F493095

General Info

Members Datasets Scaffolds Average Seq Length
1333 1025 2666 285

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0076684|Ga0496122_0076684_669_1691
Length 340
Sequence MISTTGVSPIIAAARSQAAPEEPGNLEFSWETIAFAAMLHTSHPPDVLMMGEKMGFLGRLLPKRFRKKGVSIPVVRLHGAIMTGGSQFKPTLNIATVAPMLEKAFSRKEAPVVAISLNSPGGSPVQSRLIFQRIRALAEEKQKKVLIFVEDVAASGGYMIALAGDEIFADPTSIVGSIGVVSGGFGFPEMLKKIGVERRVYTAGENKVILDPFQPEKDSDIEYLKTLQLEIHKVFIDMVKMRRGERLADDGEIFSGLFWTGNKGLELGLIDGLGDMRDVLKRRFGKDARLELIGSARSLFGRKVPGVAAITPGLGEIAAQAGAGLAAGIEERALWSRYGL

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
57 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
71 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
72 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
73 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
74 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
129 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
142 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
143 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
144 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
145 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
146 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
150 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
235 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
236 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
237 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
238 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
239 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
240 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
241 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
242 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
243 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
244 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
248 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
253 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
254 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
255 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
258 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
259 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
260 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
261 2509276019 Ensifer aridi TW10 Isolate Nodule
262 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
263 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
264 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
265 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
266 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
267 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
268 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
269 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
270 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
271 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
272 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
273 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
274 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
275 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
276 2512875024
277 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
278 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
279 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
280 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
281 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
282 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
283 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
284 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
285 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
286 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
287 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
288 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
289 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
290 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
291 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
292 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
293 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
294 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
295 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
296 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
297 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
298 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
299 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
300 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
301 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
302 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
303 2516143018 Ensifer sp. BR816 Isolate Nodule
304 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
305 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
306 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
307 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
308 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
309 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
310 2519899620 Rhizobium sp. Pop5 Isolate Nodule
311 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
312 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
313 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
314 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
315 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
316 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
317 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
318 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
319 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
320 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
321 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
322 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
323 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
324 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
325 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
326 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
327 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
328 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
329 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
330 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
331 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
332 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
333 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
334 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
335 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
336 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
337 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
338 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
339 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
340 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
341 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
342 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
343 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
344 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
345 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
346 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
347 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
348 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
349 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
350 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
351 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
352 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
353 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
354 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
355 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
356 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
357 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
358 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
359 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
360 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
361 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
362 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
363 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
364 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
365 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
366 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
367 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
368 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
369 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
370 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
371 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
372 2643221557 Ensifer sp. Root558 Isolate Unclassified
373 2643221558 Rhizobium sp. Root149 Isolate Unclassified
374 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
375 2643221568 Rhizobium sp. Root564 Isolate Unclassified
376 2643221582 Rhizobium sp. Root651 Isolate Unclassified
377 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
378 2643221599 Rhizobium sp. Root708 Isolate Unclassified
379 2643221607 Rhizobium sp. Root73 Isolate Unclassified
380 2643221610 Ensifer sp. Root74 Isolate Unclassified
381 2643221618 Ensifer sp. Root231 Isolate Unclassified
382 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
383 2643221626 Ensifer sp. Root31 Isolate Unclassified
384 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
385 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
386 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
387 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
388 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
389 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
390 2643221655 Ensifer sp. Root1252 Isolate Unclassified
391 2643221659 Ensifer sp. Root127 Isolate Unclassified
392 2643221668 Ensifer sp. Root423 Isolate Unclassified
393 2643221675 Ensifer sp. Root1298 Isolate Unclassified
394 2643221680 Ensifer sp. Root1312 Isolate Unclassified
395 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
396 2643221688 Rhizobium sp. Root482 Isolate Unclassified
397 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
398 2643221693 Rhizobium sp. Root491 Isolate Unclassified
399 2643221698 Ensifer sp. Root142 Isolate Unclassified
400 2643221712 Ensifer sp. Root258 Isolate Unclassified
401 2643221718 Rhizobium sp. Root268 Isolate Unclassified
402 2643221719 Rhizobium sp. Root274 Isolate Unclassified
403 2643221723 Ensifer sp. Root278 Isolate Unclassified
404 2643221726 Ensifer sp. Root954 Isolate Unclassified
405 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
406 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
407 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
408 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
409 2718217882 Rhizobium sp. N741 Isolate Nodule
410 2718217927 Rhizobium sp. N324 Isolate Nodule
411 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
412 2718218009 Rhizobium sp. N561 Isolate Nodule
413 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
414 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
415 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
416 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
417 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
418 2718218363 Rhizobium sp. N113 Isolate Nodule
419 2718218365 Rhizobium sp. N731 Isolate Nodule
420 2718218366 Rhizobium sp. N621 Isolate Nodule
421 2718218423 Rhizobium sp. N941 Isolate Nodule
422 2721755514 Rhizobium sp. N6212 Isolate Nodule
423 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
424 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
425 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
426 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
427 2721755809 Rhizobium sp. N541 Isolate Nodule
428 2721755810 Rhizobium sp. N871 Isolate Nodule
429 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
430 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
431 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
432 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
433 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
434 2728369365 Rhizobium sp. N1341 Isolate Nodule
435 2728369397 Rhizobium sp. N1314 Isolate Nodule
436 2738541293 Rhizobium sp. GV031 Isolate Unclassified
437 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
438 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
439 2738543024 Aminobacter sp. AP02 Isolate Unclassified
440 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
441 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
442 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
443 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
444 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
445 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
446 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
447 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
448 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
449 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
450 2791355256 Rhizobium sp. M10 Isolate Nodule
451 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
452 2791355260 Rhizobium sp. L9 Isolate Nodule
453 2791355261 Rhizobium sp. J15 Isolate Nodule
454 2791355262 Rhizobium sp. M1 Isolate Nodule
455 2791355263 Rhizobium chutanense C5 Isolate Nodule
456 2791355264 Rhizobium sp. S9 Isolate Nodule
457 2791355265 Rhizobium sp. H4 Isolate Nodule
458 2791355266 Rhizobium sp. L43 Isolate Nodule
459 2791355267 Rhizobium sp. L18 Isolate Nodule
460 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
461 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
462 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
463 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
464 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
465 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
466 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
467 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
468 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
469 2802429633 Rhizobium anhuiense J3 Isolate Nodule
470 2802429634 Rhizobium anhuiense S10 Isolate Nodule
471 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
472 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
473 2802429637 Rhizobium anhuiense C15 Isolate Nodule
474 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
475 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
476 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
477 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
478 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
479 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
480 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
481 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
482 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
483 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
484 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
485 2838048938 Rhizobium pisi 27/80 Isolate Nodule
486 2838061910 Rhizobium phaseoli L15 Isolate Nodule
487 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
488 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
489 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
490 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
491 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
492 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
493 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
494 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
495 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
496 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
497 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
498 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
499 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
500 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
501 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
502 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
503 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
504 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
505 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
506 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
507 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
508 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
509 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
510 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
511 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
512 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
513 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
514 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
515 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
516 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
517 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
518 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
519 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
520 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
521 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
522 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
523 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
524 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
525 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
526 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
527 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
528 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
529 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
530 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
531 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
532 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
533 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
534 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
535 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
536 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
537 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
538 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
539 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
540 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
541 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
542 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
543 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
544 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
545 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
546 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
547 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
548 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
549 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
550 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
551 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
552 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
553 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
