F493073

General Info

Members Datasets Scaffolds Average Seq Length
1330 332 1330 186

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10014139|Ga0157378_100141394
Length 217
Sequence VARRRRAEHDGWARMSASPVTDAQLIARCVVGDDRHAFAELVRRHQSAVRACLRKLTTGDAALADDLAQETFVLAWRNLKSFRQDARFSTWLYRIATNCWLMHARKRKEELLGDRDDAIPDDDHDAMSHLTDTAVDHTRASTLRMYLERAMRVLSEPERAAIVQCYHNDLSHEEAAYVLGIPVGTVKTHVLRAKQKLKVAMASWNPEAASGTAEGAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
220 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
250 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
251 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
252 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
255 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
256 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
257 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
258 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
259 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
322 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.92
Metatranscriptomes 0.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.74
Rhizosphere 94.89
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1634644 2162886007 Bacteria 1081
2 SwRhRL2b_contig_387844 2162886007 Bacteria 1068
3 JGI24035J26624_1001983 3300002126 Bacteria 1906
4 rootL2_10328949 3300003322 Bacteria 2370
5 JGI25405J52794_10000323 3300003911 Bacteria 6609
6 JGI25405J52794_10001843 3300003911 Bacteria 3563
7 JGI25405J52794_10001884 3300003911 Bacteria 3537
8 Ga0065704_10004765 3300005289 Bacteria 4798
9 Ga0065704_10234770 3300005289 Bacteria 1032
10 Ga0065712_10006901 3300005290 Bacteria 3276
11 Ga0065712_10009838 3300005290 Bacteria 3430
12 Ga0065715_10008051 3300005293 Bacteria 2745
13 Ga0065715_10013045 3300005293 Unclassified 2152
14 Ga0065715_10048647 3300005293 Bacteria 1093
15 Ga0065715_10109052 3300005293 Bacteria 2668
16 Ga0065715_10240229 3300005293 Bacteria 1202
17 Ga0065715_10282308 3300005293 Bacteria 1083
18 Ga0065715_10336623 3300005293 Bacteria 966
19 Ga0065715_10425309 3300005293 Bacteria 832
20 Ga0065707_10219050 3300005295 Bacteria 1232
21 Ga0070658_10009067 3300005327 Bacteria 8004
22 Ga0070676_10001268 3300005328 Bacteria 12689
23 Ga0070676_10045600 3300005328 Bacteria 2553
24 Ga0070676_10057250 3300005328 Unclassified 2306
25 Ga0070676_10083387 3300005328 Bacteria 1944
26 Ga0070683_100004758 3300005329 Bacteria 11234
27 Ga0070683_100017515 3300005329 Bacteria 6332
28 Ga0070683_100041501 3300005329 Bacteria 4233
29 Ga0070683_100253871 3300005329 Bacteria 1672
30 Ga0070683_100400758 3300005329 Bacteria 1308
31 Ga0070690_100019100 3300005330 Bacteria 4153
32 Ga0070690_100019262 3300005330 Bacteria 4138
33 Ga0070690_100168997 3300005330 Unclassified 1504
34 Ga0070670_100031216 3300005331 Bacteria 4588
35 Ga0070670_100153032 3300005331 Bacteria 1996
36 Ga0070670_100232408 3300005331 Bacteria 1605
37 Ga0070670_100252135 3300005331 Bacteria 1538
38 Ga0070677_10000242 3300005333 Bacteria 18978
39 Ga0070677_10064647 3300005333 Bacteria 1520
40 Ga0070677_10121982 3300005333 Unclassified 1178
41 Ga0068869_100086683 3300005334 Bacteria 2347
42 Ga0068869_100087886 3300005334 Bacteria 2332
43 Ga0070666_10001424 3300005335 Bacteria 14500
44 Ga0070666_10013532 3300005335 Bacteria 5179
45 Ga0070666_10035493 3300005335 Bacteria 3307
46 Ga0070666_10064321 3300005335 Bacteria 2488
47 Ga0070666_10138075 3300005335 Bacteria 1697
48 Ga0070666_10196339 3300005335 Bacteria 1419
49 Ga0070666_10204638 3300005335 Unclassified 1389
50 Ga0070680_100016424 3300005336 Bacteria 5827
51 Ga0070680_100150489 3300005336 Bacteria 1954
52 Ga0070680_100304887 3300005336 Bacteria 1351
53 Ga0070682_100064400 3300005337 Bacteria 2327
54 Ga0070682_100123707 3300005337 Bacteria 1740
55 Ga0068868_100002750 3300005338 Bacteria 12180
56 Ga0068868_100006774 3300005338 Bacteria 8140
57 Ga0068868_100010675 3300005338 Bacteria 6655
58 Ga0068868_100192419 3300005338 Bacteria 1697
59 Ga0068868_100200598 3300005338 Bacteria 1663
60 Ga0068868_100328946 3300005338 Unclassified 1304
61 Ga0068868_100374611 3300005338 Unclassified 1224
62 Ga0068868_100412726 3300005338 Bacteria 1167
63 Ga0068868_100439175 3300005338 Bacteria 1133
64 Ga0070660_100000551 3300005339 Bacteria 25098
65 Ga0070660_100118693 3300005339 Bacteria 2109
66 Ga0070660_100130753 3300005339 Unclassified 2009
67 Ga0070660_100291947 3300005339 Bacteria 1335
68 Ga0070660_100507930 3300005339 Unclassified 1003
69 Ga0070689_100013944 3300005340 Bacteria 5830
70 Ga0070689_100017987 3300005340 Bacteria 5198
71 Ga0070689_100160610 3300005340 Unclassified 1816
72 Ga0070689_100328318 3300005340 Bacteria 1279
73 Ga0070689_100421195 3300005340 Bacteria 1132
74 Ga0070687_100024597 3300005343 Bacteria 2878
75 Ga0070687_100034776 3300005343 Bacteria 2496
76 Ga0070661_100007142 3300005344 Bacteria 7701
77 Ga0070661_100033026 3300005344 Bacteria 3748
78 Ga0070661_100033465 3300005344 Bacteria 3723
79 Ga0070661_100041563 3300005344 Bacteria 3355
80 Ga0070661_100118517 3300005344 Bacteria 1981
81 Ga0070692_10223773 3300005345 Bacteria 1113
82 Ga0070668_100001406 3300005347 Bacteria 17305
83 Ga0070668_100003165 3300005347 Bacteria 12129
84 Ga0070668_100045194 3300005347 Bacteria 3379
85 Ga0070668_100219615 3300005347 Bacteria 1567
86 Ga0070668_100607428 3300005347 Unclassified 957
87 Ga0070668_101028943 3300005347 Unclassified 741
88 Ga0070668_101652075 3300005347 Unclassified 587
89 Ga0070669_100002287 3300005353 Bacteria 13893
90 Ga0070669_100104050 3300005353 Bacteria 2146
91 Ga0070669_100161040 3300005353 Bacteria 1744
92 Ga0070669_100187338 3300005353 Bacteria 1622
93 Ga0070669_100220747 3300005353 Bacteria 1498
94 Ga0070669_100264653 3300005353 Unclassified 1373
95 Ga0070669_100377487 3300005353 Bacteria 1156
96 Ga0070669_100822886 3300005353 Bacteria 790
97 Ga0070675_100002082 3300005354 Bacteria 14809
98 Ga0070675_100022317 3300005354 Bacteria 5057
99 Ga0070675_100030145 3300005354 Bacteria 4377
100 Ga0070675_100049890 3300005354 Bacteria 3436
101 Ga0070675_100063086 3300005354 Bacteria 3063
102 Ga0070675_100067503 3300005354 Bacteria 2959
103 Ga0070675_100071808 3300005354 Bacteria 2873
104 Ga0070675_100103054 3300005354 Unclassified 2405
105 Ga0070675_100104988 3300005354 Bacteria 2384
106 Ga0070675_100156590 3300005354 Unclassified 1956
107 Ga0070675_100248840 3300005354 Bacteria 1555
108 Ga0070675_100572457 3300005354 Unclassified 1023
109 Ga0070675_101386494 3300005354 Bacteria 648
110 Ga0070671_100003277 3300005355 Bacteria 12629
111 Ga0070671_100005547 3300005355 Bacteria 10050
112 Ga0070671_100020112 3300005355 Bacteria 5440
113 Ga0070671_100032550 3300005355 Bacteria 4310
114 Ga0070671_100047316 3300005355 Bacteria 3577
115 Ga0070671_100061954 3300005355 Bacteria 3115
116 Ga0070671_100063682 3300005355 Bacteria 3071
117 Ga0070671_100073286 3300005355 Bacteria 2860
118 Ga0070671_100158350 3300005355 Bacteria 1914
119 Ga0070671_100258573 3300005355 Bacteria 1480
120 Ga0070674_100000659 3300005356 Bacteria 17432
121 Ga0070674_100013733 3300005356 Bacteria 5013
122 Ga0070674_100026238 3300005356 Bacteria 3802
123 Ga0070674_100078097 3300005356 Bacteria 2358
124 Ga0070674_100129882 3300005356 Unclassified 1877
125 Ga0070673_100001356 3300005364 Bacteria 14306
126 Ga0070673_100007946 3300005364 Bacteria 7029
127 Ga0070673_100043069 3300005364 Bacteria 3485
128 Ga0070673_100045749 3300005364 Bacteria 3396
129 Ga0070673_100067957 3300005364 Bacteria 2852
130 Ga0070673_100103167 3300005364 Unclassified 2352
131 Ga0070673_100108362 3300005364 Bacteria 2300
132 Ga0070673_100185865 3300005364 Unclassified 1781
133 Ga0070673_100760360 3300005364 Bacteria 893
134 Ga0070673_101433921 3300005364 Unclassified 650
135 Ga0070688_100001625 3300005365 Bacteria 11248
136 Ga0070688_100019806 3300005365 Bacteria 3903
137 Ga0070688_100019867 3300005365 Bacteria 3897
138 Ga0070688_100039269 3300005365 Bacteria 2896
139 Ga0070688_100127953 3300005365 Bacteria 1710
140 Ga0070688_100128143 3300005365 Bacteria 1708
141 Ga0070688_100174111 3300005365 Bacteria 1488
142 Ga0070659_100000779 3300005366 Bacteria 23129
143 Ga0070659_100015404 3300005366 Bacteria 5726
144 Ga0070659_100169517 3300005366 Unclassified 1788
145 Ga0070659_100263081 3300005366 Bacteria 1431
146 Ga0070659_100395158 3300005366 Unclassified 1166
147 Ga0070659_100562625 3300005366 Bacteria 977
148 Ga0070667_100003532 3300005367 Bacteria 13319
149 Ga0070667_100003566 3300005367 Bacteria 13255
150 Ga0070667_100008508 3300005367 Bacteria 8508
151 Ga0070667_100078143 3300005367 Bacteria 2827
152 Ga0070667_100084490 3300005367 Bacteria 2721
153 Ga0070667_100106801 3300005367 Unclassified 2423
154 Ga0070667_100151596 3300005367 Bacteria 2037
155 Ga0070667_100385570 3300005367 Bacteria 1273
156 Ga0070667_100398153 3300005367 Bacteria 1253
157 Ga0070667_100583168 3300005367 Unclassified 1029
158 Ga0070667_100677736 3300005367 Bacteria 953
159 Ga0070667_100688044 3300005367 Bacteria 946
160 Ga0070667_101120663 3300005367 Unclassified 736
161 Ga0070703_10307702 3300005406 Unclassified 663
162 Ga0070709_10020181 3300005434 Bacteria 3863
163 Ga0070709_10055060 3300005434 Bacteria 2510
164 Ga0070709_10111182 3300005434 Unclassified 1842
165 Ga0070709_10160059 3300005434 Bacteria 1564
166 Ga0070709_10201156 3300005434 Bacteria 1411
167 Ga0070709_10603542 3300005434 Unclassified 845
168 Ga0070714_100037722 3300005435 Bacteria 4062
169 Ga0070714_100191387 3300005435 Bacteria 1867
170 Ga0070714_100269800 3300005435 Bacteria 1578
171 Ga0070714_100437980 3300005435 Unclassified 1240
172 Ga0070714_100635017 3300005435 Bacteria 1027
173 Ga0070713_100361069 3300005436 Bacteria 1349
174 Ga0070713_100662013 3300005436 Unclassified 995
175 Ga0070710_10004182 3300005437 Bacteria 6843
176 Ga0070710_10028443 3300005437 Bacteria 2990
177 Ga0070710_10101610 3300005437 Bacteria 1713
178 Ga0070710_10168369 3300005437 Bacteria 1364
179 Ga0070701_10422935 3300005438 Bacteria 849
180 Ga0070711_100024261 3300005439 Bacteria 3953
181 Ga0070711_100147637 3300005439 Unclassified 1770
182 Ga0070711_100211133 3300005439 Bacteria 1503
183 Ga0070711_100218554 3300005439 Unclassified 1480
184 Ga0070711_100296505 3300005439 Bacteria 1284
185 Ga0070711_100380197 3300005439 Bacteria 1142
186 Ga0070705_100004271 3300005440 Bacteria 6968
187 Ga0070705_100059114 3300005440 Bacteria 2268
188 Ga0070705_100272660 3300005440 Bacteria 1199
189 Ga0070705_100367598 3300005440 Bacteria 1054
190 Ga0070705_100473101 3300005440 Bacteria 945
191 Ga0070705_100587744 3300005440 Unclassified 859
192 Ga0070700_100003307 3300005441 Bacteria 8313
193 Ga0070700_100736289 3300005441 Bacteria 787
194 Ga0070700_100873269 3300005441 Unclassified 730
195 Ga0070694_100016263 3300005444 Bacteria 4683
196 Ga0070708_100007814 3300005445 Bacteria 8571
197 Ga0070708_100019108 3300005445 Bacteria 5749
198 Ga0070708_100043795 3300005445 Unclassified 3933
199 Ga0070708_100064287 3300005445 Unclassified 3287
200 Ga0070708_100071797 3300005445 Unclassified 3117
201 Ga0070708_100247664 3300005445 Unclassified 1674
202 Ga0070708_100333778 3300005445 Bacteria 1429
203 Ga0070708_100375406 3300005445 Bacteria 1341
204 Ga0070663_100044095 3300005455 Bacteria 3142
205 Ga0070663_100103241 3300005455 Bacteria 2131
206 Ga0070678_100001796 3300005456 Bacteria 11558
207 Ga0070678_100009966 3300005456 Bacteria 5781
208 Ga0070678_100027767 3300005456 Bacteria 3848
209 Ga0070678_100212798 3300005456 Bacteria 1602
210 Ga0070678_100266656 3300005456 Bacteria 1442
211 Ga0070678_100280893 3300005456 Unclassified 1408
212 Ga0070678_100630034 3300005456 Unclassified 960
213 Ga0070662_100000211 3300005457 Bacteria 34047
214 Ga0070662_100012527 3300005457 Bacteria 5624
215 Ga0070662_100118359 3300005457 Bacteria 2027
216 Ga0070662_100118367 3300005457 Bacteria 2027
217 Ga0070662_100459618 3300005457 Bacteria 1058
218 Ga0070662_100634167 3300005457 Unclassified 901
219 Ga0070681_10002421 3300005458 Bacteria 17061
220 Ga0070681_10012806 3300005458 Bacteria 8326
221 Ga0070681_10113966 3300005458 Bacteria 2642
222 Ga0070681_11031101 3300005458 Unclassified 743
223 Ga0068867_100002050 3300005459 Bacteria 14116
224 Ga0068867_100002361 3300005459 Bacteria 13277
225 Ga0068867_100046722 3300005459 Bacteria 3181
226 Ga0068867_100165548 3300005459 Bacteria 1747
227 Ga0068867_100190402 3300005459 Bacteria 1636
228 Ga0068867_100299719 3300005459 Unclassified 1325
229 Ga0068867_100464649 3300005459 Bacteria 1081
230 Ga0070685_10055103 3300005466 Unclassified 2310
231 Ga0070685_10185391 3300005466 Bacteria 1342
232 Ga0070706_100000012 3300005467 Bacteria 195040
233 Ga0070706_100010658 3300005467 Bacteria 8533
234 Ga0070706_100011949 3300005467 Bacteria 8059
235 Ga0070706_100025873 3300005467 Bacteria 5401
236 Ga0070706_100147868 3300005467 Bacteria 2194
237 Ga0070706_100155773 3300005467 Bacteria 2133
238 Ga0070706_100295679 3300005467 Unclassified 1511
239 Ga0070706_100342482 3300005467 Unclassified 1394
240 Ga0070706_100418331 3300005467 Unclassified 1247
241 Ga0070706_100906695 3300005467 Bacteria 814
242 Ga0070706_100956876 3300005467 Bacteria 790
243 Ga0070707_100007671 3300005468 Bacteria 10022
244 Ga0070707_100039755 3300005468 Bacteria 4498
245 Ga0070707_100043177 3300005468 Bacteria 4316
246 Ga0070707_100055855 3300005468 Bacteria 3785
247 Ga0070707_100075664 3300005468 Bacteria 3247
248 Ga0070707_100121445 3300005468 Unclassified 2537
249 Ga0070707_100145583 3300005468 Bacteria 2306
250 Ga0070707_100157651 3300005468 Bacteria 2211
251 Ga0070707_100186635 3300005468 Bacteria 2022
252 Ga0070707_100186952 3300005468 Bacteria 2020
253 Ga0070707_100355176 3300005468 Bacteria 1423
254 Ga0070707_100519650 3300005468 Bacteria 1153
255 Ga0070707_100523359 3300005468 Bacteria 1148
256 Ga0070707_100754051 3300005468 Unclassified 937
257 Ga0070698_100000413 3300005471 Bacteria 45525
258 Ga0070698_100023971 3300005471 Bacteria 6371
259 Ga0070698_100432375 3300005471 Bacteria 1251
260 Ga0070698_100618266 3300005471 Bacteria 1024
261 Ga0070698_100829553 3300005471 Bacteria 869
262 Ga0070698_101270600 3300005471 Unclassified 686
263 Ga0070699_100035199 3300005518 Bacteria 4328
264 Ga0070699_100053333 3300005518 Bacteria 3500
265 Ga0070699_100132618 3300005518 Bacteria 2196
266 Ga0070699_100245561 3300005518 Bacteria 1599
267 Ga0070699_100287557 3300005518 Unclassified 1473
268 Ga0070699_100350897 3300005518 Bacteria 1329
269 Ga0070699_100364612 3300005518 Bacteria 1303
270 Ga0070699_100597462 3300005518 Unclassified 1006
271 Ga0070699_100607951 3300005518 Bacteria 997
272 Ga0070699_100636185 3300005518 Bacteria 973
273 Ga0070679_100006694 3300005530 Bacteria 10750
274 Ga0070679_100007544 3300005530 Bacteria 10171
275 Ga0070679_100018126 3300005530 Bacteria 6825
276 Ga0070679_100021209 3300005530 Bacteria 6339
277 Ga0070679_100197004 3300005530 Unclassified 1981
278 Ga0070679_100208411 3300005530 Bacteria 1919
279 Ga0070679_100302305 3300005530 Unclassified 1550
280 Ga0070679_100843256 3300005530 Unclassified 860
281 Ga0070684_100001230 3300005535 Bacteria 18389
282 Ga0070684_100002787 3300005535 Bacteria 12946
283 Ga0070684_100003917 3300005535 Bacteria 11278
284 Ga0070684_100024102 3300005535 Bacteria 5101
285 Ga0070684_100391669 3300005535 Bacteria 1280
286 Ga0070684_100491039 3300005535 Unclassified 1137
287 Ga0070684_100908447 3300005535 Bacteria 825
288 Ga0070697_100032665 3300005536 Bacteria 4190
289 Ga0070697_100060466 3300005536 Bacteria 3088
290 Ga0070697_100061365 3300005536 Bacteria 3066
291 Ga0070697_100135666 3300005536 Bacteria 2066
292 Ga0070697_100149013 3300005536 Unclassified 1971
293 Ga0070697_100173513 3300005536 Bacteria 1826
294 Ga0070697_100305561 3300005536 Bacteria 1368
295 Ga0070697_100347575 3300005536 Bacteria 1280
296 Ga0070697_101081682 3300005536 Unclassified 713
297 Ga0068853_100006893 3300005539 Bacteria 9070
298 Ga0068853_100035421 3300005539 Bacteria 4240
299 Ga0068853_100051166 3300005539 Bacteria 3555
300 Ga0068853_100115237 3300005539 Bacteria 2391
301 Ga0068853_100305755 3300005539 Unclassified 1471
302 Ga0068853_100393342 3300005539 Unclassified 1296
303 Ga0068853_100824533 3300005539 Bacteria 889
304 Ga0070672_100003099 3300005543 Bacteria 10725
305 Ga0070672_100008014 3300005543 Bacteria 7216
306 Ga0070672_100008581 3300005543 Bacteria 6999
307 Ga0070672_100016533 3300005543 Bacteria 5284
308 Ga0070672_100093931 3300005543 Unclassified 2423
309 Ga0070672_100139228 3300005543 Bacteria 2000
310 Ga0070672_100302218 3300005543 Bacteria 1357
311 Ga0070672_100463103 3300005543 Unclassified 1093
312 Ga0070686_100344273 3300005544 Bacteria 1118
313 Ga0070695_100226023 3300005545 Unclassified 1351
314 Ga0070696_100414592 3300005546 Bacteria 1056
315 Ga0070696_100913644 3300005546 Bacteria 729
316 Ga0070693_100046532 3300005547 Bacteria 2464
317 Ga0070693_100215176 3300005547 Unclassified 1256
318 Ga0070693_100273750 3300005547 Unclassified 1128
319 Ga0070693_100381154 3300005547 Bacteria 973
320 Ga0070665_100004484 3300005548 Bacteria 14665
321 Ga0070665_100006553 3300005548 Bacteria 11833
322 Ga0070665_100023261 3300005548 Bacteria 6240
323 Ga0070665_100025375 3300005548 Bacteria 5973
324 Ga0070665_100028552 3300005548 Bacteria 5619
325 Ga0070665_100043800 3300005548 Bacteria 4496
326 Ga0070665_100066411 3300005548 Bacteria 3618
327 Ga0070665_100099856 3300005548 Bacteria 2907
328 Ga0070665_100239396 3300005548 Bacteria 1815
329 Ga0070665_100240408 3300005548 Bacteria 1811
330 Ga0070665_100294444 3300005548 Unclassified 1625
331 Ga0070665_100410794 3300005548 Unclassified 1362
332 Ga0070665_100558675 3300005548 Bacteria 1157
333 Ga0070665_100761500 3300005548 Unclassified 981
334 Ga0070704_100002585 3300005549 Bacteria 10210
335 Ga0068855_100026160 3300005563 Bacteria 6980
336 Ga0068855_100101461 3300005563 Bacteria 3313
337 Ga0068855_100291506 3300005563 Unclassified 1809
338 Ga0070664_100014087 3300005564 Bacteria 6522
339 Ga0070664_100017006 3300005564 Bacteria 5970
340 Ga0070664_100071931 3300005564 Unclassified 2965
341 Ga0070664_100175700 3300005564 Bacteria 1901
342 Ga0070664_100195760 3300005564 Unclassified 1802
343 Ga0070664_100324490 3300005564 Bacteria 1396
344 Ga0070664_100333577 3300005564 Unclassified 1376
345 Ga0068857_100047692 3300005577 Bacteria 3804
346 Ga0068857_100069369 3300005577 Bacteria 3139
347 Ga0068857_100392092 3300005577 Bacteria 1291
348 Ga0068857_100762942 3300005577 Unclassified 922
349 Ga0068854_100016524 3300005578 Bacteria 4921
350 Ga0068854_100048212 3300005578 Bacteria 3039
351 Ga0068856_100004235 3300005614 Bacteria 14328
