F493138

General Info

Members Datasets Scaffolds Average Seq Length
1338 515 1076 368

Family's Representative Sequence

Representative Sequence 3300046526|Ga0495666_0006158|Ga0495666_0006158_4361_5539
Length 392
Sequence MFPSSKEKTEPIWPVWKEKLMPYQPNDLLSRHFEESGHDLINKVEEQLNLVSPNSPNTPIYRDMILTVLRMAQEDHNRWNAKITLQALRELEHAFRVLEQFKGRRKVTVFGSARTPIEHPLYGLARELGAALARSDLMVITGAGGGIMAAAHEGAGLAHSLGFNITLPFEQHANPTVQGTTNLLSFHFFFTRKLFFVKEADALVLCPGGFGTLDEALEVLTLIQTGKSPLVPVVLLDAPGGTFWQSALDFIHHQLEENRYILPTDMKLVSLVYSAEEAVEQINQFYSNFHSSRWLKHQFIIRMNHQLSEHALEHMQVAFADLCLSDHFHQHAYSGEEHDEAQFSHLARLAFTFNARDHGRLRELVDYINLPENWAQPKPQAQHRTREPSKIT

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231010 Pseudomonas sp. GM25 Isolate Nodule
11 2511231011 Pseudomonas sp. GM30 Isolate Nodule
12 2511231012 Pseudomonas sp. GM33 Isolate Nodule
13 2511231014 Pseudomonas sp. GM48 Isolate Nodule
14 2511231015 Pseudomonas sp. GM49 Isolate Nodule
15 2511231016 Pseudomonas sp. GM50 Isolate Nodule
16 2511231017 Pseudomonas sp. GM55 Isolate Nodule
17 2511231018 Pseudomonas sp. GM60 Isolate Nodule
18 2511231019 Pseudomonas sp. GM67 Isolate Nodule
19 2511231020 Pseudomonas sp. GM74 Isolate Nodule
20 2511231021 Pseudomonas sp. GM78 Isolate Nodule
21 2511231022 Pseudomonas sp. GM79 Isolate Nodule
22 2511231023 Pseudomonas sp. GM80 Isolate Nodule
23 2511231031 Pseudomonas sp. GM16 Isolate Nodule
24 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
25 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
26 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
27 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
28 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
29 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
30 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
31 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
32 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
33 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
34 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
35 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
36 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
37 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
38 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
39 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
40 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
41 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
42 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
43 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
44 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
45 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
46 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
47 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
48 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
49 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
50 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
51 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
52 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
53 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
54 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
55 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
56 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
57 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
58 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
59 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
60 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
61 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
62 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
63 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
64 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
65 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
66 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
67 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
68 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
69 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
70 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
71 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
72 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
73 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
74 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
75 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
76 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
77 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
78 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
79 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
80 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
81 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
82 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
83 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
84 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
85 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
86 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
87 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
88 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
89 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
90 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
91 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
92 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
93 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
94 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
95 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
96 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
97 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
98 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
99 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
100 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
101 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
102 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
103 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
104 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
105 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
106 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
107 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
108 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
109 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
110 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
111 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
112 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
113 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
114 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
115 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
116 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
117 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
118 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