554 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
555 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
556 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
557 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
558 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
559 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
560 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
561 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
562 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
563 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
564 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
565 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
566 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
567 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
568 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
569 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
570 2844163670 Ensifer sp. 1H6 Isolate Unclassified
571 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
572 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
573 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
574 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
575 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
576 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
577 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
578 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
579 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
580 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
581 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
582 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
583 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
584 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
585 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
586 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
587 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
588 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
589 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
590 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
591 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
592 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
593 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
594 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
595 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
596 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
597 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
598 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
599 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
600 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
601 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
602 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
603 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
604 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
605 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
606 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
607 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
608 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
609 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
610 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
611 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
612 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
613 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
614 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
615 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
616 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
617 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
618 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
619 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
620 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
621 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
622 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
623 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
624 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
625 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
626 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
627 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
628 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
629 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
630 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
631 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
632 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
633 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
634 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
635 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
636 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
637 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
638 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
639 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
640 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
641 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
642 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
643 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
644 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
645 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
646 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
647 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
648 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
649 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
650 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
651 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
652 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
653 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
654 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
655 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
656 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
657 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
658 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
659 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
660 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
661 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
662 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
663 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
664 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
665 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
666 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
667 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
668 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
669 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
670 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
671 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
672 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
673 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
674 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
675 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
676 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
677 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
678 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
679 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
680 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
681 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
682 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
683 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
684 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
685 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
686 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
687 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
688 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
689 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
690 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
691 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
692 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
693 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
694 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
695 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
696 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
697 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
698 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
699 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
700 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
701 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
702 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
703 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
704 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
705 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
706 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
707 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
708 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
709 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
710 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
711 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
712 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
713 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
714 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
715 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
716 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
717 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
718 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
719 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
720 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
721 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
722 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
723 2933599457 Rhizobium phaseoli M3 Isolate Nodule
724 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
725 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
726 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
727 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
728 2936381700 Rhizobium chutanense C16 Isolate Unclassified
729 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
730 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
731 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
732 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
733 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
734 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
735 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
736 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
737 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
738 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
739 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
740 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
741 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
742 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
743 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
744 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
745 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
746 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
747 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
748 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
749 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
750 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
751 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
752 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
753 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
754 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
755 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
756 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
757 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
758 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
759 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
760 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
761 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
762 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
763 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
764 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
765 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
766 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
767 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
768 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
769 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
770 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
771 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
772 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
773 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
774 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
775 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
776 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
777 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
778 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
779 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
780 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
781 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
782 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
783 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
784 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
785 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
786 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
787 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
788 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
789 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
790 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
791 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
792 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
793 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
794 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
795 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
796 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
797 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
798 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
799 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
800 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
801 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
802 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
803 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
804 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
805 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
806 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
807 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
808 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
809 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
810 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
811 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
812 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
813 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
814 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
815 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
816 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
817 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
818 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
819 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
820 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
821 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
822 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
823 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
824 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
825 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
826 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
827 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
828 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
829 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
830 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
831 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
832 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
833 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
834 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
835 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
836 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
837 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
838 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
839 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
840 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
841 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
842 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
843 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
844 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
845 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
846 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
847 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
848 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
849 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
850 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
851 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
852 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
853 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
854 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
855 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
856 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
857 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
858 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
859 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
860 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
861 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
862 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
863 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
864 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
865 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
866 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
867 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
868 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
869 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
870 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
871 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
872 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
873 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
874 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
875 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
876 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
877 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
878 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
879 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