352 Ga0068856_100010690 3300005614 Bacteria 8917
353 Ga0068856_100020448 3300005614 Bacteria 6429
354 Ga0068856_100035673 3300005614 Bacteria 4874
355 Ga0068856_100563184 3300005614 Bacteria 1161
356 Ga0068856_100617891 3300005614 Unclassified 1105
357 Ga0068856_100665295 3300005614 Bacteria 1062
358 Ga0070702_100152344 3300005615 Bacteria 1486
359 Ga0068852_100003693 3300005616 Bacteria 10727
360 Ga0068852_100014944 3300005616 Bacteria 6000
361 Ga0068852_100063346 3300005616 Bacteria 3219
362 Ga0068852_100089773 3300005616 Bacteria 2747
363 Ga0068852_100215928 3300005616 Unclassified 1822
364 Ga0068852_100672728 3300005616 Unclassified 1044
365 Ga0068852_100767385 3300005616 Unclassified 977
366 Ga0068852_101338913 3300005616 Bacteria 738
367 Ga0068859_100006056 3300005617 Bacteria 12280
368 Ga0068859_100031329 3300005617 Bacteria 5340
369 Ga0068859_100178962 3300005617 Bacteria 2203
370 Ga0068859_100316119 3300005617 Bacteria 1655
371 Ga0068859_101696572 3300005617 Archaea 698
372 Ga0068864_100002334 3300005618 Bacteria 15682
373 Ga0068864_100003597 3300005618 Bacteria 12816
374 Ga0068864_100030005 3300005618 Bacteria 4609
375 Ga0068864_100154845 3300005618 Unclassified 2079
376 Ga0068864_100296909 3300005618 Bacteria 1512
377 Ga0068864_101095176 3300005618 Unclassified 793
378 Ga0068861_100122282 3300005719 Bacteria 2102
379 Ga0068861_100209913 3300005719 Bacteria 1639
380 Ga0068851_10001801 3300005834 Bacteria 9384
381 Ga0068851_10008654 3300005834 Bacteria 4711
382 Ga0068851_10009599 3300005834 Bacteria 4505
383 Ga0068851_10192646 3300005834 Bacteria 1134
384 Ga0068870_10014467 3300005840 Bacteria 3728
385 Ga0068870_10062076 3300005840 Unclassified 2011
386 Ga0068870_10237472 3300005840 Bacteria 1124
387 Ga0068863_100003877 3300005841 Bacteria 14790
388 Ga0068863_100013286 3300005841 Bacteria 7946
389 Ga0068863_100014810 3300005841 Bacteria 7497
390 Ga0068863_100068936 3300005841 Bacteria 3345
391 Ga0068863_100124985 3300005841 Bacteria 2454
392 Ga0068863_100220191 3300005841 Bacteria 1828
393 Ga0068863_100271793 3300005841 Bacteria 1641
394 Ga0068858_100003264 3300005842 Bacteria 16167
395 Ga0068858_100012075 3300005842 Bacteria 8140
396 Ga0068858_100018050 3300005842 Bacteria 6606
397 Ga0068858_100037520 3300005842 Bacteria 4495
398 Ga0068858_100054133 3300005842 Bacteria 3710
399 Ga0068858_100286608 3300005842 Bacteria 1569
400 Ga0068858_100376012 3300005842 Unclassified 1363
401 Ga0068858_100465385 3300005842 Bacteria 1219
402 Ga0068858_101600064 3300005842 Unclassified 643
403 Ga0068860_100001042 3300005843 Bacteria 30514
404 Ga0068860_100010043 3300005843 Bacteria 9381
405 Ga0068860_100012302 3300005843 Bacteria 8431
406 Ga0068860_100037702 3300005843 Bacteria 4627
407 Ga0068860_100432754 3300005843 Unclassified 1306
408 Ga0068860_100728245 3300005843 Bacteria 1003
409 Ga0068862_100194594 3300005844 Bacteria 1826
410 Ga0081455_10000547 3300005937 Bacteria 48774
411 Ga0081455_10001583 3300005937 Bacteria 27844
412 Ga0081455_10016102 3300005937 Bacteria 7230
413 Ga0081455_10016757 3300005937 Bacteria 7054
414 Ga0081455_10021993 3300005937 Bacteria 5970
415 Ga0081455_10027093 3300005937 Bacteria 5257
416 Ga0081455_10034863 3300005937 Unclassified 4505
417 Ga0081455_10217933 3300005937 Bacteria 1417
418 Ga0081540_1000016 3300005983 Bacteria 165370
419 Ga0081540_1010941 3300005983 Bacteria 6093
420 Ga0081540_1022397 3300005983 Bacteria 3731
421 Ga0081539_10000052 3300005985 Bacteria 268240
422 Ga0081539_10004458 3300005985 Bacteria 15437
423 Ga0081539_10008307 3300005985 Bacteria 9086
424 Ga0081539_10009998 3300005985 Bacteria 7813
425 Ga0081539_10020681 3300005985 Bacteria 4433
426 Ga0081539_10120493 3300005985 Unclassified 1304
427 Ga0081539_10248129 3300005985 Bacteria 793
428 Ga0070717_10004551 3300006028 Bacteria 10032
429 Ga0070717_10044850 3300006028 Bacteria 3613
430 Ga0070717_10117227 3300006028 Bacteria 2277
431 Ga0070717_10453712 3300006028 Bacteria 1155
432 Ga0070717_10555571 3300006028 Unclassified 1040
433 Ga0070717_10630238 3300006028 Unclassified 973
434 Ga0070715_10451967 3300006163 Bacteria 725
435 Ga0070716_100685547 3300006173 Unclassified 781
436 Ga0070716_100796948 3300006173 Unclassified 731
437 Ga0070712_100016473 3300006175 Bacteria 4777
438 Ga0070712_100306705 3300006175 Unclassified 1286
439 Ga0070712_100389355 3300006175 Bacteria 1149
440 Ga0070712_100684214 3300006175 Unclassified 873
441 Ga0070712_100780877 3300006175 Bacteria 819
442 Ga0070712_100865388 3300006175 Unclassified 778
443 Ga0097621_100013578 3300006237 Bacteria 6074
444 Ga0097621_100015740 3300006237 Bacteria 5700
445 Ga0097621_100018761 3300006237 Bacteria 5293
446 Ga0097621_100209356 3300006237 Unclassified 1696
447 Ga0097621_100232393 3300006237 Bacteria 1610
448 Ga0097621_100305203 3300006237 Unclassified 1407
449 Ga0097621_100356486 3300006237 Bacteria 1302
450 Ga0068871_100001817 3300006358 Bacteria 14403
451 Ga0068871_100007616 3300006358 Bacteria 7744
452 Ga0068871_100013929 3300006358 Bacteria 5979
453 Ga0068871_100023033 3300006358 Unclassified 4809
454 Ga0068871_100094475 3300006358 Unclassified 2496
455 Ga0068871_100181031 3300006358 Bacteria 1811
456 Ga0068871_100248979 3300006358 Bacteria 1547
457 Ga0068871_100553898 3300006358 Unclassified 1042
458 Ga0075428_100039310 3300006844 Bacteria 5206
459 Ga0075428_100053933 3300006844 Bacteria 4406
460 Ga0075428_100194783 3300006844 Bacteria 2192
461 Ga0075428_100375263 3300006844 Bacteria 1525
462 Ga0075433_10313300 3300006852 Bacteria 1389
463 Ga0075434_100109023 3300006871 Unclassified 2779
464 Ga0075434_100171781 3300006871 Bacteria 2188
465 Ga0075434_100208283 3300006871 Bacteria 1976
466 Ga0075434_100325667 3300006871 Unclassified 1557
467 Ga0075434_100352892 3300006871 Bacteria 1492
468 Ga0075434_100547521 3300006871 Unclassified 1177
469 Ga0075434_100577073 3300006871 Unclassified 1144
470 Ga0075434_100644291 3300006871 Unclassified 1078
471 Ga0068865_100044190 3300006881 Bacteria 3048
472 Ga0068865_100700892 3300006881 Unclassified 865
473 Ga0068865_101346575 3300006881 Unclassified 636
474 Ga0075436_100077399 3300006914 Bacteria 2304
475 Ga0075436_100113516 3300006914 Bacteria 1892
476 Ga0075436_100312407 3300006914 Bacteria 1128
477 Ga0097620_100006056 3300006931 Bacteria 12280
478 Ga0097620_100031329 3300006931 Bacteria 5340
479 Ga0097620_100178963 3300006931 Bacteria 2203
480 Ga0097620_100316123 3300006931 Bacteria 1655
481 Ga0097620_101696306 3300006931 Archaea 698
482 Ga0075435_100115740 3300007076 Bacteria 2233
483 Ga0075435_100178395 3300007076 Bacteria 1795
484 Ga0075435_100224640 3300007076 Bacteria 1595
485 Ga0105240_10008953 3300009093 Bacteria 14232
486 Ga0105240_10022687 3300009093 Bacteria 8317
487 Ga0111539_10001299 3300009094 Bacteria 33371
488 Ga0111539_10059036 3300009094 Bacteria 4550
489 Ga0111539_10060050 3300009094 Bacteria 4507
490 Ga0111539_10157405 3300009094 Bacteria 2658
491 Ga0111539_10509289 3300009094 Unclassified 1402
492 Ga0111539_10524735 3300009094 Bacteria 1380
493 Ga0111539_10539640 3300009094 Unclassified 1359
494 Ga0105245_10009797 3300009098 Bacteria 8348
495 Ga0105245_10018826 3300009098 Bacteria 6042
496 Ga0105245_10036661 3300009098 Bacteria 4357
497 Ga0105245_10103156 3300009098 Bacteria 2642
498 Ga0105245_10105036 3300009098 Bacteria 2619
499 Ga0105245_10210221 3300009098 Bacteria 1872
500 Ga0105245_10236535 3300009098 Unclassified 1769
501 Ga0105245_10441700 3300009098 Bacteria 1308
502 Ga0105247_10284676 3300009101 Bacteria 1141
503 Ga0105247_10469103 3300009101 Unclassified 911
504 Ga0114129_10095263 3300009147 Bacteria 4122
505 Ga0114129_10175486 3300009147 Bacteria 2919
506 Ga0114129_10850855 3300009147 Unclassified 1159
507 Ga0105243_10231036 3300009148 Unclassified 1641
508 Ga0105241_10015461 3300009174 Bacteria 5590
509 Ga0105241_10096732 3300009174 Bacteria 2339
510 Ga0105241_10922628 3300009174 Unclassified 812
511 Ga0105242_10022489 3300009176 Bacteria 4959
512 Ga0105242_10423439 3300009176 Unclassified 1248
513 Ga0105248_10002431 3300009177 Bacteria 20666
514 Ga0105248_10019006 3300009177 Bacteria 7597
515 Ga0105248_10158989 3300009177 Unclassified 2549
516 Ga0105248_10203082 3300009177 Unclassified 2233
517 Ga0105248_10299721 3300009177 Bacteria 1810
518 Ga0105248_10385061 3300009177 Bacteria 1579
519 Ga0105237_10107634 3300009545 Bacteria 2780
520 Ga0105237_10400540 3300009545 Bacteria 1377
521 Ga0105238_10034778 3300009551 Bacteria 5125
522 Ga0105238_11109291 3300009551 Bacteria 814
523 Ga0105249_10006766 3300009553 Bacteria 9990
524 Ga0105249_10016665 3300009553 Bacteria 6522
525 Ga0105249_10268110 3300009553 Bacteria 1700
526 Ga0105249_10347979 3300009553 Bacteria 1501
527 Ga0105249_10669291 3300009553 Bacteria 1097
528 Ga0105249_10702823 3300009553 Unclassified 1071
529 Ga0105249_10848108 3300009553 Bacteria 979
530 Ga0105249_11041037 3300009553 Unclassified 888
531 Ga0105249_11258577 3300009553 Bacteria 811
532 Ga0099796_10075146 3300010159 Bacteria 1228
533 Ga0105239_10072664 3300010375 Bacteria 3782
534 Ga0105246_10214792 3300011119 Bacteria 1504
535 Ga0105246_10516170 3300011119 Bacteria 1017
536 Ga0157373_10003902 3300013100 Bacteria 11265
537 Ga0157373_10014850 3300013100 Bacteria 5703
538 Ga0157373_10213621 3300013100 Bacteria 1360
539 Ga0157373_10375775 3300013100 Bacteria 1016
540 Ga0157371_10000446 3300013102 Bacteria 50636
541 Ga0157371_10253936 3300013102 Unclassified 1266
542 Ga0157371_10266681 3300013102 Bacteria 1235
543 Ga0157370_10010726 3300013104 Bacteria 9636
544 Ga0157370_10026708 3300013104 Bacteria 5697
545 Ga0157370_10060279 3300013104 Bacteria 3603
546 Ga0157370_10093865 3300013104 Bacteria 2816
547 Ga0157370_10153709 3300013104 Bacteria 2141
548 Ga0157370_10171572 3300013104 Bacteria 2016
549 Ga0157370_10946538 3300013104 Unclassified 781
550 Ga0157369_10012261 3300013105 Bacteria 9734
551 Ga0157369_10071605 3300013105 Bacteria 3721
552 Ga0157369_10237692 3300013105 Bacteria 1903
553 Ga0157369_10250853 3300013105 Unclassified 1847
554 Ga0157374_10032996 3300013296 Bacteria 4720
555 Ga0157374_10068236 3300013296 Bacteria 3345
556 Ga0157374_10075119 3300013296 Unclassified 3193
557 Ga0157374_10091134 3300013296 Bacteria 2907
558 Ga0157374_10110875 3300013296 Bacteria 2639
559 Ga0157374_10211274 3300013296 Unclassified 1903
560 Ga0157374_10356859 3300013296 Unclassified 1453
561 Ga0157374_10451880 3300013296 Bacteria 1286
562 Ga0157374_10538630 3300013296 Unclassified 1174
563 Ga0157374_11684549 3300013296 Unclassified 659
564 Ga0157378_10014139 3300013297 Bacteria 6984
565 Ga0157378_10054529 3300013297 Bacteria 3559
566 Ga0157378_10056068 3300013297 Bacteria 3510
567 Ga0157378_10124616 3300013297 Bacteria 2379
568 Ga0157378_10144606 3300013297 Bacteria 2211
569 Ga0157378_10480705 3300013297 Bacteria 1238
570 Ga0157378_10528490 3300013297 Unclassified 1182
571 Ga0157378_11272604 3300013297 Bacteria 776
572 Ga0163162_10006343 3300013306 Bacteria 11451
573 Ga0163162_10006529 3300013306 Bacteria 11298
574 Ga0163162_10039123 3300013306 Bacteria 4737
575 Ga0163162_10082361 3300013306 Bacteria 3290
576 Ga0163162_10118321 3300013306 Bacteria 2751
577 Ga0163162_10250502 3300013306 Bacteria 1903
578 Ga0163162_10281768 3300013306 Bacteria 1794
579 Ga0163162_10544817 3300013306 Bacteria 1289
580 Ga0163162_10558796 3300013306 Unclassified 1272
581 Ga0163162_10737186 3300013306 Bacteria 1105
582 Ga0163162_11391334 3300013306 Bacteria 798
583 Ga0163162_11551637 3300013306 Bacteria 755
584 Ga0157372_10000523 3300013307 Bacteria 42408
585 Ga0157372_10030913 3300013307 Bacteria 5860
586 Ga0157372_10032821 3300013307 Bacteria 5696
587 Ga0157372_10085120 3300013307 Bacteria 3585
588 Ga0157372_10293916 3300013307 Bacteria 1889
589 Ga0157372_10410409 3300013307 Bacteria 1578
590 Ga0157372_11614732 3300013307 Bacteria 746
591 Ga0157375_10002572 3300013308 Bacteria 15765
592 Ga0157375_10007572 3300013308 Bacteria 9494
593 Ga0157375_10031682 3300013308 Bacteria 5004
594 Ga0157375_10033665 3300013308 Bacteria 4872
595 Ga0157375_10035443 3300013308 Bacteria 4763
596 Ga0157375_10047793 3300013308 Bacteria 4181
597 Ga0157375_10064141 3300013308 Bacteria 3657
598 Ga0157375_10090221 3300013308 Bacteria 3123
599 Ga0157375_10107775 3300013308 Bacteria 2880
600 Ga0157375_10356617 3300013308 Bacteria 1628
601 Ga0157375_10602273 3300013308 Bacteria 1258
602 Ga0157375_10610839 3300013308 Unclassified 1249
603 Ga0157375_11861375 3300013308 Bacteria 714
604 Ga0157375_12170491 3300013308 Unclassified 661
605 Ga0163163_10004811 3300014325 Bacteria 11598
606 Ga0163163_10042847 3300014325 Bacteria 4435
607 Ga0163163_10060433 3300014325 Bacteria 3753
608 Ga0163163_10169102 3300014325 Bacteria 2232
609 Ga0163163_10387662 3300014325 Unclassified 1455
610 Ga0163163_10435869 3300014325 Unclassified 1370
611 Ga0157380_10178920 3300014326 Bacteria 1861
612 Ga0157380_10373587 3300014326 Bacteria 1343
613 Ga0157380_10664872 3300014326 Bacteria 1041
614 Ga0157380_10789231 3300014326 Unclassified 965
615 Ga0182008_10085522 3300014497 Bacteria 1553
616 Ga0157377_10008931 3300014745 Bacteria 4903
617 Ga0157377_10058811 3300014745 Bacteria 2189
618 Ga0157377_10127614 3300014745 Bacteria 1549
619 Ga0157377_10250451 3300014745 Bacteria 1148
620 Ga0157377_10507869 3300014745 Bacteria 844
621 Ga0157379_10015087 3300014968 Bacteria 6777
622 Ga0157379_10031752 3300014968 Bacteria 4705
623 Ga0157379_10055151 3300014968 Bacteria 3551
624 Ga0157379_10073195 3300014968 Bacteria 3066
625 Ga0157379_10278286 3300014968 Unclassified 1523
626 Ga0157376_10003007 3300014969 Bacteria 11569
627 Ga0157376_10025775 3300014969 Bacteria 4635
628 Ga0157376_10039684 3300014969 Bacteria 3842
629 Ga0157376_10076929 3300014969 Bacteria 2853
630 Ga0157376_10119817 3300014969 Bacteria 2330
631 Ga0157376_10140091 3300014969 Bacteria 2169
632 Ga0157376_10198257 3300014969 Bacteria 1845
633 Ga0157376_10230271 3300014969 Unclassified 1721
634 Ga0157376_10341720 3300014969 Bacteria 1430
635 Ga0157376_10517553 3300014969 Bacteria 1175
636 Ga0157376_11043366 3300014969 Unclassified 841
637 Ga0182005_1008598 3300015265 Bacteria 3003
638 Ga0163161_10015702 3300017792 Bacteria 5281
639 Ga0163161_10042182 3300017792 Bacteria 3281
640 Ga0163161_10073086 3300017792 Unclassified 2512
641 Ga0163161_10107910 3300017792 Bacteria 2078
642 Ga0163161_10140947 3300017792 Bacteria 1826
643 Ga0163161_10868114 3300017792 Unclassified 762
644 Ga0206356_11720413 3300020070 Bacteria 1975
645 Ga0207666_1000261 3300025271 Bacteria 7724
646 Ga0207666_1041271 3300025271 Unclassified 722
647 Ga0207673_1000951 3300025290 Bacteria 3120
648 Ga0207673_1002395 3300025290 Bacteria 2136
649 Ga0207697_10003309 3300025315 Bacteria 8017
650 Ga0207697_10004477 3300025315 Bacteria 6669
651 Ga0207697_10007175 3300025315 Bacteria 4982
652 Ga0207697_10012709 3300025315 Bacteria 3526
653 Ga0207697_10013913 3300025315 Bacteria 3349
654 Ga0207697_10025802 3300025315 Bacteria 2403
655 Ga0207656_10007104 3300025321 Bacteria 4068
656 Ga0207656_10015301 3300025321 Bacteria 2967
657 Ga0207653_10121569 3300025885 Bacteria 940
658 Ga0207653_10145502 3300025885 Unclassified 869
659 Ga0207682_10000146 3300025893 Bacteria 31872
660 Ga0207682_10079736 3300025893 Unclassified 1401
661 Ga0207692_10062561 3300025898 Bacteria 1932
662 Ga0207692_10094161 3300025898 Bacteria 1631
663 Ga0207692_10140107 3300025898 Bacteria 1375
664 Ga0207692_10393356 3300025898 Bacteria 863
665 Ga0207688_10027364 3300025901 Bacteria 3137
666 Ga0207688_10056548 3300025901 Bacteria 2204
667 Ga0207688_10105407 3300025901 Unclassified 1632
668 Ga0207688_10130638 3300025901 Bacteria 1472
669 Ga0207688_10241235 3300025901 Bacteria 1093
670 Ga0207680_10001915 3300025903 Bacteria 9760
671 Ga0207680_10010912 3300025903 Bacteria 4567
672 Ga0207680_10015333 3300025903 Bacteria 3998
673 Ga0207680_10034549 3300025903 Bacteria 2894
674 Ga0207680_10047288 3300025903 Bacteria 2549
675 Ga0207680_10057513 3300025903 Unclassified 2353
676 Ga0207680_10277385 3300025903 Bacteria 1164
677 Ga0207680_10634288 3300025903 Unclassified 765
678 Ga0207647_10015769 3300025904 Bacteria 5172
679 Ga0207699_10019067 3300025906 Bacteria 3649
680 Ga0207699_10439333 3300025906 Bacteria 934
681 Ga0207645_10000519 3300025907 Bacteria 31964
682 Ga0207645_10008023 3300025907 Bacteria 7406
683 Ga0207645_10036131 3300025907 Bacteria 3172
684 Ga0207645_10052932 3300025907 Bacteria 2594
685 Ga0207645_10061657 3300025907 Bacteria 2396
686 Ga0207645_10083026 3300025907 Unclassified 2054
687 Ga0207645_10270838 3300025907 Bacteria 1126
688 Ga0207643_10027427 3300025908 Bacteria 3158
689 Ga0207643_10032649 3300025908 Bacteria 2908
690 Ga0207643_10114043 3300025908 Unclassified 1594
691 Ga0207643_10257111 3300025908 Bacteria 1077
692 Ga0207705_10052596 3300025909 Bacteria 2932
693 Ga0207705_10128757 3300025909 Bacteria 1882
694 Ga0207705_10348839 3300025909 Bacteria 1140
695 Ga0207684_10000028 3300025910 Bacteria 306450
696 Ga0207684_10003281 3300025910 Bacteria 15868
697 Ga0207684_10032606 3300025910 Unclassified 4428
698 Ga0207684_10051288 3300025910 Bacteria 3500
699 Ga0207684_10174093 3300025910 Bacteria 1855
700 Ga0207684_10284500 3300025910 Bacteria 1426
701 Ga0207684_10329193 3300025910 Bacteria 1316
702 Ga0207684_10649754 3300025910 Unclassified 899
703 Ga0207684_10667024 3300025910 Unclassified 885
704 Ga0207707_10005207 3300025912 Bacteria 11396
705 Ga0207707_10015254 3300025912 Bacteria 6691
706 Ga0207707_10015315 3300025912 Bacteria 6676
707 Ga0207707_10058830 3300025912 Bacteria 3344
708 Ga0207695_10116325 3300025913 Bacteria 2648
709 Ga0207693_10002925 3300025915 Bacteria 14779
710 Ga0207693_10022585 3300025915 Bacteria 4999
711 Ga0207693_10066800 3300025915 Bacteria 2815
712 Ga0207693_10096529 3300025915 Bacteria 2317
713 Ga0207693_10105081 3300025915 Bacteria 2214
714 Ga0207693_10111091 3300025915 Unclassified 2149
715 Ga0207693_10137672 3300025915 Bacteria 1920
716 Ga0207693_10151897 3300025915 Bacteria 1821
717 Ga0207693_10193311 3300025915 Bacteria 1601
718 Ga0207693_10923041 3300025915 Unclassified 669
719 Ga0207663_10093753 3300025916 Bacteria 1999
720 Ga0207663_10126778 3300025916 Bacteria 1757
721 Ga0207663_10269406 3300025916 Bacteria 1261
722 Ga0207663_10282004 3300025916 Bacteria 1234
723 Ga0207663_10303054 3300025916 Bacteria 1194
724 Ga0207663_10415773 3300025916 Bacteria 1031
725 Ga0207660_10012654 3300025917 Bacteria 5526
726 Ga0207660_10040236 3300025917 Bacteria 3272
727 Ga0207660_10185491 3300025917 Bacteria 1618
728 Ga0207660_10349121 3300025917 Bacteria 1185
729 Ga0207662_10050548 3300025918 Bacteria 2470