119 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
120 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
121 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
122 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
123 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
124 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
125 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
126 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
127 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
128 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
129 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
130 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
131 2765235841 Pseudomonas putida AA7 Isolate Unclassified
132 2773857670 Pseudomonas sp. 478 Isolate Unclassified
133 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
134 2773857673 Pseudomonas sp. 443 Isolate Unclassified
135 2784132063 Pseudomonas sp. 424 Isolate Unclassified
136 2784132072 Pseudomonas sp. 460 Isolate Unclassified
137 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
138 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
139 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
140 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
141 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
142 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
143 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
144 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
145 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
146 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
147 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
148 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
149 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
150 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
151 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
152 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
153 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
154 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
155 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
156 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
157 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
158 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
159 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
160 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
161 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
162 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
163 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
164 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
165 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
166 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
167 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
168 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
169 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
170 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
171 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
172 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
173 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
174 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
175 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
176 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
177 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
178 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
179 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
180 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
181 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
182 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
183 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
184 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
185 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
186 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
187 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
188 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
189 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
190 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
191 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
192 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
193 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
194 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
195 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
196 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
197 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
198 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
199 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
200 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
201 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
202 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
203 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
204 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
205 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
206 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
207 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
208 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
209 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
210 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
211 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
212 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
213 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
214 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
215 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
216 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
217 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
218 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
219 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
220 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
221 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
222 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
223 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
224 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
225 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
226 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
227 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
228 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
229 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
230 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
231 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
232 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
233 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
234 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
235 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