880 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
881 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
882 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
883 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
884 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
885 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
886 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
887 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
888 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
889 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
890 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
891 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
892 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
893 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
894 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
895 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
896 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
897 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
898 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
899 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
900 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
901 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
902 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
903 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
904 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
905 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
906 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
907 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
908 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
909 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
910 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
911 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
912 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
913 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
914 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
915 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
916 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
917 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
918 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
919 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
920 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
921 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
922 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
923 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
924 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
925 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
926 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
927 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
928 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
929 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
930 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
931 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
932 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
933 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
934 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
935 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
936 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
937 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
938 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
939 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
940 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
941 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
942 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
943 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
944 2996887358 Rhizobium sp. R711 Isolate Nodule
945 2996893221 Rhizobium sp. R635 Isolate Nodule
946 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
947 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
948 3004167301 Mesorhizobium loti 582 Isolate Unclassified
949 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
950 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
951 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
952 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
953 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
954 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
955 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
956 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
957 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
958 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
959 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
960 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
961 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
962 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
963 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
964 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
965 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
966 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
967 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
968 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
969 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
970 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
971 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
972 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
973 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
974 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
975 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
976 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
977 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
978 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
979 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
980 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
981 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
982 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
983 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
984 8005258706 Rhizobium sp. R693 Isolate Nodule
985 8005275841 Rhizobium sp. N4311 Isolate Nodule
986 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
987 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
988 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
989 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
990 8005321885 Rhizobium sp. R72 Isolate Nodule
991 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
992 8005382845 Rhizobium sp. R634 Isolate Nodule
993 8005395548 Rhizobium sp. R339 Isolate Nodule
994 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
995 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
996 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
997 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
998 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
999 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1000 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1001 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1002 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1003 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1004 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1005 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1006 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1007 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1008 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1009 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1010 8018176218 Rhizobium sp. N122 Isolate Nodule
1011 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1012 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1013 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1014 8024501048 Rhizobium sp. H4 Isolate Nodule
1015 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1016 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1017 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1018 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1019 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1020 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1021 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1022 8056382006 Rhizobium croatiense 13T Isolate Nodule
1023 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1024 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1025 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.79
Metatranscriptomes 0.08
Isolates 58.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 17.03
Nodule 46.06
Rhizoplane 1.2
Rhizosphere 18.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0076684 3300048925 Bacteria 2351
2 RicEn_C1280 2010549000 Bacteria 2178
3 JGI24740J21852_10006979 3300001979 Bacteria 4633
4 JGI25155J39150_1000006 3300002704 Bacteria 244109
5 JGI25156J39149_1000019 3300002705 Bacteria 160845
6 JGI25154J39366_1000365 3300002738 Bacteria 25282
7 JGI25158J39367_1004713 3300002739 Bacteria 2035
8 JGI25158J39367_1005468 3300002739 Bacteria 1864
9 JGI25157J39369_1000024 3300002741 Bacteria 160844
10 JGI25152J39213_1001364 3300002773 Bacteria 10668
11 JGI25152J39213_1001530 3300002773 Bacteria 9828
12 JGI25152J39213_1002888 3300002773 Bacteria 6140
13 JGI25152J39213_1003642 3300002773 Bacteria 5196
14 JGI25152J39213_1003736 3300002773 Bacteria 5089
15 JGI25152J39213_1005803 3300002773 Bacteria 3504
16 JGI25150J39212_1000042 3300002774 Bacteria 84513
17 JGI25150J39212_1008444 3300002774 Bacteria 2013
18 JGI25159J45721_1000021 3300002987 Bacteria 119754
19 JGI25159J45721_1004731 3300002987 Bacteria 4425
20 JGI25151J46595_10000099 3300003187 Bacteria 117428
21 JGI25151J46595_10001860 3300003187 Bacteria 13545
22 JGI25151J46595_10010565 3300003187 Bacteria 4280
23 JGI25151J46595_10015525 3300003187 Bacteria 3352
24 JGI25151J46595_10043194 3300003187 Bacteria 1615
25 JGI25165J46597_1000016 3300003214 Bacteria 377866
26 JGI25165J46597_1001938 3300003214 Bacteria 8158
27 JGI25153J46596_10000761 3300003215 Bacteria 19707
28 JGI25153J46596_10004070 3300003215 Bacteria 7960
29 JGI25153J46596_10007790 3300003215 Bacteria 5204
30 JGI25153J46596_10008040 3300003215 Bacteria 5097
31 JGI25153J46596_10010745 3300003215 Bacteria 4111
32 rootH1_10065597 3300003316 Bacteria 1621
33 JGI25160J50197_1000002 3300003354 Bacteria 561707
34 JGI25160J50197_1000261 3300003354 Bacteria 39695
35 JGI25160J50197_1001976 3300003354 Bacteria 9776
36 JGI25160J50197_1009243 3300003354 Bacteria 3676
37 JGI25161J50226_1000195 3300003374 Bacteria 39695
38 JGI25161J50226_1000745 3300003374 Bacteria 12478
39 JGI25161J50226_1001106 3300003374 Bacteria 9087
40 JGI25161J50226_1006651 3300003374 Bacteria 2060
41 Ga0006562J51391_1023041 3300003578 Bacteria 1650
42 Ga0055542_1000694 3300003762 Bacteria 26573
43 Ga0055529_1003767 3300003763 Bacteria 2434
44 Ga0055526_1001512 3300003771 Bacteria 16479
45 Ga0055526_1009662 3300003771 Bacteria 4603
46 Ga0055526_1014659 3300003771 Bacteria 3205
47 Ga0055526_1024076 3300003771 Bacteria 2006
48 Ga0055524_1004697 3300003775 Bacteria 6261
49 Ga0055524_1007742 3300003775 Bacteria 4534
50 Ga0055524_1008112 3300003775 Bacteria 4389
51 Ga0055536_1009924 3300003781 Bacteria 3861
52 Ga0055536_1011977 3300003781 Bacteria 3263
53 Ga0055528_1000263 3300003790 Bacteria 44623
54 Ga0055528_1007710 3300003790 Bacteria 4718
55 Ga0055528_1011212 3300003790 Bacteria 3581
56 Ga0055528_1022634 3300003790 Bacteria 1950
57 Ga0055528_1025618 3300003790 Bacteria 1725
58 Ga0055540_1000422 3300003792 Bacteria 33923
59 Ga0055540_1001170 3300003792 Bacteria 16272
60 Ga0055540_1011377 3300003792 Bacteria 2874
61 Ga0055531_10005822 3300003794 Bacteria 7131
62 Ga0055531_10007471 3300003794 Bacteria 5956
63 Ga0058692_1005505 3300003856 Bacteria 3604
64 Ga0058692_1006931 3300003856 Bacteria 3055
65 Ga0055543_1000010 3300004625 Bacteria 198371
66 Ga0055543_1000215 3300004625 Bacteria 46312
67 Ga0055543_1000358 3300004625 Bacteria 30677
68 Ga0055543_1000923 3300004625 Bacteria 13689
69 Ga0065165_1000004 3300005262 Bacteria 377081
70 Ga0065165_1002152 3300005262 Bacteria 17826
71 Ga0065165_1012112 3300005262 Bacteria 3534
72 Ga0070670_100000811 3300005331 Bacteria 24347
73 Ga0070666_10013250 3300005335 Bacteria 5228
74 Ga0070660_100171301 3300005339 Bacteria 1754
75 Ga0070668_100193502 3300005347 Bacteria 1667
76 Ga0070667_100115697 3300005367 Bacteria 2329
77 Ga0070663_100045818 3300005455 Bacteria 3091
78 Ga0070665_100050865 3300005548 Bacteria 4158
79 Ga0070665_100053285 3300005548 Bacteria 4057
80 Ga0068855_100154182 3300005563 Bacteria 2611
81 Ga0068854_100106300 3300005578 Bacteria 2111
82 Ga0068852_100026503 3300005616 Bacteria 4713
83 Ga0068852_100219705 3300005616 Bacteria 1807
84 Ga0075365_10000341 3300006038 Bacteria 16645
85 Ga0075365_10008377 3300006038 Bacteria 5864
86 Ga0075365_10053672 3300006038 Bacteria 2670
87 Ga0075365_10067790 3300006038 Bacteria 2396
88 Ga0075365_10159001 3300006038 Bacteria 1573
89 Ga0075368_10013797 3300006042 Bacteria 2972
90 Ga0075368_10017200 3300006042 Bacteria 2704
91 Ga0075368_10114481 3300006042 Bacteria 1114
92 Ga0075363_100212744 3300006048 Bacteria 1107
93 Ga0075364_10000730 3300006051 Bacteria 17230
94 Ga0075364_10021793 3300006051 Bacteria 4039
95 Ga0075364_10130609 3300006051 Bacteria 1686
96 Ga0075362_10028537 3300006177 Bacteria 2397
97 Ga0075362_10051478 3300006177 Bacteria 1843
98 Ga0075367_10013411 3300006178 Bacteria 4404
99 Ga0075367_10042176 3300006178 Bacteria 2669
100 Ga0075367_10115594 3300006178 Bacteria 1650
101 Ga0075369_10001103 3300006186 Bacteria 9069
102 Ga0075369_10019551 3300006186 Bacteria 2766
103 Ga0075369_10104750 3300006186 Bacteria 1271
104 Ga0075366_10003971 3300006195 Bacteria 7897
105 Ga0075366_10049432 3300006195 Bacteria 2495
106 Ga0075370_10062936 3300006353 Bacteria 2114
107 Ga0079104_1000210 3300006946 Bacteria 81817
108 Ga0079104_1010958 3300006946 Bacteria 2947
109 Ga0099826_10000253 3300006948 Bacteria 23616
110 Ga0105240_10000027 3300009093 Bacteria 348486
111 Ga0105247_10129215 3300009101 Bacteria 1645
112 Ga0105243_10091152 3300009148 Bacteria 2510
113 Ga0105243_10325002 3300009148 Bacteria 1403
114 Ga0105237_10000508 3300009545 Bacteria 54970
115 Ga0105237_10212767 3300009545 Bacteria 1933
116 Ga0105237_10452980 3300009545 Bacteria 1289
117 Ga0105238_10009417 3300009551 Bacteria 9780
118 Ga0123341_1000027 3300009765 Bacteria 69241
119 Ga0123341_1083171 3300009765 Bacteria 1229
120 Ga0123342_1024745 3300009766 Bacteria 3714
121 Ga0105239_10002593 3300010375 Bacteria 22866
122 Ga0105239_10100782 3300010375 Bacteria 3195
123 Ga0105239_10197951 3300010375 Bacteria 2250
124 Ga0105239_10326413 3300010375 Bacteria 1731
125 Ga0105239_10668443 3300010375 Bacteria 1187
126 Ga0105246_10115834 3300011119 Bacteria 1977
127 Ga0157313_1000967 3300012503 Bacteria 1452
128 Ga0157373_10091390 3300013100 Bacteria 2144
129 Ga0157373_10250304 3300013100 Bacteria 1253
130 Ga0157371_10000058 3300013102 Bacteria 171756
131 Ga0157371_10047546 3300013102 Bacteria 3051
132 Ga0157370_10000048 3300013104 Bacteria 124683
133 Ga0157370_10000792 3300013104 Bacteria 39754
134 Ga0157370_10104078 3300013104 Bacteria 2657
135 Ga0157370_10197909 3300013104 Bacteria 1865
136 Ga0157370_10311511 3300013104 Bacteria 1452
137 Ga0157369_10033463 3300013105 Bacteria 5648
138 Ga0157369_10161492 3300013105 Bacteria 2365
139 Ga0171463_1001 3300013249 Bacteria 1406070
140 Ga0163163_10456271 3300014325 Bacteria 1338
141 Ga0182007_10001900 3300015262 Bacteria 10892
142 Ga0183363_1067 3300015690 Bacteria 32305
143 Ga0163161_10328652 3300017792 Bacteria 1210
144 Ga0214542_1029774 3300021321 Bacteria 2195
145 Ga0214543_1000003 3300021327 Bacteria 692327
146 Ga0228711_1000137 3300022739 Bacteria 66265
147 Ga0228710_1000031 3300022740 Bacteria 95534
148 Ga0209435_100011 3300025206 Bacteria 413027
149 Ga0209436_100904 3300025208 Bacteria 11762
150 Ga0209436_102216 3300025208 Bacteria 6038
151 Ga0209563_101762 3300025230 Bacteria 5444
152 Ga0209437_100036 3300025233 Bacteria 469153
153 Ga0207425_1000012 3300025245 Bacteria 528324
154 Ga0207425_1001651 3300025245 Bacteria 8970
155 Ga0209646_1000024 3300025246 Bacteria 413027
156 Ga0209026_1000030 3300025250 Bacteria 329811
157 Ga0209677_100177 3300025253 Bacteria 54158
158 Ga0209148_1000057 3300025254 Bacteria 360463
159 Ga0209759_1000011 3300025256 Bacteria 413027
160 Ga0209129_1000086 3300025258 Bacteria 181543
161 Ga0209129_1000428 3300025258 Bacteria 31778
162 Ga0209129_1000965 3300025258 Bacteria 17284
163 Ga0209129_1001065 3300025258 Bacteria 16216
164 Ga0209129_1001501 3300025258 Bacteria 12969
165 Ga0209129_1003602 3300025258 Bacteria 6626
166 Ga0209129_1003829 3300025258 Bacteria 6284
167 Ga0209233_1000056 3300025261 Bacteria 438104
168 Ga0209233_1000068 3300025261 Bacteria 377969
169 Ga0209233_1000640 3300025261 Bacteria 17399
170 Ga0209233_1017467 3300025261 Bacteria 1953
171 Ga0209455_1000240 3300025272 Bacteria 68476
172 Ga0209455_1003068 3300025272 Bacteria 6101
173 Ga0209673_1000091 3300025273 Bacteria 201875
174 Ga0209673_1000122 3300025273 Bacteria 170443
175 Ga0209673_1001847 3300025273 Bacteria 17281
176 Ga0209673_1002257 3300025273 Bacteria 13890
177 Ga0209673_1003203 3300025273 Bacteria 9917
178 Ga0209673_1003816 3300025273 Bacteria 8536
179 Ga0209673_1006605 3300025273 Bacteria 5553
180 Ga0209673_1027364 3300025273 Bacteria 1855
181 Ga0209130_1000008 3300025284 Bacteria 581232
182 Ga0209130_1000013 3300025284 Bacteria 412810
183 Ga0209130_1000015 3300025284 Bacteria 409631
184 Ga0209130_1006718 3300025284 Bacteria 3683
185 Ga0209676_1002616 3300025292 Bacteria 12308
186 Ga0209676_1007603 3300025292 Bacteria 5035
187 Ga0209025_1000024 3300025294 Bacteria 528324
188 Ga0209025_1000118 3300025294 Bacteria 214009
189 Ga0209025_1000425 3300025294 Bacteria 83943
190 Ga0209025_1000549 3300025294 Bacteria 70203
191 Ga0209025_1002239 3300025294 Bacteria 21292
192 Ga0209025_1003170 3300025294 Bacteria 15999
193 Ga0209025_1005506 3300025294 Bacteria 10292
194 Ga0209025_1009578 3300025294 Bacteria 6721
195 Ga0209025_1041339 3300025294 Bacteria 1976
196 Ga0209025_1053081 3300025294 Bacteria 1594
197 Ga0209564_1000091 3300025295 Bacteria 249103
198 Ga0209564_1000398 3300025295 Bacteria 77724
199 Ga0209564_1001660 3300025295 Bacteria 21392
200 Ga0209564_1001988 3300025295 Bacteria 17897
201 Ga0209564_1004066 3300025295 Bacteria 9223
202 Ga0209564_1007014 3300025295 Bacteria 5908
203 Ga0209564_1015416 3300025295 Bacteria 3110
204 Ga0209758_1000046 3300025297 Bacteria 364931
205 Ga0209758_1000191 3300025297 Bacteria 136984
206 Ga0209758_1000325 3300025297 Bacteria 91078
207 Ga0209758_1001314 3300025297 Bacteria 30234
208 Ga0209758_1001929 3300025297 Bacteria 22554
209 Ga0209758_1003374 3300025297 Bacteria 14624
210 Ga0209758_1007852 3300025297 Bacteria 7107
211 Ga0209758_1039329 3300025297 Bacteria 1800
212 Ga0209758_1042064 3300025297 Bacteria 1699
213 Ga0209050_1002194 3300025298 Bacteria 17600
214 Ga0209050_1002228 3300025298 Bacteria 17343
