 | |||
| 2625 | 3007865355 | |||
| 2626 | 3007870212 | |||
| 2627 | 3007875539 | |||
| 2628 | 637321539 | |||
| 2629 | 640488431 | |||
| 2630 | 651176466 | |||
| 2631 | 8011355474 | |||
| 2632 | 8015691996 | |||
| 2633 | 8019774454 | |||
| 2634 | 8019780914 | |||
| 2635 | 8029996951 | |||
| 2636 | 8034967081 | |||
| 2637 | 8054285646 | |||
| 2638 | 8054350783 | |||
| 2639 | 8054507457 | |||
| 2640 | 8055775205 | |||
| 2641 | 8055822400 | |||
| 2642 | 8055880667 | |||
| 2643 | 8056124324 | |||
| 2644 | 8056127632 | |||
| 2645 | 8056135862 | |||
| 2646 | 8056139183 | |||
| 2647 | 8056147201 | |||
| 2648 | 8056153181 | |||
| 2649 | 8056157254 | |||
| 2650 | 8056167350 | |||
| 2651 | 8056173334 | |||
| 2652 | 8056179529 | |||
| 2653 | 8056572669 | |||
| 2654 | 8057804018 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fw2-assembly1.cif.gz_A | crystal structure of human marc1 | 0.9235 | 2 | 267 |
| 6fw2-assembly1.cif.gz_A | crystal structure of human marc1 | 0.9168 | 2 | 267 |
| 7p41-assembly1.cif.gz_D | crystal structure of human marc1 a165t variant | 0.9133 | 2 | 267 |
| 7p41-assembly1.cif.gz_D | crystal structure of human marc1 a165t variant | 0.9067 | 2 | 267 |
| 1u8r-assembly1.cif.gz_A | crystal structure of an ider-dna complex reveals a conformational change in activated ider for base-specific interactions | 0.8525 | 57 | 80 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75863_136_262_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.9542 | 143 | 264 | 2.40.33.20 |
| af_U4PC34_202_334_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.9439 | 140 | 264 | 2.40.33.20 |
| af_A1Z803_208_336_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.9358 | 144 | 264 | 2.40.33.20 |
| af_Q54JB6_217_359_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.928 | 142 | 252 | 2.40.33.20 |
| af_A0A1D6EVE2_172_293_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.9269 | 143 | 252 | 2.40.33.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A658G1V1-F1-model_v4 | deleted | 0.9864 | 1 | 175 |
|
| AF-A0A7Y8B592-F1-model_v4 | deleted | 0.982 | 100 | 267 |
|
| AF-A0A4Q3IGA4-F1-model_v4 | deleted | 0.9813 | 3 | 199 |
|
| AF-A0A7G5DJ28-F1-model_v4 | MOSC domain-containing protein | 0.9795 | 2 | 267 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A4Q3IPK1-F1-model_v4 | deleted | 0.9779 | 117 | 267 |
|