236 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
237 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
238 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
239 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
240 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
241 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
242 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
243 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
244 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
245 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
246 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
247 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
248 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
249 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
250 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
251 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
252 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
253 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
254 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
255 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
256 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
257 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
258 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
259 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
260 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
261 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
262 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
263 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
264 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
265 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
266 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
267 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
268 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
269 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
270 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
271 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
272 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
273 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
274 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
275 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
276 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
277 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
278 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
279 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
280 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
281 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
282 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
283 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
284 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
285 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
286 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
287 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
288 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
289 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
290 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
296 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
297 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
299 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
301 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
302 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
323 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
324 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
327 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
329 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
330 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
331 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
332 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
333 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
334 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
335 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
336 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
337 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
338 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
339 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
340 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
341 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
342 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
343 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
344 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
345 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
346 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
347 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
348 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
349 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
350 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
351 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
352 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
353 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
354 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
355 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
356 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
357 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
358 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
359 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
360 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
361 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
362 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
363 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
364 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
365 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
366 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
367 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
368 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
369 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
370 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
371 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
372 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
373 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
374 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
375 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
376 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
377 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
378 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
379 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
380 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
381 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
382 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
383 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
384 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
385 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
386 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
387 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
388 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
389 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
390 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
391 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
392 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
393 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
394 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
395 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
396 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
397 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
398 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
399 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
400 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
401 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
402 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
403 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
404 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
405 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
406 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
407 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
408 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
409 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
410 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
411 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
412 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
413 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
414 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
415 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
416 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
417 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
418 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
419 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
420 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
421 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
422 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
423 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
424 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
425 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
426 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
427 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
428 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
429 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
430 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
431 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
432 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
433 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
434 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
435 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
436 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
437 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
438 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
439 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
440 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
441 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
442 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
443 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
444 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
445 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
446 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
447 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
448 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
449 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
450 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
451 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
452 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
453 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
454 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
455 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
456 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
457 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
458 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
459 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
460 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
461 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
462 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
463 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
464 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
465 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
466 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
467 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
468 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
469 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
470 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
471 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
472 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
473 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
474 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
477 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
479 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
480 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
481 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
482 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
483 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
484 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
485 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
486 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
487 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
488 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
489 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
490 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
491 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
492 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
493 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
494 8052494512 Pseudomonas putida LD6 Isolate Unclassified
495 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
496 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
497 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
498 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
499 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
500 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
501 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