215 Ga0209050_1024676 3300025298 Bacteria 2070
216 Ga0209256_1000169 3300025299 Bacteria 131077
217 Ga0209256_1001378 3300025299 Bacteria 25439
218 Ga0209256_1001486 3300025299 Bacteria 23935
219 Ga0209256_1004334 3300025299 Bacteria 9011
220 Ga0209256_1004935 3300025299 Bacteria 7998
221 Ga0209256_1005505 3300025299 Bacteria 7245
222 Ga0209256_1005974 3300025299 Bacteria 6690
223 Ga0209256_1008187 3300025299 Bacteria 4910
224 Ga0209256_1009659 3300025299 Bacteria 4185
225 Ga0209256_1039148 3300025299 Bacteria 1222
226 Ga0207426_1000016 3300025302 Bacteria 581232
227 Ga0207426_1000063 3300025302 Bacteria 358920
228 Ga0207426_1000081 3300025302 Bacteria 304502
229 Ga0207426_1000144 3300025302 Bacteria 191590
230 Ga0207426_1003683 3300025302 Bacteria 8041
231 Ga0209051_1000205 3300025303 Bacteria 104781
232 Ga0209051_1000615 3300025303 Bacteria 41084
233 Ga0209051_1001961 3300025303 Bacteria 15832
234 Ga0209051_1014612 3300025303 Bacteria 3652
235 Ga0209051_1017763 3300025303 Bacteria 3169
236 Ga0209051_1021103 3300025303 Bacteria 2784
237 Ga0209051_1040687 3300025303 Bacteria 1662
238 Ga0209257_1002565 3300025304 Bacteria 17712
239 Ga0209257_1003359 3300025304 Bacteria 13832
240 Ga0209257_1006311 3300025304 Bacteria 7727
241 Ga0209257_1018915 3300025304 Bacteria 2622
242 Ga0207695_10000024 3300025913 Bacteria 632311
243 Ga0207671_10000176 3300025914 Bacteria 98289
244 Ga0207671_10090167 3300025914 Bacteria 2309
245 Ga0207657_10071363 3300025919 Bacteria 2941
246 Ga0207694_10157799 3300025924 Bacteria 1831
247 Ga0207650_10000681 3300025925 Bacteria 26706
248 Ga0207709_10133866 3300025935 Bacteria 1693
249 Ga0207668_10251948 3300025972 Bacteria 1434
250 Ga0207640_10054979 3300025981 Bacteria 2605
251 Ga0207658_10101377 3300025986 Bacteria 2256
252 Ga0207678_10038944 3300026067 Bacteria 4127
253 Ga0207674_10065563 3300026116 Bacteria 3660
254 Ga0207698_10270315 3300026142 Bacteria 1567
255 Ga0209281_1000155 3300027111 Bacteria 164423
256 Ga0209281_1000215 3300027111 Bacteria 126639
257 Ga0209281_1000253 3300027111 Bacteria 105600
258 Ga0209371_1000009 3300027312 Bacteria 963030
259 Ga0209371_1003770 3300027312 Bacteria 7067
260 Ga0209282_1000025 3300027666 Bacteria 168676
261 Ga0209282_1001877 3300027666 Bacteria 11838
262 Ga0209813_10021208 3300027866 Bacteria 1824
263 Ga0268266_10015167 3300028379 Bacteria 6616
264 Ga0268266_10038826 3300028379 Bacteria 4053
265 Ga0307515_10000154 3300028794 Bacteria 166582
266 Ga0307515_10008516 3300028794 Bacteria 19978
267 Ga0307515_10180960 3300028794 Bacteria 2058
268 Ga0268256_1000010 3300030500 Bacteria 963034
269 Ga0268256_1004527 3300030500 Bacteria 5739
270 Ga0268256_1012512 3300030500 Bacteria 2621
271 Ga0307513_10001432 3300031456 Bacteria 34296
272 Ga0307513_10069330 3300031456 Bacteria 3690
273 Ga0307513_10345605 3300031456 Bacteria 1237
274 Ga0307408_100138440 3300031548 Bacteria 1907
275 Ga0307408_100143758 3300031548 Bacteria 1875
276 Ga0307516_10254803 3300031730 Bacteria 1448
277 Ga0307405_10008416 3300031731 Bacteria 5228
278 Ga0307410_10023710 3300031852 Bacteria 3821
279 Ga0307406_10039073 3300031901 Bacteria 2942
280 Ga0307412_10002253 3300031911 Bacteria 10684
281 Ga0307412_10052489 3300031911 Bacteria 2700
282 Ga0315914_1000020 3300031967 Bacteria 121647
283 Ga0307416_100169679 3300032002 Bacteria 2029
284 Ga0307414_10264825 3300032004 Bacteria 1436
285 Ga0307414_10421069 3300032004 Bacteria 1165
286 Ga0307411_10511517 3300032005 Bacteria 1017
287 Ga0315913_1000013 3300033430 Bacteria 121559
288 Ga0315915_1000015 3300033464 Bacteria 168491
289 Ga0373935_0103526 3300035692 Bacteria 1880
290 Ga0373927_0000146 3300035695 Bacteria 55573
291 Ga0373925_0001219 3300037068 Bacteria 22707
292 Ga0395899_0000030 3300037312 Bacteria 329063
293 Ga0395900_0000023 3300037418 Bacteria 336048
294 Ga0395898_0000038 3300037466 Bacteria 329063
295 Ga0395905_0000021 3300037471 Bacteria 329054
296 Ga0395905_0000441 3300037471 Bacteria 58119
297 Ga0395901_0000018 3300038443 Bacteria 336048
298 Ga0439436_0009254 3300041404 Bacteria 3020
299 Ga0439439_0010106 3300041406 Bacteria 2254
300 Ga0439465_0012020 3300041413 Bacteria 2710
301 Ga0439465_0020674 3300041413 Bacteria 2062
302 Ga0439465_0054055 3300041413 Bacteria 1320
303 Ga0451833_1218183 3300041491 Bacteria 3735
304 Ga0451835_1152586 3300041492 Bacteria 2735
305 Ga0451839_0724193 3300041496 Bacteria 1177
306 Ga0451841_0360016 3300041498 Bacteria 1005
307 Ga0451841_0520367 3300041498 Bacteria 1370
308 Ga0451841_1428998 3300041498 Bacteria 1509
309 Ga0451849_1312558 3300041505 Bacteria 1122
310 Ga0451851_0563320 3300041507 Bacteria 1692
311 Ga0451851_0598238 3300041507 Bacteria 1314
312 Ga0439432_070680 3300042006 Bacteria 1065
313 Ga0439449_0004953 3300042007 Bacteria 5125
314 Ga0439449_0075717 3300042007 Bacteria 1240
315 Ga0450906_006099 3300042145 Bacteria 2445
316 Ga0450918_006966 3300042531 Bacteria 2009
317 Ga0495590_0012602 3300046457 Bacteria 3135
318 Ga0495591_032670 3300046458 Bacteria 1547
319 Ga0495638_0001179 3300046460 Bacteria 25086
320 Ga0495638_0009816 3300046460 Bacteria 6684
321 Ga0495638_0010606 3300046460 Bacteria 6383
322 Ga0495638_0018504 3300046460 Bacteria 4625
323 Ga0495651_0186530 3300046462 Bacteria 1463
324 Ga0495650_0014683 3300046471 Bacteria 4054
325 Ga0495605_0001233 3300046474 Bacteria 17043
326 Ga0495662_0006720 3300046476 Bacteria 5731
327 Ga0495585_0020929 3300046492 Bacteria 3758
328 Ga0495585_0051118 3300046492 Bacteria 2291
329 Ga0495607_0059975 3300046501 Bacteria 2167
330 Ga0495607_0142439 3300046501 Bacteria 1235
331 Ga0495583_0004185 3300046506 Bacteria 10509
332 Ga0495583_0049061 3300046506 Bacteria 1935
333 Ga0495606_0000762 3300046507 Bacteria 49554
334 Ga0495606_0064735 3300046507 Bacteria 2325
335 Ga0495606_0075425 3300046507 Bacteria 2110
336 Ga0495606_0137386 3300046507 Bacteria 1446
337 Ga0495610_0005850 3300046512 Bacteria 8636
338 Ga0495610_0067666 3300046512 Bacteria 1677
339 Ga0495610_0069765 3300046512 Bacteria 1644
340 Ga0495616_0066483 3300046513 Bacteria 1754
341 Ga0495620_0017389 3300046515 Bacteria 3585
342 Ga0495620_0026400 3300046515 Bacteria 2732
343 Ga0495620_0031963 3300046515 Bacteria 2404
344 Ga0495631_0001700 3300046518 Bacteria 13071
345 Ga0495632_0008591 3300046519 Bacteria 6242
346 Ga0495632_0030135 3300046519 Bacteria 2819
347 Ga0495643_0022226 3300046522 Bacteria 3622
348 Ga0495643_0062642 3300046522 Bacteria 1968
349 Ga0495648_0096178 3300046524 Bacteria 1646
350 Ga0495652_0276354 3300046529 Bacteria 1232
351 Ga0495654_0000436 3300046530 Bacteria 35437
352 Ga0495609_0060189 3300046538 Bacteria 1679
353 Ga0495633_0014552 3300046558 Bacteria 4108
354 Ga0495656_0026549 3300046615 Bacteria 2306
355 Ga0495668_0002936 3300046616 Bacteria 13453
356 Ga0495611_0052505 3300046648 Bacteria 1839
357 Ga0495611_0108663 3300046648 Bacteria 1290
358 Ga0495625_0001444 3300046660 Bacteria 28890
359 Ga0495625_0016487 3300046660 Bacteria 5812
360 Ga0495625_0028625 3300046660 Bacteria 4176
361 Ga0495625_0030420 3300046660 Bacteria 4029
362 Ga0495588_0003056 3300046674 Bacteria 7239
363 Ga0495670_0023133 3300046691 Bacteria 3069
364 Ga0495670_0047418 3300046691 Bacteria 2148
365 Ga0495671_0057389 3300046692 Bacteria 1927
366 Ga0495649_0089135 3300046694 Bacteria 1645
367 Ga0495649_0096704 3300046694 Bacteria 1571
368 Ga0495600_0006817 3300046809 Bacteria 6964
369 Ga0495604_0100341 3300047317 Bacteria 2128
370 Ga0495672_0119146 3300047320 Bacteria 1405
371 Ga0495683_0048068 3300047323 Bacteria 2140
372 Ga0495683_0182655 3300047323 Bacteria 957
373 Ga0495687_044169 3300047443 Bacteria 1939
374 Ga0495673_0033574 3300047469 Bacteria 2380
375 Ga0495681_0001172 3300047470 Bacteria 19925
376 Ga0495681_0056949 3300047470 Bacteria 1817
377 Ga0495681_0082805 3300047470 Bacteria 1429
378 Ga0495686_0004080 3300047472 Bacteria 12188
379 Ga0495686_0013054 3300047472 Bacteria 5784
380 Ga0495686_0023550 3300047472 Bacteria 4060
381 Ga0495686_0090043 3300047472 Bacteria 1864
382 Ga0495686_0162049 3300047472 Bacteria 1306
383 Ga0495626_0053411 3300048091 Bacteria 1860
384 Ga0496101_0289967 3300048904 Bacteria 1280
385 Ga0496106_0000912 3300048909 Bacteria 21488
386 Ga0496111_0020904 3300048914 Bacteria 4563
387 Ga0496112_0018703 3300048915 Bacteria 6530
388 Ga0496113_0287669 3300048916 Bacteria 1315
389 Ga0496115_0645132 3300048918 Bacteria 837
390 Ga0496116_0001841 3300048919 Bacteria 22929
391 Ga0496116_0002642 3300048919 Bacteria 18565
392 Ga0496116_0022408 3300048919 Bacteria 4733
393 Ga0496116_0026286 3300048919 Bacteria 4261
394 Ga0496116_0042101 3300048919 Bacteria 3126
395 Ga0496116_0182141 3300048919 Bacteria 1123
396 Ga0496117_0000002 3300048920 Bacteria 2483758
397 Ga0496117_0002297 3300048920 Bacteria 24621
398 Ga0496117_0006068 3300048920 Bacteria 12398
399 Ga0496117_0012864 3300048920 Bacteria 7338
400 Ga0496117_0039846 3300048920 Bacteria 3463
401 Ga0496117_0087175 3300048920 Bacteria 2024
402 Ga0496117_0171202 3300048920 Bacteria 1260
403 Ga0496118_0000233 3300048921 Bacteria 97731
404 Ga0496118_0001988 3300048921 Bacteria 29035
405 Ga0496118_0012608 3300048921 Bacteria 8090
406 Ga0496118_0055709 3300048921 Bacteria 2980
407 Ga0496118_0061022 3300048921 Bacteria 2795
408 Ga0496118_0063321 3300048921 Bacteria 2722
409 Ga0496119_0015134 3300048922 Bacteria 5970
410 Ga0496119_0022235 3300048922 Bacteria 4550
411 Ga0496119_0038975 3300048922 Bacteria 3060
412 Ga0496119_0119548 3300048922 Bacteria 1450
413 Ga0496120_0000021 3300048923 Bacteria 250966
414 Ga0496120_0023198 3300048923 Bacteria 3887
415 Ga0496120_0031345 3300048923 Bacteria 3220
416 Ga0496120_0076177 3300048923 Bacteria 1829
417 Ga0496121_0000001 3300048924 Bacteria 1830318
418 Ga0496121_0000459 3300048924 Bacteria 80085
419 Ga0496121_0003778 3300048924 Bacteria 21151
420 Ga0496121_0009317 3300048924 Bacteria 11323
421 Ga0496121_0012314 3300048924 Bacteria 9354
422 Ga0496121_0039218 3300048924 Bacteria 4179
423 Ga0496121_0046638 3300048924 Bacteria 3707
424 Ga0496121_0117897 3300048924 Bacteria 2010
425 Ga0496121_0334802 3300048924 Bacteria 1014
426 Ga0496122_0000001 3300048925 Bacteria 1827766
427 Ga0496122_0000009 3300048925 Bacteria 584024
428 Ga0496122_0000247 3300048925 Bacteria 121291
429 Ga0496122_0007204 3300048925 Bacteria 12452
430 Ga0496122_0014899 3300048925 Bacteria 7484
431 Ga0496122_0023470 3300048925 Bacteria 5436
432 Ga0496122_0027734 3300048925 Bacteria 4831
433 Ga0496122_0030322 3300048925 Bacteria 4534
434 Ga0496122_0078927 3300048925 Bacteria 2303
435 Ga0496122_0083673 3300048925 Bacteria 2211
436 Ga0496122_0211715 3300048925 Bacteria 1122
437 Ga0496123_0000001 3300048926 Bacteria 1831497
438 Ga0496123_0000020 3300048926 Bacteria 388748
439 Ga0496123_0000222 3300048926 Bacteria 115482
440 Ga0496123_0006783 3300048926 Bacteria 11002
441 Ga0496123_0017248 3300048926 Bacteria 5820
442 Ga0496123_0028989 3300048926 Bacteria 4086
443 Ga0496123_0031989 3300048926 Bacteria 3818
444 Ga0496123_0036397 3300048926 Bacteria 3492
445 Ga0496123_0073079 3300048926 Bacteria 2129
446 Ga0496123_0156585 3300048926 Bacteria 1220
447 Ga0496124_0000262 3300048927 Bacteria 101572
448 Ga0496124_0000592 3300048927 Bacteria 61048
449 Ga0496124_0002069 3300048927 Bacteria 27175
450 Ga0496124_0004006 3300048927 Bacteria 17528
451 Ga0496124_0020386 3300048927 Bacteria 6127
452 Ga0496124_0042181 3300048927 Bacteria 3931
453 Ga0496124_0046415 3300048927 Bacteria 3719
454 Ga0496124_0110214 3300048927 Bacteria 2216
455 Ga0496124_0122746 3300048927 Bacteria 2073
456 Ga0496124_0216017 3300048927 Bacteria 1446
457 Ga0496124_0473442 3300048927 Bacteria 848
458 Ga0496125_0000001 3300048928 Bacteria 1766138
459 Ga0496125_0000557 3300048928 Bacteria 64217
460 Ga0496125_0002964 3300048928 Bacteria 21337
461 Ga0496125_0016086 3300048928 Bacteria 7201
462 Ga0496125_0028713 3300048928 Bacteria 5016
463 Ga0496125_0053506 3300048928 Bacteria 3308
464 Ga0496126_0000438 3300048929 Bacteria 83060
465 Ga0496126_0000747 3300048929 Bacteria 58936
466 Ga0496126_0095418 3300048929 Bacteria 2609
467 Ga0496126_0304894 3300048929 Bacteria 1312
468 Ga0501031_0088875 3300049568 Bacteria 2014
469 Ga0501032_0000060 3300049569 Bacteria 95279
470 Ga0501033_0000171 3300049570 Bacteria 61888
471 Ga0501033_0000490 3300049570 Bacteria 37274
472 Ga0501033_0026133 3300049570 Bacteria 4394
473 Ga0501034_0000262 3300049571 Bacteria 95293
474 Ga0501034_0019677 3300049571 Bacteria 6902
475 Ga0501034_0020260 3300049571 Bacteria 6792
476 Ga0501034_0192430 3300049571 Bacteria 2001
477 Ga0501034_0197244 3300049571 Bacteria 1972
478 Ga0501034_0349017 3300049571 Bacteria 1408
479 Ga0501036_0002418 3300049572 Bacteria 14607
480 Ga0501037_0000950 3300049573 Bacteria 21540
481 Ga0501037_0196563 3300049573 Bacteria 1426
482 Ga0501037_0264506 3300049573 Bacteria 1201
483 Ga0501038_0000051 3300049574 Bacteria 95293
484 Ga0501039_0000051 3300049575 Bacteria 95293
485 Ga0501043_0000288 3300049579 Bacteria 45317
486 Ga0501043_0042688 3300049579 Bacteria 3564
487 Ga0501046_0019962 3300049580 Bacteria 5548
488 Ga0501047_0090915 3300049581 Bacteria 2930
489 Ga0501047_0163482 3300049581 Bacteria 2097
490 Ga0501047_0417222 3300049581 Bacteria 1174
491 Ga0501047_0445687 3300049581 Bacteria 1124
492 Ga0501048_0198556 3300049582 Bacteria 1422
493 Ga0501080_0240007 3300049742 Bacteria 1654
494 Ga0501083_0052869 3300049744 Bacteria 2727
495 Ga0501083_0172225 3300049744 Bacteria 1415
496 Ga0501280_003130 3300049776 Bacteria 2592
497 Ga0501035_0000119 3300049822 Bacteria 95271
498 Ga0501035_0000841 3300049822 Bacteria 32800
499 Ga0501035_0114499 3300049822 Bacteria 2361
500 Ga0501035_0249760 3300049822 Bacteria 1507
501 Ga0501044_0017596 3300049823 Bacteria 7666
502 Ga0501044_0291124 3300049823 Bacteria 1564
503 Ga0501044_0493424 3300049823 Bacteria 1126
504 Ga0501045_0210774 3300049824 Bacteria 1447
505 nmdc:mga03683_15312_c1 3300050489 Bacteria 2860
506 nmdc:mga03683_39022_c1 3300050489 Bacteria 1942
507 nmdc:mga03683_75287_c1 3300050489 Bacteria 1449
508 nmdc:mga03n38_42062_c1 3300050490 Bacteria 1995
509 nmdc:mga03n38_7503_c1 3300050490 Bacteria 3863
510 nmdc:mga00v17_31958_c1 3300050491 Bacteria 3108
511 nmdc:mga00v17_7173_c1 3300050491 Bacteria 5938
512 nmdc:mga00v17_91675_c1 3300050491 Bacteria 1909
513 nmdc:mga00v17_92_c1 3300050491 Bacteria 53037
514 nmdc:mga0yw44_126834_c1 3300050492 Bacteria 1649
515 nmdc:mga0yw44_133573_c1 3300050492 Bacteria 1608
516 nmdc:mga0yw44_4716_c1 3300050492 Bacteria 6309
517 nmdc:mga0yw44_50749_c1 3300050492 Bacteria 2510
518 nmdc:mga0yw44_54089_c1 3300050492 Bacteria 2439
519 nmdc:mga0k408_81905_c1 3300050493 Bacteria 1890
520 nmdc:mga06z11_162269_c1 3300050494 Bacteria 1278
521 nmdc:mga04h51_25351_c1 3300050495 Bacteria 1824
522 nmdc:mga04h51_39125_c1 3300050495 Bacteria 1539
523 nmdc:mga07m45_137405_c1 3300050496 Bacteria 1415
524 nmdc:mga07m45_138240_c1 3300050496 Bacteria 1411
525 nmdc:mga0sz30_109534_c1 3300050516 Bacteria 1210
526 nmdc:mga0sz30_4178_c1 3300050516 Bacteria 5203
527 nmdc:mga0sz30_51477_c1 3300050516 Bacteria 1747
528 Ga0495601_0083631 3300053077 Bacteria 2050
529 Ga0500610_0014244 3300053079 Bacteria 3725
530 Ga0500578_0093503 3300053086 Bacteria 1907
531 Ga0500644_0005233 3300053088 Bacteria 3267
532 Ga0500557_001655 3300053105 Bacteria 3756
533 Ga0500560_000887 3300053107 Bacteria 4687
534 Ga0500560_010826 3300053107 Bacteria 2301
535 Ga0500569_000978 3300053109 Bacteria 5148
536 Ga0500569_096445 3300053109 Bacteria 964
537 Ga0500572_008017 3300053111 Bacteria 2458
538 Ga0500594_0003405 3300053118 Bacteria 3489
539 Ga0500608_024673 3300053122 Bacteria 2809
540 Ga0500618_000132 3300053125 Bacteria 62415
541 Ga0500618_003524 3300053125 Bacteria 5331
542 Ga0500618_005292 3300053125 Bacteria 3954
543 Ga0500658_0000774 3300053134 Bacteria 13187
544 Ga0500568_0011657 3300053139 Bacteria 4066
545 Ga0500573_0016700 3300053140 Bacteria 4169
546 Ga0500590_000811 3300053148 Bacteria 11687
547 Ga0500604_0012475 3300053151 Bacteria 2294
548 Ga0500616_0003108 3300053153 Bacteria 12998
549 Ga0500616_0020526 3300053153 Bacteria 3709
550 Ga0500620_000159 3300053155 Bacteria 13636
551 Ga0500622_0000342 3300053156 Bacteria 45708
552 Ga0500622_0003075 3300053156 Bacteria 11504
553 Ga0500624_000370 3300053157 Bacteria 14500
554 Ga0500633_0010989 3300053160 Bacteria 2444
555 Ga0500634_0009996 3300053161 Bacteria 4830
556 Ga0500636_0000023 3300053177 Bacteria 89900
557 Ga0500636_0001609 3300053177 Bacteria 12311
558 Ga0501082_0201735 3300060353 Bacteria 1730
559 2503203725 2503198000 Bacteria 6884444
560 2509107232 2508501122 Bacteria 6292184
561 2509113913 2508501123 Bacteria 6283661
562 2509141050 2508501127 Bacteria 7037543
563 2509374802 2509276019 Bacteria 6802256
564 2509388273 2509276021 Bacteria 7634384
565 2509398089 2509276022 Bacteria 6200534
566 2509443840 2509276033 Bacteria 7180565
567 2509444841 2509276033 Bacteria 7180565
568 2510131628 2510065019 Bacteria 6903379
569 2510304932 2510065057 Bacteria 6649661
570 2510316663 2510065059 Bacteria 6847884
571 2510839894 2510461069 Bacteria 5505000
572 2510893080 2510461076 Bacteria 8618824
573 2510897921 2510461076 Bacteria 8618824
574 2511134532 2510917022 Bacteria 6504556
575 2511174866 2510917026 Bacteria 7046020
576 2511194475 2510917030 Bacteria 7460662
577 2511500722 2511231052 Bacteria 6974333
578 2512532140 2512047086 Bacteria 6850303
579 2512929464 2512875016 Bacteria 6529530
580 2512964256 2512875024 Bacteria 7195110
581 2512972526 2512875026 Bacteria 6861065
582 2513571206 2513237084 Bacteria 7231967
583 2513579254 2513237085 Bacteria 7695351
584 2513585714 2513237086 Bacteria 7265287
585 2513598514 2513237088 Bacteria 6927906
586 2513605548 2513237089 Bacteria 6553624
587 2513616785 2513237091 Bacteria 6900273
588 2513632300 2513237093 Bacteria 7545552
589 2513711626 2513237103 Bacteria 7647401
590 2513866335 2513237138 Bacteria 7368160
591 2513880801 2513237140 Bacteria 7076289
592 2513903795 2513237143 Bacteria 6664116
593 2513907951 2513237144 Bacteria 7530820
594 2513927608 2513237146 Bacteria 7166346
595 2513986105 2513237156 Bacteria 6402557
596 2513999889 2513237159 Bacteria 6810126
597 2514007522 2513237160 Bacteria 6650282
598 2514020873 2513237162 Bacteria 7468464
599 2514033994 2513237164 Bacteria 7563725
600 2514418876 2513237305 Bacteria 7293571
601 2515110550 2515075009 Bacteria 7288508
602 2515607855 2515154107 Bacteria 6795637
603 2515639012 2515154113 Bacteria 7807172
604 2515645255 2515154114 Bacteria 7848616
605 2515659468 2515154116 Bacteria 7552979
606 2515742944 2515154134 Bacteria 7220242
607 2516208596 2516143018 Bacteria 6951533
608 2516891997 2516653046 Bacteria 6989037
609 2517039251 2516653077 Bacteria 7555578
610 2517079495 2516653085 Bacteria 7346596
611 2517093441 2517093000 Bacteria 7412387
612 2517405140 2517287029 Bacteria 6905599
613 2517411526 2517287029 Bacteria 6905599
614 2517568810 2517487022 Bacteria 7227575
615 2520376689 2519899620 Bacteria 6499161
616 2524450048 2524023207 Bacteria 6813453