730 Ga0207662_10060963 3300025918 Bacteria 2264
731 Ga0207657_10000229 3300025919 Bacteria 58709
732 Ga0207657_10008077 3300025919 Bacteria 10730
733 Ga0207657_10024320 3300025919 Bacteria 5614
734 Ga0207657_10061470 3300025919 Bacteria 3220
735 Ga0207657_10118344 3300025919 Bacteria 2181
736 Ga0207657_10129942 3300025919 Unclassified 2065
737 Ga0207649_10002277 3300025920 Bacteria 10798
738 Ga0207649_10012421 3300025920 Bacteria 4725
739 Ga0207649_10019167 3300025920 Bacteria 3907
740 Ga0207649_10029744 3300025920 Bacteria 3228
741 Ga0207649_10055680 3300025920 Bacteria 2466
742 Ga0207649_10065890 3300025920 Bacteria 2294
743 Ga0207652_10003991 3300025921 Bacteria 12060
744 Ga0207652_10007247 3300025921 Bacteria 8934
745 Ga0207652_10064470 3300025921 Bacteria 3170
746 Ga0207652_10074201 3300025921 Bacteria 2961
747 Ga0207652_10168764 3300025921 Bacteria 1963
748 Ga0207646_10000734 3300025922 Bacteria 42601
749 Ga0207646_10002142 3300025922 Bacteria 23602
750 Ga0207646_10006254 3300025922 Bacteria 12357
751 Ga0207646_10006743 3300025922 Bacteria 11822
752 Ga0207646_10026769 3300025922 Bacteria 5261
753 Ga0207646_10102036 3300025922 Unclassified 2572
754 Ga0207646_10134306 3300025922 Bacteria 2228
755 Ga0207646_10134948 3300025922 Bacteria 2222
756 Ga0207646_10167702 3300025922 Bacteria 1982
757 Ga0207646_10325683 3300025922 Unclassified 1388
758 Ga0207646_10329032 3300025922 Bacteria 1380
759 Ga0207646_10565005 3300025922 Bacteria 1022
760 Ga0207646_10631358 3300025922 Unclassified 960
761 Ga0207646_10738601 3300025922 Unclassified 879
762 Ga0207681_10002527 3300025923 Bacteria 11626
763 Ga0207681_10024176 3300025923 Bacteria 3897
764 Ga0207681_10046095 3300025923 Bacteria 2931
765 Ga0207681_10063647 3300025923 Bacteria 2544
766 Ga0207681_10112293 3300025923 Bacteria 1984
767 Ga0207681_10142153 3300025923 Bacteria 1789
768 Ga0207694_10299767 3300025924 Bacteria 1323
769 Ga0207694_10607278 3300025924 Unclassified 920
770 Ga0207650_10002534 3300025925 Bacteria 12678
771 Ga0207650_10016498 3300025925 Bacteria 5164
772 Ga0207650_10035787 3300025925 Bacteria 3608
773 Ga0207650_10067227 3300025925 Bacteria 2689
774 Ga0207650_10088138 3300025925 Bacteria 2366
775 Ga0207650_10093562 3300025925 Bacteria 2301
776 Ga0207650_10102856 3300025925 Bacteria 2202
777 Ga0207650_10113894 3300025925 Unclassified 2097
778 Ga0207650_10301029 3300025925 Bacteria 1310
779 Ga0207650_10365468 3300025925 Bacteria 1189
780 Ga0207650_10498298 3300025925 Bacteria 1018
781 Ga0207659_10002707 3300025926 Bacteria 10560
782 Ga0207659_10004071 3300025926 Bacteria 8822
783 Ga0207659_10004632 3300025926 Bacteria 8325
784 Ga0207659_10007428 3300025926 Bacteria 6736
785 Ga0207659_10021504 3300025926 Bacteria 4283
786 Ga0207659_10073946 3300025926 Bacteria 2497
787 Ga0207659_10080899 3300025926 Bacteria 2401
788 Ga0207659_10107969 3300025926 Bacteria 2110
789 Ga0207659_10221815 3300025926 Bacteria 1521
790 Ga0207659_10247305 3300025926 Unclassified 1445
791 Ga0207659_10300714 3300025926 Unclassified 1318
792 Ga0207659_10557799 3300025926 Unclassified 974
793 Ga0207659_10840634 3300025926 Bacteria 789
794 Ga0207687_10067295 3300025927 Unclassified 2548
795 Ga0207687_10111634 3300025927 Bacteria 2030
796 Ga0207687_10354175 3300025927 Unclassified 1197
797 Ga0207687_10413551 3300025927 Bacteria 1112
798 Ga0207687_10436830 3300025927 Bacteria 1083
799 Ga0207687_10514625 3300025927 Bacteria 1000
800 Ga0207700_10046468 3300025928 Bacteria 3211
801 Ga0207700_10064817 3300025928 Unclassified 2785
802 Ga0207700_10164458 3300025928 Bacteria 1845
803 Ga0207700_10694708 3300025928 Bacteria 908
804 Ga0207664_10003067 3300025929 Bacteria 11098
805 Ga0207664_10006738 3300025929 Bacteria 7934
806 Ga0207664_10068190 3300025929 Bacteria 2857
807 Ga0207664_10089089 3300025929 Unclassified 2526
808 Ga0207664_10184931 3300025929 Unclassified 1791
809 Ga0207664_10214414 3300025929 Bacteria 1667
810 Ga0207664_10273045 3300025929 Bacteria 1481
811 Ga0207664_10554166 3300025929 Unclassified 1031
812 Ga0207644_10000405 3300025931 Bacteria 28099
813 Ga0207644_10008476 3300025931 Bacteria 6730
814 Ga0207644_10012225 3300025931 Bacteria 5698
815 Ga0207644_10045397 3300025931 Bacteria 3126
816 Ga0207644_10091346 3300025931 Bacteria 2270
817 Ga0207644_10095598 3300025931 Bacteria 2222
818 Ga0207644_10112928 3300025931 Bacteria 2057
819 Ga0207644_10147015 3300025931 Unclassified 1820
820 Ga0207644_10169498 3300025931 Bacteria 1703
821 Ga0207644_10224422 3300025931 Unclassified 1491
822 Ga0207644_10328019 3300025931 Unclassified 1239
823 Ga0207644_10498472 3300025931 Bacteria 1004
824 Ga0207690_10000348 3300025932 Bacteria 30788
825 Ga0207690_10006051 3300025932 Bacteria 7165
826 Ga0207690_10021602 3300025932 Bacteria 3993
827 Ga0207690_10035029 3300025932 Bacteria 3238
828 Ga0207690_10171351 3300025932 Unclassified 1626
829 Ga0207690_10453579 3300025932 Bacteria 1031
830 Ga0207706_10000045 3300025933 Bacteria 120758
831 Ga0207706_10092757 3300025933 Bacteria 2655
832 Ga0207706_10186955 3300025933 Bacteria 1819
833 Ga0207706_10203631 3300025933 Bacteria 1735
834 Ga0207706_10214358 3300025933 Unclassified 1687
835 Ga0207706_10266083 3300025933 Unclassified 1496
836 Ga0207706_10671301 3300025933 Unclassified 887
837 Ga0207709_10024389 3300025935 Bacteria 3454
838 Ga0207709_10143527 3300025935 Bacteria 1644
839 Ga0207709_10215953 3300025935 Bacteria 1380
840 Ga0207670_10011155 3300025936 Bacteria 5205
841 Ga0207670_10017407 3300025936 Bacteria 4344
842 Ga0207670_10021344 3300025936 Bacteria 3993
843 Ga0207670_10032817 3300025936 Bacteria 3341
844 Ga0207670_10293109 3300025936 Bacteria 1271
845 Ga0207669_10010707 3300025937 Bacteria 4427
846 Ga0207669_10082682 3300025937 Unclassified 2062
847 Ga0207669_10124455 3300025937 Bacteria 1758
848 Ga0207669_10166393 3300025937 Bacteria 1564
849 Ga0207669_10330980 3300025937 Bacteria 1169
850 Ga0207704_10525997 3300025938 Bacteria 957
851 Ga0207704_11006500 3300025938 Unclassified 705
852 Ga0207665_10035723 3300025939 Bacteria 3301
853 Ga0207665_10069200 3300025939 Bacteria 2406
854 Ga0207665_10541113 3300025939 Unclassified 904
855 Ga0207665_10587753 3300025939 Unclassified 868
856 Ga0207691_10000310 3300025940 Bacteria 48478
857 Ga0207691_10000629 3300025940 Bacteria 34886
858 Ga0207691_10004119 3300025940 Bacteria 14122
859 Ga0207691_10025264 3300025940 Bacteria 5578
860 Ga0207691_10029499 3300025940 Bacteria 5131
861 Ga0207691_10050625 3300025940 Bacteria 3802
862 Ga0207691_10097269 3300025940 Bacteria 2631
863 Ga0207691_10174393 3300025940 Bacteria 1881
864 Ga0207691_10182382 3300025940 Bacteria 1834
865 Ga0207691_10220893 3300025940 Bacteria 1643
866 Ga0207691_10227923 3300025940 Bacteria 1614
867 Ga0207691_10258771 3300025940 Unclassified 1500
868 Ga0207711_10011574 3300025941 Bacteria 7334
869 Ga0207711_10019828 3300025941 Bacteria 5604
870 Ga0207711_10086395 3300025941 Bacteria 2750
871 Ga0207711_10126282 3300025941 Unclassified 2288
872 Ga0207711_10157887 3300025941 Bacteria 2051
873 Ga0207711_10171143 3300025941 Bacteria 1971
874 Ga0207711_10281258 3300025941 Bacteria 1532
875 Ga0207689_10013147 3300025942 Bacteria 7063
876 Ga0207689_10096085 3300025942 Bacteria 2434
877 Ga0207661_10009915 3300025944 Bacteria 6840
878 Ga0207661_10074070 3300025944 Bacteria 2790
879 Ga0207661_10141705 3300025944 Bacteria 2069
880 Ga0207661_10163180 3300025944 Bacteria 1934
881 Ga0207661_11025791 3300025944 Unclassified 760
882 Ga0207661_11113666 3300025944 Unclassified 727
883 Ga0207679_10003526 3300025945 Bacteria 9684
884 Ga0207679_10011829 3300025945 Bacteria 5671
885 Ga0207679_10059635 3300025945 Bacteria 2832
886 Ga0207679_10126044 3300025945 Bacteria 2046
887 Ga0207679_10164325 3300025945 Unclassified 1821
888 Ga0207679_10206445 3300025945 Bacteria 1645
889 Ga0207679_10496401 3300025945 Unclassified 1088
890 Ga0207679_10613889 3300025945 Bacteria 981
891 Ga0207667_10002826 3300025949 Bacteria 21544
892 Ga0207667_10003469 3300025949 Bacteria 19459
893 Ga0207667_10171767 3300025949 Unclassified 2228
894 Ga0207667_10214858 3300025949 Unclassified 1971
895 Ga0207667_10738763 3300025949 Bacteria 984
896 Ga0207667_10856780 3300025949 Unclassified 903
897 Ga0207667_11143784 3300025949 Bacteria 760
898 Ga0207651_10025782 3300025960 Bacteria 3660
899 Ga0207651_10059712 3300025960 Unclassified 2643
900 Ga0207651_10165509 3300025960 Bacteria 1738
901 Ga0207651_10171949 3300025960 Unclassified 1709
902 Ga0207651_10212322 3300025960 Bacteria 1559
903 Ga0207651_10228386 3300025960 Unclassified 1509
904 Ga0207651_10414992 3300025960 Bacteria 1148
905 Ga0207651_10459188 3300025960 Bacteria 1094
906 Ga0207651_10553609 3300025960 Bacteria 1000
907 Ga0207712_10302566 3300025961 Bacteria 1313
908 Ga0207712_10903992 3300025961 Unclassified 780
909 Ga0207712_11070034 3300025961 Bacteria 717
910 Ga0207712_11165510 3300025961 Unclassified 687
911 Ga0207668_10003264 3300025972 Bacteria 9507
912 Ga0207668_10005981 3300025972 Bacteria 7173
913 Ga0207668_10018149 3300025972 Bacteria 4420
914 Ga0207668_10029476 3300025972 Bacteria 3597
915 Ga0207668_10128930 3300025972 Bacteria 1928
916 Ga0207668_10146554 3300025972 Unclassified 1822
917 Ga0207668_10167562 3300025972 Unclassified 1719
918 Ga0207668_10313168 3300025972 Bacteria 1300
919 Ga0207668_11005799 3300025972 Unclassified 745
920 Ga0207640_10109298 3300025981 Bacteria 1956
921 Ga0207640_10244709 3300025981 Bacteria 1388
922 Ga0207640_10306082 3300025981 Bacteria 1259
923 Ga0207640_10644912 3300025981 Bacteria 902
924 Ga0207640_11185715 3300025981 Bacteria 678
925 Ga0207658_10008951 3300025986 Bacteria 6790
926 Ga0207658_10076428 3300025986 Bacteria 2551
927 Ga0207658_10112751 3300025986 Unclassified 2153
928 Ga0207658_10129696 3300025986 Bacteria 2024
929 Ga0207658_10443746 3300025986 Unclassified 1148
930 Ga0207658_10884370 3300025986 Unclassified 813
931 Ga0207677_10011855 3300026023 Bacteria 4988
932 Ga0207677_10089514 3300026023 Bacteria 2234
933 Ga0207677_10098606 3300026023 Bacteria 2144
934 Ga0207677_10146418 3300026023 Bacteria 1816
935 Ga0207677_10187502 3300026023 Bacteria 1633
936 Ga0207677_10252945 3300026023 Unclassified 1432
937 Ga0207677_10379498 3300026023 Unclassified 1193
938 Ga0207677_10738246 3300026023 Bacteria 876
939 Ga0207677_10863564 3300026023 Bacteria 814
940 Ga0207703_10005921 3300026035 Bacteria 9800
941 Ga0207703_10007291 3300026035 Bacteria 8791
942 Ga0207703_10059886 3300026035 Bacteria 3111
943 Ga0207703_10119091 3300026035 Bacteria 2264
944 Ga0207703_10198221 3300026035 Bacteria 1783
945 Ga0207703_10282430 3300026035 Unclassified 1508
946 Ga0207639_10008842 3300026041 Bacteria 6925
947 Ga0207639_10030631 3300026041 Bacteria 3947
948 Ga0207639_10353982 3300026041 Bacteria 1312
949 Ga0207639_10401021 3300026041 Bacteria 1235
950 Ga0207678_10004526 3300026067 Bacteria 12499
951 Ga0207678_10010760 3300026067 Bacteria 8038
952 Ga0207678_10014233 3300026067 Bacteria 6993
953 Ga0207678_10154353 3300026067 Unclassified 1960
954 Ga0207678_10187032 3300026067 Unclassified 1769
955 Ga0207678_10483728 3300026067 Unclassified 1078
956 Ga0207708_10008199 3300026075 Bacteria 7740
957 Ga0207708_10473231 3300026075 Unclassified 1047
958 Ga0207708_10578467 3300026075 Bacteria 949
959 Ga0207708_10767764 3300026075 Bacteria 828
960 Ga0207702_10000715 3300026078 Bacteria 35679
961 Ga0207702_10017719 3300026078 Bacteria 5895
962 Ga0207702_10027561 3300026078 Bacteria 4718
963 Ga0207702_10056652 3300026078 Bacteria 3328
964 Ga0207641_10001932 3300026088 Bacteria 19887
965 Ga0207641_10002486 3300026088 Bacteria 17012
966 Ga0207641_10048312 3300026088 Bacteria 3591
967 Ga0207641_10068310 3300026088 Bacteria 3047
968 Ga0207641_10696297 3300026088 Unclassified 1000
969 Ga0207648_10000364 3300026089 Bacteria 49697
970 Ga0207648_10002046 3300026089 Bacteria 21988
971 Ga0207648_10003344 3300026089 Bacteria 16855
972 Ga0207648_10014214 3300026089 Bacteria 7363
973 Ga0207648_10035274 3300026089 Bacteria 4407
974 Ga0207648_10114825 3300026089 Bacteria 2366
975 Ga0207648_10173623 3300026089 Unclassified 1906
976 Ga0207648_10907644 3300026089 Bacteria 823
977 Ga0207676_10000633 3300026095 Bacteria 28376
978 Ga0207676_10003751 3300026095 Bacteria 10735
979 Ga0207676_10014659 3300026095 Bacteria 5645
980 Ga0207676_10126705 3300026095 Unclassified 2164
981 Ga0207676_10151572 3300026095 Unclassified 1997
982 Ga0207674_10000225 3300026116 Bacteria 70648
983 Ga0207674_10030050 3300026116 Bacteria 5716
984 Ga0207674_10108322 3300026116 Bacteria 2755
985 Ga0207674_10281679 3300026116 Bacteria 1610
986 Ga0207675_100000658 3300026118 Bacteria 33969
987 Ga0207675_100048450 3300026118 Bacteria 3966
988 Ga0207675_100054380 3300026118 Bacteria 3734
989 Ga0207675_100133367 3300026118 Bacteria 2355
990 Ga0207675_100211783 3300026118 Unclassified 1864
991 Ga0207675_100243445 3300026118 Bacteria 1738
992 Ga0207675_101089251 3300026118 Unclassified 819
993 Ga0207683_10000076 3300026121 Bacteria 77762
994 Ga0207683_10000121 3300026121 Bacteria 64376
995 Ga0207683_10005699 3300026121 Bacteria 10686
996 Ga0207683_10013281 3300026121 Bacteria 7022
997 Ga0207683_10083217 3300026121 Bacteria 2844
998 Ga0207683_10225139 3300026121 Bacteria 1710
999 Ga0207683_10311584 3300026121 Bacteria 1441
1000 Ga0207698_10007229 3300026142 Bacteria 6957
1001 Ga0207698_10007522 3300026142 Bacteria 6827
1002 Ga0207698_10015072 3300026142 Bacteria 5165
1003 Ga0207698_10083517 3300026142 Bacteria 2585
1004 Ga0207698_10161096 3300026142 Bacteria 1962
1005 Ga0207698_10366647 3300026142 Unclassified 1366
1006 Ga0207698_10400033 3300026142 Unclassified 1312
1007 Ga0207698_10426621 3300026142 Bacteria 1274
1008 Ga0209995_1007841 3300027471 Bacteria 1722
1009 Ga0209968_1022046 3300027526 Bacteria 1037
1010 Ga0209982_1041769 3300027552 Bacteria 732
1011 Ga0210002_1007025 3300027617 Bacteria 1703
1012 Ga0210002_1026552 3300027617 Bacteria 950
1013 Ga0209983_1003112 3300027665 Bacteria 3564
1014 Ga0209971_1001091 3300027682 Bacteria 6889
1015 Ga0209974_10000048 3300027876 Bacteria 30134
1016 Ga0209974_10049320 3300027876 Bacteria 1412
1017 Ga0207428_10354896 3300027907 Bacteria 1078
1018 Ga0268266_10028455 3300028379 Bacteria 4750
1019 Ga0268266_10046833 3300028379 Bacteria 3702
1020 Ga0268266_10066893 3300028379 Bacteria 3109
1021 Ga0268266_10101921 3300028379 Bacteria 2531
1022 Ga0268266_10181768 3300028379 Bacteria 1915
1023 Ga0268266_10324459 3300028379 Unclassified 1442
1024 Ga0268266_10494484 3300028379 Bacteria 1167
1025 Ga0268266_10725778 3300028379 Bacteria 958
1026 Ga0268266_10781206 3300028379 Unclassified 922
1027 Ga0268265_10049098 3300028380 Unclassified 3172
1028 Ga0268265_10104731 3300028380 Bacteria 2294
1029 Ga0268265_10174509 3300028380 Bacteria 1841
1030 Ga0268265_10361016 3300028380 Bacteria 1330
1031 Ga0268265_10599475 3300028380 Bacteria 1053
1032 Ga0268264_10007545 3300028381 Bacteria 9076
1033 Ga0268264_10010492 3300028381 Bacteria 7658
1034 Ga0268264_10024971 3300028381 Bacteria 4884
1035 Ga0268264_10067969 3300028381 Bacteria 3009
1036 Ga0268264_10084520 3300028381 Bacteria 2721
1037 Ga0268264_10280500 3300028381 Unclassified 1560
1038 Ga0268264_10328401 3300028381 Bacteria 1449
1039 Ga0268264_10330570 3300028381 Bacteria 1444
1040 Ga0268264_10640838 3300028381 Bacteria 1051
1041 Ga0307513_10045324 3300031456 Bacteria 4807
1042 Ga0307408_100557049 3300031548 Bacteria 1012
1043 Ga0307408_100827325 3300031548 Bacteria 842
1044 Ga0307405_10369740 3300031731 Bacteria 1112
1045 Ga0307405_10514766 3300031731 Bacteria 962
1046 Ga0307405_10572863 3300031731 Bacteria 917
1047 Ga0307413_10080155 3300031824 Unclassified 2089
1048 Ga0307410_10098627 3300031852 Bacteria 2090
1049 Ga0307410_10178627 3300031852 Unclassified 1605
1050 Ga0307410_10449410 3300031852 Bacteria 1051
1051 Ga0307406_10072396 3300031901 Unclassified 2262
1052 Ga0307407_10001541 3300031903 Bacteria 8458
1053 Ga0307407_10600723 3300031903 Bacteria 819
1054 Ga0307412_10048394 3300031911 Bacteria 2796
1055 Ga0307409_100005712 3300031995 Bacteria 7211
1056 Ga0307409_100009446 3300031995 Bacteria 5992
1057 Ga0307409_100024574 3300031995 Bacteria 4205
1058 Ga0307409_101149512 3300031995 Bacteria 799
1059 Ga0307416_100005475 3300032002 Bacteria 7798
1060 Ga0307416_100385011 3300032002 Bacteria 1434
1061 Ga0307416_100503129 3300032002 Unclassified 1276
1062 Ga0307414_10021464 3300032004 Bacteria 4053
1063 Ga0307414_10365959 3300032004 Unclassified 1242
1064 Ga0307411_10027198 3300032005 Bacteria 3456
1065 Ga0307411_10043391 3300032005 Bacteria 2877
1066 Ga0307415_100019074 3300032126 Bacteria 4157
1067 Ga0307415_100267275 3300032126 Bacteria 1399
1068 Ga0373959_0091406 3300034820 Unclassified 714
1069 Ga0373929_0090138 3300035085 Unclassified 760
1070 Ga0373934_0055451 3300035086 Unclassified 1575
1071 Ga0373944_0051313 3300035089 Bacteria 1301
1072 Ga0373949_0043851 3300035090 Bacteria 1108
1073 Ga0373951_0055773 3300035091 Unclassified 981
1074 Ga0373923_0221649 3300035111 Bacteria 879
1075 Ga0373945_0035016 3300035116 Bacteria 1793
1076 Ga0373953_0018370 3300035117 Unclassified 2586
1077 Ga0373953_0127717 3300035117 Bacteria 1083
1078 Ga0373954_0134456 3300035118 Unclassified 1205
1079 Ga0373954_0383179 3300035118 Bacteria 695
1080 Ga0373957_0056436 3300035120 Unclassified 1512
1081 Ga0373957_0140634 3300035120 Bacteria 987
1082 Ga0373943_0013149 3300035170 Bacteria 3735
1083 Ga0373943_0042386 3300035170 Unclassified 2206
1084 Ga0373943_0108319 3300035170 Unclassified 1462
1085 Ga0373943_0164482 3300035170 Bacteria 1210
1086 Ga0373943_0187626 3300035170 Unclassified 1139
1087 Ga0373943_0295284 3300035170 Bacteria 919
1088 Ga0373943_0296106 3300035170 Unclassified 918
1089 Ga0373946_0053581 3300035171 Bacteria 1695
1090 Ga0373955_0031790 3300035172 Unclassified 2766
1091 Ga0373955_0123356 3300035172 Unclassified 1507
1092 Ga0373955_0207398 3300035172 Bacteria 1168
1093 Ga0373955_0431393 3300035172 Bacteria 802
1094 Ga0373942_0174660 3300035207 Unclassified 701
1095 Ga0373942_0233011 3300035207 Unclassified 621
1096 Ga0373961_0055934 3300035241 Unclassified 1184
1097 Ga0373961_0141227 3300035241 Unclassified 814
1098 Ga0373961_0231975 3300035241 Bacteria 662
1099 Ga0373924_0168041 3300035410 Bacteria 963
1100 Ga0373924_0193320 3300035410 Unclassified 897
1101 Ga0373924_0272505 3300035410 Unclassified 750
1102 Ga0373931_0065836 3300035691 Bacteria 1965
1103 Ga0373931_0093401 3300035691 Bacteria 1680
1104 Ga0373931_0162623 3300035691 Bacteria 1310
1105 Ga0373931_0285613 3300035691 Unclassified 1014
1106 Ga0373931_0532831 3300035691 Unclassified 761
1107 Ga0373935_0048456 3300035692 Bacteria 2690