502 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
503 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
504 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
505 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
506 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
507 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
508 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
509 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
510 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
511 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
512 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
513 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
514 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
515 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.34
Metatranscriptomes 0.07
Isolates 19.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 4.78
Nodule 2.02
Rhizoplane 5.75
Rhizosphere 75.19
Stem 0
Stem Tuber 0
Unclassified 12.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_5 2124908027 Bacteria 78295
2 SwRhRL2b_contig_1517485 2162886007 Bacteria 3748
3 SwRhRL2b_contig_2911292 2162886007 Bacteria 3797
4 JGI25162J39368_1000884 3300002737 Bacteria 19596
5 JGI25162J39368_1000907 3300002737 Bacteria 19179
6 JGI25163J39215_1000928 3300002771 Bacteria 6708
7 JGI25163J39215_1000957 3300002771 Bacteria 6478
8 JGI25164J39214_1000487 3300002772 Bacteria 19596
9 JGI25164J39214_1000499 3300002772 Bacteria 19179
10 JGI25165J46597_1000962 3300003214 Bacteria 19596
11 JGI25165J46597_1000976 3300003214 Bacteria 19179
12 Ga0006562J51391_1005900 3300003578 Bacteria 1463
13 Ga0055538_1000073 3300003751 Bacteria 90843
14 Ga0055539_1000109 3300003752 Bacteria 90843
15 Ga0055533_1000117 3300003756 Bacteria 90843
16 Ga0055532_1000120 3300003758 Bacteria 81088
17 Ga0055525_1000156 3300003759 Bacteria 90843
18 Ga0055536_1004135 3300003781 Bacteria 7523
19 Ga0055536_1004536 3300003781 Bacteria 7060
20 Ga0055536_1004967 3300003781 Bacteria 6619
21 Ga0055530_10001227 3300003791 Bacteria 19616
22 Ga0055530_10001233 3300003791 Bacteria 19520
23 Ga0055530_10002285 3300003791 Bacteria 12579
24 Ga0055540_1000720 3300003792 Bacteria 22554
25 Ga0055540_1003658 3300003792 Bacteria 7321
26 Ga0055540_1003724 3300003792 Bacteria 7207
27 Ga0055531_10000458 3300003794 Bacteria 37744
28 Ga0055541_1000074 3300003841 Bacteria 90843
29 Ga0058692_1016075 3300003856 Bacteria 1673
30 Ga0065714_10000080 3300005288 Bacteria 15007
31 Ga0065714_10003654 3300005288 Bacteria 6446
32 Ga0065714_10004349 3300005288 Bacteria 6133
33 Ga0065714_10006895 3300005288 Bacteria 3087
34 Ga0065714_10008537 3300005288 Bacteria 6751
35 Ga0065714_10011906 3300005288 Bacteria 3105
36 Ga0065714_10012136 3300005288 Bacteria 2482
37 Ga0065714_10024207 3300005288 Bacteria 1199
38 Ga0065714_10067384 3300005288 Bacteria 5578
39 Ga0065714_10080417 3300005288 Bacteria 2412
40 Ga0065714_10100864 3300005288 Bacteria 1655
41 Ga0065714_10101290 3300005288 Bacteria 1642
42 Ga0065714_10101832 3300005288 Bacteria 1620
43 Ga0065704_10006457 3300005289 Bacteria 2926
44 Ga0065704_10073380 3300005289 Bacteria 7226
45 Ga0065704_10075425 3300005289 Bacteria 5598
46 Ga0065704_10099076 3300005289 Bacteria 2326
47 Ga0065704_10118033 3300005289 Bacteria 1823
48 Ga0065712_10002656 3300005290 Bacteria 7495
49 Ga0065712_10067760 3300005290 Bacteria 50775
50 Ga0065715_10002680 3300005293 Bacteria 5551
51 Ga0070670_100001403 3300005331 Bacteria 19336
52 Ga0070670_100014586 3300005331 Bacteria 6747
53 Ga0070661_100000219 3300005344 Bacteria 47253
54 Ga0070669_100011057 3300005353 Bacteria 6404
55 Ga0070662_100002558 3300005457 Bacteria 11199
56 Ga0068853_100006809 3300005539 Bacteria 9113
57 Ga0070665_100204999 3300005548 Bacteria 1972
58 Ga0070664_100001287 3300005564 Bacteria 20065
59 Ga0070664_100048699 3300005564 Bacteria 3581
60 Ga0068854_100003783 3300005578 Bacteria 9463
61 Ga0068851_10000037 3300005834 Bacteria 97386
62 Ga0075364_10038227 3300006051 Bacteria 3109
63 Ga0075364_10081776 3300006051 Bacteria 2136
64 Ga0075364_10120826 3300006051 Bacteria 1753
65 Ga0075364_10151126 3300006051 Bacteria 1565
66 Ga0075432_10001964 3300006058 Bacteria 6839
67 Ga0075432_10003091 3300006058 Bacteria 5613
68 Ga0075432_10020219 3300006058 Bacteria 2276
69 Ga0099823_1000119 3300006944 Bacteria 39691
70 Ga0079104_1000461 3300006946 Bacteria 45894
71 Ga0079104_1001117 3300006946 Bacteria 19697
72 Ga0105251_10000444 3300009011 Bacteria 40000
73 Ga0105251_10001804 3300009011 Bacteria 17773
74 Ga0105251_10007457 3300009011 Bacteria 6739
75 Ga0105251_10008037 3300009011 Bacteria 6398
76 Ga0105251_10008502 3300009011 Bacteria 6168
77 Ga0105251_10011477 3300009011 Bacteria 5059
78 Ga0105251_10028951 3300009011 Bacteria 2795
79 Ga0105251_10030173 3300009011 Bacteria 2725
80 Ga0105251_10040456 3300009011 Bacteria 2273
81 Ga0105251_10063301 3300009011 Bacteria 1736
82 Ga0105244_10001467 3300009036 Bacteria 19052
83 Ga0105244_10002831 3300009036 Bacteria 12873
84 Ga0105244_10004314 3300009036 Bacteria 9838
85 Ga0105244_10007287 3300009036 Bacteria 7035
86 Ga0105244_10007970 3300009036 Bacteria 6669
87 Ga0105244_10009411 3300009036 Bacteria 6009
88 Ga0105244_10009684 3300009036 Bacteria 5899
89 Ga0105244_10012945 3300009036 Bacteria 4906
90 Ga0105244_10013873 3300009036 Bacteria 4683
91 Ga0105244_10014177 3300009036 Bacteria 4620
92 Ga0105244_10017103 3300009036 Bacteria 4109
93 Ga0105244_10018575 3300009036 Bacteria 3898
94 Ga0105244_10034986 3300009036 Bacteria 2641
95 Ga0105244_10035455 3300009036 Bacteria 2621
96 Ga0105244_10054187 3300009036 Bacteria 2036
97 Ga0105244_10057058 3300009036 Bacteria 1974
98 Ga0105244_10078342 3300009036 Bacteria 1639
99 Ga0105250_10003455 3300009092 Bacteria 7482
100 Ga0105250_10004255 3300009092 Bacteria 6624
101 Ga0105250_10004308 3300009092 Bacteria 6570
102 Ga0105250_10014325 3300009092 Bacteria 3261
103 Ga0105250_10017669 3300009092 Bacteria 2898
104 Ga0105250_10018457 3300009092 Bacteria 2825
105 Ga0105243_10001595 3300009148 Bacteria 19782
106 Ga0105243_10008251 3300009148 Bacteria 8000
107 Ga0105243_10009844 3300009148 Bacteria 7275
108 Ga0105243_10010135 3300009148 Bacteria 7166
109 Ga0105242_10001117 3300009176 Bacteria 21160
110 Ga0105248_10048021 3300009177 Bacteria 4788
111 Ga0105237_10000196 3300009545 Bacteria 85826
112 Ga0105237_10205898 3300009545 Bacteria 1968
113 Ga0105249_10116218 3300009553 Bacteria 2536
114 Ga0105246_10006476 3300011119 Bacteria 7153
115 Ga0105246_10007385 3300011119 Bacteria 6732
116 Ga0157345_1000469 3300012498 Bacteria 3859
117 Ga0157373_10004821 3300013100 Bacteria 10154
118 Ga0157373_10018490 3300013100 Bacteria 5073
119 Ga0157373_10033833 3300013100 Bacteria 3673
120 Ga0157373_10048042 3300013100 Bacteria 3043
121 Ga0157373_10057829 3300013100 Bacteria 2750