617 2524457648 2524023209 Bacteria 6679728
618 2530647658 2529292951 Bacteria 6916614
619 2535515231 2534681796 Bacteria 7146037
620 2537872859 2537561587 Bacteria 5425293
621 2551675937 2551306084 Bacteria 8942552
622 2551686887 2551306085 Bacteria 7347181
623 2551695249 2551306086 Bacteria 6843938
624 2551699047 2551306087 Bacteria 7351905
625 2551708766 2551306089 Bacteria 7162724
626 2551717569 2551306090 Bacteria 7953713
627 2551725979 2551306091 Bacteria 7086830
628 2551733348 2551306092 Bacteria 6992595
629 2551741729 2551306093 Bacteria 7064773
630 2554246662 2554235003 Bacteria 5877155
631 2558863794 2558860100 Bacteria 8458965
632 2559293890 2558860242 Bacteria 5568029
633 2561467309 2558860983 Bacteria 4133860
634 2585165150 2582581283 Bacteria 6030556
635 2585204007 2582581294 Bacteria 6626667
636 2585225729 2582581298 Bacteria 7315509
637 2585229122 2582581299 Bacteria 6518058
638 2585257064 2582581304 Bacteria 5831370
639 2585266638 2582581306 Bacteria 6450535
640 2585275306 2582581307 Bacteria 6597605
641 2585281949 2582581308 Bacteria 7413247
642 2585325848 2582581315 Bacteria 7318924
643 2585330019 2582581316 Bacteria 7774528
644 2585387654 2582581865 Bacteria 6644329
645 2585394248 2582581866 Bacteria 6859583
646 2585398414 2582581867 Bacteria 7184437
647 2585528447 2585427526 Bacteria 7258840
648 2585536447 2585427527 Bacteria 7273426
649 2585539840 2585427528 Bacteria 6842387
650 2585547996 2585427529 Bacteria 7395659
651 2585556882 2585427530 Bacteria 7383882
652 2585560251 2585427531 Bacteria 6992870
653 2585819439 2585427590 Bacteria 6824633
654 2585837821 2585427593 Bacteria 7141551
655 2585844507 2585427594 Bacteria 6180594
656 2585905567 2585427609 Bacteria 6667127
657 2585994605 2585427633 Bacteria 6413184
658 2585999093 2585427634 Bacteria 6455027
659 2587979317 2585428125 Bacteria 6662905
660 2588515040 2588253730 Bacteria 6881675
661 2597815758 2597489875 Bacteria 7010078
662 2599333176 2599185156 Bacteria 5403036
663 2599419039 2599185170 Bacteria 7295545
664 2599605441 2599185210 Bacteria 5624189
665 2599719425 2599185236 Bacteria 6875203
666 2599938598 2599185301 Bacteria 6161860
667 2600191596 2599185352 Bacteria 7228948
668 2600374841 2600254933 Bacteria 4750527
669 2601609135 2600255279 Bacteria 5605316
670 2601745910 2600255308 Bacteria 5611129
671 2616295812 2615840624 Bacteria 6557588
672 2616306192 2615840626 Bacteria 7921970
673 2617382603 2617270742 Bacteria 6808054
674 2643773986 2643221550 Bacteria 4619371
675 2643774653 2643221551 Bacteria 3750538
676 2643793098 2643221555 Bacteria 3749717
677 2643807553 2643221557 Bacteria 7184309
678 2643810420 2643221558 Bacteria 5460675
679 2643838469 2643221564 Bacteria 4193379
680 2643856241 2643221568 Bacteria 5187270
681 2643921123 2643221582 Bacteria 5804683
682 2643989189 2643221595 Bacteria 6565519
683 2644007480 2643221599 Bacteria 6292121
684 2644046993 2643221607 Bacteria 6314006
685 2644069964 2643221610 Bacteria 7480339
686 2644103044 2643221618 Bacteria 7717186
687 2644132618 2643221623 Bacteria 5239945
688 2644152027 2643221626 Bacteria 8069654
689 2644152386 2643221627 Bacteria 6761570
690 2644190734 2643221634 Bacteria 6705461
691 2644203568 2643221636 Bacteria 6583769
692 2644206554 2643221637 Bacteria 5345260
693 2644241414 2643221643 Bacteria 5749658
694 2644297429 2643221653 Bacteria 4569637
695 2644305971 2643221655 Bacteria 7722067
696 2644330273 2643221659 Bacteria 7890716
697 2644380936 2643221668 Bacteria 7306521
698 2644414841 2643221675 Bacteria 7473456
699 2644448498 2643221680 Bacteria 7473610
700 2644479782 2643221686 Bacteria 6310811
701 2644493721 2643221688 Bacteria 5260751
702 2644497318 2643221689 Bacteria 6042950
703 2644519196 2643221693 Bacteria 5513853
704 2644542974 2643221698 Bacteria 7756764
705 2644619078 2643221712 Bacteria 7729434
706 2644650201 2643221718 Bacteria 5345506
707 2644655682 2643221719 Bacteria 4568197
708 2644673891 2643221723 Bacteria 7095460
709 2644689195 2643221726 Bacteria 7455827
710 2657682029 2657244999 Bacteria 5946535
711 2671112500 2667528174 Bacteria 6435400
712 2688600487 2687453392 Bacteria 6880454
713 2692317115 2690316117 Bacteria 6800650
714 2719179708 2718217882 Bacteria 6556348
715 2719384321 2718217927 Bacteria 6972593
716 2719664058 2718217997 Bacteria 6740740
717 2719730378 2718218009 Bacteria 6478651
718 2720490477 2718218199 Bacteria 6740745
719 2720611858 2718218232 Bacteria 6720332
720 2720618712 2718218233 Bacteria 6662049
721 2720630112 2718218235 Bacteria 6630699
722 2720773807 2718218269 Bacteria 6906114
723 2721145801 2718218363 Bacteria 6524337
724 2721157334 2718218365 Bacteria 6274507
725 2721162680 2718218366 Bacteria 6425255
726 2721398035 2718218423 Bacteria 6438183
727 2722838850 2721755514 Bacteria 6424414
728 2723025477 2721755556 Bacteria 6745503
729 2723559060 2721755684 Bacteria 6859907
730 2723565667 2721755685 Bacteria 6704835
731 2723577763 2721755686 Bacteria 7343952
732 2724036845 2721755809 Bacteria 6438790
733 2724043134 2721755810 Bacteria 6479005
734 2724088414 2721755819 Bacteria 6906405
735 2724102932 2721755822 Bacteria 6726041
736 2724108795 2721755823 Bacteria 6752556
737 2725950098 2724679232 Bacteria 7646494
738 2730106413 2728369352 Bacteria 6745171
739 2730162945 2728369365 Bacteria 6555560
740 2730296966 2728369397 Bacteria 6274511
741 2738803692 2738541293 Bacteria 7065685
742 2738945728 2738541317 Bacteria 5340176
743 2739034697 2738541333 Bacteria 7106503
744 2739308696 2738543024 Bacteria 5603683
745 2756672955 2756170246 Bacteria 7451806
746 2766065555 2765235942 Bacteria 7445910
747 2766067059 2765235942 Bacteria 7445910
748 2776912285 2775507049 Bacteria 6284736
749 2778174301 2775507266 Bacteria 7392367
750 2792583880 2791355082 Bacteria 5973319
751 2792622318 2791355091 Bacteria 6135441
752 2792628116 2791355092 Bacteria 6248105
753 2792638627 2791355094 Bacteria 7011481
754 2792753068 2791355123 Bacteria 8049106
755 2793281917 2791355253 Bacteria 5171699
756 2793295073 2791355256 Bacteria 6798008
757 2793315282 2791355259 Bacteria 7254731
758 2793320142 2791355260 Bacteria 6598818
759 2793328231 2791355261 Bacteria 6661293
760 2793332573 2791355262 Bacteria 6774204
761 2793343189 2791355263 Bacteria 6872478
762 2793350724 2791355264 Bacteria 6429314
763 2793353241 2791355265 Bacteria 6539969
764 2793361035 2791355266 Bacteria 7116587
765 2793364824 2791355267 Bacteria 7222458
766 2802717452 2802428858 Bacteria 6636079
767 2802723620 2802428859 Bacteria 6667919
768 2802730931 2802428860 Bacteria 6525526
769 2802735937 2802428861 Bacteria 6534206
770 2802743854 2802428862 Bacteria 6633353
771 2802752929 2802428863 Bacteria 6410669
772 2804751047 2802429268 Bacteria 6094027
773 2805927440 2802429605 Bacteria 6875453
774 2805936477 2802429606 Bacteria 6346811
775 2806043996 2802429633 Bacteria 7341974
776 2806052186 2802429634 Bacteria 7083200
777 2806058487 2802429635 Bacteria 7650140
778 2806066985 2802429636 Bacteria 7597525
779 2806074728 2802429637 Bacteria 7067217
780 2808986334 2808606387 Bacteria 5697198
781 2819243090 2818991272 Bacteria 4622173
782 2819556466 2818991439 Bacteria 6907412
783 2819643461 2818991453 Bacteria 7181617
784 2819684578 2818991461 Bacteria 7026071
785 2821123769 2821123053 Bacteria 7836056
786 2838022091 2838016132 Bacteria 6577831
787 2838028982 2838022645 Bacteria 6494267
788 2838029162 2838029111 Bacteria 6603031
789 2838037274 2838035591 Bacteria 7166484
790 2838047240 2838042994 Bacteria 6046894
791 2838053949 2838048938 Bacteria 6044578
792 2838066720 2838061910 Bacteria 6794874
793 2838073777 2838068647 Bacteria 6208656
794 2838075510 2838074704 Bacteria 6785777
795 2838663538 2838661181 Bacteria 7385261
796 2838673207 2838668709 Bacteria 6671819
797 2838677195 2838675328 Bacteria 4909118
798 2838680739 2838680041 Bacteria 6545511
799 2838692601 2838686498 Bacteria 7807632
800 2838695228 2838694306 Bacteria 6853137
801 2838704009 2838701080 Bacteria 6669771
802 2838708604 2838707686 Bacteria 6619912
803 2838716083 2838714209 Bacteria 5525906
804 2838720117 2838719591 Bacteria 5523910
805 2838726835 2838724970 Bacteria 4908691
806 2838732673 2838729681 Bacteria 7400765
807 2838739201 2838736955 Bacteria 5760694
808 2838745568 2838742623 Bacteria 7396178
809 2841735138 2841734538 Bacteria 6784580
810 2841843099 2841840854 Bacteria 5761912
811 2841847051 2841846520 Bacteria 5345850
812 2841855212 2841851746 Bacteria 7532261
813 2841860420 2841859092 Bacteria 5436171
814 2841866663 2841864319 Bacteria 6742987
815 2842080161 2842077413 Bacteria 6508645
816 2842112353 2842110456 Bacteria 7656360
817 2842120781 2842118031 Bacteria 7033875
818 2842126920 2842124991 Bacteria 5346824
819 2842132088 2842130223 Bacteria 4909145
820 2842142881 2842140634 Bacteria 5759631
821 2842148199 2842146304 Bacteria 5957337
822 2842152743 2842152218 Bacteria 4908957
823 2842161758 2842156927 Bacteria 6894975
824 2842170157 2842163707 Bacteria 6916235
825 2842172328 2842170452 Bacteria 5525737
826 2842176362 2842175837 Bacteria 4908771
827 2842185375 2842180545 Bacteria 6888678
828 2842189190 2842187318 Bacteria 5524014
829 2842193048 2842192696 Bacteria 6147454
830 2842205089 2842198810 Bacteria 6608673
831 2842206790 2842205361 Bacteria 6340321
832 2842213504 2842211629 Bacteria 5523832
833 2842218645 2842217011 Bacteria 7497767
834 2842224878 2842224351 Bacteria 5524473
835 2842233313 2842229732 Bacteria 7475766
836 2842238016 2842237096 Bacteria 6620661
837 2842248683 2842243621 Bacteria 7421798
838 2842253265 2842250916 Bacteria 6579627
839 2842261826 2842257432 Bacteria 7401195
840 2842267300 2842264693 Bacteria 6472963
841 2842277110 2842271015 Bacteria 7807131
842 2842280517 2842278818 Bacteria 6340002
843 2842289468 2842285085 Bacteria 6011953
844 2842293821 2842291075 Bacteria 7076806
845 2842300737 2842298080 Bacteria 6123127
846 2842306332 2842304105 Bacteria 7023636
847 2842312479 2842311132 Bacteria 6616990
848 2842322370 2842317721 Bacteria 6793725
849 2842342927 2842341865 Bacteria 7003929
850 2842358144 2842357229 Bacteria 6485165
851 2842369914 2842363717 Bacteria 6844742
852 2842371202 2842370503 Bacteria 7038661
853 2842380217 2842377471 Bacteria 7140707
854 2842387289 2842384541 Bacteria 7057858
855 2842400708 2842395702 Bacteria 6780583
856 2842406816 2842402390 Bacteria 6681310
857 2842413687 2842409023 Bacteria 6687331
858 2842420350 2842415677 Bacteria 6596907
859 2842427225 2842422224 Bacteria 6239196
860 2842431448 2842428310 Bacteria 6767288
861 2842437783 2842434925 Bacteria 6502746
862 2842444598 2842441272 Bacteria 6769273
863 2842450351 2842447887 Bacteria 6754142
864 2842465574 2842462802 Bacteria 6588055
865 2842472384 2842469257 Bacteria 6752936
866 2842476408 2842475841 Bacteria 6603183
867 2842495045 2842489311 Bacteria 6620893
868 2842500954 2842495871 Bacteria 6820686
869 2842502690 2842502639 Bacteria 6604161
870 2842509338 2842509118 Bacteria 6850950
871 2842517205 2842515876 Bacteria 5436280
872 2842526462 2842521101 Bacteria 6569494
873 2842923479 2842922631 Bacteria 5824079
874 2844005415 2844002411 Bacteria 7168230
875 2844015812 2844009547 Bacteria 6728125
876 2844170603 2844163670 Bacteria 7266046
877 2844455827 2844454524 Bacteria 7952546
878 2847417816 2847417321 Bacteria 6913799
879 2848992659 2848992105 Bacteria 6810864
880 2850080168 2850079185 Bacteria 6848280
881 2852388634 2852387548 Bacteria 8025568
882 2854898411 2854896431 Bacteria 5869725
883 2854919126 2854916844 Bacteria 5725939
884 2855831917 2855825444 Bacteria 6785811
885 2855840201 2855839649 Bacteria 7135830
886 2855873211 2855872281 Bacteria 6964271
887 2856330388 2856328259 Bacteria 6528202
888 2856336810 2856334872 Bacteria 7037011
889 2856343400 2856342000 Bacteria 7176905
890 2856365306 2856364286 Bacteria 6939991
891 2857354736 2857349434 Bacteria 7926032
892 2857369904 2857367948 Bacteria 6965560
893 2857522235 2857516855 Bacteria 7787325
894 2857531331 2857531043 Bacteria 6754041
895 2858804108 2858800743 Bacteria 6603254
896 2869167082 2869162929 Bacteria 6399702
897 2869176509 2869169390 Bacteria 6659796
898 2869238187 2869234852 Bacteria 6654993
899 2869248904 2869242130 Bacteria 6609239
900 2869255225 2869249662 Bacteria 6868783
901 2869263112 2869256925 Bacteria 6981691
902 2869269797 2869264136 Bacteria 6880765
903 2869271925 2869271264 Bacteria 6908218
904 2869280317 2869278585 Bacteria 7077053
905 2869289217 2869285874 Bacteria 6901219
906 2871431285 2871429161 Bacteria 6547891
907 2871437304 2871435913 Bacteria 6880295
908 2871453233 2871451962 Bacteria 7336357
909 2871464237 2871459585 Bacteria 6866887
910 2871471240 2871466892 Bacteria 6923287
911 2871474805 2871474448 Bacteria 6806570
912 2871481903 2871481445 Bacteria 6700002
913 2874120338 2874116593 Bacteria 6674494
914 2874133241 2874131515 Bacteria 6820270
915 2874144426 2874139085 Bacteria 7021506
916 2874148484 2874146452 Bacteria 7533118
917 2874156228 2874155637 Bacteria 6724144
918 2874167002 2874162495 Bacteria 6174670
919 2874173734 2874168670 Bacteria 8062617
920 2876366977 2876363079 Bacteria 6544991
921 2876389042 2876386047 Bacteria 6698674
922 2876398952 2876392853 Bacteria 6660880
923 2876406814 2876399893 Bacteria 6927900
924 2876413478 2876406927 Bacteria 6191900
925 2876415263 2876413966 Bacteria 6831344
926 2876425467 2876420981 Bacteria 6687741
927 2878736473 2878730984 Bacteria 6380721
928 2878744199 2878738818 Bacteria 7136951
929 2878747889 2878745973 Bacteria 6867388
930 2878778202 2878774303 Bacteria 6108671
931 2878788181 2878781027 Bacteria 6834456
932 2878792427 2878788777 Bacteria 6567085
933 2881163168 2881161766 Bacteria 7127907
934 2882639972 2882632389 Bacteria 8154593
935 2885315797 2885312484 Bacteria 6415165
936 2888341862 2888337043 Bacteria 6629336
937 2888349148 2888343758 Bacteria 6611049
938 2888351103 2888350351 Bacteria 7372807
939 2889013492 2889010040 Bacteria 6749192
940 2889021790 2889016732 Bacteria 6700763
941 2891376294 2891373044 Bacteria 5202277
942 2896385396 2896384573 Bacteria 7700774
943 2899792485 2899792073 Bacteria 4926588
944 2899804344 2899803654 Bacteria 5577784
945 2899847925 2899845264 Bacteria 5672268
946 2903453555 2903448605 Bacteria 7357801
947 2903505889 2903492973 Bacteria 13473544
948 2903524844 2903521522 Bacteria 6525694
949 2903530913 2903528002 Bacteria 6586099
950 2904665484 2904659560 Bacteria 6685615
951 2906311507 2906308376 Bacteria 6841989
952 2906323247 2906321335 Bacteria 6579571
953 2906354638 2906354277 Bacteria 6991324
954 2906369628 2906363423 Bacteria 6856682
955 2906371819 2906370794 Bacteria 6881062
956 2906385195 2906378014 Bacteria 6911440
957 2906388788 2906386501 Bacteria 5977019
958 2906400704 2906393657 Bacteria 6790866
959 2906405491 2906401398 Bacteria 6693206
960 2906413271 2906408224 Bacteria 6162342
961 2906429620 2906427513 Bacteria 6375796
962 2913310590 2913308742 Bacteria 5350706
963 2915982288 2915980308 Bacteria 6624279
964 2915991434 2915986958 Bacteria 6739310
965 2915995772 2915993759 Bacteria 7016183
966 2916006839 2916000859 Bacteria 6865702
967 2916010990 2916007675 Bacteria 6898660
968 2916021035 2916014648 Bacteria 6946486
969 2916024628 2916021584 Bacteria 6854472
970 2916032661 2916028427 Bacteria 6748433
971 2916036072 2916035215 Bacteria 6755766
972 2916045933 2916041962 Bacteria 6820487
973 2916051603 2916048683 Bacteria 6543552
974 2916059375 2916055098 Bacteria 6758838
975 2916062624 2916061851 Bacteria 6737736
976 2916071366 2916068649 Bacteria 6943657
977 2916081935 2916076590 Bacteria 6596108
978 2919101206 2919100787 Bacteria 7710546
979 2919116286 2919114240 Bacteria 5700270
980 2919166993 2919166419 Bacteria 4952238
981 2919171937 2919171160 Bacteria 6499771
982 2919408933 2919408235 Bacteria 6149349
983 2920763186 2920760137 Bacteria 7427611
984 2920823517 2920822456 Bacteria 6897201
985 2921204135 2921201388 Bacteria 6926299
986 2921213141 2921208531 Bacteria 6745326
987 2921239227 2921237296 Bacteria 6876710
988 2921247580 2921244191 Bacteria 6568419
989 2921250715 2921250672 Bacteria 6677771
990 2921261913 2921257292 Bacteria 6808382
991 2921268357 2921263974 Bacteria 6864552
992 2921286951 2921282425 Bacteria 6826397
993 2921291217 2921289301 Bacteria 7316391
994 2921301003 2921296804 Bacteria 7176999
995 2922137865 2922130491 Bacteria 7173936
996 2922155126 2922151315 Bacteria 6902399
997 2922177155 2922172374 Bacteria 6167644
998 2922182954 2922178524 Bacteria 6025201
999 2922194134 2922185730 Bacteria 7113964
1000 2923557331 2923556063 Bacteria 6793593
1001 2924149256 2924144063 Bacteria 6883928
1002 2924155781 2924150972 Bacteria 7169444
1003 2924161393 2924158325 Bacteria 7188855
1004 2924169589 2924165586 Bacteria 7260590
1005 2924177038 2924172951 Bacteria 6749356
1006 2924184700 2924179722 Bacteria 6843264
1007 2924190561 2924186466 Bacteria 6876637
1008 2924198300 2924193448 Bacteria 6955718
1009 2924205051 2924200457 Bacteria 6757188
1010 2924211916 2924207177 Bacteria 6917007
1011 2924218657 2924214083 Bacteria 7080103
1012 2924225483 2924221636 Bacteria 7113495
1013 2924234128 2924228884 Bacteria 6633132
1014 2924722512 2924718760 Bacteria 6331356
1015 2924738659 2924733363 Bacteria 7574837
1016 2924745935 2924741084 Bacteria 6661321
1017 2924752515 2924748358 Bacteria 6154725
1018 2924756520 2924754689 Bacteria 6774424
1019 2924766163 2924762789 Bacteria 6561353
1020 2924782116 2924776078 Bacteria 7492003
1021 2926757240 2926754445 Bacteria 5964435
1022 2926761454 2926760298 Bacteria 5505990
1023 2933007388 2933006813 Bacteria 4912075
1024 2933012152 2933011516 Bacteria 5439334
1025 2933019822 2933016740 Bacteria 6355406
1026 2933573401 2933570622 Bacteria 7023390
1027 2933587682 2933586486 Bacteria 7667493
1028 2933594600 2933594066 Bacteria 5594265
1029 2933604205 2933599457 Bacteria 5858799
1030 2935895751 2935894831 Bacteria 6620579
1031 2935907796 2935901341 Bacteria 7341747
1032 2936368774 2936367885 Bacteria 7324495
1033 2936377148 2936375103 Bacteria 6652732
1034 2936387317 2936381700 Bacteria 7006523
1035 2936999324 2936996657 Bacteria 6298727
1036 2937008076 2937002841 Bacteria 6934057
1037 2937014543 2937009748 Bacteria 6746052
1038 2937021470 2937016420 Bacteria 6782579
1039 2937026845 2937023124 Bacteria 6815156
1040 2937030108 2937029754 Bacteria 6424026
1041 2937037900 2937036028 Bacteria 6846469
1042 2937048910 2937042894 Bacteria 6741576
1043 2937053768 2937049772 Bacteria 6757901
1044 2937060940 2937056579 Bacteria 7107896
1045 2937070357 2937063883 Bacteria 7199456
1046 2937076482 2937071275 Bacteria 6984483
1047 2937080183 2937078374 Bacteria 6610289
1048 2937090472 2937084907 Bacteria 6618516
1049 2937094671 2937091812 Bacteria 6979387
1050 2937102078 2937098957 Bacteria 7249374
1051 2937109608 2937106411 Bacteria 6947143
1052 2937116977 2937113482 Bacteria 6505872
1053 2937124306 2937119839 Bacteria 6597547
1054 2937131235 2937126314 Bacteria 6771275
1055 2937818672 2937813078 Bacteria 7783518