1108 Ga0373935_0049597 3300035692 Bacteria 2661
1109 Ga0373935_0128571 3300035692 Unclassified 1700
1110 Ga0373935_0353488 3300035692 Unclassified 1048
1111 Ga0373935_0554699 3300035692 Unclassified 838
1112 Ga0373927_0086834 3300035695 Bacteria 2031
1113 Ga0373927_0157181 3300035695 Bacteria 1489
1114 Ga0373927_0160628 3300035695 Unclassified 1472
1115 Ga0373933_0078009 3300035724 Bacteria 2026
1116 Ga0373933_0434664 3300035724 Unclassified 858
1117 Ga0373933_0751308 3300035724 Unclassified 642
1118 Ga0373947_0153234 3300035725 Unclassified 1486
1119 Ga0373947_0156153 3300035725 Unclassified 1473
1120 Ga0373937_0004100 3300036401 Bacteria 12359
1121 Ga0373937_0020917 3300036401 Bacteria 5869
1122 Ga0373937_0084311 3300036401 Bacteria 2940
1123 Ga0373937_0086762 3300036401 Bacteria 2896
1124 Ga0373937_0454968 3300036401 Unclassified 1216
1125 Ga0373937_0719962 3300036401 Bacteria 945
1126 Ga0373925_0014302 3300037068 Bacteria 5741
1127 Ga0373925_0051602 3300037068 Bacteria 3071
1128 Ga0373925_0175884 3300037068 Bacteria 1692
1129 Ga0373925_0212371 3300037068 Bacteria 1542
1130 Ga0373925_0656339 3300037068 Unclassified 864
1131 Ga0395900_0002016 3300037418 Bacteria 22869
1132 Ga0395900_0035910 3300037418 Bacteria 5107
1133 Ga0395900_0203491 3300037418 Unclassified 2002
1134 Ga0395900_0217548 3300037418 Bacteria 1927
1135 Ga0395900_0767025 3300037418 Unclassified 894
1136 Ga0395898_0012264 3300037466 Bacteria 8863
1137 Ga0395898_0118427 3300037466 Bacteria 2537
1138 Ga0395898_0293100 3300037466 Bacteria 1552
1139 Ga0395905_0034576 3300037471 Bacteria 4746
1140 Ga0395905_0158105 3300037471 Bacteria 2131
1141 Ga0395905_0517289 3300037471 Bacteria 1094
1142 Ga0395901_0034534 3300038443 Bacteria 5222
1143 Ga0395901_0056833 3300038443 Bacteria 4071
1144 Ga0395901_0367164 3300038443 Unclassified 1483
1145 Ga0395901_1110382 3300038443 Unclassified 761
1146 Ga0436363_0788885 3300039450 Unclassified 1095
1147 Ga0436362_0735304 3300039453 Unclassified 1533
1148 Ga0451791_0486903 3300041451 Unclassified 907
1149 Ga0451807_0453940 3300041486 Unclassified 1519
1150 Ga0451807_0845975 3300041486 Bacteria 2570
1151 Ga0451807_1843067 3300041486 Unclassified 1225
1152 Ga0451807_2078124 3300041486 Unclassified 631
1153 Ga0451835_0936074 3300041492 Unclassified 1086
1154 Ga0451839_0036848 3300041496 Bacteria 825
1155 Ga0439448_0090790 3300042005 Unclassified 1032
1156 Ga0439451_003915 3300042009 Bacteria 3028
1157 Ga0439454_004180 3300042011 Bacteria 1648
1158 Ga0439454_038878 3300042011 Unclassified 772
1159 Ga0439455_0017390 3300042012 Unclassified 1675
1160 Ga0439434_0225377 3300042435 Bacteria 637
1161 Ga0439435_0107671 3300042436 Bacteria 862
1162 Ga0439459_0056536 3300042438 Unclassified 876
1163 Ga0451577_0672392 3300042876 Unclassified 938
1164 Ga0466965_0363010 3300044683 Unclassified 795
1165 Ga0466964_0063166 3300044706 Unclassified 1546
1166 Ga0451576_0000443 3300045051 Bacteria 94447
1167 Ga0451576_0005126 3300045051 Bacteria 16602
1168 Ga0451576_0062976 3300045051 Bacteria 3866
1169 Ga0466967_0580341 3300045976 Bacteria 1105
1170 Ga0495592_0077861 3300046454 Bacteria 2402
1171 Ga0495603_0499316 3300046455 Bacteria 697
1172 Ga0495603_0542386 3300046455 Unclassified 666
1173 Ga0495651_0002069 3300046462 Bacteria 15476
1174 Ga0495651_0119451 3300046462 Bacteria 1939
1175 Ga0495651_0167256 3300046462 Unclassified 1569
1176 Ga0495651_0489282 3300046462 Unclassified 789
1177 Ga0495653_0131853 3300046463 Unclassified 1768
1178 Ga0495653_0379707 3300046463 Bacteria 903
1179 Ga0495580_0288511 3300046472 Bacteria 1119
1180 Ga0495605_0252741 3300046474 Unclassified 754
1181 Ga0495662_0133205 3300046476 Bacteria 1222
1182 Ga0495662_0315612 3300046476 Unclassified 769
1183 Ga0495585_0261865 3300046492 Unclassified 860
1184 Ga0495608_0059603 3300046511 Bacteria 2514
1185 Ga0495608_0104512 3300046511 Unclassified 1824
1186 Ga0495608_0135699 3300046511 Unclassified 1573
1187 Ga0495608_0419992 3300046511 Unclassified 816
1188 Ga0495618_0106238 3300046514 Bacteria 1797
1189 Ga0495628_0161951 3300046516 Unclassified 1700
1190 Ga0495628_0398602 3300046516 Bacteria 1005
1191 Ga0495630_0017716 3300046517 Bacteria 5222
1192 Ga0495630_0122358 3300046517 Bacteria 1974
1193 Ga0495630_0659161 3300046517 Unclassified 801
1194 Ga0495652_0002382 3300046529 Bacteria 19460
1195 Ga0495652_0018444 3300046529 Bacteria 6220
1196 Ga0495652_0097537 3300046529 Bacteria 2391
1197 Ga0495665_0080554 3300046531 Bacteria 1713
1198 Ga0495587_0099795 3300046536 Bacteria 1673
1199 Ga0495598_0065706 3300046537 Bacteria 1130
1200 Ga0495621_0067420 3300046539 Bacteria 1311
1201 Ga0495645_0001349 3300046543 Bacteria 16596
1202 Ga0495645_0076108 3300046543 Bacteria 2415
1203 Ga0495645_0098755 3300046543 Bacteria 2078
1204 Ga0495645_0223375 3300046543 Bacteria 1266
1205 Ga0495667_0015938 3300046559 Bacteria 5080
1206 Ga0495667_0035700 3300046559 Unclassified 3321
1207 Ga0495667_0467394 3300046559 Bacteria 792
1208 Ga0495656_0354571 3300046615 Unclassified 761
1209 Ga0495635_0703429 3300046663 Unclassified 655
1210 Ga0495635_0727494 3300046663 Bacteria 642
1211 Ga0495659_0105214 3300046664 Unclassified 1097
1212 Ga0495659_0201372 3300046664 Unclassified 817
1213 Ga0495657_0024000 3300046675 Unclassified 4350
1214 Ga0495599_0083130 3300046678 Unclassified 2000
1215 Ga0495599_0169053 3300046678 Bacteria 1349
1216 Ga0495599_0609517 3300046678 Bacteria 635
1217 Ga0495623_0018902 3300046679 Bacteria 4449
1218 Ga0495623_0065191 3300046679 Bacteria 2278
1219 Ga0495646_0022094 3300046680 Bacteria 4015
1220 Ga0495658_0066607 3300046683 Bacteria 2081
1221 Ga0495658_0183254 3300046683 Unclassified 1300
1222 Ga0495669_0168597 3300046684 Bacteria 1041
1223 Ga0495669_0237917 3300046684 Unclassified 874
1224 Ga0495600_0052803 3300046809 Unclassified 2654
1225 Ga0495600_0112176 3300046809 Bacteria 1776
1226 Ga0495604_0480204 3300047317 Bacteria 808
1227 Ga0495674_0201867 3300047319 Bacteria 1649
1228 Ga0495676_0184902 3300047321 Bacteria 1458
1229 Ga0495680_0218080 3300047322 Bacteria 1363
1230 Ga0495680_0572295 3300047322 Bacteria 759
1231 Ga0495680_0776973 3300047322 Bacteria 627
1232 Ga0495675_0020921 3300047444 Unclassified 4164
1233 Ga0495675_0106698 3300047444 Bacteria 1750
1234 Ga0495684_0018401 3300047471 Bacteria 5382
1235 Ga0495684_0244313 3300047471 Unclassified 1308
1236 Ga0495593_0099700 3300047673 Bacteria 1491
1237 Ga0495602_0092945 3300048088 Bacteria 2497
1238 Ga0495602_0485795 3300048088 Unclassified 866
1239 Ga0496100_0029379 3300048903 Unclassified 3400
1240 Ga0496100_0363946 3300048903 Bacteria 1095
1241 Ga0496100_0367823 3300048903 Bacteria 1089
1242 Ga0496100_0603440 3300048903 Unclassified 852
1243 Ga0496101_0030711 3300048904 Bacteria 3771
1244 Ga0496101_0057350 3300048904 Bacteria 2817
1245 Ga0496101_0191061 3300048904 Unclassified 1580
1246 Ga0496101_0255690 3300048904 Unclassified 1365
1247 Ga0496101_0390007 3300048904 Bacteria 1096
1248 Ga0496102_0060713 3300048905 Unclassified 3458
1249 Ga0496102_0098397 3300048905 Bacteria 2714
1250 Ga0496102_0248196 3300048905 Bacteria 1678
1251 Ga0496102_0557253 3300048905 Unclassified 1069
1252 Ga0496102_1183070 3300048905 Bacteria 684
1253 Ga0496103_0048618 3300048906 Bacteria 2621
1254 Ga0496103_0074371 3300048906 Bacteria 2130
1255 Ga0496103_0099912 3300048906 Bacteria 1836
1256 Ga0496104_0242492 3300048907 Bacteria 1715
1257 Ga0496104_0267729 3300048907 Unclassified 1621
1258 Ga0496104_0292550 3300048907 Unclassified 1541
1259 Ga0496104_0369501 3300048907 Unclassified 1347
1260 Ga0496104_0406503 3300048907 Unclassified 1274
1261 Ga0496105_0015917 3300048908 Bacteria 5999
1262 Ga0496105_0171980 3300048908 Unclassified 1776
1263 Ga0496106_0000931 3300048909 Bacteria 21318
1264 Ga0496106_0089107 3300048909 Bacteria 2379
1265 Ga0496106_0302521 3300048909 Unclassified 1283
1266 Ga0496106_0441091 3300048909 Bacteria 1046
1267 Ga0496107_0004980 3300048910 Bacteria 9042
1268 Ga0496107_0114221 3300048910 Unclassified 1987
1269 Ga0496108_0228481 3300048911 Unclassified 1618
1270 Ga0496108_0275170 3300048911 Unclassified 1466
1271 Ga0496108_0358646 3300048911 Bacteria 1272
1272 Ga0496108_0529651 3300048911 Bacteria 1028
1273 Ga0496108_0702327 3300048911 Unclassified 877
1274 Ga0496109_0003295 3300048912 Bacteria 13486
1275 Ga0496109_0267962 3300048912 Unclassified 1609
1276 Ga0496109_0628543 3300048912 Unclassified 1010
1277 Ga0496109_0727887 3300048912 Bacteria 930
1278 Ga0496110_0005169 3300048913 Bacteria 10205
1279 Ga0496110_0186176 3300048913 Bacteria 1885
1280 Ga0496110_0730324 3300048913 Bacteria 893
1281 Ga0496110_0748007 3300048913 Bacteria 881
1282 Ga0496110_0983568 3300048913 Bacteria 751
1283 Ga0496111_0071833 3300048914 Bacteria 2519
1284 Ga0496111_0294540 3300048914 Unclassified 1203
1285 Ga0496112_0012037 3300048915 Bacteria 7937
1286 Ga0496112_0697637 3300048915 Unclassified 943
1287 Ga0496112_0927724 3300048915 Bacteria 792
1288 Ga0496113_0514411 3300048916 Unclassified 961
1289 Ga0496114_0006008 3300048917 Bacteria 9553
1290 Ga0496114_0386386 3300048917 Unclassified 1239
1291 Ga0496115_0002245 3300048918 Bacteria 13825
1292 Ga0496115_0011572 3300048918 Bacteria 6615
1293 Ga0496115_0041385 3300048918 Bacteria 3667
1294 Ga0496115_0361349 3300048918 Bacteria 1183
1295 Ga0496115_0364171 3300048918 Bacteria 1178
1296 Ga0496115_0779278 3300048918 Unclassified 746
1297 Ga0501040_0268614 3300049576 Unclassified 1218
1298 Ga0501067_0130946 3300049583 Unclassified 1396
1299 Ga0501072_0837507 3300049588 Bacteria 719
1300 Ga0501075_0244207 3300049591 Bacteria 1369
1301 Ga0501243_001814 3300049675 Bacteria 3092
1302 Ga0501081_0166412 3300049743 Bacteria 1591
1303 Ga0501045_0359695 3300049824 Bacteria 1083
1304 nmdc:mga05p37_230926_c1 3300050507 Bacteria 2229
1305 nmdc:mga05p37_508068_c1 3300050507 Unclassified 1381
1306 nmdc:mga05p37_624008_c1 3300050507 Unclassified 1212
1307 nmdc:mga05p37_626317_c1 3300050507 Unclassified 1210
1308 nmdc:mga08y16_1060237_c1 3300050511 Unclassified 787
1309 nmdc:mga08y16_123955_c1 3300050511 Unclassified 2688
1310 nmdc:mga08y16_140210_c1 3300050511 Bacteria 2513
1311 nmdc:mga08y16_250812_c1 3300050511 Bacteria 1829
1312 nmdc:mga08y16_4473_c1 3300050511 Bacteria 14606
1313 nmdc:mga0n895_1016870_c1 3300050512 Bacteria 809
1314 nmdc:mga0n895_120848_c1 3300050512 Bacteria 2640
1315 nmdc:mga0n895_264144_c1 3300050512 Bacteria 1746
1316 nmdc:mga0n895_325208_c1 3300050512 Bacteria 1558
1317 nmdc:mga0n895_383427_c1 3300050512 Bacteria 1422
1318 nmdc:mga0n895_979579_c1 3300050512 Unclassified 828
1319 nmdc:mga08x19_258084_c1 3300050514 Bacteria 1204
1320 nmdc:mga08x19_398716_c1 3300050514 Bacteria 965
1321 nmdc:mga08x19_528808_c1 3300050514 Bacteria 834
1322 nmdc:mga0a205_738712_c1 3300050515 Bacteria 833
1323 nmdc:mga0a205_75661_c1 3300050515 Bacteria 3253
1324 Ga0495601_0031806 3300053077 Bacteria 3281
1325 Ga0495601_0122844 3300053077 Bacteria 1687
1326 Ga0495595_0112475 3300053084 Bacteria 1321
1327 Ga0495595_0139857 3300053084 Bacteria 1187
1328 Ga0495619_0055978 3300053085 Bacteria 2614
1329 Ga0495619_0429277 3300053085 Bacteria 911
1330 Ga0495619_0528656 3300053085 Bacteria 810

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100258573 Ga0070671_1002585732 145
2 3300025925 Ga0207650_10016498 Ga0207650_100164987 145
3 3300026095 Ga0207676_10151572 Ga0207676_101515723 145
4 3300005328 Ga0070676_10057250 Ga0070676_100572502 153
5 3300005354 Ga0070675_100049890 Ga0070675_1000498903 153
6 3300005364 Ga0070673_100103167 Ga0070673_1001031673 153
7 3300005548 Ga0070665_100410794 Ga0070665_1004107942 153
8 3300025907 Ga0207645_10083026 Ga0207645_100830262 153
9 3300025926 Ga0207659_10247305 Ga0207659_102473052 153
10 3300025940 Ga0207691_10258771 Ga0207691_102587713 153
11 3300025960 Ga0207651_10228386 Ga0207651_102283862 153
12 3300025972 Ga0207668_10313168 Ga0207668_103131682 153
13 3300026118 Ga0207675_100000658 Ga0207675_1000006581 153
14 3300028379 Ga0268266_10324459 Ga0268266_103244592 153
15 3300014745 Ga0157377_10127614 Ga0157377_101276142 156
16 3300005331 Ga0070670_100153032 Ga0070670_1001530322 162
17 3300005353 Ga0070669_100187338 Ga0070669_1001873382 162
18 3300005354 Ga0070675_100104988 Ga0070675_1001049883 162
19 3300005364 Ga0070673_100108362 Ga0070673_1001083622 162
20 3300005438 Ga0070701_10422935 Ga0070701_104229352 162
21 3300005543 Ga0070672_100016533 Ga0070672_1000165333 162
22 3300005719 Ga0068861_100209913 Ga0068861_1002099132 162
23 3300005840 Ga0068870_10237472 Ga0068870_102374722 162
24 3300005841 Ga0068863_100271793 Ga0068863_1002717932 162
25 3300005843 Ga0068860_100037702 Ga0068860_1000377023 162
26 3300009177 Ga0105248_10299721 Ga0105248_102997213 162
27 3300013308 Ga0157375_10035443 Ga0157375_100354434 162
28 3300014325 Ga0163163_10004811 Ga0163163_100048112 162
29 3300014326 Ga0157380_10178920 Ga0157380_101789202 162
30 3300014969 Ga0157376_10517553 Ga0157376_105175532 162
31 3300025901 Ga0207688_10130638 Ga0207688_101306383 162
32 3300025908 Ga0207643_10257111 Ga0207643_102571112 162
33 3300025923 Ga0207681_10024176 Ga0207681_100241763 162
34 3300025925 Ga0207650_10067227 Ga0207650_100672275 162
35 3300025940 Ga0207691_10025264 Ga0207691_100252644 162
36 3300025941 Ga0207711_10281258 Ga0207711_102812583 162
37 3300025960 Ga0207651_10025782 Ga0207651_100257822 162
38 3300028381 Ga0268264_10330570 Ga0268264_103305703 162
39 3300025925 Ga0207650_10365468 Ga0207650_103654682 163
40 3300025938 Ga0207704_10525997 Ga0207704_105259971 163
41 3300005334 Ga0068869_100087886 Ga0068869_1000878862 164
42 3300005367 Ga0070667_100385570 Ga0070667_1003855702 164
43 3300005456 Ga0070678_100009966 Ga0070678_1000099667 164
44 3300005543 Ga0070672_100008014 Ga0070672_1000080143 164
45 3300005544 Ga0070686_100344273 Ga0070686_1003442732 164
46 3300005548 Ga0070665_100028552 Ga0070665_1000285522 164
47 3300005616 Ga0068852_100063346 Ga0068852_1000633466 164
48 3300005618 Ga0068864_100030005 Ga0068864_1000300052 164
49 3300005834 Ga0068851_10009599 Ga0068851_100095996 164
50 3300005841 Ga0068863_100013286 Ga0068863_1000132862 164
51 3300005844 Ga0068862_100194594 Ga0068862_1001945943 164
52 3300006358 Ga0068871_100007616 Ga0068871_1000076168 164
53 3300017792 Ga0163161_10042182 Ga0163161_100421822 164
54 3300025321 Ga0207656_10015301 Ga0207656_100153015 164
55 3300025893 Ga0207682_10000146 Ga0207682_1000014631 164
56 3300025903 Ga0207680_10010912 Ga0207680_100109123 164
57 3300025907 Ga0207645_10008023 Ga0207645_100080232 164
58 3300025908 Ga0207643_10027427 Ga0207643_100274275 164
59 3300025909 Ga0207705_10348839 Ga0207705_103488392 164
60 3300025926 Ga0207659_10007428 Ga0207659_100074281 164
61 3300025931 Ga0207644_10008476 Ga0207644_100084764 164
62 3300025937 Ga0207669_10010707 Ga0207669_100107072 164
63 3300025940 Ga0207691_10000310 Ga0207691_1000031010 164
64 3300025972 Ga0207668_10005981 Ga0207668_100059816 164
65 3300026023 Ga0207677_10011855 Ga0207677_100118557 164
66 3300026067 Ga0207678_10010760 Ga0207678_100107607 164
67 3300026089 Ga0207648_10003344 Ga0207648_1000334410 164
68 3300026095 Ga0207676_10014659 Ga0207676_100146598 164
69 3300026118 Ga0207675_100054380 Ga0207675_1000543803 164
70 3300026121 Ga0207683_10000121 Ga0207683_1000012158 164
71 3300026142 Ga0207698_10015072 Ga0207698_100150728 164
72 3300027526 Ga0209968_1022046 Ga0209968_10220462 164
73 3300028380 Ga0268265_10104731 Ga0268265_101047312 164
74 3300028381 Ga0268264_10084520 Ga0268264_100845205 164
75 3300053085 Ga0495619_0528656 Ga0495619_0528656_157_747 164
76 3300003322 rootL2_10328949 rootL2_103289491 165
77 3300006844 Ga0075428_100194783 Ga0075428_1001947833 165
78 3300041486 Ga0451807_0845975 Ga0451807_0845975_1725_2309 166
79 3300005434 Ga0070709_10603542 Ga0070709_106035421 167
80 3300005985 Ga0081539_10000052 Ga0081539_10000052163 167
81 3300014497 Ga0182008_10085522 Ga0182008_100855222 167
82 3300005457 Ga0070662_100118367 Ga0070662_1001183672 168
83 3300005467 Ga0070706_100906695 Ga0070706_1009066951 168
84 3300006028 Ga0070717_10630238 Ga0070717_106302381 168
85 3300006871 Ga0075434_100352892 Ga0075434_1003528923 168
86 3300025915 Ga0207693_10066800 Ga0207693_100668005 168
87 3300025928 Ga0207700_10046468 Ga0207700_100464685 168
88 3300025929 Ga0207664_10003067 Ga0207664_100030679 168
89 3300046543 Ga0495645_0098755 Ga0495645_0098755_726_1334 168
90 3300025909 Ga0207705_10052596 Ga0207705_100525966 169
91 3300025925 Ga0207650_10035787 Ga0207650_100357873 169
92 3300035111 Ga0373923_0221649 Ga0373923_0221649_10_612 169
93 3300036401 Ga0373937_0086762 Ga0373937_0086762_797_1399 169
94 3300005331 Ga0070670_100232408 Ga0070670_1002324082 170
95 3300005337 Ga0070682_100123707 Ga0070682_1001237072 170
96 3300005458 Ga0070681_10002421 Ga0070681_100024212 170
97 3300005530 Ga0070679_100006694 Ga0070679_1000066944 170
98 3300005530 Ga0070679_100302305 Ga0070679_1003023052 170
99 3300005539 Ga0068853_100035421 Ga0068853_1000354212 170
100 3300005547 Ga0070693_100381154 Ga0070693_1003811541 170
101 3300005618 Ga0068864_100002334 Ga0068864_1000023348 170
102 3300005841 Ga0068863_100014810 Ga0068863_1000148102 170
103 3300014325 Ga0163163_10042847 Ga0163163_100428472 170
104 3300025925 Ga0207650_10002534 Ga0207650_100025347 170
105 3300025925 Ga0207650_10301029 Ga0207650_103010292 170
106 3300025931 Ga0207644_10224422 Ga0207644_102244222 170
107 3300026041 Ga0207639_10030631 Ga0207639_100306316 170
108 3300026088 Ga0207641_10002486 Ga0207641_100024866 170
109 3300026095 Ga0207676_10000633 Ga0207676_100006337 170
110 3300028380 Ga0268265_10049098 Ga0268265_100490983 170
111 3300005539 Ga0068853_100115237 Ga0068853_1001152373 171
112 3300005563 Ga0068855_100101461 Ga0068855_1001014613 171
113 3300005616 Ga0068852_100014944 Ga0068852_1000149446 171
114 3300005841 Ga0068863_100124985 Ga0068863_1001249853 171
115 3300009098 Ga0105245_10009797 Ga0105245_100097972 171
116 3300013307 Ga0157372_10293916 Ga0157372_102939162 171
117 3300025909 Ga0207705_10128757 Ga0207705_101287572 171
118 3300025920 Ga0207649_10055680 Ga0207649_100556803 171
119 3300025927 Ga0207687_10067295 Ga0207687_100672952 171
120 3300025932 Ga0207690_10453579 Ga0207690_104535792 171
121 3300025949 Ga0207667_10738763 Ga0207667_107387631 171
122 3300026118 Ga0207675_100211783 Ga0207675_1002117832 171
123 3300026142 Ga0207698_10007229 Ga0207698_100072295 171
124 3300035241 Ga0373961_0231975 Ga0373961_0231975_42_644 171
125 3300035691 Ga0373931_0093401 Ga0373931_0093401_456_1058 171
126 3300037466 Ga0395898_0118427 Ga0395898_0118427_1326_1934 171
127 3300038443 Ga0395901_0367164 Ga0395901_0367164_704_1312 171