122 Ga0157373_10062558 3300013100 Bacteria 2636
123 Ga0157373_10080182 3300013100 Bacteria 2302
124 Ga0157373_10085256 3300013100 Bacteria 2226
125 Ga0157373_10088533 3300013100 Bacteria 2181
126 Ga0157373_10089230 3300013100 Bacteria 2171
127 Ga0157373_10168644 3300013100 Bacteria 1541
128 Ga0157373_10174245 3300013100 Bacteria 1514
129 Ga0157371_10001003 3300013102 Bacteria 31164
130 Ga0157371_10010283 3300013102 Bacteria 7299
131 Ga0157371_10013592 3300013102 Bacteria 6179
132 Ga0157371_10014075 3300013102 Bacteria 6051
133 Ga0157370_10000379 3300013104 Bacteria 56039
134 Ga0157370_10025382 3300013104 Bacteria 5866
135 Ga0157370_10040737 3300013104 Bacteria 4485
136 Ga0157370_10153605 3300013104 Bacteria 2142
137 Ga0157370_10156709 3300013104 Bacteria 2119
138 Ga0157370_10242675 3300013104 Bacteria 1667
139 Ga0157369_10008221 3300013105 Bacteria 11965
140 Ga0157369_10029419 3300013105 Bacteria 6070
141 Ga0157369_10088577 3300013105 Bacteria 3304
142 Ga0157369_10096632 3300013105 Bacteria 3151
143 Ga0157369_10105675 3300013105 Bacteria 2997
144 Ga0157369_10139264 3300013105 Bacteria 2568
145 Ga0157369_10258666 3300013105 Bacteria 1816
146 Ga0163162_10005867 3300013306 Bacteria 11881
147 Ga0163162_10023433 3300013306 Bacteria 6092
148 Ga0163162_10405391 3300013306 Bacteria 1496
149 Ga0157372_10000663 3300013307 Bacteria 37808
150 Ga0157372_10065016 3300013307 Bacteria 4094
151 Ga0157372_10187018 3300013307 Bacteria 2398
152 Ga0157375_10023422 3300013308 Bacteria 5698
153 Ga0157375_10117585 3300013308 Bacteria 2764
154 Ga0157375_10127299 3300013308 Bacteria 2663
155 Ga0157375_10271941 3300013308 Bacteria 1857
156 Ga0182008_10005424 3300014497 Bacteria 7264
157 Ga0182008_10006712 3300014497 Bacteria 6408
158 Ga0182008_10007492 3300014497 Bacteria 6022
159 Ga0182008_10008395 3300014497 Bacteria 5638
160 Ga0182008_10024766 3300014497 Bacteria 3052
161 Ga0182008_10027930 3300014497 Bacteria 2855
162 Ga0182008_10047439 3300014497 Bacteria 2134
163 Ga0182006_1004989 3300015261 Bacteria 6396
164 Ga0182006_1005031 3300015261 Bacteria 6361
165 Ga0182006_1005984 3300015261 Bacteria 5709
166 Ga0182006_1006065 3300015261 Bacteria 5654
167 Ga0182006_1007804 3300015261 Bacteria 4878
168 Ga0182006_1010985 3300015261 Bacteria 3999
169 Ga0182006_1017379 3300015261 Bacteria 3057
170 Ga0182006_1039104 3300015261 Bacteria 1873
171 Ga0182006_1041770 3300015261 Bacteria 1799
172 Ga0182006_1050403 3300015261 Bacteria 1604
173 Ga0182007_10012548 3300015262 Bacteria 3255
174 Ga0182007_10020124 3300015262 Bacteria 2391
175 Ga0182005_1002532 3300015265 Bacteria 6487
176 Ga0182005_1007638 3300015265 Bacteria 3231
177 Ga0163161_10010864 3300017792 Bacteria 6312
178 Ga0163161_10016215 3300017792 Bacteria 5200
179 Ga0163161_10041881 3300017792 Bacteria 3292
180 Ga0163161_10051432 3300017792 Bacteria 2984
181 Ga0163161_10065947 3300017792 Bacteria 2642
182 Ga0163161_10066975 3300017792 Bacteria 2622
183 Ga0163161_10077187 3300017792 Bacteria 2447
184 Ga0163161_10085500 3300017792 Bacteria 2327
185 Ga0163161_10106081 3300017792 Bacteria 2096
186 Ga0163161_10160482 3300017792 Bacteria 1714
187 Ga0209435_100620 3300025206 Bacteria 6478
188 Ga0209760_100046 3300025207 Bacteria 107840
189 Ga0209760_100318 3300025207 Bacteria 15241
190 Ga0209784_100015 3300025224 Bacteria 482117
191 Ga0209566_100012 3300025225 Bacteria 482281
192 Ga0209674_100027 3300025226 Bacteria 482281
193 Ga0209147_100019 3300025229 Bacteria 482139
194 Ga0209563_100031 3300025230 Bacteria 482281
195 Ga0207427_100001 3300025231 Bacteria 1410763
196 Ga0207427_100029 3300025231 Bacteria 376678
197 Ga0209437_100003 3300025233 Bacteria 1517827
198 Ga0209437_100009 3300025233 Bacteria 915954
199 Ga0209258_100296 3300025242 Bacteria 81403
200 Ga0209646_1000213 3300025246 Bacteria 64543
201 Ga0209677_100016 3300025253 Bacteria 482117
202 Ga0209759_1003694 3300025256 Bacteria 6000
203 Ga0209233_1000007 3300025261 Bacteria 1411234
204 Ga0209233_1000032 3300025261 Bacteria 623596
205 Ga0209675_1003103 3300025291 Bacteria 8112
206 Ga0209676_1000016 3300025292 Bacteria 655561
207 Ga0209676_1000080 3300025292 Bacteria 287400
208 Ga0209676_1000397 3300025292 Bacteria 79463
209 Ga0209676_1000973 3300025292 Bacteria 34485
210 Ga0209676_1005078 3300025292 Bacteria 7029
211 Ga0209050_1000117 3300025298 Bacteria 202979
212 Ga0209050_1000588 3300025298 Bacteria 58223
213 Ga0209050_1001195 3300025298 Bacteria 30517
214 Ga0209050_1003119 3300025298 Bacteria 12697
215 Ga0209051_1000077 3300025303 Bacteria 202959
216 Ga0209051_1000219 3300025303 Bacteria 96484
217 Ga0209051_1000422 3300025303 Bacteria 58223
218 Ga0209051_1016203 3300025303 Bacteria 3388
219 Ga0209257_1000342 3300025304 Bacteria 97045
220 Ga0209257_1014089 3300025304 Bacteria 3475
221 Ga0207656_10000014 3300025321 Bacteria 146941
222 Ga0207696_1000032 3300025711 Bacteria 380071
223 Ga0207696_1000141 3300025711 Bacteria 127091
224 Ga0207696_1000144 3300025711 Bacteria 122345
225 Ga0207696_1000221 3300025711 Bacteria 82620
226 Ga0207696_1004122 3300025711 Bacteria 6356
227 Ga0207696_1005797 3300025711 Bacteria 5074
228 Ga0207696_1006936 3300025711 Bacteria 4493
229 Ga0207696_1010537 3300025711 Bacteria 3383
230 Ga0207696_1012284 3300025711 Bacteria 3033
231 Ga0207696_1014106 3300025711 Bacteria 2753
232 Ga0207696_1022179 3300025711 Bacteria 2022
233 Ga0207655_1000005 3300025728 Bacteria 917277
234 Ga0207655_1000563 3300025728 Bacteria 46042
235 Ga0207655_1000930 3300025728 Bacteria 30394
236 Ga0207655_1001253 3300025728 Bacteria 24224
237 Ga0207655_1002193 3300025728 Bacteria 16206
238 Ga0207655_1002689 3300025728 Bacteria 13959
239 Ga0207655_1003258 3300025728 Bacteria 12184
240 Ga0207655_1004244 3300025728 Bacteria 10264
241 Ga0207655_1009126 3300025728 Bacteria 6200
242 Ga0207655_1012023 3300025728 Bacteria 5099
243 Ga0207655_1012187 3300025728 Bacteria 5047
244 Ga0207655_1018134 3300025728 Bacteria 3754
245 Ga0207655_1021522 3300025728 Bacteria 3270
246 Ga0207655_1022539 3300025728 Bacteria 3153
247 Ga0207655_1025870 3300025728 Bacteria 2835
248 Ga0207655_1033085 3300025728 Bacteria 2350
249 Ga0207655_1037320 3300025728 Bacteria 2141
250 Ga0207713_1000085 3300025735 Bacteria 160800
251 Ga0207713_1000098 3300025735 Bacteria 143900
252 Ga0207713_1000999 3300025735 Bacteria 24784
253 Ga0207713_1001704 3300025735 Bacteria 16975
254 Ga0207713_1001749 3300025735 Bacteria 16666
255 Ga0207713_1002013 3300025735 Bacteria 15242
256 Ga0207713_1002569 3300025735 Bacteria 13108
257 Ga0207713_1003301 3300025735 Bacteria 11090
258 Ga0207713_1005235 3300025735 Bacteria 8177
259 Ga0207713_1007333 3300025735 Bacteria 6532
260 Ga0207713_1008659 3300025735 Bacteria 5820
261 Ga0207713_1011794 3300025735 Bacteria 4719
262 Ga0207713_1012117 3300025735 Bacteria 4635