1056 2937828548 2937822353 Bacteria 7290551
1057 2937840354 2937836603 Bacteria 6811263
1058 2937850509 2937848649 Bacteria 6983481
1059 2937867756 2937861824 Bacteria 6660327
1060 2937868961 2937868953 Bacteria 6639878
1061 2937877756 2937877337 Bacteria 7246526
1062 2937977826 2937972304 Bacteria 7532020
1063 2941500577 2941499720 Bacteria 7599444
1064 2957377445 2957375807 Bacteria 6425588
1065 2957387159 2957382221 Bacteria 6737050
1066 2957392577 2957388812 Bacteria 6778072
1067 2957398536 2957395598 Bacteria 6822399
1068 2957407178 2957402308 Bacteria 6741770
1069 2957413280 2957408893 Bacteria 6558585
1070 2957420784 2957415311 Bacteria 6991633
1071 2957424284 2957422303 Bacteria 7172205
1072 2957433846 2957430029 Bacteria 7022557
1073 2957443148 2957437181 Bacteria 6568994
1074 2957446432 2957443900 Bacteria 6869977
1075 2957455726 2957450854 Bacteria 6765715
1076 2957462995 2957457609 Bacteria 6967680
1077 2957469459 2957464669 Bacteria 6568877
1078 2957474822 2957471148 Bacteria 6797643
1079 2957483460 2957478035 Bacteria 6756658
1080 2957488427 2957484790 Bacteria 6703082
1081 2957495419 2957491536 Bacteria 6695180
1082 2957502281 2957498199 Bacteria 7126688
1083 2957509370 2957505466 Bacteria 7253085
1084 2958036186 2958034702 Bacteria 6989922
1085 2958047610 2958041894 Bacteria 13082850
1086 2958053687 2958041894 Bacteria 13082850
1087 2958066278 2958064165 Bacteria 7158582
1088 2958075862 2958071322 Bacteria 6815895
1089 2958084864 2958084443 Bacteria 7312792
1090 2958093247 2958092219 Bacteria 6861151
1091 2958101028 2958100919 Bacteria 6800575
1092 2958112277 2958108152 Bacteria 6681128
1093 2958122743 2958122699 Bacteria 7280457
1094 2958133593 2958130278 Bacteria 6897202
1095 2958141115 2958137437 Bacteria 6050276
1096 2958151948 2958144490 Bacteria 6677056
1097 2958160926 2958158011 Bacteria 6058449
1098 2958177203 2958172287 Bacteria 6716688
1099 2958183237 2958179912 Bacteria 6874908
1100 2960588839 2960584000 Bacteria 6864594
1101 2960593728 2960591022 Bacteria 6622873
1102 2960601638 2960597568 Bacteria 6550735
1103 2960609552 2960603979 Bacteria 6898737
1104 2960614908 2960610863 Bacteria 6691244
1105 2960621067 2960617483 Bacteria 6727748
1106 2960628534 2960624210 Bacteria 6875384
1107 2960632962 2960631154 Bacteria 6732508
1108 2960640081 2960637947 Bacteria 7296468
1109 2960650310 2960645483 Bacteria 7211087
1110 2960653683 2960652885 Bacteria 7083688
1111 2960664758 2960660292 Bacteria 7041660
1112 2960672477 2960667422 Bacteria 6763020
1113 2960679129 2960674078 Bacteria 6609048
1114 2960685601 2960680706 Bacteria 6624464
1115 2960687973 2960687367 Bacteria 6535474
1116 2960695614 2960693952 Bacteria 6749742
1117 2961081204 2961077736 Bacteria 7079850
1118 2961120484 2961114664 Bacteria 6680456
1119 2961141927 2961136820 Bacteria 6775228
1120 2961185021 2961183825 Bacteria 6688536
1121 2963649770 2963644680 Bacteria 6530403
1122 2964609789 2964607997 Bacteria 7101408
1123 2964619528 2964615318 Bacteria 6809089
1124 2964626801 2964621998 Bacteria 6834995
1125 2964630138 2964628898 Bacteria 7083044
1126 2964637457 2964636051 Bacteria 7091832
1127 2964647783 2964643177 Bacteria 6820887
1128 2964653583 2964649959 Bacteria 6675118
1129 2964661785 2964656573 Bacteria 7100150
1130 2964668961 2964663802 Bacteria 7019362
1131 2964672115 2964670856 Bacteria 6851364
1132 2964681323 2964678106 Bacteria 6792020
1133 2964689908 2964685014 Bacteria 6839111
1134 2964696854 2964691889 Bacteria 6802758
1135 2964699309 2964698721 Bacteria 6765331
1136 2964711060 2964705432 Bacteria 7114648
1137 2964715758 2964712639 Bacteria 6695970
1138 2964721523 2964719344 Bacteria 7286602
1139 2965026875 2965025482 Bacteria 6532201
1140 2965032972 2965032056 Bacteria 6887443
1141 2965043105 2965040258 Bacteria 6855979
1142 2965054842 2965047637 Bacteria 6623551
1143 2965093423 2965089291 Bacteria 6866420
1144 2965110239 2965102966 Bacteria 6800987
1145 2965118355 2965110997 Bacteria 6693150
1146 2965123081 2965119406 Bacteria 6956431
1147 2967670700 2967664464 Bacteria 6948836
1148 2967677707 2967671571 Bacteria 7021409
1149 2967680832 2967678726 Bacteria 7264382
1150 2967686175 2967686174 Bacteria 6678622
1151 2967696659 2967693043 Bacteria 6804451
1152 2967701264 2967699805 Bacteria 6854538
1153 2967708773 2967706974 Bacteria 7186053
1154 2967718149 2967714385 Bacteria 7000047
1155 2967725951 2967721400 Bacteria 7073753
1156 2967729856 2967728569 Bacteria 6641507
1157 2967738255 2967735183 Bacteria 6827012
1158 2967744948 2967742019 Bacteria 6794534
1159 2967754103 2967748971 Bacteria 6733771
1160 2967756645 2967755722 Bacteria 6814706
1161 2967763068 2967762386 Bacteria 6923502
1162 2967774192 2967769361 Bacteria 6587838
1163 2967781522 2967775926 Bacteria 6738189
1164 2968022177 2968016561 Bacteria 7022047
1165 2968086919 2968083720 Bacteria 7351627
1166 2968116951 2968110612 Bacteria 6814636
1167 2968118679 2968117919 Bacteria 6536078
1168 2968146191 2968138860 Bacteria 6605449
1169 2970020726 2970019648 Bacteria 7072033
1170 2970032537 2970026789 Bacteria 6785236
1171 2970037570 2970033650 Bacteria 7118744
1172 2970045240 2970040964 Bacteria 6731123
1173 2970053556 2970047711 Bacteria 7088379
1174 2970058743 2970054988 Bacteria 6611507
1175 2970065017 2970061556 Bacteria 7099761
1176 2970072756 2970068827 Bacteria 7123112
1177 2970081627 2970076120 Bacteria 6697332
1178 2970086201 2970082768 Bacteria 6183754
1179 2970094025 2970088815 Bacteria 6933825
1180 2970100813 2970095765 Bacteria 6936963
1181 2970106340 2970102677 Bacteria 6812532
1182 2970113613 2970109326 Bacteria 6863976
1183 2970120272 2970116247 Bacteria 6501857
1184 2970123768 2970122695 Bacteria 6625855
1185 2970132863 2970129317 Bacteria 6806560
1186 2970139902 2970136068 Bacteria 7207982
1187 2970145622 2970143518 Bacteria 6446480
1188 2970153662 2970149975 Bacteria 6779706
1189 2970158609 2970156795 Bacteria 7168044
1190 2970169280 2970164137 Bacteria 6861252
1191 2970177778 2970170962 Bacteria 6876229
1192 2970181484 2970177841 Bacteria 6768001
1193 2970191330 2970184632 Bacteria 7054431
1194 2970195811 2970191845 Bacteria 7032787
1195 2970474767 2970469710 Bacteria 6969209
1196 2970494562 2970489779 Bacteria 6517260
1197 2970511773 2970510686 Bacteria 7006402
1198 2970529049 2970524798 Bacteria 6840927
1199 2970537130 2970532167 Bacteria 6553173
1200 2970542287 2970540015 Bacteria 6977556
1201 2970549883 2970547951 Bacteria 6931819
1202 2970594915 2970593180 Bacteria 7073582
1203 2970622795 2970619444 Bacteria 6986144
1204 2970632657 2970627176 Bacteria 6680862
1205 2977523094 2977516862 Bacteria 6940108
1206 2977529210 2977523885 Bacteria 6960446
1207 2977537594 2977530762 Bacteria 6951399
1208 2977540611 2977537788 Bacteria 6929320
1209 2977555683 2977551784 Bacteria 7125765
1210 2977564016 2977558990 Bacteria 6863948
1211 2977570929 2977565890 Bacteria 6901543
1212 2977573325 2977572785 Bacteria 6763888
1213 2977584009 2977579622 Bacteria 6772100
1214 2977844531 2977843712 Bacteria 6753583
1215 2977853042 2977851361 Bacteria 6694324
1216 2977875083 2977872689 Bacteria 7270173
1217 2977913971 2977907340 Bacteria 6577984
1218 2977916223 2977915119 Bacteria 6829656
1219 2977927804 2977922695 Bacteria 6956781
1220 2977936304 2977935797 Bacteria 6252826
1221 2977946517 2977942078 Bacteria 7570577
1222 2977957154 2977950692 Bacteria 6893264
1223 2977960585 2977957713 Bacteria 6877875
1224 2977972362 2977971508 Bacteria 7472917
1225 2977987057 2977986579 Bacteria 6581278
1226 2978973411 2978969890 Bacteria 5400756
1227 2979093260 2979089926 Bacteria 5670289
1228 2979099355 2979095461 Bacteria 5669583
1229 2979105228 2979100975 Bacteria 5423623
1230 2979713096 2979710463 Bacteria 6785254
1231 2979745018 2979742915 Bacteria 7301278
1232 2979764790 2979764755 Bacteria 6610066
1233 2979772684 2979772303 Bacteria 6618277
1234 2979800843 2979793036 Bacteria 6808957
1235 2984512916 2984509177 Bacteria 5274802
1236 2984520720 2984518228 Bacteria 5277463
1237 2984540013 2984537506 Bacteria 5277481
1238 2984591694 2984587000 Bacteria 5263363
1239 2984602203 2984601300 Bacteria 5455244
1240 2987643338 2987636660 Bacteria 8088555
1241 2987649023 2987645492 Bacteria 6117018
1242 2987652750 2987652177 Bacteria 6969023
1243 2987670757 2987666974 Bacteria 6509233
1244 2987674627 2987673487 Bacteria 6884027
1245 2989355374 2989349275 Bacteria 6349068
1246 2989774096 2989771324 Bacteria 5605128
1247 2989777650 2989776772 Bacteria 4843317
1248 2996313018 2996310559 Bacteria 6357320
1249 2996354176 2996348954 Bacteria 7239054
1250 2996387402 2996386984 Bacteria 6978667
1251 2996892049 2996887358 Bacteria 5795980
1252 2996893598 2996893221 Bacteria 5823108
1253 3000141249 3000135777 Bacteria 6891109
1254 3003932230 3003930520 Bacteria 5667563
1255 3004171303 3004167301 Bacteria 8330599
1256 3004200880 3004195979 Bacteria 6776956
1257 3004206884 3004203850 Bacteria 7307914
1258 3004213813 3004211236 Bacteria 7417683
1259 3004223404 3004218560 Bacteria 7421728
1260 3004238840 3004232784 Bacteria 6662140
1261 3004242702 3004239961 Bacteria 6892290
1262 3004249723 3004248173 Bacteria 6563236
1263 3004270427 3004268573 Bacteria 7043476
1264 3004280844 3004275668 Bacteria 7114440
1265 3004294721 3004289098 Bacteria 6135450
1266 3004338995 3004334049 Bacteria 8449246
1267 3005411363 3005409236 Bacteria 7188837
1268 3005446312 3005445848 Bacteria 6906074
1269 3005452974 3005452660 Bacteria 5889319
1270 637079213 637000159 Bacteria 7596297
1271 639646823 639633055 Bacteria 7751309
1272 643824669 643692032 Bacteria 6891900
1273 648740239 648276728 Bacteria 6968865
1274 649874938 649633066 Bacteria 6690028
1275 650739081 650716007 Bacteria 5573770
1276 8002288134 8002285264 Bacteria 6717907
1277 8003572713 8003570095 Bacteria 5747666
1278 8003992616 8003992118 Bacteria 7266902
1279 8003999936 8003999396 Bacteria 7063185
1280 8004303882 8004300914 Bacteria 6132239
1281 8004318144 8004312739 Bacteria 7444653
1282 8004365725 8004361976 Bacteria 6858373
1283 8004391096 8004387939 Bacteria 7049250
1284 8004400587 8004395343 Bacteria 6620908
1285 8004634133 8004633249 Bacteria 6723080
1286 8004645990 8004640170 Bacteria 6723001
1287 8004702418 8004695233 Bacteria 6731676
1288 8004716467 8004714634 Bacteria 6776161
1289 8004734294 8004727605 Bacteria 6643904
1290 8005247183 8005246636 Bacteria 4933972
1291 8005263625 8005258706 Bacteria 6184835
1292 8005279036 8005275841 Bacteria 6929066
1293 8005283725 8005282627 Bacteria 6675747
1294 8005291857 8005289223 Bacteria 6634003
1295 8005303990 8005301065 Bacteria 6614431
1296 8005308809 8005307578 Bacteria 7395396
1297 8005326576 8005321885 Bacteria 5795980
1298 8005377279 8005376324 Bacteria 6590079
1299 8005387148 8005382845 Bacteria 6732062
1300 8005401908 8005395548 Bacteria 6806915
1301 8005433074 8005430974 Bacteria 6689030
1302 8005461191 8005460587 Bacteria 7157962
1303 8005498801 8005497431 Bacteria 6477605
1304 8005543910 8005542996 Bacteria 7077758
1305 8005560790 8005556819 Bacteria 6908598
1306 8005569773 8005563573 Bacteria 7153261
1307 8005571533 8005570704 Bacteria 6957481
1308 8005577073 8005570704 Bacteria 6957481
1309 8005619994 8005619151 Bacteria 7030230
1310 8005628593 8005626139 Bacteria 6534237
1311 8005660461 8005658619 Bacteria 4500593
1312 8005670212 8005668836 Bacteria 6953162
1313 8005690416 8005688590 Bacteria 6610080
1314 8005697952 8005695170 Bacteria 6912330
1315 8018133271 8018127388 Bacteria 7351159
1316 8018151771 8018150411 Bacteria 5549903
1317 8018167738 8018163183 Bacteria 7277977
1318 8018181229 8018176218 Bacteria 6896178
1319 8023684063 8023680758 Bacteria 7729763
1320 8024480446 8024479707 Bacteria 6954785
1321 8024489398 8024486573 Bacteria 6540512
1322 8024503533 8024501048 Bacteria 6427847
1323 8046771029 8046767195 Bacteria 7547379
1324 8049293623 8049293176 Bacteria 6128433
1325 8054461410 8054460903 Bacteria 4872905
1326 8054558807 8054558443 Bacteria 5204801
1327 8055433353 8055431914 Bacteria 4551896
1328 8055623552 8055617313 Bacteria 7548464
1329 8056375781 8056375014 Bacteria 7006639
1330 8056386098 8056382006 Bacteria 6408074
1331 8056879256 8056875544 Bacteria 4355797
1332 8057579795 8057575449 Bacteria 7367519
1333 8057881076 8057874678 Bacteria 7494653
1334 Ga0496122_0076684
1335 RicEn_C1280
1336 JGI24740J21852_10006979
1337 JGI25155J39150_1000006
1338 JGI25156J39149_1000019
1339 JGI25154J39366_1000365
1340 JGI25158J39367_1004713
1341 JGI25158J39367_1005468
1342 JGI25157J39369_1000024
1343 JGI25152J39213_1001364
1344 JGI25152J39213_1001530
1345 JGI25152J39213_1002888
1346 JGI25152J39213_1003642
1347 JGI25152J39213_1003736
1348 JGI25152J39213_1005803
1349 JGI25150J39212_1000042
1350 JGI25150J39212_1008444
1351 JGI25159J45721_1000021
1352 JGI25159J45721_1004731
1353 JGI25151J46595_10000099
1354 JGI25151J46595_10001860
1355 JGI25151J46595_10010565
1356 JGI25151J46595_10015525
1357 JGI25151J46595_10043194
1358 JGI25165J46597_1000016
1359 JGI25165J46597_1001938
1360 JGI25153J46596_10000761
1361 JGI25153J46596_10004070
1362 JGI25153J46596_10007790
1363 JGI25153J46596_10008040
1364 JGI25153J46596_10010745
1365 rootH1_10065597
1366 JGI25160J50197_1000002
1367 JGI25160J50197_1000261
1368 JGI25160J50197_1001976
1369 JGI25160J50197_1009243
1370 JGI25161J50226_1000195
1371 JGI25161J50226_1000745
1372 JGI25161J50226_1001106
1373 JGI25161J50226_1006651
1374 Ga0006562J51391_1023041
1375 Ga0055542_1000694
1376 Ga0055529_1003767
1377 Ga0055526_1001512
1378 Ga0055526_1009662
1379 Ga0055526_1014659
1380 Ga0055526_1024076
1381 Ga0055524_1004697
1382 Ga0055524_1007742
1383 Ga0055524_1008112
1384 Ga0055536_1009924
1385 Ga0055536_1011977
1386 Ga0055528_1000263
1387 Ga0055528_1007710
1388 Ga0055528_1011212
1389 Ga0055528_1022634
1390 Ga0055528_1025618
1391 Ga0055540_1000422
1392 Ga0055540_1001170
1393 Ga0055540_1011377
1394 Ga0055531_10005822
1395 Ga0055531_10007471
1396 Ga0058692_1005505
1397 Ga0058692_1006931
1398 Ga0055543_1000010
1399 Ga0055543_1000215
1400 Ga0055543_1000358
1401 Ga0055543_1000923
1402 Ga0065165_1000004
1403 Ga0065165_1002152
1404 Ga0065165_1012112
1405 Ga0070670_100000811
1406 Ga0070666_10013250
1407 Ga0070660_100171301
1408 Ga0070668_100193502
1409 Ga0070667_100115697
1410 Ga0070663_100045818
1411 Ga0070665_100050865
1412 Ga0070665_100053285
1413 Ga0068855_100154182
1414 Ga0068854_100106300
1415 Ga0068852_100026503
1416 Ga0068852_100219705
1417 Ga0075365_10000341
1418 Ga0075365_10008377
1419 Ga0075365_10053672
1420 Ga0075365_10067790
1421 Ga0075365_10159001
1422 Ga0075368_10013797
1423 Ga0075368_10017200
1424 Ga0075368_10114481
1425 Ga0075363_100212744
1426 Ga0075364_10000730
1427 Ga0075364_10021793
1428 Ga0075364_10130609
1429 Ga0075362_10028537
1430 Ga0075362_10051478
1431 Ga0075367_10013411
1432 Ga0075367_10042176
1433 Ga0075367_10115594
1434 Ga0075369_10001103
1435 Ga0075369_10019551
1436 Ga0075369_10104750
1437 Ga0075366_10003971
1438 Ga0075366_10049432
1439 Ga0075370_10062936
1440 Ga0079104_1000210
1441 Ga0079104_1010958
1442 Ga0099826_10000253
1443 Ga0105240_10000027
1444 Ga0105247_10129215
1445 Ga0105243_10091152
1446 Ga0105243_10325002
1447 Ga0105237_10000508
1448 Ga0105237_10212767
1449 Ga0105237_10452980
1450 Ga0105238_10009417
1451 Ga0123341_1000027
1452 Ga0123341_1083171
1453 Ga0123342_1024745
1454 Ga0105239_10002593
1455 Ga0105239_10100782
1456 Ga0105239_10197951
1457 Ga0105239_10326413
1458 Ga0105239_10668443
1459 Ga0105246_10115834
1460 Ga0157313_1000967
1461 Ga0157373_10091390
1462 Ga0157373_10250304
1463 Ga0157371_10000058
1464 Ga0157371_10047546
1465 Ga0157370_10000048
1466 Ga0157370_10000792
1467 Ga0157370_10104078
1468 Ga0157370_10197909
1469 Ga0157370_10311511
1470 Ga0157369_10033463
1471 Ga0157369_10161492
1472 Ga0171463_1001
1473 Ga0163163_10456271
1474 Ga0182007_10001900
1475 Ga0183363_1067
1476 Ga0163161_10328652
1477 Ga0214542_1029774
1478 Ga0214543_1000003
1479 Ga0228711_1000137
1480 Ga0228710_1000031
1481 Ga0209435_100011
1482 Ga0209436_100904
1483 Ga0209436_102216
1484 Ga0209563_101762
1485 Ga0209437_100036
1486 Ga0207425_1000012
1487 Ga0207425_1001651
1488 Ga0209646_1000024
1489 Ga0209026_1000030
1490 Ga0209677_100177
1491 Ga0209148_1000057
1492 Ga0209759_1000011
1493 Ga0209129_1000086
1494 Ga0209129_1000428
1495 Ga0209129_1000965
1496 Ga0209129_1001065
1497 Ga0209129_1001501
1498 Ga0209129_1003602
1499 Ga0209129_1003829
1500 Ga0209233_1000056
1501 Ga0209233_1000068
1502 Ga0209233_1000640
1503 Ga0209233_1017467
1504 Ga0209455_1000240
1505 Ga0209455_1003068
1506 Ga0209673_1000091
1507 Ga0209673_1000122
1508 Ga0209673_1001847
1509 Ga0209673_1002257
1510 Ga0209673_1003203
1511 Ga0209673_1003816
1512 Ga0209673_1006605
1513 Ga0209673_1027364
1514 Ga0209130_1000008
1515 Ga0209130_1000013
1516 Ga0209130_1000015
1517 Ga0209130_1006718
1518 Ga0209676_1002616
1519 Ga0209676_1007603
1520 Ga0209025_1000024
1521 Ga0209025_1000118
1522 Ga0209025_1000425
1523 Ga0209025_1000549
1524 Ga0209025_1002239
1525 Ga0209025_1003170
1526 Ga0209025_1005506
1527 Ga0209025_1009578
1528 Ga0209025_1041339
1529 Ga0209025_1053081
1530 Ga0209564_1000091
1531 Ga0209564_1000398
1532 Ga0209564_1001660
1533 Ga0209564_1001988
1534 Ga0209564_1004066
1535 Ga0209564_1007014
1536 Ga0209564_1015416
1537 Ga0209758_1000046
1538 Ga0209758_1000191
1539 Ga0209758_1000325
1540 Ga0209758_1001314
1541 Ga0209758_1001929
1542 Ga0209758_1003374
1543 Ga0209758_1007852
1544 Ga0209758_1039329
1545 Ga0209758_1042064
1546 Ga0209050_1002194
1547 Ga0209050_1002228
1548 Ga0209050_1024676
1549 Ga0209256_1000169
1550 Ga0209256_1001378
1551 Ga0209256_1001486
1552 Ga0209256_1004334
1553 Ga0209256_1004935
1554 Ga0209256_1005505
1555 Ga0209256_1005974
1556 Ga0209256_1008187
1557 Ga0209256_1009659
1558 Ga0209256_1039148
1559 Ga0207426_1000016
1560 Ga0207426_1000063
1561 Ga0207426_1000081
1562 Ga0207426_1000144
1563 Ga0207426_1003683
1564 Ga0209051_1000205
1565 Ga0209051_1000615
1566 Ga0209051_1001961
1567 Ga0209051_1014612
1568 Ga0209051_1017763
1569 Ga0209051_1021103
1570 Ga0209051_1040687
1571 Ga0209257_1002565
1572 Ga0209257_1003359
1573 Ga0209257_1006311
1574 Ga0209257_1018915
1575 Ga0207695_10000024
1576 Ga0207671_10000176
1577 Ga0207671_10090167
1578 Ga0207657_10071363
1579 Ga0207694_10157799
1580 Ga0207650_10000681
1581 Ga0207709_10133866
1582 Ga0207668_10251948
1583 Ga0207640_10054979
1584 Ga0207658_10101377
1585 Ga0207678_10038944
1586 Ga0207674_10065563
1587 Ga0207698_10270315
1588 Ga0209281_1000155
1589 Ga0209281_1000215
1590 Ga0209281_1000253
1591 Ga0209371_1000009
1592 Ga0209371_1003770
1593 Ga0209282_1000025
1594 Ga0209282_1001877
1595 Ga0209813_10021208
1596 Ga0268266_10015167
1597 Ga0268266_10038826
1598 Ga0307515_10000154
1599 Ga0307515_10008516
1600 Ga0307515_10180960
1601 Ga0268256_1000010
1602 Ga0268256_1004527
1603 Ga0268256_1012512
1604 Ga0307513_10001432
1605 Ga0307513_10069330
1606 Ga0307513_10345605
1607 Ga0307408_100138440
1608 Ga0307408_100143758
1609 Ga0307516_10254803
1610 Ga0307405_10008416
1611 Ga0307410_10023710
1612 Ga0307406_10039073