128 3300005331 Ga0070670_100031216 Ga0070670_1000312166 172
129 3300005338 Ga0068868_100192419 Ga0068868_1001924193 172
130 3300005347 Ga0070668_100045194 Ga0070668_1000451943 172
131 3300005353 Ga0070669_100264653 Ga0070669_1002646532 172
132 3300005353 Ga0070669_100822886 Ga0070669_1008228861 172
133 3300005354 Ga0070675_100063086 Ga0070675_1000630863 172
134 3300005356 Ga0070674_100026238 Ga0070674_1000262383 172
135 3300005366 Ga0070659_100562625 Ga0070659_1005626251 172
136 3300005367 Ga0070667_100398153 Ga0070667_1003981532 172
137 3300005459 Ga0068867_100190402 Ga0068867_1001904022 172
138 3300005518 Ga0070699_100245561 Ga0070699_1002455612 172
139 3300005539 Ga0068853_100824533 Ga0068853_1008245332 172
140 3300005543 Ga0070672_100139228 Ga0070672_1001392283 172
141 3300005543 Ga0070672_100463103 Ga0070672_1004631032 172
142 3300005548 Ga0070665_100043800 Ga0070665_1000438003 172
143 3300005577 Ga0068857_100047692 Ga0068857_1000476923 172
144 3300005615 Ga0070702_100152344 Ga0070702_1001523442 172
145 3300005617 Ga0068859_100178962 Ga0068859_1001789622 172
146 3300005618 Ga0068864_100154845 Ga0068864_1001548452 172
147 3300005841 Ga0068863_100068936 Ga0068863_1000689363 172
148 3300006931 Ga0097620_100178963 Ga0097620_1001789633 172
149 3300007076 Ga0075435_100224640 Ga0075435_1002246402 172
150 3300009094 Ga0111539_10509289 Ga0111539_105092892 172
151 3300009553 Ga0105249_11041037 Ga0105249_110410371 172
152 3300013104 Ga0157370_10153709 Ga0157370_101537092 172
153 3300013104 Ga0157370_10171572 Ga0157370_101715722 172
154 3300013105 Ga0157369_10012261 Ga0157369_100122616 172
155 3300013296 Ga0157374_10451880 Ga0157374_104518802 172
156 3300013306 Ga0163162_11551637 Ga0163162_115516371 172
157 3300013307 Ga0157372_10030913 Ga0157372_100309132 172
158 3300025901 Ga0207688_10241235 Ga0207688_102412351 172
159 3300025907 Ga0207645_10036131 Ga0207645_100361313 172
160 3300025912 Ga0207707_10058830 Ga0207707_100588303 172
161 3300025919 Ga0207657_10024320 Ga0207657_100243206 172
162 3300025921 Ga0207652_10007247 Ga0207652_100072473 172
163 3300025923 Ga0207681_10046095 Ga0207681_100460952 172
164 3300025926 Ga0207659_10021504 Ga0207659_100215043 172
165 3300025926 Ga0207659_10840634 Ga0207659_108406342 172
166 3300025931 Ga0207644_10498472 Ga0207644_104984722 172
167 3300025937 Ga0207669_10330980 Ga0207669_103309802 172
168 3300025940 Ga0207691_10004119 Ga0207691_100041194 172
169 3300025940 Ga0207691_10097269 Ga0207691_100972692 172
170 3300025960 Ga0207651_10165509 Ga0207651_101655092 172
171 3300025972 Ga0207668_10018149 Ga0207668_100181493 172
172 3300025972 Ga0207668_10029476 Ga0207668_100294762 172
173 3300025972 Ga0207668_10167562 Ga0207668_101675622 172
174 3300025986 Ga0207658_10112751 Ga0207658_101127513 172
175 3300026023 Ga0207677_10098606 Ga0207677_100986063 172
176 3300026041 Ga0207639_10401021 Ga0207639_104010212 172
177 3300026088 Ga0207641_10068310 Ga0207641_100683102 172
178 3300026089 Ga0207648_10014214 Ga0207648_100142144 172
179 3300026089 Ga0207648_10114825 Ga0207648_101148252 172
180 3300026095 Ga0207676_10126705 Ga0207676_101267052 172
181 3300026116 Ga0207674_10030050 Ga0207674_100300503 172
182 3300026118 Ga0207675_100048450 Ga0207675_1000484503 172
183 3300026118 Ga0207675_101089251 Ga0207675_1010892512 172
184 3300026142 Ga0207698_10161096 Ga0207698_101610962 172
185 3300027471 Ga0209995_1007841 Ga0209995_10078413 172
186 3300027552 Ga0209982_1041769 Ga0209982_10417691 172
187 3300027617 Ga0210002_1007025 Ga0210002_10070253 172
188 3300027682 Ga0209971_1001091 Ga0209971_100109110 172
189 3300027876 Ga0209974_10000048 Ga0209974_100000486 172
190 3300028379 Ga0268266_10725778 Ga0268266_107257782 172
191 3300028380 Ga0268265_10174509 Ga0268265_101745091 172
192 3300028380 Ga0268265_10361016 Ga0268265_103610162 172
193 3300028381 Ga0268264_10067969 Ga0268264_100679693 172
194 3300028381 Ga0268264_10328401 Ga0268264_103284013 172
195 3300031731 Ga0307405_10572863 Ga0307405_105728631 172
196 3300031852 Ga0307410_10098627 Ga0307410_100986273 172
197 3300031903 Ga0307407_10600723 Ga0307407_106007232 172
198 3300031995 Ga0307409_100005712 Ga0307409_1000057127 172
199 3300031995 Ga0307409_100024574 Ga0307409_1000245742 172
200 3300032002 Ga0307416_100503129 Ga0307416_1005031292 172
201 3300032004 Ga0307414_10365959 Ga0307414_103659591 172
202 3300032005 Ga0307411_10043391 Ga0307411_100433915 172
203 3300032126 Ga0307415_100267275 Ga0307415_1002672752 172
204 3300037418 Ga0395900_0035910 Ga0395900_0035910_81_680 172
205 3300041451 Ga0451791_0486903 Ga0451791_0486903_82_657 172
206 3300041496 Ga0451839_0036848 Ga0451839_0036848_155_688 172
207 3300048913 Ga0496110_0748007 Ga0496110_0748007_120_698 172
208 3300049576 Ga0501040_0268614 Ga0501040_0268614_345_917 172
209 3300049588 Ga0501072_0837507 Ga0501072_0837507_97_669 172
210 3300049591 Ga0501075_0244207 Ga0501075_0244207_237_809 172
211 3300049824 Ga0501045_0359695 Ga0501045_0359695_71_643 172
212 3300050511 nmdc:mga08y16_123955_c1 nmdc:mga08y16_123955_c1_1494_2072 172
213 3300005328 Ga0070676_10083387 Ga0070676_100833872 173
214 3300005335 Ga0070666_10204638 Ga0070666_102046382 173
215 3300005339 Ga0070660_100000551 Ga0070660_10000055113 173
216 3300005344 Ga0070661_100033465 Ga0070661_1000334653 173
217 3300005354 Ga0070675_101386494 Ga0070675_1013864941 173
218 3300005355 Ga0070671_100032550 Ga0070671_1000325503 173
219 3300005355 Ga0070671_100158350 Ga0070671_1001583502 173
220 3300005364 Ga0070673_100045749 Ga0070673_1000457492 173
221 3300005364 Ga0070673_100760360 Ga0070673_1007603602 173
222 3300005366 Ga0070659_100000779 Ga0070659_1000007793 173
223 3300005366 Ga0070659_100169517 Ga0070659_1001695172 173
224 3300005367 Ga0070667_100084490 Ga0070667_1000844903 173
225 3300005367 Ga0070667_100688044 Ga0070667_1006880442 173
226 3300005441 Ga0070700_100736289 Ga0070700_1007362891 173
227 3300005445 Ga0070708_100064287 Ga0070708_1000642873 173
228 3300005457 Ga0070662_100000211 Ga0070662_1000002115 173
229 3300005458 Ga0070681_11031101 Ga0070681_110311011 173
230 3300005530 Ga0070679_100208411 Ga0070679_1002084111 173
231 3300005539 Ga0068853_100051166 Ga0068853_1000511666 173
232 3300005546 Ga0070696_100414592 Ga0070696_1004145922 173
233 3300005547 Ga0070693_100273750 Ga0070693_1002737501 173
234 3300005548 Ga0070665_100025375 Ga0070665_1000253753 173
235 3300005564 Ga0070664_100071931 Ga0070664_1000719313 173
236 3300005564 Ga0070664_100333577 Ga0070664_1003335772 173
237 3300005614 Ga0068856_100004235 Ga0068856_1000042354 173
238 3300005616 Ga0068852_100672728 Ga0068852_1006727282 173
239 3300005617 Ga0068859_100316119 Ga0068859_1003161193 173
240 3300005617 Ga0068859_101696572 Ga0068859_1016965722 173
241 3300005842 Ga0068858_100465385 Ga0068858_1004653852 173
242 3300005843 Ga0068860_100012302 Ga0068860_1000123026 173
243 3300005843 Ga0068860_100728245 Ga0068860_1007282452 173
244 3300006237 Ga0097621_100015740 Ga0097621_1000157404 173
245 3300006358 Ga0068871_100013929 Ga0068871_1000139295 173
246 3300006358 Ga0068871_100248979 Ga0068871_1002489792 173
247 3300006931 Ga0097620_100316123 Ga0097620_1003161233 173
248 3300006931 Ga0097620_101696306 Ga0097620_1016963062 173
249 3300009094 Ga0111539_10539640 Ga0111539_105396402 173
250 3300009177 Ga0105248_10385061 Ga0105248_103850612 173
251 3300009553 Ga0105249_10347979 Ga0105249_103479793 173
252 3300009553 Ga0105249_10848108 Ga0105249_108481082 173
253 3300013100 Ga0157373_10014850 Ga0157373_100148503 173
254 3300013102 Ga0157371_10000446 Ga0157371_1000044621 173
255 3300013104 Ga0157370_10946538 Ga0157370_109465382 173
256 3300013306 Ga0163162_10250502 Ga0163162_102505022 173
257 3300013306 Ga0163162_11391334 Ga0163162_113913341 173
258 3300013307 Ga0157372_10000523 Ga0157372_1000052329 173
259 3300013308 Ga0157375_10064141 Ga0157375_100641414 173
260 3300013308 Ga0157375_10602273 Ga0157375_106022732 173
261 3300014325 Ga0163163_10060433 Ga0163163_100604333 173
262 3300014968 Ga0157379_10073195 Ga0157379_100731952 173
263 3300014969 Ga0157376_10076929 Ga0157376_100769294 173
264 3300014969 Ga0157376_10230271 Ga0157376_102302712 173
265 3300025908 Ga0207643_10114043 Ga0207643_101140432 173
266 3300025918 Ga0207662_10060963 Ga0207662_100609633 173
267 3300025919 Ga0207657_10008077 Ga0207657_100080779 173
268 3300025920 Ga0207649_10019167 Ga0207649_100191673 173
269 3300025921 Ga0207652_10168764 Ga0207652_101687642 173
270 3300025931 Ga0207644_10000405 Ga0207644_100004054 173
271 3300025931 Ga0207644_10169498 Ga0207644_101694982 173
272 3300025932 Ga0207690_10000348 Ga0207690_1000034826 173
273 3300025933 Ga0207706_10000045 Ga0207706_1000004568 173
274 3300025940 Ga0207691_10182382 Ga0207691_101823821 173
275 3300025941 Ga0207711_10171143 Ga0207711_101711433 173
276 3300025945 Ga0207679_10003526 Ga0207679_100035268 173
277 3300025945 Ga0207679_10613889 Ga0207679_106138892 173
278 3300025949 Ga0207667_10002826 Ga0207667_100028269 173
279 3300026041 Ga0207639_10008842 Ga0207639_100088424 173
280 3300026067 Ga0207678_10187032 Ga0207678_101870322 173
281 3300026075 Ga0207708_10767764 Ga0207708_107677642 173
282 3300026078 Ga0207702_10000715 Ga0207702_1000071524 173
283 3300026089 Ga0207648_10173623 Ga0207648_101736232 173
284 3300026121 Ga0207683_10083217 Ga0207683_100832173 173
285 3300026142 Ga0207698_10083517 Ga0207698_100835173 173
286 3300027665 Ga0209983_1003112 Ga0209983_10031125 173
287 3300027876 Ga0209974_10049320 Ga0209974_100493203 173
288 3300028379 Ga0268266_10046833 Ga0268266_100468333 173
289 3300028381 Ga0268264_10010492 Ga0268264_100104926 173
290 3300031731 Ga0307405_10369740 Ga0307405_103697402 173
291 3300031824 Ga0307413_10080155 Ga0307413_100801552 173
292 3300031852 Ga0307410_10178627 Ga0307410_101786273 173
293 3300031901 Ga0307406_10072396 Ga0307406_100723963 173
294 3300031903 Ga0307407_10001541 Ga0307407_100015418 173
295 3300031911 Ga0307412_10048394 Ga0307412_100483943 173
296 3300031995 Ga0307409_100009446 Ga0307409_1000094463 173
297 3300032002 Ga0307416_100005475 Ga0307416_1000054756 173
298 3300032004 Ga0307414_10021464 Ga0307414_100214643 173
299 3300032005 Ga0307411_10027198 Ga0307411_100271982 173
300 3300032126 Ga0307415_100019074 Ga0307415_1000190743 173
301 3300034820 Ga0373959_0091406 Ga0373959_0091406_88_687 173
302 3300035241 Ga0373961_0055934 Ga0373961_0055934_278_877 173
303 3300035691 Ga0373931_0065836 Ga0373931_0065836_509_1108 173
304 3300041486 Ga0451807_2078124 Ga0451807_2078124_17_604 173
305 3300042435 Ga0439434_0225377 Ga0439434_0225377_46_618 173
306 3300048903 Ga0496100_0029379 Ga0496100_0029379_1643_2242 173
307 3300048903 Ga0496100_0363946 Ga0496100_0363946_128_712 173
308 3300048905 Ga0496102_0060713 Ga0496102_0060713_1375_1974 173
309 3300048906 Ga0496103_0048618 Ga0496103_0048618_1500_2099 173
310 3300048909 Ga0496106_0000931 Ga0496106_0000931_13540_14139 173
311 3300048910 Ga0496107_0004980 Ga0496107_0004980_6680_7279 173
312 3300049743 Ga0501081_0166412 Ga0501081_0166412_737_1306 173
313 3300050512 nmdc:mga0n895_120848_c1 nmdc:mga0n895_120848_c1_118_702 173
314 3300005293 Ga0065715_10282308 Ga0065715_102823082 174
315 3300005327 Ga0070658_10009067 Ga0070658_100090677 174
316 3300005328 Ga0070676_10001268 Ga0070676_1000126810 174
317 3300005329 Ga0070683_100004758 Ga0070683_10000475812 174
318 3300005330 Ga0070690_100019262 Ga0070690_1000192622 174
319 3300005333 Ga0070677_10000242 Ga0070677_100002423 174
320 3300005333 Ga0070677_10121982 Ga0070677_101219822 174
321 3300005335 Ga0070666_10001424 Ga0070666_100014244 174
322 3300005335 Ga0070666_10013532 Ga0070666_100135327 174
323 3300005335 Ga0070666_10035493 Ga0070666_100354934 174
324 3300005335 Ga0070666_10064321 Ga0070666_100643213 174
325 3300005335 Ga0070666_10196339 Ga0070666_101963391 174
326 3300005336 Ga0070680_100016424 Ga0070680_1000164244 174
327 3300005336 Ga0070680_100304887 Ga0070680_1003048872 174
328 3300005338 Ga0068868_100002750 Ga0068868_1000027508 174
329 3300005338 Ga0068868_100006774 Ga0068868_1000067746 174
330 3300005338 Ga0068868_100200598 Ga0068868_1002005982 174
331 3300005338 Ga0068868_100328946 Ga0068868_1003289461 174
332 3300005339 Ga0070660_100130753 Ga0070660_1001307532 174
333 3300005339 Ga0070660_100291947 Ga0070660_1002919472 174
334 3300005339 Ga0070660_100507930 Ga0070660_1005079302 174
335 3300005340 Ga0070689_100013944 Ga0070689_1000139444 174
336 3300005344 Ga0070661_100007142 Ga0070661_1000071423 174
337 3300005344 Ga0070661_100041563 Ga0070661_1000415632 174
338 3300005344 Ga0070661_100118517 Ga0070661_1001185172 174
339 3300005347 Ga0070668_100001406 Ga0070668_1000014065 174
340 3300005347 Ga0070668_100003165 Ga0070668_10000316514 174
341 3300005347 Ga0070668_101028943 Ga0070668_1010289431 174
342 3300005353 Ga0070669_100002287 Ga0070669_10000228712 174
343 3300005353 Ga0070669_100104050 Ga0070669_1001040501 174
344 3300005353 Ga0070669_100161040 Ga0070669_1001610401 174
345 3300005354 Ga0070675_100002082 Ga0070675_10000208210 174
346 3300005355 Ga0070671_100003277 Ga0070671_1000032775 174
347 3300005355 Ga0070671_100005547 Ga0070671_1000055474 174
348 3300005355 Ga0070671_100047316 Ga0070671_1000473163 174
349 3300005355 Ga0070671_100063682 Ga0070671_1000636823 174
350 3300005355 Ga0070671_100073286 Ga0070671_1000732863 174
351 3300005356 Ga0070674_100000659 Ga0070674_10000065919 174
352 3300005356 Ga0070674_100013733 Ga0070674_1000137332 174
353 3300005364 Ga0070673_100001356 Ga0070673_10000135610 174
354 3300005364 Ga0070673_100007946 Ga0070673_1000079466 174
355 3300005364 Ga0070673_100043069 Ga0070673_1000430692 174
356 3300005364 Ga0070673_100067957 Ga0070673_1000679573 174
357 3300005365 Ga0070688_100019867 Ga0070688_1000198673 174
358 3300005365 Ga0070688_100039269 Ga0070688_1000392692 174
359 3300005366 Ga0070659_100263081 Ga0070659_1002630812 174
360 3300005367 Ga0070667_100003532 Ga0070667_1000035324 174
361 3300005367 Ga0070667_100003566 Ga0070667_1000035663 174
362 3300005367 Ga0070667_100078143 Ga0070667_1000781433 174
363 3300005367 Ga0070667_100677736 Ga0070667_1006777362 174
364 3300005434 Ga0070709_10020181 Ga0070709_100201813 174
365 3300005434 Ga0070709_10055060 Ga0070709_100550603 174
366 3300005434 Ga0070709_10111182 Ga0070709_101111822 174
367 3300005434 Ga0070709_10160059 Ga0070709_101600592 174
368 3300005435 Ga0070714_100037722 Ga0070714_1000377222 174
369 3300005436 Ga0070713_100662013 Ga0070713_1006620131 174
370 3300005437 Ga0070710_10028443 Ga0070710_100284432 174
371 3300005437 Ga0070710_10101610 Ga0070710_101016102 174
372 3300005439 Ga0070711_100147637 Ga0070711_1001476373 174
373 3300005439 Ga0070711_100211133 Ga0070711_1002111332 174
374 3300005445 Ga0070708_100007814 Ga0070708_1000078148 174
375 3300005455 Ga0070663_100103241 Ga0070663_1001032413 174
376 3300005456 Ga0070678_100001796 Ga0070678_10000179611 174
377 3300005459 Ga0068867_100002050 Ga0068867_10000205013 174
378 3300005459 Ga0068867_100002361 Ga0068867_1000023614 174
379 3300005466 Ga0070685_10055103 Ga0070685_100551032 174
380 3300005518 Ga0070699_100597462 Ga0070699_1005974621 174
381 3300005518 Ga0070699_100636185 Ga0070699_1006361851 174
382 3300005530 Ga0070679_100021209 Ga0070679_1000212092 174
383 3300005530 Ga0070679_100197004 Ga0070679_1001970042 174
384 3300005535 Ga0070684_100003917 Ga0070684_1000039174 174
385 3300005535 Ga0070684_100391669 Ga0070684_1003916692 174
386 3300005535 Ga0070684_100908447 Ga0070684_1009084471 174
387 3300005539 Ga0068853_100006893 Ga0068853_1000068939 174
388 3300005539 Ga0068853_100305755 Ga0068853_1003057552 174
389 3300005543 Ga0070672_100003099 Ga0070672_10000309910 174
390 3300005543 Ga0070672_100008581 Ga0070672_1000085814 174
391 3300005547 Ga0070693_100215176 Ga0070693_1002151761 174
392 3300005548 Ga0070665_100004484 Ga0070665_10000448413 174
393 3300005548 Ga0070665_100006553 Ga0070665_1000065533 174
394 3300005548 Ga0070665_100240408 Ga0070665_1002404081 174
395 3300005548 Ga0070665_100558675 Ga0070665_1005586752 174
396 3300005563 Ga0068855_100026160 Ga0068855_1000261606 174
397 3300005563 Ga0068855_100291506 Ga0068855_1002915062 174
398 3300005564 Ga0070664_100014087 Ga0070664_1000140875 174
399 3300005564 Ga0070664_100017006 Ga0070664_1000170063 174
400 3300005564 Ga0070664_100195760 Ga0070664_1001957602 174
401 3300005577 Ga0068857_100069369 Ga0068857_1000693692 174
402 3300005577 Ga0068857_100762942 Ga0068857_1007629421 174
403 3300005578 Ga0068854_100016524 Ga0068854_1000165243 174
404 3300005578 Ga0068854_100048212 Ga0068854_1000482126 174
405 3300005614 Ga0068856_100010690 Ga0068856_1000106909 174
406 3300005614 Ga0068856_100035673 Ga0068856_1000356735 174
407 3300005614 Ga0068856_100665295 Ga0068856_1006652952 174
408 3300005616 Ga0068852_100003693 Ga0068852_10000369310 174
409 3300005616 Ga0068852_100089773 Ga0068852_1000897735 174
410 3300005616 Ga0068852_100215928 Ga0068852_1002159283 174
411 3300005616 Ga0068852_101338913 Ga0068852_1013389131 174
412 3300005617 Ga0068859_100006056 Ga0068859_1000060563 174
413 3300005618 Ga0068864_100003597 Ga0068864_1000035975 174
414 3300005618 Ga0068864_101095176 Ga0068864_1010951761 174
415 3300005834 Ga0068851_10001801 Ga0068851_100018015 174
416 3300005834 Ga0068851_10008654 Ga0068851_100086543 174
417 3300005834 Ga0068851_10192646 Ga0068851_101926462 174
418 3300005840 Ga0068870_10014467 Ga0068870_100144673 174
419 3300005840 Ga0068870_10062076 Ga0068870_100620762 174
420 3300005842 Ga0068858_100003264 Ga0068858_10000326412 174
421 3300005842 Ga0068858_100012075 Ga0068858_1000120752 174
422 3300005842 Ga0068858_100037520 Ga0068858_1000375204 174
423 3300005842 Ga0068858_100054133 Ga0068858_1000541335 174
424 3300005843 Ga0068860_100001042 Ga0068860_10000104221 174
425 3300006237 Ga0097621_100018761 Ga0097621_1000187612 174
426 3300006237 Ga0097621_100209356 Ga0097621_1002093561 174
427 3300006358 Ga0068871_100001817 Ga0068871_1000018175 174
428 3300006358 Ga0068871_100181031 Ga0068871_1001810312 174
429 3300006844 Ga0075428_100039310 Ga0075428_1000393103 174
430 3300006844 Ga0075428_100375263 Ga0075428_1003752632 174
431 3300006871 Ga0075434_100109023 Ga0075434_1001090232 174
432 3300006871 Ga0075434_100208283 Ga0075434_1002082833 174
433 3300006914 Ga0075436_100312407 Ga0075436_1003124072 174
434 3300006931 Ga0097620_100006056 Ga0097620_1000060563 174
435 3300007076 Ga0075435_100115740 Ga0075435_1001157404 174
436 3300009093 Ga0105240_10008953 Ga0105240_100089535 174
437 3300009093 Ga0105240_10022687 Ga0105240_100226873 174
438 3300009094 Ga0111539_10001299 Ga0111539_100012997 174