263 Ga0207713_1016770 3300025735 Bacteria 3706
264 Ga0207713_1019531 3300025735 Bacteria 3310
265 Ga0207713_1030125 3300025735 Bacteria 2419
266 Ga0207671_10000019 3300025914 Bacteria 317781
267 Ga0207671_10165529 3300025914 Bacteria 1714
268 Ga0207649_10000002 3300025920 Bacteria 498633
269 Ga0207681_10000149 3300025923 Bacteria 58528
270 Ga0207650_10000198 3300025925 Bacteria 69296
271 Ga0207650_10000363 3300025925 Bacteria 43515
272 Ga0207706_10016327 3300025933 Bacteria 6703
273 Ga0207686_10002119 3300025934 Bacteria 10922
274 Ga0207709_10000228 3300025935 Bacteria 70988
275 Ga0207709_10009665 3300025935 Bacteria 5313
276 Ga0207709_10010352 3300025935 Bacteria 5136
277 Ga0207709_10028654 3300025935 Bacteria 3221
278 Ga0207709_10050279 3300025935 Bacteria 2549
279 Ga0207711_10027344 3300025941 Bacteria 4791
280 Ga0207679_10000006 3300025945 Bacteria 498868
281 Ga0207679_10045261 3300025945 Bacteria 3181
282 Ga0207640_10022738 3300025981 Bacteria 3758
283 Ga0207639_10011804 3300026041 Bacteria 6073
284 Ga0209281_1000013 3300027111 Bacteria 653449
285 Ga0209281_1000015 3300027111 Bacteria 590084
286 Ga0209281_1002821 3300027111 Bacteria 6389
287 Ga0209389_1000205 3300027296 Bacteria 42388
288 Ga0209389_1071430 3300027296 Bacteria 1890
289 Ga0209371_1000142 3300027312 Bacteria 118726
290 Ga0209371_1000584 3300027312 Bacteria 32775
291 Ga0209371_1007191 3300027312 Bacteria 3932
292 Ga0209974_10024025 3300027876 Bacteria 2017
293 Ga0209974_10027442 3300027876 Bacteria 1884
294 Ga0207428_10036429 3300027907 Bacteria 4013
295 Ga0207428_10046472 3300027907 Bacteria 3492
296 Ga0207428_10059352 3300027907 Bacteria 3034
297 Ga0207428_10093391 3300027907 Bacteria 2334
298 Ga0268266_10015218 3300028379 Bacteria 6607
299 Ga0307517_10145124 3300028786 Bacteria 1650
300 Ga0268256_1000111 3300030500 Bacteria 118726
301 Ga0268256_1000436 3300030500 Bacteria 37153
302 Ga0307511_10089532 3300030521 Bacteria 2096
303 Ga0316177_1013888 3300030731 Bacteria 2726
304 Ga0316178_1009525 3300030735 Bacteria 55280
305 Ga0316181_1203960 3300030744 Bacteria 6926
306 Ga0307509_10168619 3300031507 Bacteria 2073
307 Ga0307408_100000025 3300031548 Bacteria 267563
308 Ga0307408_100009974 3300031548 Bacteria 6257
309 Ga0307408_100050067 3300031548 Bacteria 3002
310 Ga0307408_100091211 3300031548 Bacteria 2300
311 Ga0307408_100097838 3300031548 Bacteria 2229
312 Ga0307408_100205357 3300031548 Bacteria 1597
313 Ga0307405_10003250 3300031731 Bacteria 7415
314 Ga0307405_10004727 3300031731 Bacteria 6482
315 Ga0307405_10031170 3300031731 Bacteria 3135
316 Ga0307405_10045062 3300031731 Bacteria 2700
317 Ga0307405_10163014 3300031731 Bacteria 1581
318 Ga0307413_10024705 3300031824 Bacteria 3281
319 Ga0307413_10083500 3300031824 Bacteria 2056
320 Ga0307406_10020867 3300031901 Bacteria 3866
321 Ga0307406_10029874 3300031901 Bacteria 3304
322 Ga0307412_10006760 3300031911 Bacteria 6500
323 Ga0307412_10018741 3300031911 Bacteria 4173
324 Ga0307412_10095610 3300031911 Bacteria 2089
325 Ga0307412_10115168 3300031911 Bacteria 1926
326 Ga0307412_10158503 3300031911 Bacteria 1678
327 Ga0307409_100010041 3300031995 Bacteria 5856
328 Ga0307416_100214941 3300032002 Bacteria 1838
329 Ga0307414_10083843 3300032004 Bacteria 2342
330 Ga0307411_10005099 3300032005 Bacteria 6405
331 Ga0307510_10028379 3300033180 Bacteria 6391
332 Ga0307510_10133120 3300033180 Bacteria 2152
333 Ga0439436_0000093 3300041404 Bacteria 21035
334 Ga0439438_003254 3300041405 Bacteria 6637
335 Ga0439438_004409 3300041405 Bacteria 5412
336 Ga0439438_004964 3300041405 Bacteria 4971
337 Ga0439438_005843 3300041405 Bacteria 4458
338 Ga0439438_006030 3300041405 Bacteria 4354
339 Ga0439438_008478 3300041405 Bacteria 3401
340 Ga0439438_009212 3300041405 Bacteria 3211
341 Ga0439438_010669 3300041405 Bacteria 2893
342 Ga0439438_012190 3300041405 Bacteria 2644
343 Ga0439447_000651 3300041407 Bacteria 12896
344 Ga0439447_002546 3300041407 Bacteria 6631
345 Ga0439447_003754 3300041407 Bacteria 5340
346 Ga0439447_004819 3300041407 Bacteria 4583
347 Ga0439447_007053 3300041407 Bacteria 3599
348 Ga0439447_007796 3300041407 Bacteria 3362
349 Ga0439447_007931 3300041407 Bacteria 3326
350 Ga0439447_010551 3300041407 Bacteria 2736
351 Ga0439447_017697 3300041407 Bacteria 1937
352 Ga0439447_024010 3300041407 Bacteria 1583
353 Ga0439466_0000852 3300041411 Bacteria 11637
354 Ga0439466_0002187 3300041411 Bacteria 7663
355 Ga0439466_0003023 3300041411 Bacteria 6560
356 Ga0439466_0003485 3300041411 Bacteria 6098
357 Ga0439466_0003523 3300041411 Bacteria 6055
358 Ga0439466_0008081 3300041411 Bacteria 3967
359 Ga0439466_0010364 3300041411 Bacteria 3465
360 Ga0439466_0012899 3300041411 Bacteria 3065
361 Ga0439466_0013905 3300041411 Bacteria 2939
362 Ga0439466_0021160 3300041411 Bacteria 2309
363 Ga0439466_0039524 3300041411 Bacteria 1580
364 Ga0439466_0041114 3300041411 Bacteria 1544
365 Ga0439431_0004876 3300041997 Bacteria 2958
366 Ga0439431_0021268 3300041997 Bacteria 1556
367 Ga0439437_001599 3300042000 Bacteria 2385
368 Ga0439432_002957 3300042006 Bacteria 6330
369 Ga0439432_003013 3300042006 Bacteria 6270
370 Ga0439432_003671 3300042006 Bacteria 5676
371 Ga0439432_003789 3300042006 Bacteria 5580
372 Ga0439432_005523 3300042006 Bacteria 4548
373 Ga0439432_006565 3300042006 Bacteria 4148
374 Ga0439432_008167 3300042006 Bacteria 3682
375 Ga0439432_021041 3300042006 Bacteria 2164
376 Ga0439432_047018 3300042006 Bacteria 1354
377 Ga0439451_002017 3300042009 Bacteria 4072
378 Ga0439451_003275 3300042009 Bacteria 3282
379 Ga0439452_002598 3300042010 Bacteria 6621
380 Ga0439452_002747 3300042010 Bacteria 6367
381 Ga0439452_006199 3300042010 Bacteria 3765
382 Ga0439452_006834 3300042010 Bacteria 3541
383 Ga0439456_000040 3300042013 Bacteria 47854
384 Ga0439456_001602 3300042013 Bacteria 4559
385 Ga0439456_004857 3300042013 Bacteria 2723
386 Ga0439456_023210 3300042013 Bacteria 1315
387 Ga0439463_000561 3300042016 Bacteria 10392
388 Ga0439463_015148 3300042016 Bacteria 1906
389 Ga0450911_000005 3300042115 Bacteria 233469
390 Ga0450911_001924 3300042115 Bacteria 4357
391 Ga0450911_002077 3300042115 Bacteria 4113
392 Ga0450911_002943 3300042115 Bacteria 3150
393 Ga0450911_003696 3300042115 Bacteria 2642
394 Ga0450919_000955 3300042121 Bacteria 3744
395 Ga0450920_001171 3300042122 Bacteria 4307
396 Ga0450922_000599 3300042124 Bacteria 3761
397 Ga0450890_000840 3300042127 Bacteria 4428
398 Ga0450900_001524 3300042136 Bacteria 2277
399 Ga0450902_001735 3300042137 Bacteria 3008
400 Ga0450902_002578 3300042137 Bacteria 2577
401 Ga0450903_001143 3300042138 Bacteria 5026
402 Ga0450904_000002 3300042139 Bacteria 82376
403 Ga0450905_001357 3300042142 Bacteria 3109
404 Ga0450906_002331 3300042145 Bacteria 4159
405 Ga0450906_003212 3300042145 Bacteria 3531
406 Ga0450907_000909 3300042146 Bacteria 7057