1613 Ga0307412_10002253
1614 Ga0307412_10052489
1615 Ga0315914_1000020
1616 Ga0307416_100169679
1617 Ga0307414_10264825
1618 Ga0307414_10421069
1619 Ga0307411_10511517
1620 Ga0315913_1000013
1621 Ga0315915_1000015
1622 Ga0373935_0103526
1623 Ga0373927_0000146
1624 Ga0373925_0001219
1625 Ga0395899_0000030
1626 Ga0395900_0000023
1627 Ga0395898_0000038
1628 Ga0395905_0000021
1629 Ga0395905_0000441
1630 Ga0395901_0000018
1631 Ga0439436_0009254
1632 Ga0439439_0010106
1633 Ga0439465_0012020
1634 Ga0439465_0020674
1635 Ga0439465_0054055
1636 Ga0451833_1218183
1637 Ga0451835_1152586
1638 Ga0451839_0724193
1639 Ga0451841_0360016
1640 Ga0451841_0520367
1641 Ga0451841_1428998
1642 Ga0451849_1312558
1643 Ga0451851_0563320
1644 Ga0451851_0598238
1645 Ga0439432_070680
1646 Ga0439449_0004953
1647 Ga0439449_0075717
1648 Ga0450906_006099
1649 Ga0450918_006966
1650 Ga0495590_0012602
1651 Ga0495591_032670
1652 Ga0495638_0001179
1653 Ga0495638_0009816
1654 Ga0495638_0010606
1655 Ga0495638_0018504
1656 Ga0495651_0186530
1657 Ga0495650_0014683
1658 Ga0495605_0001233
1659 Ga0495662_0006720
1660 Ga0495585_0020929
1661 Ga0495585_0051118
1662 Ga0495607_0059975
1663 Ga0495607_0142439
1664 Ga0495583_0004185
1665 Ga0495583_0049061
1666 Ga0495606_0000762
1667 Ga0495606_0064735
1668 Ga0495606_0075425
1669 Ga0495606_0137386
1670 Ga0495610_0005850
1671 Ga0495610_0067666
1672 Ga0495610_0069765
1673 Ga0495616_0066483
1674 Ga0495620_0017389
1675 Ga0495620_0026400
1676 Ga0495620_0031963
1677 Ga0495631_0001700
1678 Ga0495632_0008591
1679 Ga0495632_0030135
1680 Ga0495643_0022226
1681 Ga0495643_0062642
1682 Ga0495648_0096178
1683 Ga0495652_0276354
1684 Ga0495654_0000436
1685 Ga0495609_0060189
1686 Ga0495633_0014552
1687 Ga0495656_0026549
1688 Ga0495668_0002936
1689 Ga0495611_0052505
1690 Ga0495611_0108663
1691 Ga0495625_0001444
1692 Ga0495625_0016487
1693 Ga0495625_0028625
1694 Ga0495625_0030420
1695 Ga0495588_0003056
1696 Ga0495670_0023133
1697 Ga0495670_0047418
1698 Ga0495671_0057389
1699 Ga0495649_0089135
1700 Ga0495649_0096704
1701 Ga0495600_0006817
1702 Ga0495604_0100341
1703 Ga0495672_0119146
1704 Ga0495683_0048068
1705 Ga0495683_0182655
1706 Ga0495687_044169
1707 Ga0495673_0033574
1708 Ga0495681_0001172
1709 Ga0495681_0056949
1710 Ga0495681_0082805
1711 Ga0495686_0004080
1712 Ga0495686_0013054
1713 Ga0495686_0023550
1714 Ga0495686_0090043
1715 Ga0495686_0162049
1716 Ga0495626_0053411
1717 Ga0496101_0289967
1718 Ga0496106_0000912
1719 Ga0496111_0020904
1720 Ga0496112_0018703
1721 Ga0496113_0287669
1722 Ga0496115_0645132
1723 Ga0496116_0001841
1724 Ga0496116_0002642
1725 Ga0496116_0022408
1726 Ga0496116_0026286
1727 Ga0496116_0042101
1728 Ga0496116_0182141
1729 Ga0496117_0000002
1730 Ga0496117_0002297
1731 Ga0496117_0006068
1732 Ga0496117_0012864
1733 Ga0496117_0039846
1734 Ga0496117_0087175
1735 Ga0496117_0171202
1736 Ga0496118_0000233
1737 Ga0496118_0001988
1738 Ga0496118_0012608
1739 Ga0496118_0055709
1740 Ga0496118_0061022
1741 Ga0496118_0063321
1742 Ga0496119_0015134
1743 Ga0496119_0022235
1744 Ga0496119_0038975
1745 Ga0496119_0119548
1746 Ga0496120_0000021
1747 Ga0496120_0023198
1748 Ga0496120_0031345
1749 Ga0496120_0076177
1750 Ga0496121_0000001
1751 Ga0496121_0000459
1752 Ga0496121_0003778
1753 Ga0496121_0009317
1754 Ga0496121_0012314
1755 Ga0496121_0039218
1756 Ga0496121_0046638
1757 Ga0496121_0117897
1758 Ga0496121_0334802
1759 Ga0496122_0000001
1760 Ga0496122_0000009
1761 Ga0496122_0000247
1762 Ga0496122_0007204
1763 Ga0496122_0014899
1764 Ga0496122_0023470
1765 Ga0496122_0027734
1766 Ga0496122_0030322
1767 Ga0496122_0078927
1768 Ga0496122_0083673
1769 Ga0496122_0211715
1770 Ga0496123_0000001
1771 Ga0496123_0000020
1772 Ga0496123_0000222
1773 Ga0496123_0006783
1774 Ga0496123_0017248
1775 Ga0496123_0028989
1776 Ga0496123_0031989
1777 Ga0496123_0036397
1778 Ga0496123_0073079
1779 Ga0496123_0156585
1780 Ga0496124_0000262
1781 Ga0496124_0000592
1782 Ga0496124_0002069
1783 Ga0496124_0004006
1784 Ga0496124_0020386
1785 Ga0496124_0042181
1786 Ga0496124_0046415
1787 Ga0496124_0110214
1788 Ga0496124_0122746
1789 Ga0496124_0216017
1790 Ga0496124_0473442
1791 Ga0496125_0000001
1792 Ga0496125_0000557
1793 Ga0496125_0002964
1794 Ga0496125_0016086
1795 Ga0496125_0028713
1796 Ga0496125_0053506
1797 Ga0496126_0000438
1798 Ga0496126_0000747
1799 Ga0496126_0095418
1800 Ga0496126_0304894
1801 Ga0501031_0088875
1802 Ga0501032_0000060
1803 Ga0501033_0000171
1804 Ga0501033_0000490
1805 Ga0501033_0026133
1806 Ga0501034_0000262
1807 Ga0501034_0019677
1808 Ga0501034_0020260
1809 Ga0501034_0192430
1810 Ga0501034_0197244
1811 Ga0501034_0349017
1812 Ga0501036_0002418
1813 Ga0501037_0000950
1814 Ga0501037_0196563
1815 Ga0501037_0264506
1816 Ga0501038_0000051
1817 Ga0501039_0000051
1818 Ga0501043_0000288
1819 Ga0501043_0042688
1820 Ga0501046_0019962
1821 Ga0501047_0090915
1822 Ga0501047_0163482
1823 Ga0501047_0417222
1824 Ga0501047_0445687
1825 Ga0501048_0198556
1826 Ga0501080_0240007
1827 Ga0501083_0052869
1828 Ga0501083_0172225
1829 Ga0501280_003130
1830 Ga0501035_0000119
1831 Ga0501035_0000841
1832 Ga0501035_0114499
1833 Ga0501035_0249760
1834 Ga0501044_0017596
1835 Ga0501044_0291124
1836 Ga0501044_0493424
1837 Ga0501045_0210774
1838 nmdc:mga03683_15312_c1
1839 nmdc:mga03683_39022_c1
1840 nmdc:mga03683_75287_c1
1841 nmdc:mga03n38_42062_c1
1842 nmdc:mga03n38_7503_c1
1843 nmdc:mga00v17_31958_c1
1844 nmdc:mga00v17_7173_c1
1845 nmdc:mga00v17_91675_c1
1846 nmdc:mga00v17_92_c1
1847 nmdc:mga0yw44_126834_c1
1848 nmdc:mga0yw44_133573_c1
1849 nmdc:mga0yw44_4716_c1
1850 nmdc:mga0yw44_50749_c1
1851 nmdc:mga0yw44_54089_c1
1852 nmdc:mga0k408_81905_c1
1853 nmdc:mga06z11_162269_c1
1854 nmdc:mga04h51_25351_c1
1855 nmdc:mga04h51_39125_c1
1856 nmdc:mga07m45_137405_c1
1857 nmdc:mga07m45_138240_c1
1858 nmdc:mga0sz30_109534_c1
1859 nmdc:mga0sz30_4178_c1
1860 nmdc:mga0sz30_51477_c1
1861 Ga0495601_0083631
1862 Ga0500610_0014244
1863 Ga0500578_0093503
1864 Ga0500644_0005233
1865 Ga0500557_001655
1866 Ga0500560_000887
1867 Ga0500560_010826
1868 Ga0500569_000978
1869 Ga0500569_096445
1870 Ga0500572_008017
1871 Ga0500594_0003405
1872 Ga0500608_024673
1873 Ga0500618_000132
1874 Ga0500618_003524
1875 Ga0500618_005292
1876 Ga0500658_0000774
1877 Ga0500568_0011657
1878 Ga0500573_0016700
1879 Ga0500590_000811
1880 Ga0500604_0012475
1881 Ga0500616_0003108
1882 Ga0500616_0020526
1883 Ga0500620_000159
1884 Ga0500622_0000342
1885 Ga0500622_0003075
1886 Ga0500624_000370
1887 Ga0500633_0010989
1888 Ga0500634_0009996
1889 Ga0500636_0000023
1890 Ga0500636_0001609
1891 Ga0501082_0201735
1892 2503203725
1893 2509107232
1894 2509113913
1895 2509141050
1896 2509374802
1897 2509388273
1898 2509398089
1899 2509443840
1900 2509444841
1901 2510131628
1902 2510304932
1903 2510316663
1904 2510839894
1905 2510893080
1906 2510897921
1907 2511134532
1908 2511174866
1909 2511194475
1910 2511500722
1911 2512532140
1912 2512929464
1913 2512964256
1914 2512972526
1915 2513571206
1916 2513579254
1917 2513585714
1918 2513598514
1919 2513605548
1920 2513616785
1921 2513632300
1922 2513711626
1923 2513866335
1924 2513880801
1925 2513903795
1926 2513907951
1927 2513927608
1928 2513986105
1929 2513999889
1930 2514007522
1931 2514020873
1932 2514033994
1933 2514418876
1934 2515110550
1935 2515607855
1936 2515639012
1937 2515645255
1938 2515659468
1939 2515742944
1940 2516208596
1941 2516891997
1942 2517039251
1943 2517079495
1944 2517093441
1945 2517405140
1946 2517411526
1947 2517568810
1948 2520376689
1949 2524450048
1950 2524457648
1951 2530647658
1952 2535515231
1953 2537872859
1954 2551675937
1955 2551686887
1956 2551695249
1957 2551699047
1958 2551708766
1959 2551717569
1960 2551725979
1961 2551733348
1962 2551741729
1963 2554246662
1964 2558863794
1965 2559293890
1966 2561467309
1967 2585165150
1968 2585204007
1969 2585225729
1970 2585229122
1971 2585257064
1972 2585266638
1973 2585275306
1974 2585281949
1975 2585325848
1976 2585330019
1977 2585387654
1978 2585394248
1979 2585398414
1980 2585528447
1981 2585536447
1982 2585539840
1983 2585547996
1984 2585556882
1985 2585560251
1986 2585819439
1987 2585837821
1988 2585844507
1989 2585905567
1990 2585994605
1991 2585999093
1992 2587979317
1993 2588515040
1994 2597815758
1995 2599333176
1996 2599419039
1997 2599605441
1998 2599719425
1999 2599938598
2000 2600191596
2001 2600374841
2002 2601609135
2003 2601745910
2004 2616295812
2005 2616306192
2006 2617382603
2007 2643773986
2008 2643774653
2009 2643793098
2010 2643807553
2011 2643810420
2012 2643838469
2013 2643856241
2014 2643921123
2015 2643989189
2016 2644007480
2017 2644046993
2018 2644069964
2019 2644103044
2020 2644132618
2021 2644152027
2022 2644152386
2023 2644190734
2024 2644203568
2025 2644206554
2026 2644241414
2027 2644297429
2028 2644305971
2029 2644330273
2030 2644380936
2031 2644414841
2032 2644448498
2033 2644479782
2034 2644493721
2035 2644497318
2036 2644519196
2037 2644542974
2038 2644619078
2039 2644650201
2040 2644655682
2041 2644673891
2042 2644689195
2043 2657682029
2044 2671112500
2045 2688600487
2046 2692317115
2047 2719179708
2048 2719384321
2049 2719664058
2050 2719730378
2051 2720490477
2052 2720611858
2053 2720618712
2054 2720630112
2055 2720773807
2056 2721145801
2057 2721157334
2058 2721162680
2059 2721398035
2060 2722838850
2061 2723025477
2062 2723559060
2063 2723565667
2064 2723577763
2065 2724036845
2066 2724043134
2067 2724088414
2068 2724102932
2069 2724108795
2070 2725950098
2071 2730106413
2072 2730162945
2073 2730296966
2074 2738803692
2075 2738945728
2076 2739034697
2077 2739308696
2078 2756672955
2079 2766065555
2080 2766067059
2081 2776912285
2082 2778174301
2083 2792583880
2084 2792622318
2085 2792628116
2086 2792638627
2087 2792753068
2088 2793281917
2089 2793295073
2090 2793315282
2091 2793320142
2092 2793328231
2093 2793332573
2094 2793343189
2095 2793350724
2096 2793353241
2097 2793361035
2098 2793364824
2099 2802717452
2100 2802723620
2101 2802730931
2102 2802735937
2103 2802743854
2104 2802752929
2105 2804751047
2106 2805927440
2107 2805936477
2108 2806043996
2109 2806052186
2110 2806058487
2111 2806066985
2112 2806074728
2113 2808986334
2114 2819243090
2115 2819556466
2116 2819643461
2117 2819684578
2118 2821123769
2119 2838022091
2120 2838028982
2121 2838029162
2122 2838037274
2123 2838047240
2124 2838053949
2125 2838066720
2126 2838073777
2127 2838075510
2128 2838663538
2129 2838673207
2130 2838677195
2131 2838680739
2132 2838692601
2133 2838695228
2134 2838704009
2135 2838708604
2136 2838716083
2137 2838720117
2138 2838726835
2139 2838732673
2140 2838739201
2141 2838745568
2142 2841735138
2143 2841843099
2144 2841847051
2145 2841855212
2146 2841860420
2147 2841866663
2148 2842080161
2149 2842112353
2150 2842120781
2151 2842126920
2152 2842132088
2153 2842142881
2154 2842148199
2155 2842152743
2156 2842161758
2157 2842170157
2158 2842172328
2159 2842176362
2160 2842185375
2161 2842189190
2162 2842193048
2163 2842205089
2164 2842206790
2165 2842213504
2166 2842218645
2167 2842224878
2168 2842233313
2169 2842238016
2170 2842248683
2171 2842253265
2172 2842261826
2173 2842267300
2174 2842277110
2175 2842280517
2176 2842289468
2177 2842293821
2178 2842300737
2179 2842306332
2180 2842312479
2181 2842322370
2182 2842342927
2183 2842358144
2184 2842369914
2185 2842371202
2186 2842380217
2187 2842387289
2188 2842400708
2189 2842406816
2190 2842413687
2191 2842420350
2192 2842427225
2193 2842431448
2194 2842437783
2195 2842444598
2196 2842450351
2197 2842465574
2198 2842472384
2199 2842476408
2200 2842495045
2201 2842500954
2202 2842502690
2203 2842509338
2204 2842517205
2205 2842526462
2206 2842923479
2207 2844005415
2208 2844015812
2209 2844170603
2210 2844455827
2211 2847417816
2212 2848992659
2213 2850080168
2214 2852388634
2215 2854898411
2216 2854919126
2217 2855831917
2218 2855840201
2219 2855873211
2220 2856330388
2221 2856336810
2222 2856343400
2223 2856365306
2224 2857354736
2225 2857369904
2226 2857522235
2227 2857531331
2228 2858804108
2229 2869167082
2230 2869176509
2231 2869238187
2232 2869248904
2233 2869255225
2234 2869263112
2235 2869269797
2236 2869271925
2237 2869280317
2238 2869289217
2239 2871431285
2240 2871437304
2241 2871453233
2242 2871464237
2243 2871471240
2244 2871474805
2245 2871481903
2246 2874120338
2247 2874133241
2248 2874144426
2249 2874148484
2250 2874156228
2251 2874167002
2252 2874173734
2253 2876366977
2254 2876389042
2255 2876398952
2256 2876406814
2257 2876413478
2258 2876415263
2259 2876425467
2260 2878736473
2261 2878744199
2262 2878747889
2263 2878778202
2264 2878788181
2265 2878792427
2266 2881163168
2267 2882639972
2268 2885315797
2269 2888341862
2270 2888349148
2271 2888351103
2272 2889013492
2273 2889021790
2274 2891376294
2275 2896385396
2276 2899792485
2277 2899804344
2278 2899847925
2279 2903453555
2280 2903505889
2281 2903524844
2282 2903530913
2283 2904665484
2284 2906311507
2285 2906323247
2286 2906354638
2287 2906369628
2288 2906371819
2289 2906385195
2290 2906388788
2291 2906400704
2292 2906405491
2293 2906413271
2294 2906429620
2295 2913310590
2296 2915982288
2297 2915991434
2298 2915995772
2299 2916006839
2300 2916010990
2301 2916021035
2302 2916024628
2303 2916032661
2304 2916036072
2305 2916045933
2306 2916051603
2307 2916059375
2308 2916062624
2309 2916071366
2310 2916081935
2311 2919101206
2312 2919116286
2313 2919166993
2314 2919171937
2315 2919408933
2316 2920763186
2317 2920823517
2318 2921204135
2319 2921213141
2320 2921239227
2321 2921247580
2322 2921250715
2323 2921261913
2324 2921268357
2325 2921286951
2326 2921291217
2327 2921301003
2328 2922137865
2329 2922155126
2330 2922177155
2331 2922182954
2332 2922194134
2333 2923557331
2334 2924149256
2335 2924155781
2336 2924161393
2337 2924169589
2338 2924177038
2339 2924184700
2340 2924190561
2341 2924198300
2342 2924205051
2343 2924211916
2344 2924218657
2345 2924225483
2346 2924234128
2347 2924722512
2348 2924738659
2349 2924745935
2350 2924752515
2351 2924756520
2352 2924766163
2353 2924782116
2354 2926757240
2355 2926761454
2356 2933007388
2357 2933012152
2358 2933019822
2359 2933573401
2360 2933587682
2361 2933594600
2362 2933604205
2363 2935895751
2364 2935907796
2365 2936368774
2366 2936377148
2367 2936387317
2368 2936999324
2369 2937008076
2370 2937014543
2371 2937021470
2372 2937026845
2373 2937030108
2374 2937037900
2375 2937048910
2376 2937053768
2377 2937060940
2378 2937070357
2379 2937076482
2380 2937080183
2381 2937090472
2382 2937094671
2383 2937102078
2384 2937109608
2385 2937116977
2386 2937124306
2387 2937131235
2388 2937818672
2389 2937828548
2390 2937840354
2391 2937850509
2392 2937867756
2393 2937868961
2394 2937877756
2395 2937977826
2396 2941500577
2397 2957377445
2398 2957387159
2399 2957392577
2400 2957398536
2401 2957407178
2402 2957413280
2403 2957420784
2404 2957424284
2405 2957433846
2406 2957443148
2407 2957446432
2408 2957455726
2409 2957462995
2410 2957469459
2411 2957474822
2412 2957483460
2413 2957488427
2414 2957495419
2415 2957502281
2416 2957509370
2417 2958036186
2418 2958047610
2419 2958053687
2420 2958066278
2421 2958075862
2422 2958084864
2423 2958093247
2424 2958101028
2425 2958112277
2426 2958122743
2427 2958133593
2428 2958141115
2429 2958151948
2430 2958160926
2431 2958177203
2432 2958183237
2433 2960588839
2434 2960593728
2435 2960601638
2436 2960609552
2437 2960614908
2438 2960621067
2439 2960628534
2440 2960632962
2441 2960640081
2442 2960650310
2443 2960653683
2444 2960664758
2445 2960672477
2446 2960679129
2447 2960685601
2448 2960687973
2449 2960695614
2450 2961081204
2451 2961120484
2452 2961141927
2453 2961185021
2454 2963649770
2455 2964609789
2456 2964619528
2457 2964626801
2458 2964630138
2459 2964637457
2460 2964647783
2461 2964653583
2462 2964661785
2463 2964668961
2464 2964672115
2465 2964681323
2466 2964689908
2467 2964696854
2468 2964699309
2469 2964711060
2470 2964715758
2471 2964721523
2472 2965026875
2473 2965032972
2474 2965043105
2475 2965054842
2476 2965093423
2477 2965110239
2478 2965118355
2479 2965123081
2480 2967670700
2481 2967677707
2482 2967680832
2483 2967686175
2484 2967696659
2485 2967701264
2486 2967708773
2487 2967718149
2488 2967725951
2489 2967729856
2490 2967738255
2491 2967744948
2492 2967754103
2493 2967756645
2494 2967763068
2495 2967774192
2496 2967781522
2497 2968022177
2498 2968086919
2499 2968116951
2500 2968118679
2501 2968146191
2502 2970020726
2503 2970032537
2504 2970037570
2505 2970045240
2506 2970053556
2507 2970058743
2508 2970065017
2509 2970072756
2510 2970081627
2511 2970086201
2512 2970094025
2513 2970100813
2514 2970106340
2515 2970113613
2516 2970120272
2517 2970123768
2518 2970132863
2519 2970139902
2520 2970145622
2521 2970153662
2522 2970158609
2523 2970169280
2524 2970177778
2525 2970181484
2526 2970191330
2527 2970195811
2528 2970474767
2529 2970494562
2530 2970511773
2531 2970529049
2532 2970537130
2533 2970542287
2534 2970549883
2535 2970594915
2536 2970622795
2537 2970632657
2538 2977523094
2539 2977529210
2540 2977537594
2541 2977540611
2542 2977555683
2543 2977564016
2544 2977570929
2545 2977573325
2546 2977584009
2547 2977844531
2548 2977853042
2549 2977875083
2550 2977913971
2551 2977916223
2552 2977927804
2553 2977936304
2554 2977946517
2555 2977957154
2556 2977960585
2557 2977972362
2558 2977987057
2559 2978973411
2560 2979093260
2561 2979099355
2562 2979105228
2563 2979713096
2564 2979745018
2565 2979764790
2566 2979772684
2567 2979800843
2568 2984512916
2569 2984520720
2570 2984540013
2571 2984591694
2572 2984602203
2573 2987643338
2574 2987649023
2575 2987652750
2576 2987670757
2577 2987674627
2578 2989355374
2579 2989774096
2580 2989777650
2581 2996313018
2582 2996354176
2583 2996387402
2584 2996892049
2585 2996893598
2586 3000141249
2587 3003932230
2588 3004171303
2589 3004200880
2590 3004206884
2591 3004213813
2592 3004223404
2593 3004238840
2594 3004242702
2595 3004249723
2596 3004270427
2597 3004280844
2598 3004294721
2599 3004338995
2600 3005411363
2601 3005446312
2602 3005452974
2603 637079213
2604 639646823
2605 643824669
2606 648740239
2607 649874938
2608 650739081
2609 8002288134
2610 8003572713
2611 8003992616
2612 8003999936
2613 8004303882
2614 8004318144
2615 8004365725
2616 8004391096
2617 8004400587
2618 8004634133
2619 8004645990
2620 8004702418
2621 8004716467
2622 8004734294
2623 8005247183
2624 8005263625
2625 8005279036
2626 8005283725
2627 8005291857
2628 8005303990
2629 8005308809
2630 8005326576
2631 8005377279
2632 8005387148
2633 8005401908
2634 8005433074
2635 8005461191
2636 8005498801
2637 8005543910
2638 8005560790
2639 8005569773
2640 8005571533
2641 8005577073
2642 8005619994
2643 8005628593
2644 8005660461
2645 8005670212
2646 8005690416
2647 8005697952
2648 8018133271
2649 8018151771
2650 8018167738
2651 8018181229
2652 8023684063
2653 8024480446
2654 8024489398
2655 8024503533
2656 8046771029
2657 8049293623
2658 8054461410
2659 8054558807
2660 8055433353
2661 8055623552
2662 8056375781
2663 8056386098
2664 8056879256
2665 8057579795
2666 8057881076