439 3300009094 Ga0111539_10059036 Ga0111539_100590363 174
440 3300009098 Ga0105245_10210221 Ga0105245_102102211 174
441 3300009174 Ga0105241_10015461 Ga0105241_100154613 174
442 3300009177 Ga0105248_10002431 Ga0105248_1000243112 174
443 3300009177 Ga0105248_10019006 Ga0105248_100190063 174
444 3300009177 Ga0105248_10203082 Ga0105248_102030822 174
445 3300009551 Ga0105238_10034778 Ga0105238_100347789 174
446 3300009551 Ga0105238_11109291 Ga0105238_111092912 174
447 3300009553 Ga0105249_10268110 Ga0105249_102681102 174
448 3300009553 Ga0105249_10702823 Ga0105249_107028232 174
449 3300013100 Ga0157373_10003902 Ga0157373_1000390211 174
450 3300013100 Ga0157373_10213621 Ga0157373_102136212 174
451 3300013100 Ga0157373_10375775 Ga0157373_103757752 174
452 3300013102 Ga0157371_10253936 Ga0157371_102539362 174
453 3300013104 Ga0157370_10010726 Ga0157370_100107267 174
454 3300013104 Ga0157370_10026708 Ga0157370_100267084 174
455 3300013104 Ga0157370_10060279 Ga0157370_100602793 174
456 3300013104 Ga0157370_10093865 Ga0157370_100938651 174
457 3300013105 Ga0157369_10071605 Ga0157369_100716053 174
458 3300013105 Ga0157369_10237692 Ga0157369_102376922 174
459 3300013105 Ga0157369_10250853 Ga0157369_102508533 174
460 3300013296 Ga0157374_10075119 Ga0157374_100751193 174
461 3300013297 Ga0157378_10014139 Ga0157378_100141394 174
462 3300013297 Ga0157378_10144606 Ga0157378_101446062 174
463 3300013297 Ga0157378_11272604 Ga0157378_112726042 174
464 3300013306 Ga0163162_10006529 Ga0163162_1000652912 174
465 3300013306 Ga0163162_10281768 Ga0163162_102817682 174
466 3300013306 Ga0163162_10544817 Ga0163162_105448172 174
467 3300013306 Ga0163162_10737186 Ga0163162_107371862 174
468 3300013307 Ga0157372_10032821 Ga0157372_100328214 174
469 3300013307 Ga0157372_10085120 Ga0157372_100851203 174
470 3300013307 Ga0157372_10410409 Ga0157372_104104092 174
471 3300013308 Ga0157375_10002572 Ga0157375_100025724 174
472 3300013308 Ga0157375_10090221 Ga0157375_100902214 174
473 3300013308 Ga0157375_10107775 Ga0157375_101077753 174
474 3300013308 Ga0157375_12170491 Ga0157375_121704911 174
475 3300014745 Ga0157377_10008931 Ga0157377_100089315 174
476 3300014745 Ga0157377_10507869 Ga0157377_105078692 174
477 3300014968 Ga0157379_10015087 Ga0157379_100150875 174
478 3300014968 Ga0157379_10031752 Ga0157379_100317524 174
479 3300014969 Ga0157376_10003007 Ga0157376_100030074 174
480 3300014969 Ga0157376_10341720 Ga0157376_103417201 174
481 3300017792 Ga0163161_10015702 Ga0163161_100157023 174
482 3300017792 Ga0163161_10107910 Ga0163161_101079102 174
483 3300017792 Ga0163161_10140947 Ga0163161_101409472 174
484 3300020070 Ga0206356_11720413 Ga0206356_117204132 174
485 3300025315 Ga0207697_10004477 Ga0207697_100044776 174
486 3300025321 Ga0207656_10007104 Ga0207656_100071043 174
487 3300025893 Ga0207682_10079736 Ga0207682_100797362 174
488 3300025898 Ga0207692_10094161 Ga0207692_100941612 174
489 3300025903 Ga0207680_10001915 Ga0207680_100019159 174
490 3300025903 Ga0207680_10015333 Ga0207680_100153333 174
491 3300025903 Ga0207680_10034549 Ga0207680_100345493 174
492 3300025903 Ga0207680_10277385 Ga0207680_102773851 174
493 3300025903 Ga0207680_10634288 Ga0207680_106342882 174
494 3300025906 Ga0207699_10019067 Ga0207699_100190673 174
495 3300025907 Ga0207645_10000519 Ga0207645_1000051925 174
496 3300025907 Ga0207645_10270838 Ga0207645_102708382 174
497 3300025912 Ga0207707_10005207 Ga0207707_100052079 174
498 3300025913 Ga0207695_10116325 Ga0207695_101163252 174
499 3300025916 Ga0207663_10126778 Ga0207663_101267783 174
500 3300025916 Ga0207663_10282004 Ga0207663_102820043 174
501 3300025916 Ga0207663_10303054 Ga0207663_103030542 174
502 3300025917 Ga0207660_10012654 Ga0207660_100126548 174
503 3300025917 Ga0207660_10185491 Ga0207660_101854912 174
504 3300025919 Ga0207657_10000229 Ga0207657_1000022922 174
505 3300025919 Ga0207657_10129942 Ga0207657_101299422 174
506 3300025920 Ga0207649_10002277 Ga0207649_100022779 174
507 3300025920 Ga0207649_10029744 Ga0207649_100297443 174
508 3300025920 Ga0207649_10065890 Ga0207649_100658902 174
509 3300025921 Ga0207652_10003991 Ga0207652_100039918 174
510 3300025923 Ga0207681_10002527 Ga0207681_1000252710 174
511 3300025923 Ga0207681_10112293 Ga0207681_101122933 174
512 3300025924 Ga0207694_10299767 Ga0207694_102997672 174
513 3300025924 Ga0207694_10607278 Ga0207694_106072782 174
514 3300025925 Ga0207650_10093562 Ga0207650_100935622 174
515 3300025925 Ga0207650_10102856 Ga0207650_101028563 174
516 3300025926 Ga0207659_10002707 Ga0207659_100027074 174
517 3300025929 Ga0207664_10006738 Ga0207664_100067389 174
518 3300025929 Ga0207664_10089089 Ga0207664_100890893 174
519 3300025931 Ga0207644_10012225 Ga0207644_100122254 174
520 3300025931 Ga0207644_10095598 Ga0207644_100955983 174
521 3300025931 Ga0207644_10147015 Ga0207644_101470152 174
522 3300025931 Ga0207644_10328019 Ga0207644_103280192 174
523 3300025932 Ga0207690_10006051 Ga0207690_100060518 174
524 3300025932 Ga0207690_10035029 Ga0207690_100350292 174
525 3300025932 Ga0207690_10171351 Ga0207690_101713512 174
526 3300025933 Ga0207706_10092757 Ga0207706_100927574 174
527 3300025933 Ga0207706_10214358 Ga0207706_102143583 174
528 3300025935 Ga0207709_10024389 Ga0207709_100243892 174
529 3300025935 Ga0207709_10143527 Ga0207709_101435273 174
530 3300025937 Ga0207669_10082682 Ga0207669_100826822 174
531 3300025940 Ga0207691_10000629 Ga0207691_1000062924 174
532 3300025940 Ga0207691_10050625 Ga0207691_100506254 174
533 3300025940 Ga0207691_10227923 Ga0207691_102279232 174
534 3300025941 Ga0207711_10011574 Ga0207711_100115748 174
535 3300025941 Ga0207711_10019828 Ga0207711_100198284 174
536 3300025941 Ga0207711_10157887 Ga0207711_101578872 174
537 3300025942 Ga0207689_10013147 Ga0207689_100131476 174
538 3300025944 Ga0207661_10074070 Ga0207661_100740701 174
539 3300025944 Ga0207661_10141705 Ga0207661_101417054 174
540 3300025944 Ga0207661_11025791 Ga0207661_110257911 174
541 3300025945 Ga0207679_10011829 Ga0207679_100118299 174
542 3300025945 Ga0207679_10059635 Ga0207679_100596353 174
543 3300025945 Ga0207679_10126044 Ga0207679_101260443 174
544 3300025945 Ga0207679_10164325 Ga0207679_101643252 174
545 3300025949 Ga0207667_10003469 Ga0207667_1000346910 174
546 3300025949 Ga0207667_10171767 Ga0207667_101717674 174
547 3300025949 Ga0207667_10214858 Ga0207667_102148582 174
548 3300025949 Ga0207667_10856780 Ga0207667_108567801 174
549 3300025949 Ga0207667_11143784 Ga0207667_111437841 174
550 3300025960 Ga0207651_10171949 Ga0207651_101719492 174
551 3300025960 Ga0207651_10414992 Ga0207651_104149922 174
552 3300025960 Ga0207651_10459188 Ga0207651_104591881 174
553 3300025960 Ga0207651_10553609 Ga0207651_105536091 174
554 3300025961 Ga0207712_11070034 Ga0207712_110700341 174
555 3300025961 Ga0207712_11165510 Ga0207712_111655102 174
556 3300025972 Ga0207668_10003264 Ga0207668_100032642 174
557 3300025972 Ga0207668_10146554 Ga0207668_101465543 174
558 3300025981 Ga0207640_10109298 Ga0207640_101092984 174
559 3300025981 Ga0207640_10244709 Ga0207640_102447092 174
560 3300025981 Ga0207640_10644912 Ga0207640_106449121 174
561 3300025986 Ga0207658_10008951 Ga0207658_100089516 174
562 3300025986 Ga0207658_10076428 Ga0207658_100764282 174
563 3300026023 Ga0207677_10187502 Ga0207677_101875022 174
564 3300026023 Ga0207677_10738246 Ga0207677_107382461 174
565 3300026023 Ga0207677_10863564 Ga0207677_108635641 174
566 3300026035 Ga0207703_10005921 Ga0207703_100059216 174
567 3300026035 Ga0207703_10007291 Ga0207703_1000729110 174
568 3300026035 Ga0207703_10119091 Ga0207703_101190912 174
569 3300026041 Ga0207639_10353982 Ga0207639_103539822 174
570 3300026067 Ga0207678_10004526 Ga0207678_100045264 174
571 3300026075 Ga0207708_10473231 Ga0207708_104732312 174
572 3300026075 Ga0207708_10578467 Ga0207708_105784671 174
573 3300026078 Ga0207702_10027561 Ga0207702_100275616 174
574 3300026078 Ga0207702_10056652 Ga0207702_100566522 174
575 3300026088 Ga0207641_10001932 Ga0207641_100019324 174
576 3300026088 Ga0207641_10696297 Ga0207641_106962972 174
577 3300026089 Ga0207648_10000364 Ga0207648_1000036412 174
578 3300026089 Ga0207648_10002046 Ga0207648_100020462 174
579 3300026089 Ga0207648_10035274 Ga0207648_100352743 174
580 3300026095 Ga0207676_10003751 Ga0207676_100037513 174
581 3300026116 Ga0207674_10000225 Ga0207674_1000022557 174
582 3300026118 Ga0207675_100133367 Ga0207675_1001333675 174
583 3300026121 Ga0207683_10000076 Ga0207683_1000007672 174
584 3300026121 Ga0207683_10005699 Ga0207683_1000569910 174
585 3300026142 Ga0207698_10007522 Ga0207698_100075229 174
586 3300026142 Ga0207698_10366647 Ga0207698_103666472 174
587 3300026142 Ga0207698_10400033 Ga0207698_104000331 174
588 3300028379 Ga0268266_10028455 Ga0268266_100284552 174
589 3300028379 Ga0268266_10066893 Ga0268266_100668932 174
590 3300028379 Ga0268266_10494484 Ga0268266_104944842 174
591 3300028381 Ga0268264_10007545 Ga0268264_100075452 174
592 3300028381 Ga0268264_10640838 Ga0268264_106408382 174
593 3300031731 Ga0307405_10514766 Ga0307405_105147662 174
594 3300035090 Ga0373949_0043851 Ga0373949_0043851_319_933 174
595 3300035116 Ga0373945_0035016 Ga0373945_0035016_896_1498 174
596 3300035118 Ga0373954_0134456 Ga0373954_0134456_513_1115 174
597 3300035170 Ga0373943_0042386 Ga0373943_0042386_507_1118 174
598 3300035170 Ga0373943_0296106 Ga0373943_0296106_10_630 174
599 3300035171 Ga0373946_0053581 Ga0373946_0053581_1041_1652 174
600 3300035692 Ga0373935_0128571 Ga0373935_0128571_866_1486 174
601 3300035695 Ga0373927_0157181 Ga0373927_0157181_272_883 174
602 3300035695 Ga0373927_0160628 Ga0373927_0160628_364_984 174
603 3300035724 Ga0373933_0434664 Ga0373933_0434664_117_704 174
604 3300036401 Ga0373937_0084311 Ga0373937_0084311_364_987 174
605 3300036401 Ga0373937_0454968 Ga0373937_0454968_393_980 174
606 3300037068 Ga0373925_0014302 Ga0373925_0014302_1638_2258 174
607 3300037471 Ga0395905_0158105 Ga0395905_0158105_645_1247 174
608 3300041486 Ga0451807_0453940 Ga0451807_0453940_887_1498 174
609 3300041492 Ga0451835_0936074 Ga0451835_0936074_122_733 174
610 3300042876 Ga0451577_0672392 Ga0451577_0672392_265_885 174
611 3300045051 Ga0451576_0000443 Ga0451576_0000443_4076_4612 174
612 3300045051 Ga0451576_0005126 Ga0451576_0005126_14235_14771 174
613 3300046472 Ga0495580_0288511 Ga0495580_0288511_397_999 174
614 3300046539 Ga0495621_0067420 Ga0495621_0067420_96_698 174
615 3300048903 Ga0496100_0367823 Ga0496100_0367823_64_666 174
616 3300048904 Ga0496101_0030711 Ga0496101_0030711_1560_2147 174
617 3300048904 Ga0496101_0191061 Ga0496101_0191061_384_986 174
618 3300048905 Ga0496102_1183070 Ga0496102_1183070_33_632 174
619 3300048907 Ga0496104_0406503 Ga0496104_0406503_189_776 174
620 3300048909 Ga0496106_0302521 Ga0496106_0302521_209_829 174
621 3300048909 Ga0496106_0441091 Ga0496106_0441091_279_893 174
622 3300048910 Ga0496107_0114221 Ga0496107_0114221_849_1436 174
623 3300048911 Ga0496108_0702327 Ga0496108_0702327_116_730 174
624 3300048912 Ga0496109_0003295 Ga0496109_0003295_10871_11473 174
625 3300048912 Ga0496109_0267962 Ga0496109_0267962_483_1070 174
626 3300048912 Ga0496109_0727887 Ga0496109_0727887_305_910 174
627 3300048913 Ga0496110_0005169 Ga0496110_0005169_8755_9357 174
628 3300048913 Ga0496110_0983568 Ga0496110_0983568_71_670 174
629 3300048914 Ga0496111_0071833 Ga0496111_0071833_1552_2154 174
630 3300048915 Ga0496112_0927724 Ga0496112_0927724_136_738 174
631 3300049675 Ga0501243_001814 Ga0501243_001814_27_569 174
632 3300050511 nmdc:mga08y16_4473_c1 nmdc:mga08y16_4473_c1_11505_12056 174
633 3300050512 nmdc:mga0n895_264144_c1 nmdc:mga0n895_264144_c1_714_1313 174
634 3300050512 nmdc:mga0n895_325208_c1 nmdc:mga0n895_325208_c1_349_948 174
635 3300050512 nmdc:mga0n895_383427_c1 nmdc:mga0n895_383427_c1_627_1232 174
636 3300005331 Ga0070670_100252135 Ga0070670_1002521352 175
637 3300005336 Ga0070680_100150489 Ga0070680_1001504892 175
638 3300005338 Ga0068868_100412726 Ga0068868_1004127262 175
639 3300005340 Ga0070689_100160610 Ga0070689_1001606103 175
640 3300005345 Ga0070692_10223773 Ga0070692_102237732 175
641 3300005353 Ga0070669_100377487 Ga0070669_1003774872 175
642 3300005364 Ga0070673_100185865 Ga0070673_1001858652 175
643 3300005365 Ga0070688_100001625 Ga0070688_1000016254 175
644 3300005366 Ga0070659_100395158 Ga0070659_1003951581 175
645 3300005435 Ga0070714_100635017 Ga0070714_1006350172 175
646 3300005439 Ga0070711_100296505 Ga0070711_1002965052 175
647 3300005456 Ga0070678_100027767 Ga0070678_1000277676 175
648 3300005458 Ga0070681_10113966 Ga0070681_101139664 175
649 3300005459 Ga0068867_100464649 Ga0068867_1004646492 175
650 3300005466 Ga0070685_10185391 Ga0070685_101853912 175
651 3300005530 Ga0070679_100007544 Ga0070679_1000075446 175
652 3300005546 Ga0070696_100913644 Ga0070696_1009136441 175
653 3300005547 Ga0070693_100046532 Ga0070693_1000465322 175
654 3300005564 Ga0070664_100175700 Ga0070664_1001757003 175
655 3300005843 Ga0068860_100432754 Ga0068860_1004327542 175
656 3300005985 Ga0081539_10009998 Ga0081539_100099982 175
657 3300005985 Ga0081539_10120493 Ga0081539_101204932 175
658 3300006237 Ga0097621_100356486 Ga0097621_1003564862 175
659 3300006871 Ga0075434_100644291 Ga0075434_1006442911 175
660 3300006881 Ga0068865_100044190 Ga0068865_1000441904 175
661 3300009098 Ga0105245_10441700 Ga0105245_104417003 175
662 3300009148 Ga0105243_10231036 Ga0105243_102310363 175
663 3300009176 Ga0105242_10022489 Ga0105242_100224896 175
664 3300009177 Ga0105248_10158989 Ga0105248_101589894 175
665 3300011119 Ga0105246_10214792 Ga0105246_102147922 175
666 3300013296 Ga0157374_10211274 Ga0157374_102112743 175
667 3300013308 Ga0157375_10047793 Ga0157375_100477932 175
668 3300013308 Ga0157375_11861375 Ga0157375_118613752 175
669 3300014326 Ga0157380_10373587 Ga0157380_103735873 175
670 3300014326 Ga0157380_10664872 Ga0157380_106648722 175
671 3300014745 Ga0157377_10058811 Ga0157377_100588113 175
672 3300014968 Ga0157379_10278286 Ga0157379_102782862 175
673 3300025898 Ga0207692_10393356 Ga0207692_103933562 175
674 3300025901 Ga0207688_10027364 Ga0207688_100273643 175
675 3300025906 Ga0207699_10439333 Ga0207699_104393332 175
676 3300025908 Ga0207643_10032649 Ga0207643_100326493 175
677 3300025912 Ga0207707_10015315 Ga0207707_100153156 175
678 3300025917 Ga0207660_10349121 Ga0207660_103491212 175
679 3300025921 Ga0207652_10074201 Ga0207652_100742014 175
680 3300025925 Ga0207650_10088138 Ga0207650_100881382 175
681 3300025926 Ga0207659_10107969 Ga0207659_101079692 175
682 3300025927 Ga0207687_10111634 Ga0207687_101116344 175
683 3300025927 Ga0207687_10354175 Ga0207687_103541752 175
684 3300025935 Ga0207709_10215953 Ga0207709_102159532 175
685 3300025936 Ga0207670_10017407 Ga0207670_100174074 175
686 3300025936 Ga0207670_10021344 Ga0207670_100213444 175
687 3300025937 Ga0207669_10124455 Ga0207669_101244554 175
688 3300025940 Ga0207691_10174393 Ga0207691_101743932 175
689 3300025941 Ga0207711_10086395 Ga0207711_100863952 175
690 3300025941 Ga0207711_10126282 Ga0207711_101262822 175
691 3300025961 Ga0207712_10302566 Ga0207712_103025662 175
692 3300025981 Ga0207640_10306082 Ga0207640_103060822 175
693 3300026023 Ga0207677_10089514 Ga0207677_100895143 175
694 3300026035 Ga0207703_10198221 Ga0207703_101982214 175
695 3300026116 Ga0207674_10108322 Ga0207674_101083221 175
696 3300026121 Ga0207683_10225139 Ga0207683_102251393 175
697 3300028381 Ga0268264_10280500 Ga0268264_102805004 175
698 3300031548 Ga0307408_100557049 Ga0307408_1005570492 175
699 3300031548 Ga0307408_100827325 Ga0307408_1008273251 175
700 3300031852 Ga0307410_10449410 Ga0307410_104494102 175
701 3300031995 Ga0307409_101149512 Ga0307409_1011495122 175
702 3300032002 Ga0307416_100385011 Ga0307416_1003850112 175
703 3300035086 Ga0373934_0055451 Ga0373934_0055451_488_1051 175
704 3300035120 Ga0373957_0056436 Ga0373957_0056436_219_782 175
705 3300035172 Ga0373955_0431393 Ga0373955_0431393_27_590 175
706 3300036401 Ga0373937_0020917 Ga0373937_0020917_3650_4213 175
707 3300041486 Ga0451807_1843067 Ga0451807_1843067_139_696 175
708 3300042436 Ga0439435_0107671 Ga0439435_0107671_85_639 175
709 3300046462 Ga0495651_0167256 Ga0495651_0167256_838_1401 175
710 3300046511 Ga0495608_0059603 Ga0495608_0059603_586_1149 175
711 3300046516 Ga0495628_0161951 Ga0495628_0161951_967_1530 175
712 3300046529 Ga0495652_0097537 Ga0495652_0097537_981_1544 175
713 3300046543 Ga0495645_0001349 Ga0495645_0001349_13286_13849 175
714 3300046559 Ga0495667_0015938 Ga0495667_0015938_1472_2035 175
715 3300046675 Ga0495657_0024000 Ga0495657_0024000_2813_3376 175
716 3300046678 Ga0495599_0609517 Ga0495599_0609517_15_572 175
717 3300046679 Ga0495623_0018902 Ga0495623_0018902_1950_2513 175
718 3300047317 Ga0495604_0480204 Ga0495604_0480204_101_664 175
719 3300047322 Ga0495680_0572295 Ga0495680_0572295_135_695 175
720 3300047471 Ga0495684_0244313 Ga0495684_0244313_261_824 175
721 3300050512 nmdc:mga0n895_1016870_c1 nmdc:mga0n895_1016870_c1_151_714 175
722 3300050515 nmdc:mga0a205_75661_c1 nmdc:mga0a205_75661_c1_2469_3032 175
723 3300053077 Ga0495601_0031806 Ga0495601_0031806_861_1424 175
724 3300053085 Ga0495619_0055978 Ga0495619_0055978_411_974 175
725 3300046455 Ga0495603_0499316 Ga0495603_0499316_21_596 176
726 3300005289 Ga0065704_10234770 Ga0065704_102347702 177
727 3300005435 Ga0070714_100191387 Ga0070714_1001913871 177
728 3300005440 Ga0070705_100367598 Ga0070705_1003675982 177
729 3300005445 Ga0070708_100043795 Ga0070708_1000437954 177
730 3300005445 Ga0070708_100071797 Ga0070708_1000717976 177
731 3300005467 Ga0070706_100295679 Ga0070706_1002956792 177
732 3300005467 Ga0070706_100418331 Ga0070706_1004183312 177
733 3300005468 Ga0070707_100039755 Ga0070707_1000397556 177
734 3300005468 Ga0070707_100055855 Ga0070707_1000558554 177
735 3300005468 Ga0070707_100186635 Ga0070707_1001866352 177
736 3300005468 Ga0070707_100355176 Ga0070707_1003551762 177
737 3300005471 Ga0070698_100023971 Ga0070698_1000239715 177
738 3300005471 Ga0070698_100432375 Ga0070698_1004323752 177
739 3300005518 Ga0070699_100132618 Ga0070699_1001326182 177
740 3300005536 Ga0070697_100061365 Ga0070697_1000613655 177
741 3300006028 Ga0070717_10044850 Ga0070717_100448505 177
742 3300006028 Ga0070717_10453712 Ga0070717_104537122 177
743 3300006914 Ga0075436_100113516 Ga0075436_1001135162 177
744 3300025885 Ga0207653_10121569 Ga0207653_101215692 177
745 3300025910 Ga0207684_10051288 Ga0207684_100512884 177
746 3300025910 Ga0207684_10174093 Ga0207684_101740932 177
747 3300025910 Ga0207684_10667024 Ga0207684_106670242 177
748 3300025922 Ga0207646_10000734 Ga0207646_1000073417 177
749 3300025922 Ga0207646_10002142 Ga0207646_1000214222 177