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01343

Peptidase_S49

Peptidase family S49

138

289

0.98

PF01972

SDH_sah

Serine dehydrogenase proteinase

102

211

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kwb-assembly1.cif.gz_D structure of signal peptide peptidase a with c-termini bound in the active sites: insights into specificity, self-processing and regulation 0.7748 25 245
3rst-assembly1.cif.gz_A crystal structure of bacillus subtilis signal peptide peptidase a 0.7617 23 247
3rst-assembly1.cif.gz_H crystal structure of bacillus subtilis signal peptide peptidase a 0.7577 22 247
3rst-assembly1.cif.gz_B crystal structure of bacillus subtilis signal peptide peptidase a 0.7564 22 245
3rst-assembly1.cif.gz_A crystal structure of bacillus subtilis signal peptide peptidase a 0.7523 23 247
ID Description Score Start End Superfamily
4kwbC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7927 22 256 3.90.226.10
4kwbC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7582 22 256 3.90.226.10
3bezC03 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7559 22 245 3.90.226.10
3rq1C02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.7504 39 104 3.40.640.10
3u9tB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7469 54 121 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A383EXC7-F1-model_v4 Peptidase S49 domain-containing protein 0.9269 18 134 GO:0006508
GO:0008233
AF-A0A383EXC7-F1-model_v4 Peptidase S49 domain-containing protein 0.8902 18 134 GO:0006508
GO:0008233
AF-A0A527ZKB2-F1-model_v4 S49 family peptidase 0.8679 32 244 GO:0006508
GO:0008236
AF-A0A3B9DJX4-F1-model_v4 deleted 0.8644 18 252
AF-A0A527ZKB2-F1-model_v4 S49 family peptidase 0.8639 32 244 GO:0006508
GO:0008236

Map