750 3300025922 Ga0207646_10134306 Ga0207646_101343064 177
751 3300025922 Ga0207646_10631358 Ga0207646_106313582 177
752 3300025922 Ga0207646_10738601 Ga0207646_107386012 177
753 3300025929 Ga0207664_10068190 Ga0207664_100681901 177
754 3300035725 Ga0373947_0153234 Ga0373947_0153234_467_1000 177
755 3300039453 Ga0436362_0735304 Ga0436362_0735304_823_1356 177
756 3300050514 nmdc:mga08x19_258084_c1 nmdc:mga08x19_258084_c1_266_799 177
757 3300050514 nmdc:mga08x19_398716_c1 nmdc:mga08x19_398716_c1_385_918 177
758 2162886007 SwRhRL2b_contig_1634644 SwRhRL2b_0138.00001510 178
759 2162886007 SwRhRL2b_contig_387844 SwRhRL2b_0829.00006800 178
760 3300002126 JGI24035J26624_1001983 JGI24035J26624_10019833 178
761 3300003911 JGI25405J52794_10000323 JGI25405J52794_100003237 178
762 3300003911 JGI25405J52794_10001843 JGI25405J52794_100018434 178
763 3300003911 JGI25405J52794_10001884 JGI25405J52794_100018842 178
764 3300005289 Ga0065704_10004765 Ga0065704_100047652 178
765 3300005290 Ga0065712_10006901 Ga0065712_100069012 178
766 3300005290 Ga0065712_10009838 Ga0065712_100098384 178
767 3300005293 Ga0065715_10008051 Ga0065715_100080514 178
768 3300005293 Ga0065715_10013045 Ga0065715_100130452 178
769 3300005293 Ga0065715_10048647 Ga0065715_100486472 178
770 3300005293 Ga0065715_10109052 Ga0065715_101090522 178
771 3300005293 Ga0065715_10240229 Ga0065715_102402292 178
772 3300005293 Ga0065715_10336623 Ga0065715_103366231 178
773 3300005293 Ga0065715_10425309 Ga0065715_104253092 178
774 3300005295 Ga0065707_10219050 Ga0065707_102190502 178
775 3300005328 Ga0070676_10045600 Ga0070676_100456003 178
776 3300005329 Ga0070683_100017515 Ga0070683_1000175155 178
777 3300005329 Ga0070683_100041501 Ga0070683_1000415014 178
778 3300005329 Ga0070683_100253871 Ga0070683_1002538712 178
779 3300005329 Ga0070683_100400758 Ga0070683_1004007581 178
780 3300005330 Ga0070690_100019100 Ga0070690_1000191006 178
781 3300005330 Ga0070690_100168997 Ga0070690_1001689972 178
782 3300005333 Ga0070677_10064647 Ga0070677_100646473 178
783 3300005334 Ga0068869_100086683 Ga0068869_1000866833 178
784 3300005335 Ga0070666_10138075 Ga0070666_101380752 178
785 3300005337 Ga0070682_100064400 Ga0070682_1000644002 178
786 3300005338 Ga0068868_100010675 Ga0068868_1000106756 178
787 3300005338 Ga0068868_100374611 Ga0068868_1003746112 178
788 3300005338 Ga0068868_100439175 Ga0068868_1004391753 178
789 3300005339 Ga0070660_100118693 Ga0070660_1001186931 178
790 3300005340 Ga0070689_100017987 Ga0070689_1000179875 178
791 3300005340 Ga0070689_100328318 Ga0070689_1003283182 178
792 3300005340 Ga0070689_100421195 Ga0070689_1004211951 178
793 3300005343 Ga0070687_100024597 Ga0070687_1000245973 178
794 3300005343 Ga0070687_100034776 Ga0070687_1000347764 178
795 3300005344 Ga0070661_100033026 Ga0070661_1000330263 178
796 3300005347 Ga0070668_100219615 Ga0070668_1002196152 178
797 3300005347 Ga0070668_100607428 Ga0070668_1006074281 178
798 3300005347 Ga0070668_101652075 Ga0070668_1016520751 178
799 3300005353 Ga0070669_100220747 Ga0070669_1002207471 178
800 3300005354 Ga0070675_100022317 Ga0070675_1000223177 178
801 3300005354 Ga0070675_100030145 Ga0070675_1000301453 178
802 3300005354 Ga0070675_100067503 Ga0070675_1000675033 178
803 3300005354 Ga0070675_100071808 Ga0070675_1000718084 178
804 3300005354 Ga0070675_100103054 Ga0070675_1001030542 178
805 3300005354 Ga0070675_100156590 Ga0070675_1001565902 178
806 3300005354 Ga0070675_100248840 Ga0070675_1002488401 178
807 3300005354 Ga0070675_100572457 Ga0070675_1005724572 178
808 3300005355 Ga0070671_100020112 Ga0070671_1000201126 178
809 3300005355 Ga0070671_100061954 Ga0070671_1000619544 178
810 3300005356 Ga0070674_100078097 Ga0070674_1000780974 178
811 3300005356 Ga0070674_100129882 Ga0070674_1001298822 178
812 3300005364 Ga0070673_101433921 Ga0070673_1014339211 178
813 3300005365 Ga0070688_100019806 Ga0070688_1000198064 178
814 3300005365 Ga0070688_100127953 Ga0070688_1001279533 178
815 3300005365 Ga0070688_100128143 Ga0070688_1001281432 178
816 3300005365 Ga0070688_100174111 Ga0070688_1001741113 178
817 3300005366 Ga0070659_100015404 Ga0070659_1000154047 178
818 3300005367 Ga0070667_100008508 Ga0070667_10000850810 178
819 3300005367 Ga0070667_100106801 Ga0070667_1001068012 178
820 3300005367 Ga0070667_100151596 Ga0070667_1001515963 178
821 3300005367 Ga0070667_100583168 Ga0070667_1005831681 178
822 3300005367 Ga0070667_101120663 Ga0070667_1011206631 178
823 3300005406 Ga0070703_10307702 Ga0070703_103077021 178
824 3300005434 Ga0070709_10201156 Ga0070709_102011562 178
825 3300005435 Ga0070714_100269800 Ga0070714_1002698002 178
826 3300005435 Ga0070714_100437980 Ga0070714_1004379802 178
827 3300005436 Ga0070713_100361069 Ga0070713_1003610692 178
828 3300005437 Ga0070710_10004182 Ga0070710_100041827 178
829 3300005437 Ga0070710_10168369 Ga0070710_101683692 178
830 3300005439 Ga0070711_100024261 Ga0070711_1000242613 178
831 3300005439 Ga0070711_100218554 Ga0070711_1002185542 178
832 3300005439 Ga0070711_100380197 Ga0070711_1003801972 178
833 3300005440 Ga0070705_100004271 Ga0070705_1000042715 178
834 3300005440 Ga0070705_100059114 Ga0070705_1000591142 178
835 3300005440 Ga0070705_100272660 Ga0070705_1002726602 178
836 3300005440 Ga0070705_100473101 Ga0070705_1004731012 178
837 3300005440 Ga0070705_100587744 Ga0070705_1005877442 178
838 3300005441 Ga0070700_100003307 Ga0070700_1000033079 178
839 3300005441 Ga0070700_100873269 Ga0070700_1008732692 178
840 3300005444 Ga0070694_100016263 Ga0070694_1000162632 178
841 3300005445 Ga0070708_100019108 Ga0070708_1000191087 178
842 3300005445 Ga0070708_100247664 Ga0070708_1002476643 178
843 3300005445 Ga0070708_100333778 Ga0070708_1003337782 178
844 3300005445 Ga0070708_100375406 Ga0070708_1003754062 178
845 3300005455 Ga0070663_100044095 Ga0070663_1000440954 178
846 3300005456 Ga0070678_100212798 Ga0070678_1002127982 178
847 3300005456 Ga0070678_100266656 Ga0070678_1002666562 178
848 3300005456 Ga0070678_100280893 Ga0070678_1002808933 178
849 3300005456 Ga0070678_100630034 Ga0070678_1006300342 178
850 3300005457 Ga0070662_100012527 Ga0070662_1000125277 178
851 3300005457 Ga0070662_100118359 Ga0070662_1001183593 178
852 3300005457 Ga0070662_100459618 Ga0070662_1004596181 178
853 3300005457 Ga0070662_100634167 Ga0070662_1006341672 178
854 3300005458 Ga0070681_10012806 Ga0070681_100128068 178
855 3300005459 Ga0068867_100046722 Ga0068867_1000467224 178
856 3300005459 Ga0068867_100165548 Ga0068867_1001655481 178
857 3300005459 Ga0068867_100299719 Ga0068867_1002997192 178
858 3300005467 Ga0070706_100000012 Ga0070706_10000001261 178
859 3300005467 Ga0070706_100010658 Ga0070706_1000106588 178
860 3300005467 Ga0070706_100011949 Ga0070706_1000119497 178
861 3300005467 Ga0070706_100025873 Ga0070706_1000258732 178
862 3300005467 Ga0070706_100147868 Ga0070706_1001478683 178
863 3300005467 Ga0070706_100155773 Ga0070706_1001557732 178
864 3300005467 Ga0070706_100342482 Ga0070706_1003424822 178
865 3300005467 Ga0070706_100956876 Ga0070706_1009568762 178
866 3300005468 Ga0070707_100007671 Ga0070707_1000076714 178
867 3300005468 Ga0070707_100043177 Ga0070707_1000431772 178
868 3300005468 Ga0070707_100075664 Ga0070707_1000756642 178
869 3300005468 Ga0070707_100121445 Ga0070707_1001214454 178
870 3300005468 Ga0070707_100145583 Ga0070707_1001455833 178
871 3300005468 Ga0070707_100157651 Ga0070707_1001576513 178
872 3300005468 Ga0070707_100186952 Ga0070707_1001869523 178
873 3300005468 Ga0070707_100519650 Ga0070707_1005196502 178
874 3300005468 Ga0070707_100523359 Ga0070707_1005233591 178
875 3300005468 Ga0070707_100754051 Ga0070707_1007540512 178
876 3300005471 Ga0070698_100000413 Ga0070698_1000004138 178
877 3300005471 Ga0070698_100618266 Ga0070698_1006182662 178
878 3300005471 Ga0070698_100829553 Ga0070698_1008295531 178
879 3300005471 Ga0070698_101270600 Ga0070698_1012706001 178
880 3300005518 Ga0070699_100035199 Ga0070699_1000351992 178
881 3300005518 Ga0070699_100053333 Ga0070699_1000533334 178
882 3300005518 Ga0070699_100287557 Ga0070699_1002875572 178
883 3300005518 Ga0070699_100350897 Ga0070699_1003508972 178
884 3300005518 Ga0070699_100364612 Ga0070699_1003646122 178
885 3300005518 Ga0070699_100607951 Ga0070699_1006079512 178
886 3300005530 Ga0070679_100018126 Ga0070679_1000181267 178
887 3300005530 Ga0070679_100843256 Ga0070679_1008432561 178
888 3300005535 Ga0070684_100001230 Ga0070684_10000123011 178
889 3300005535 Ga0070684_100002787 Ga0070684_1000027879 178
890 3300005535 Ga0070684_100024102 Ga0070684_1000241023 178
891 3300005535 Ga0070684_100491039 Ga0070684_1004910391 178
892 3300005536 Ga0070697_100032665 Ga0070697_1000326652 178
893 3300005536 Ga0070697_100060466 Ga0070697_1000604663 178
894 3300005536 Ga0070697_100135666 Ga0070697_1001356663 178
895 3300005536 Ga0070697_100149013 Ga0070697_1001490133 178
896 3300005536 Ga0070697_100173513 Ga0070697_1001735133 178
897 3300005536 Ga0070697_100305561 Ga0070697_1003055613 178
898 3300005536 Ga0070697_100347575 Ga0070697_1003475751 178
899 3300005536 Ga0070697_101081682 Ga0070697_1010816821 178
900 3300005539 Ga0068853_100393342 Ga0068853_1003933421 178
901 3300005543 Ga0070672_100093931 Ga0070672_1000939314 178
902 3300005543 Ga0070672_100302218 Ga0070672_1003022182 178
903 3300005545 Ga0070695_100226023 Ga0070695_1002260232 178
904 3300005548 Ga0070665_100023261 Ga0070665_1000232615 178
905 3300005548 Ga0070665_100066411 Ga0070665_1000664113 178
906 3300005548 Ga0070665_100099856 Ga0070665_1000998565 178
907 3300005548 Ga0070665_100239396 Ga0070665_1002393963 178
908 3300005548 Ga0070665_100294444 Ga0070665_1002944442 178
909 3300005548 Ga0070665_100761500 Ga0070665_1007615002 178
910 3300005549 Ga0070704_100002585 Ga0070704_1000025855 178
911 3300005564 Ga0070664_100324490 Ga0070664_1003244903 178
912 3300005577 Ga0068857_100392092 Ga0068857_1003920922 178
913 3300005614 Ga0068856_100020448 Ga0068856_1000204485 178
914 3300005614 Ga0068856_100563184 Ga0068856_1005631842 178
915 3300005614 Ga0068856_100617891 Ga0068856_1006178912 178
916 3300005616 Ga0068852_100767385 Ga0068852_1007673852 178
917 3300005617 Ga0068859_100031329 Ga0068859_1000313296 178
918 3300005618 Ga0068864_100296909 Ga0068864_1002969092 178
919 3300005719 Ga0068861_100122282 Ga0068861_1001222822 178
920 3300005841 Ga0068863_100003877 Ga0068863_10000387713 178
921 3300005841 Ga0068863_100220191 Ga0068863_1002201913 178
922 3300005842 Ga0068858_100018050 Ga0068858_1000180508 178
923 3300005842 Ga0068858_100286608 Ga0068858_1002866083 178
924 3300005842 Ga0068858_100376012 Ga0068858_1003760123 178
925 3300005842 Ga0068858_101600064 Ga0068858_1016000641 178
926 3300005843 Ga0068860_100010043 Ga0068860_1000100439 178
927 3300005937 Ga0081455_10000547 Ga0081455_1000054740 178
928 3300005937 Ga0081455_10001583 Ga0081455_100015838 178
929 3300005937 Ga0081455_10016102 Ga0081455_100161022 178
930 3300005937 Ga0081455_10016757 Ga0081455_100167577 178
931 3300005937 Ga0081455_10021993 Ga0081455_100219937 178
932 3300005937 Ga0081455_10027093 Ga0081455_100270937 178
933 3300005937 Ga0081455_10034863 Ga0081455_100348635 178
934 3300005937 Ga0081455_10217933 Ga0081455_102179332 178
935 3300005983 Ga0081540_1000016 Ga0081540_1000016127 178
936 3300005983 Ga0081540_1010941 Ga0081540_10109414 178
937 3300005983 Ga0081540_1022397 Ga0081540_10223975 178
938 3300005985 Ga0081539_10004458 Ga0081539_1000445814 178
939 3300005985 Ga0081539_10008307 Ga0081539_100083077 178
940 3300005985 Ga0081539_10020681 Ga0081539_100206813 178
941 3300005985 Ga0081539_10248129 Ga0081539_102481291 178
942 3300006028 Ga0070717_10004551 Ga0070717_100045519 178
943 3300006028 Ga0070717_10117227 Ga0070717_101172274 178
944 3300006028 Ga0070717_10555571 Ga0070717_105555712 178
945 3300006163 Ga0070715_10451967 Ga0070715_104519672 178
946 3300006173 Ga0070716_100685547 Ga0070716_1006855472 178
947 3300006173 Ga0070716_100796948 Ga0070716_1007969482 178
948 3300006175 Ga0070712_100016473 Ga0070712_1000164735 178
949 3300006175 Ga0070712_100306705 Ga0070712_1003067052 178
950 3300006175 Ga0070712_100389355 Ga0070712_1003893551 178
951 3300006175 Ga0070712_100684214 Ga0070712_1006842142 178
952 3300006175 Ga0070712_100780877 Ga0070712_1007808771 178
953 3300006175 Ga0070712_100865388 Ga0070712_1008653881 178
954 3300006237 Ga0097621_100013578 Ga0097621_1000135782 178
955 3300006237 Ga0097621_100232393 Ga0097621_1002323932 178
956 3300006237 Ga0097621_100305203 Ga0097621_1003052032 178
957 3300006358 Ga0068871_100023033 Ga0068871_1000230336 178
958 3300006358 Ga0068871_100094475 Ga0068871_1000944755 178
959 3300006358 Ga0068871_100553898 Ga0068871_1005538982 178
960 3300006844 Ga0075428_100053933 Ga0075428_1000539332 178
961 3300006852 Ga0075433_10313300 Ga0075433_103133001 178
962 3300006871 Ga0075434_100171781 Ga0075434_1001717813 178
963 3300006871 Ga0075434_100325667 Ga0075434_1003256672 178
964 3300006871 Ga0075434_100547521 Ga0075434_1005475212 178
965 3300006871 Ga0075434_100577073 Ga0075434_1005770732 178
966 3300006881 Ga0068865_100700892 Ga0068865_1007008921 178
967 3300006881 Ga0068865_101346575 Ga0068865_1013465751 178
968 3300006914 Ga0075436_100077399 Ga0075436_1000773992 178
969 3300006931 Ga0097620_100031329 Ga0097620_1000313294 178
970 3300007076 Ga0075435_100178395 Ga0075435_1001783952 178
971 3300009094 Ga0111539_10060050 Ga0111539_100600503 178
972 3300009094 Ga0111539_10157405 Ga0111539_101574053 178
973 3300009094 Ga0111539_10524735 Ga0111539_105247352 178
974 3300009098 Ga0105245_10018826 Ga0105245_100188265 178
975 3300009098 Ga0105245_10036661 Ga0105245_100366612 178
976 3300009098 Ga0105245_10103156 Ga0105245_101031562 178
977 3300009098 Ga0105245_10105036 Ga0105245_101050362 178
978 3300009098 Ga0105245_10236535 Ga0105245_102365353 178
979 3300009101 Ga0105247_10284676 Ga0105247_102846762 178
980 3300009101 Ga0105247_10469103 Ga0105247_104691032 178
981 3300009147 Ga0114129_10095263 Ga0114129_100952636 178
982 3300009147 Ga0114129_10175486 Ga0114129_101754863 178
983 3300009147 Ga0114129_10850855 Ga0114129_108508552 178
984 3300009174 Ga0105241_10096732 Ga0105241_100967322 178
985 3300009174 Ga0105241_10922628 Ga0105241_109226282 178
986 3300009176 Ga0105242_10423439 Ga0105242_104234393 178
987 3300009545 Ga0105237_10107634 Ga0105237_101076342 178
988 3300009545 Ga0105237_10400540 Ga0105237_104005402 178
989 3300009553 Ga0105249_10006766 Ga0105249_100067664 178
990 3300009553 Ga0105249_10016665 Ga0105249_100166652 178
991 3300009553 Ga0105249_10669291 Ga0105249_106692912 178
992 3300009553 Ga0105249_11258577 Ga0105249_112585772 178
993 3300010159 Ga0099796_10075146 Ga0099796_100751461 178
994 3300010375 Ga0105239_10072664 Ga0105239_100726643 178
995 3300011119 Ga0105246_10516170 Ga0105246_105161702 178
996 3300013102 Ga0157371_10266681 Ga0157371_102666813 178
997 3300013296 Ga0157374_10032996 Ga0157374_100329963 178
998 3300013296 Ga0157374_10068236 Ga0157374_100682365 178
999 3300013296 Ga0157374_10091134 Ga0157374_100911344 178
1000 3300013296 Ga0157374_10110875 Ga0157374_101108753 178
1001 3300013296 Ga0157374_10356859 Ga0157374_103568592 178
1002 3300013296 Ga0157374_10538630 Ga0157374_105386302 178
1003 3300013296 Ga0157374_11684549 Ga0157374_116845491 178
1004 3300013297 Ga0157378_10054529 Ga0157378_100545295 178
1005 3300013297 Ga0157378_10056068 Ga0157378_100560685 178
1006 3300013297 Ga0157378_10124616 Ga0157378_101246162 178
1007 3300013297 Ga0157378_10480705 Ga0157378_104807053 178
1008 3300013297 Ga0157378_10528490 Ga0157378_105284901 178
1009 3300013306 Ga0163162_10006343 Ga0163162_100063433 178
1010 3300013306 Ga0163162_10039123 Ga0163162_100391236 178
1011 3300013306 Ga0163162_10082361 Ga0163162_100823615 178
1012 3300013306 Ga0163162_10118321 Ga0163162_101183213 178
1013 3300013306 Ga0163162_10558796 Ga0163162_105587962 178
1014 3300013307 Ga0157372_11614732 Ga0157372_116147322 178
1015 3300013308 Ga0157375_10007572 Ga0157375_100075729 178
1016 3300013308 Ga0157375_10031682 Ga0157375_100316826 178
1017 3300013308 Ga0157375_10033665 Ga0157375_100336655 178
1018 3300013308 Ga0157375_10356617 Ga0157375_103566173 178
1019 3300013308 Ga0157375_10610839 Ga0157375_106108392 178
1020 3300014325 Ga0163163_10169102 Ga0163163_101691023 178
1021 3300014325 Ga0163163_10387662 Ga0163163_103876622 178
1022 3300014325 Ga0163163_10435869 Ga0163163_104358693 178
1023 3300014326 Ga0157380_10789231 Ga0157380_107892312 178
1024 3300014745 Ga0157377_10250451 Ga0157377_102504512 178
1025 3300014968 Ga0157379_10055151 Ga0157379_100551515 178
1026 3300014969 Ga0157376_10025775 Ga0157376_100257753 178
1027 3300014969 Ga0157376_10039684 Ga0157376_100396845 178
1028 3300014969 Ga0157376_10119817 Ga0157376_101198173 178
1029 3300014969 Ga0157376_10140091 Ga0157376_101400912 178
1030 3300014969 Ga0157376_10198257 Ga0157376_101982574 178
1031 3300014969 Ga0157376_11043366 Ga0157376_110433662 178
1032 3300015265 Ga0182005_1008598 Ga0182005_10085985 178
1033 3300017792 Ga0163161_10073086 Ga0163161_100730862 178
1034 3300017792 Ga0163161_10868114 Ga0163161_108681142 178
1035 3300025271 Ga0207666_1000261 Ga0207666_10002611 178
1036 3300025271 Ga0207666_1041271 Ga0207666_10412712 178
1037 3300025290 Ga0207673_1000951 Ga0207673_10009512 178
1038 3300025290 Ga0207673_1002395 Ga0207673_10023954 178
1039 3300025315 Ga0207697_10003309 Ga0207697_100033096 178
1040 3300025315 Ga0207697_10007175 Ga0207697_100071754 178
1041 3300025315 Ga0207697_10012709 Ga0207697_100127095 178
1042 3300025315 Ga0207697_10013913 Ga0207697_100139133 178
1043 3300025315 Ga0207697_10025802 Ga0207697_100258023 178
1044 3300025885 Ga0207653_10145502 Ga0207653_101455022 178
1045 3300025898 Ga0207692_10062561 Ga0207692_100625611 178
1046 3300025898 Ga0207692_10140107 Ga0207692_101401072 178
1047 3300025901 Ga0207688_10056548 Ga0207688_100565483 178
1048 3300025901 Ga0207688_10105407 Ga0207688_101054073 178
1049 3300025903 Ga0207680_10047288 Ga0207680_100472882 178
1050 3300025903 Ga0207680_10057513 Ga0207680_100575133 178
1051 3300025904 Ga0207647_10015769 Ga0207647_100157693 178
1052 3300025907 Ga0207645_10052932 Ga0207645_100529323 178
1053 3300025907 Ga0207645_10061657 Ga0207645_100616572 178
1054 3300025910 Ga0207684_10000028 Ga0207684_10000028189 178
1055 3300025910 Ga0207684_10003281 Ga0207684_100032817 178
1056 3300025910 Ga0207684_10032606 Ga0207684_100326062 178
1057 3300025910 Ga0207684_10284500 Ga0207684_102845002 178
1058 3300025910 Ga0207684_10329193 Ga0207684_103291933 178
1059 3300025910 Ga0207684_10649754 Ga0207684_106497542 178
1060 3300025912 Ga0207707_10015254 Ga0207707_100152544 178
1061 3300025915 Ga0207693_10002925 Ga0207693_100029258 178
1062 3300025915 Ga0207693_10022585 Ga0207693_100225853 178
1063 3300025915 Ga0207693_10096529 Ga0207693_100965294 178
1064 3300025915 Ga0207693_10105081 Ga0207693_101050812 178
1065 3300025915 Ga0207693_10111091 Ga0207693_101110912 178
1066 3300025915 Ga0207693_10137672 Ga0207693_101376723 178
1067 3300025915 Ga0207693_10151897 Ga0207693_101518972 178
1068 3300025915 Ga0207693_10193311 Ga0207693_101933111 178
1069 3300025915 Ga0207693_10923041 Ga0207693_109230411 178
1070 3300025916 Ga0207663_10093753 Ga0207663_100937532 178
1071 3300025916 Ga0207663_10269406 Ga0207663_102694062 178
1072 3300025916 Ga0207663_10415773 Ga0207663_104157732 178
1073 3300025917 Ga0207660_10040236 Ga0207660_100402363 178
1074 3300025918 Ga0207662_10050548 Ga0207662_100505482 178
1075 3300025919 Ga0207657_10061470 Ga0207657_100614705 178
1076 3300025919 Ga0207657_10118344 Ga0207657_101183442 178
1077 3300025920 Ga0207649_10012421 Ga0207649_100124214 178
1078 3300025921 Ga0207652_10064470 Ga0207652_100644704 178
1079 3300025922 Ga0207646_10006254 Ga0207646_100062549 178
1080 3300025922 Ga0207646_10006743 Ga0207646_100067434 178
1081 3300025922 Ga0207646_10026769 Ga0207646_100267693 178
1082 3300025922 Ga0207646_10102036 Ga0207646_101020362 178
1083 3300025922 Ga0207646_10134948 Ga0207646_101349483 178
1084 3300025922 Ga0207646_10167702 Ga0207646_101677023 178
1085 3300025922 Ga0207646_10325683 Ga0207646_103256832 178
1086 3300025922 Ga0207646_10329032 Ga0207646_103290323 178
1087 3300025922 Ga0207646_10565005 Ga0207646_105650051 178
1088 3300025923 Ga0207681_10063647 Ga0207681_100636474 178
1089 3300025923 Ga0207681_10142153 Ga0207681_101421533 178
1090 3300025925 Ga0207650_10113894 Ga0207650_101138944 178
1091 3300025925 Ga0207650_10498298 Ga0207650_104982981 178
1092 3300025926 Ga0207659_10004071 Ga0207659_100040717 178
1093 3300025926 Ga0207659_10004632 Ga0207659_100046327 178
1094 3300025926 Ga0207659_10073946 Ga0207659_100739464 178
1095 3300025926 Ga0207659_10080899 Ga0207659_100808993 178
1096 3300025926 Ga0207659_10221815 Ga0207659_102218152 178
1097 3300025926 Ga0207659_10300714 Ga0207659_103007142 178
1098 3300025926 Ga0207659_10557799 Ga0207659_105577991 178
1099 3300025927 Ga0207687_10413551 Ga0207687_104135513 178
1100 3300025927 Ga0207687_10436830 Ga0207687_104368302 178
1101 3300025927 Ga0207687_10514625 Ga0207687_105146252 178
1102 3300025928 Ga0207700_10064817 Ga0207700_100648174 178
1103 3300025928 Ga0207700_10164458 Ga0207700_101644584 178
1104 3300025928 Ga0207700_10694708 Ga0207700_106947082 178
1105 3300025929 Ga0207664_10184931 Ga0207664_101849313 178
1106 3300025929 Ga0207664_10214414 Ga0207664_102144143 178
1107 3300025929 Ga0207664_10273045 Ga0207664_102730453 178
1108 3300025929 Ga0207664_10554166 Ga0207664_105541662 178
1109 3300025931 Ga0207644_10045397 Ga0207644_100453975 178
1110 3300025931 Ga0207644_10091346 Ga0207644_100913463 178
1111 3300025931 Ga0207644_10112928 Ga0207644_101129283 178
1112 3300025932 Ga0207690_10021602 Ga0207690_100216025 178
1113 3300025933 Ga0207706_10186955 Ga0207706_101869552 178
1114 3300025933 Ga0207706_10203631 Ga0207706_102036312 178
1115 3300025933 Ga0207706_10266083 Ga0207706_102660832 178
1116 3300025933 Ga0207706_10671301 Ga0207706_106713012 178
1117 3300025936 Ga0207670_10011155 Ga0207670_100111554 178
1118 3300025936 Ga0207670_10032817 Ga0207670_100328174 178
1119 3300025936 Ga0207670_10293109 Ga0207670_102931092 178
1120 3300025937 Ga0207669_10166393 Ga0207669_101663932 178
1121 3300025938 Ga0207704_11006500 Ga0207704_110065002 178
1122 3300025939 Ga0207665_10035723 Ga0207665_100357236 178
1123 3300025939 Ga0207665_10069200 Ga0207665_100692002 178
1124 3300025939 Ga0207665_10541113 Ga0207665_105411132 178
1125 3300025939 Ga0207665_10587753 Ga0207665_105877532 178
1126 3300025940 Ga0207691_10029499 Ga0207691_100294993 178
1127 3300025940 Ga0207691_10220893 Ga0207691_102208932 178
1128 3300025942 Ga0207689_10096085 Ga0207689_100960853 178
1129 3300025944 Ga0207661_10009915 Ga0207661_100099155 178
1130 3300025944 Ga0207661_10163180 Ga0207661_101631802 178
1131 3300025944 Ga0207661_11113666 Ga0207661_111136662 178
1132 3300025945 Ga0207679_10206445 Ga0207679_102064453 178
1133 3300025945 Ga0207679_10496401 Ga0207679_104964012 178
1134 3300025960 Ga0207651_10059712 Ga0207651_100597122 178
1135 3300025960 Ga0207651_10212322 Ga0207651_102123223 178
1136 3300025961 Ga0207712_10903992 Ga0207712_109039922 178
1137 3300025972 Ga0207668_10128930 Ga0207668_101289304 178
1138 3300025972 Ga0207668_11005799 Ga0207668_110057991 178
1139 3300025981 Ga0207640_11185715 Ga0207640_111857152 178
1140 3300025986 Ga0207658_10129696 Ga0207658_101296963 178
1141 3300025986 Ga0207658_10443746 Ga0207658_104437462 178
1142 3300025986 Ga0207658_10884370 Ga0207658_108843702 178
1143 3300026023 Ga0207677_10146418 Ga0207677_101464183 178
1144 3300026023 Ga0207677_10252945 Ga0207677_102529452 178
1145 3300026023 Ga0207677_10379498 Ga0207677_103794981 178
1146 3300026035 Ga0207703_10059886 Ga0207703_100598865 178
1147 3300026035 Ga0207703_10282430 Ga0207703_102824302 178
1148 3300026067 Ga0207678_10014233 Ga0207678_100142334 178
1149 3300026067 Ga0207678_10154353 Ga0207678_101543533 178
1150 3300026067 Ga0207678_10483728 Ga0207678_104837281 178
1151 3300026075 Ga0207708_10008199 Ga0207708_100081994 178
1152 3300026078 Ga0207702_10017719 Ga0207702_100177196 178
1153 3300026088 Ga0207641_10048312 Ga0207641_100483123 178
1154 3300026089 Ga0207648_10907644 Ga0207648_109076442 178
1155 3300026116 Ga0207674_10281679 Ga0207674_102816794 178
1156 3300026118 Ga0207675_100243445 Ga0207675_1002434452 178
1157 3300026121 Ga0207683_10013281 Ga0207683_100132817 178
1158 3300026121 Ga0207683_10311584 Ga0207683_103115843 178
1159 3300026142 Ga0207698_10426621 Ga0207698_104266212 178
1160 3300027617 Ga0210002_1026552 Ga0210002_10265522 178
1161 3300027907 Ga0207428_10354896 Ga0207428_103548962 178
1162 3300028379 Ga0268266_10101921 Ga0268266_101019213 178
1163 3300028379 Ga0268266_10181768 Ga0268266_101817683 178
1164 3300028379 Ga0268266_10781206 Ga0268266_107812062 178
1165 3300028380 Ga0268265_10599475 Ga0268265_105994752 178
1166 3300028381 Ga0268264_10024971 Ga0268264_100249716 178
1167 3300031456 Ga0307513_10045324 Ga0307513_100453244 178
1168 3300035085 Ga0373929_0090138 Ga0373929_0090138_184_720 178
1169 3300035089 Ga0373944_0051313 Ga0373944_0051313_543_1079 178
1170 3300035091 Ga0373951_0055773 Ga0373951_0055773_184_720 178
1171 3300035117 Ga0373953_0018370 Ga0373953_0018370_1369_1905 178
1172 3300035117 Ga0373953_0127717 Ga0373953_0127717_243_779 178
1173 3300035118 Ga0373954_0383179 Ga0373954_0383179_52_588 178
1174 3300035120 Ga0373957_0140634 Ga0373957_0140634_209_745 178
1175 3300035170 Ga0373943_0013149 Ga0373943_0013149_1401_1937 178
1176 3300035170 Ga0373943_0108319 Ga0373943_0108319_818_1354 178
1177 3300035170 Ga0373943_0164482 Ga0373943_0164482_474_1010 178
1178 3300035170 Ga0373943_0187626 Ga0373943_0187626_413_949 178
1179 3300035170 Ga0373943_0295284 Ga0373943_0295284_124_660 178
1180 3300035172 Ga0373955_0031790 Ga0373955_0031790_563_1099 178
1181 3300035172 Ga0373955_0123356 Ga0373955_0123356_855_1391 178
1182 3300035172 Ga0373955_0207398 Ga0373955_0207398_509_1045 178
1183 3300035207 Ga0373942_0174660 Ga0373942_0174660_77_613 178
1184 3300035207 Ga0373942_0233011 Ga0373942_0233011_70_606 178
1185 3300035241 Ga0373961_0141227 Ga0373961_0141227_201_737 178
1186 3300035410 Ga0373924_0168041 Ga0373924_0168041_65_601 178
1187 3300035410 Ga0373924_0193320 Ga0373924_0193320_57_593 178
1188 3300035410 Ga0373924_0272505 Ga0373924_0272505_18_554 178
1189 3300035691 Ga0373931_0162623 Ga0373931_0162623_356_892 178
1190 3300035691 Ga0373931_0285613 Ga0373931_0285613_333_869 178
1191 3300035691 Ga0373931_0532831 Ga0373931_0532831_202_738 178
1192 3300035692 Ga0373935_0048456 Ga0373935_0048456_1932_2468 178
1193 3300035692 Ga0373935_0049597 Ga0373935_0049597_541_1077 178
1194 3300035692 Ga0373935_0353488 Ga0373935_0353488_150_686 178
1195 3300035692 Ga0373935_0554699 Ga0373935_0554699_215_751 178
1196 3300035695 Ga0373927_0086834 Ga0373927_0086834_1437_1973 178
1197 3300035724 Ga0373933_0078009 Ga0373933_0078009_1469_2005 178
1198 3300035724 Ga0373933_0751308 Ga0373933_0751308_13_549 178
1199 3300035725 Ga0373947_0156153 Ga0373947_0156153_342_878 178
1200 3300036401 Ga0373937_0004100 Ga0373937_0004100_8893_9429 178
1201 3300036401 Ga0373937_0719962 Ga0373937_0719962_145_681 178
1202 3300037068 Ga0373925_0051602 Ga0373925_0051602_143_679 178
1203 3300037068 Ga0373925_0175884 Ga0373925_0175884_405_941 178
1204 3300037068 Ga0373925_0212371 Ga0373925_0212371_341_877 178
1205 3300037068 Ga0373925_0656339 Ga0373925_0656339_245_781 178
1206 3300037418 Ga0395900_0002016 Ga0395900_0002016_1800_2336 178
1207 3300037418 Ga0395900_0203491 Ga0395900_0203491_644_1180 178
1208 3300037418 Ga0395900_0217548 Ga0395900_0217548_505_1041 178
1209 3300037418 Ga0395900_0767025 Ga0395900_0767025_46_582 178
1210 3300037466 Ga0395898_0012264 Ga0395898_0012264_3719_4255 178
1211 3300037466 Ga0395898_0293100 Ga0395898_0293100_49_585 178
1212 3300037471 Ga0395905_0034576 Ga0395905_0034576_1939_2475 178
1213 3300037471 Ga0395905_0517289 Ga0395905_0517289_311_847 178
1214 3300038443 Ga0395901_0034534 Ga0395901_0034534_833_1369 178
1215 3300038443 Ga0395901_0056833 Ga0395901_0056833_1283_1819 178
1216 3300038443 Ga0395901_1110382 Ga0395901_1110382_35_571 178
1217 3300039450 Ga0436363_0788885 Ga0436363_0788885_151_687 178
1218 3300042005 Ga0439448_0090790 Ga0439448_0090790_296_832 178
1219 3300042009 Ga0439451_003915 Ga0439451_003915_1159_1695 178
1220 3300042011 Ga0439454_004180 Ga0439454_004180_342_878 178
1221 3300042011 Ga0439454_038878 Ga0439454_038878_153_689 178
1222 3300042012 Ga0439455_0017390 Ga0439455_0017390_516_1052 178
1223 3300042438 Ga0439459_0056536 Ga0439459_0056536_261_797 178
1224 3300044683 Ga0466965_0363010 Ga0466965_0363010_47_583 178
1225 3300044706 Ga0466964_0063166 Ga0466964_0063166_720_1256 178
1226 3300045051 Ga0451576_0062976 Ga0451576_0062976_368_904 178
1227 3300045976 Ga0466967_0580341 Ga0466967_0580341_498_1034 178
1228 3300046454 Ga0495592_0077861 Ga0495592_0077861_1845_2381 178
1229 3300046455 Ga0495603_0542386 Ga0495603_0542386_16_552 178
1230 3300046462 Ga0495651_0002069 Ga0495651_0002069_6379_6915 178
1231 3300046462 Ga0495651_0119451 Ga0495651_0119451_1355_1891 178
1232 3300046462 Ga0495651_0489282 Ga0495651_0489282_80_616 178
1233 3300046463 Ga0495653_0131853 Ga0495653_0131853_548_1084 178
1234 3300046463 Ga0495653_0379707 Ga0495653_0379707_346_882 178
1235 3300046474 Ga0495605_0252741 Ga0495605_0252741_204_740 178
1236 3300046476 Ga0495662_0133205 Ga0495662_0133205_233_769 178
1237 3300046476 Ga0495662_0315612 Ga0495662_0315612_154_690 178
1238 3300046492 Ga0495585_0261865 Ga0495585_0261865_60_596 178
1239 3300046511 Ga0495608_0104512 Ga0495608_0104512_1168_1704 178
1240 3300046511 Ga0495608_0135699 Ga0495608_0135699_804_1340 178
1241 3300046511 Ga0495608_0419992 Ga0495608_0419992_217_753 178
1242 3300046514 Ga0495618_0106238 Ga0495618_0106238_290_826 178
1243 3300046516 Ga0495628_0398602 Ga0495628_0398602_137_673 178
1244 3300046517 Ga0495630_0017716 Ga0495630_0017716_4462_4998 178
1245 3300046517 Ga0495630_0122358 Ga0495630_0122358_445_981 178
1246 3300046517 Ga0495630_0659161 Ga0495630_0659161_132_668 178
1247 3300046529 Ga0495652_0002382 Ga0495652_0002382_9999_10535 178
1248 3300046529 Ga0495652_0018444 Ga0495652_0018444_176_712 178
1249 3300046531 Ga0495665_0080554 Ga0495665_0080554_964_1500 178
1250 3300046536 Ga0495587_0099795 Ga0495587_0099795_751_1287 178
1251 3300046537 Ga0495598_0065706 Ga0495598_0065706_272_808 178
1252 3300046543 Ga0495645_0076108 Ga0495645_0076108_1865_2401 178
1253 3300046543 Ga0495645_0223375 Ga0495645_0223375_48_584 178
1254 3300046559 Ga0495667_0035700 Ga0495667_0035700_884_1420 178
1255 3300046559 Ga0495667_0467394 Ga0495667_0467394_47_583 178
1256 3300046615 Ga0495656_0354571 Ga0495656_0354571_165_701 178
1257 3300046663 Ga0495635_0703429 Ga0495635_0703429_61_597 178
1258 3300046663 Ga0495635_0727494 Ga0495635_0727494_77_613 178
1259 3300046664 Ga0495659_0105214 Ga0495659_0105214_519_1055 178
1260 3300046664 Ga0495659_0201372 Ga0495659_0201372_46_582 178
1261 3300046678 Ga0495599_0083130 Ga0495599_0083130_1193_1729 178
1262 3300046678 Ga0495599_0169053 Ga0495599_0169053_786_1322 178
1263 3300046679 Ga0495623_0065191 Ga0495623_0065191_1440_1976 178
1264 3300046680 Ga0495646_0022094 Ga0495646_0022094_323_859 178
1265 3300046683 Ga0495658_0066607 Ga0495658_0066607_312_848 178
1266 3300046683 Ga0495658_0183254 Ga0495658_0183254_655_1191 178
1267 3300046684 Ga0495669_0168597 Ga0495669_0168597_261_797 178
1268 3300046684 Ga0495669_0237917 Ga0495669_0237917_96_632 178
1269 3300046809 Ga0495600_0052803 Ga0495600_0052803_1495_2031 178
1270 3300046809 Ga0495600_0112176 Ga0495600_0112176_239_775 178
1271 3300047319 Ga0495674_0201867 Ga0495674_0201867_110_646 178
1272 3300047321 Ga0495676_0184902 Ga0495676_0184902_747_1283 178
1273 3300047322 Ga0495680_0218080 Ga0495680_0218080_596_1132 178
1274 3300047322 Ga0495680_0776973 Ga0495680_0776973_47_583 178
1275 3300047444 Ga0495675_0020921 Ga0495675_0020921_2739_3275 178
1276 3300047444 Ga0495675_0106698 Ga0495675_0106698_537_1073 178
1277 3300047471 Ga0495684_0018401 Ga0495684_0018401_3094_3630 178
1278 3300047673 Ga0495593_0099700 Ga0495593_0099700_74_610 178
1279 3300048088 Ga0495602_0092945 Ga0495602_0092945_326_862 178
1280 3300048088 Ga0495602_0485795 Ga0495602_0485795_117_653 178
1281 3300048903 Ga0496100_0603440 Ga0496100_0603440_26_562 178
1282 3300048904 Ga0496101_0057350 Ga0496101_0057350_1323_1859 178
1283 3300048904 Ga0496101_0255690 Ga0496101_0255690_794_1330 178
1284 3300048904 Ga0496101_0390007 Ga0496101_0390007_116_652 178
1285 3300048905 Ga0496102_0098397 Ga0496102_0098397_1793_2329 178
1286 3300048905 Ga0496102_0248196 Ga0496102_0248196_962_1498 178
1287 3300048905 Ga0496102_0557253 Ga0496102_0557253_477_1013 178
1288 3300048906 Ga0496103_0074371 Ga0496103_0074371_826_1362 178
1289 3300048906 Ga0496103_0099912 Ga0496103_0099912_209_745 178
1290 3300048907 Ga0496104_0242492 Ga0496104_0242492_844_1380 178
1291 3300048907 Ga0496104_0267729 Ga0496104_0267729_402_938 178
1292 3300048907 Ga0496104_0292550 Ga0496104_0292550_374_910 178
1293 3300048907 Ga0496104_0369501 Ga0496104_0369501_413_949 178
1294 3300048908 Ga0496105_0015917 Ga0496105_0015917_1127_1663 178
1295 3300048908 Ga0496105_0171980 Ga0496105_0171980_530_1066 178
1296 3300048909 Ga0496106_0089107 Ga0496106_0089107_996_1532 178
1297 3300048911 Ga0496108_0228481 Ga0496108_0228481_15_551 178
1298 3300048911 Ga0496108_0275170 Ga0496108_0275170_516_1052 178
1299 3300048911 Ga0496108_0358646 Ga0496108_0358646_119_655 178
1300 3300048911 Ga0496108_0529651 Ga0496108_0529651_49_585 178
1301 3300048912 Ga0496109_0628543 Ga0496109_0628543_75_611 178
1302 3300048913 Ga0496110_0186176 Ga0496110_0186176_362_898 178
1303 3300048913 Ga0496110_0730324 Ga0496110_0730324_247_783 178
1304 3300048914 Ga0496111_0294540 Ga0496111_0294540_132_668 178
1305 3300048915 Ga0496112_0012037 Ga0496112_0012037_1065_1601 178
1306 3300048915 Ga0496112_0697637 Ga0496112_0697637_72_608 178
1307 3300048916 Ga0496113_0514411 Ga0496113_0514411_415_951 178
1308 3300048917 Ga0496114_0006008 Ga0496114_0006008_4960_5496 178
1309 3300048917 Ga0496114_0386386 Ga0496114_0386386_626_1162 178
1310 3300048918 Ga0496115_0002245 Ga0496115_0002245_5256_5792 178
1311 3300048918 Ga0496115_0011572 Ga0496115_0011572_1148_1684 178
1312 3300048918 Ga0496115_0041385 Ga0496115_0041385_2509_3045 178
1313 3300048918 Ga0496115_0361349 Ga0496115_0361349_482_1018 178
1314 3300048918 Ga0496115_0364171 Ga0496115_0364171_46_582 178
1315 3300048918 Ga0496115_0779278 Ga0496115_0779278_25_561 178
1316 3300049583 Ga0501067_0130946 Ga0501067_0130946_451_987 178
1317 3300050507 nmdc:mga05p37_230926_c1 nmdc:mga05p37_230926_c1_1227_1763 178
1318 3300050507 nmdc:mga05p37_508068_c1 nmdc:mga05p37_508068_c1_444_980 178
1319 3300050507 nmdc:mga05p37_624008_c1 nmdc:mga05p37_624008_c1_388_924 178
1320 3300050507 nmdc:mga05p37_626317_c1 nmdc:mga05p37_626317_c1_342_878 178
1321 3300050511 nmdc:mga08y16_1060237_c1 nmdc:mga08y16_1060237_c1_64_600 178
1322 3300050511 nmdc:mga08y16_140210_c1 nmdc:mga08y16_140210_c1_1126_1662 178
1323 3300050511 nmdc:mga08y16_250812_c1 nmdc:mga08y16_250812_c1_344_880 178
1324 3300050512 nmdc:mga0n895_979579_c1 nmdc:mga0n895_979579_c1_47_583 178
1325 3300050514 nmdc:mga08x19_528808_c1 nmdc:mga08x19_528808_c1_204_740 178
1326 3300050515 nmdc:mga0a205_738712_c1 nmdc:mga0a205_738712_c1_23_559 178
1327 3300053077 Ga0495601_0122844 Ga0495601_0122844_886_1422 178
1328 3300053084 Ga0495595_0112475 Ga0495595_0112475_420_956 178
1329 3300053084 Ga0495595_0139857 Ga0495595_0139857_511_1047 178
1330 3300053085 Ga0495619_0429277 Ga0495619_0429277_179_715 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

150

199

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

144

197

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

41

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9661 118 168
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9593 118 168
6eo2-assembly1.cif.gz_A conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c crossed 0.9553 125 169
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9494 1 95
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9443 118 173
ID Description Score Start End Superfamily
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9661 118 168 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9593 118 168 1.10.10.10
1or7B01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9528 5 87 1.10.1740.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9515 118 168 1.10.10.10
4lupC00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9493 1 95 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A536ZWP5-F1-model_v4 RNA polymerase sigma factor 1.002 1 92 GO:0003677
GO:0006352
GO:0016987
AF-A0A4Q2XYZ5-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.9256 1 89 GO:0006352
GO:0016987
AF-A0A2W4RZU8-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.8989 1 101 GO:0006352
GO:0016987
AF-A0A2V6MJR0-F1-model_v4 RNA polymerase sigma factor 0.8598 1 113 GO:0003677
GO:0006352
GO:0016987
AF-A0A2V6MJR0-F1-model_v4 RNA polymerase sigma factor 0.8406 1 113 GO:0003677
GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
87.78 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map