407 Ga0450907_003483 3300042146 Bacteria 2803
408 Ga0439446_0001273 3300042156 Bacteria 5662
409 Ga0439446_0004584 3300042156 Bacteria 3505
410 Ga0439446_0006568 3300042156 Bacteria 3039
411 Ga0439446_0007496 3300042156 Bacteria 2869
412 Ga0450908_002663 3300042184 Bacteria 3501
413 Ga0450908_006620 3300042184 Bacteria 2194
414 Ga0450909_000803 3300042185 Bacteria 4259
415 Ga0450909_001988 3300042185 Bacteria 2882
416 Ga0439434_0001746 3300042435 Bacteria 6302
417 Ga0439434_0014034 3300042435 Bacteria 2382
418 Ga0439464_0001948 3300042439 Bacteria 4998
419 Ga0439464_0007327 3300042439 Bacteria 2883
420 Ga0439460_0003622 3300042461 Bacteria 3738
421 Ga0439460_0005683 3300042461 Bacteria 3071
422 Ga0439460_0011540 3300042461 Bacteria 2279
423 Ga0450918_005008 3300042531 Bacteria 2386
424 Ga0450893_0001345 3300042532 Bacteria 3735
425 Ga0450901_000214 3300042533 Bacteria 6896
426 Ga0439440_0002345 3300042993 Bacteria 3565
427 Ga0439440_0004880 3300042993 Bacteria 2645
428 Ga0495617_003091 3300046452 Bacteria 6341
429 Ga0495617_003447 3300046452 Bacteria 5955
430 Ga0495617_010871 3300046452 Bacteria 3116
431 Ga0495617_018335 3300046452 Bacteria 2366
432 Ga0495617_026339 3300046452 Bacteria 1957
433 Ga0495617_035093 3300046452 Bacteria 1684
434 Ga0495627_000424 3300046453 Bacteria 36677
435 Ga0495627_000496 3300046453 Bacteria 33018
436 Ga0495627_001316 3300046453 Bacteria 15137
437 Ga0495627_004068 3300046453 Bacteria 6227
438 Ga0495627_005036 3300046453 Bacteria 5404
439 Ga0495627_013431 3300046453 Bacteria 2880
440 Ga0495627_014503 3300046453 Bacteria 2749
441 Ga0495627_021734 3300046453 Bacteria 2121
442 Ga0495627_031744 3300046453 Bacteria 1665
443 Ga0495592_0094847 3300046454 Bacteria 2135
444 Ga0495603_0071200 3300046455 Bacteria 2044
445 Ga0495603_0161537 3300046455 Bacteria 1299
446 Ga0495590_0003495 3300046457 Bacteria 6417
447 Ga0495590_0003677 3300046457 Bacteria 6243
448 Ga0495590_0004086 3300046457 Bacteria 5917
449 Ga0495590_0007358 3300046457 Bacteria 4251
450 Ga0495590_0014884 3300046457 Bacteria 2834
451 Ga0495591_000212 3300046458 Bacteria 58623
452 Ga0495591_000705 3300046458 Bacteria 24276
453 Ga0495591_000849 3300046458 Bacteria 21493
454 Ga0495591_002195 3300046458 Bacteria 11159
455 Ga0495591_003156 3300046458 Bacteria 8711
456 Ga0495591_005095 3300046458 Bacteria 6170
457 Ga0495591_014480 3300046458 Bacteria 2832
458 Ga0495591_014727 3300046458 Bacteria 2794
459 Ga0495591_015504 3300046458 Bacteria 2688
460 Ga0495591_015764 3300046458 Bacteria 2658
461 Ga0495591_017816 3300046458 Bacteria 2426
462 Ga0495591_022496 3300046458 Bacteria 2035
463 Ga0495591_028401 3300046458 Bacteria 1711
464 Ga0495591_043357 3300046458 Bacteria 1266
465 Ga0495591_051607 3300046458 Bacteria 1121
466 Ga0495629_0012820 3300046459 Bacteria 6065
467 Ga0495638_0006152 3300046460 Bacteria 8770
468 Ga0495638_0009903 3300046460 Bacteria 6650
469 Ga0495638_0009918 3300046460 Bacteria 6646
470 Ga0495638_0012321 3300046460 Bacteria 5864
471 Ga0495638_0023683 3300046460 Bacteria 4011
472 Ga0495638_0038736 3300046460 Bacteria 3027
473 Ga0495638_0039400 3300046460 Bacteria 3000
474 Ga0495638_0049828 3300046460 Bacteria 2617
475 Ga0495638_0055790 3300046460 Bacteria 2452
476 Ga0495638_0069703 3300046460 Bacteria 2154
477 Ga0495638_0090252 3300046460 Bacteria 1847
478 Ga0495638_0165385 3300046460 Bacteria 1273
479 Ga0495653_0014045 3300046463 Bacteria 6529
480 Ga0495653_0018252 3300046463 Bacteria 5701
481 Ga0495653_0035518 3300046463 Bacteria 3932
482 Ga0495653_0062795 3300046463 Bacteria 2805
483 Ga0495650_0001154 3300046471 Bacteria 28448
484 Ga0495650_0012313 3300046471 Bacteria 4608
485 Ga0495650_0025606 3300046471 Bacteria 2760
486 Ga0495650_0026664 3300046471 Bacteria 2682
487 Ga0495650_0026942 3300046471 Bacteria 2663
488 Ga0495650_0029516 3300046471 Bacteria 2498
489 Ga0495650_0030766 3300046471 Bacteria 2425
490 Ga0495650_0033501 3300046471 Bacteria 2285
491 Ga0495650_0036117 3300046471 Bacteria 2166
492 Ga0495605_0000323 3300046474 Bacteria 49229
493 Ga0495605_0000449 3300046474 Bacteria 36901
494 Ga0495605_0000461 3300046474 Bacteria 36449
495 Ga0495605_0001417 3300046474 Bacteria 15714
496 Ga0495605_0003084 3300046474 Bacteria 10047
497 Ga0495605_0006537 3300046474 Bacteria 6692
498 Ga0495605_0010728 3300046474 Bacteria 5119
499 Ga0495605_0025145 3300046474 Bacteria 3104
500 Ga0495605_0036277 3300046474 Bacteria 2486
501 Ga0495605_0041984 3300046474 Bacteria 2275
502 Ga0495605_0042518 3300046474 Bacteria 2258
503 Ga0495605_0045077 3300046474 Bacteria 2175
504 Ga0495605_0078396 3300046474 Bacteria 1548
505 Ga0495639_0003672 3300046475 Bacteria 6610
506 Ga0495584_0005790 3300046491 Bacteria 6518
507 Ga0495584_0007014 3300046491 Bacteria 5885
508 Ga0495584_0008332 3300046491 Bacteria 5368
509 Ga0495584_0008693 3300046491 Bacteria 5251
510 Ga0495584_0009943 3300046491 Bacteria 4887
511 Ga0495584_0023749 3300046491 Bacteria 3108
512 Ga0495584_0028508 3300046491 Bacteria 2829
513 Ga0495584_0031381 3300046491 Bacteria 2689
514 Ga0495584_0032736 3300046491 Bacteria 2630
515 Ga0495584_0033183 3300046491 Bacteria 2611
516 Ga0495584_0037625 3300046491 Bacteria 2446
517 Ga0495584_0046416 3300046491 Bacteria 2191
518 Ga0495584_0061524 3300046491 Bacteria 1887
519 Ga0495584_0159988 3300046491 Bacteria 1144
520 Ga0495585_0001500 3300046492 Bacteria 18178
521 Ga0495585_0002713 3300046492 Bacteria 12379
522 Ga0495585_0008592 3300046492 Bacteria 6182
523 Ga0495585_0019144 3300046492 Bacteria 3950
524 Ga0495585_0032159 3300046492 Bacteria 2974
525 Ga0495585_0040650 3300046492 Bacteria 2610
526 Ga0495585_0043611 3300046492 Bacteria 2507
527 Ga0495594_0003153 3300046499 Bacteria 8527
528 Ga0495594_0007071 3300046499 Bacteria 5771
529 Ga0495594_0044200 3300046499 Bacteria 2443
530 Ga0495594_0058014 3300046499 Bacteria 2138
531 Ga0495596_0001940 3300046500 Bacteria 11437
532 Ga0495596_0021699 3300046500 Bacteria 2618
533 Ga0495596_0036024 3300046500 Bacteria 1961
534 Ga0495607_0000276 3300046501 Bacteria 55274
535 Ga0495607_0000490 3300046501 Bacteria 39577
536 Ga0495607_0000544 3300046501 Bacteria 36921
537 Ga0495607_0000841 3300046501 Bacteria 29029
538 Ga0495607_0009593 3300046501 Bacteria 6541
539 Ga0495607_0010798 3300046501 Bacteria 6113
540 Ga0495607_0013540 3300046501 Bacteria 5342
541 Ga0495607_0014789 3300046501 Bacteria 5072
542 Ga0495607_0017407 3300046501 Bacteria 4613
543 Ga0495607_0024779 3300046501 Bacteria 3736
544 Ga0495607_0033027 3300046501 Bacteria 3151
545 Ga0495607_0039066 3300046501 Bacteria 2836
546 Ga0495607_0044385 3300046501 Bacteria 2621
547 Ga0495607_0045368 3300046501 Bacteria 2586
548 Ga0495607_0052900 3300046501 Bacteria 2349
549 Ga0495607_0057922 3300046501 Bacteria 2218
550 Ga0495607_0079470 3300046501 Bacteria 1806
551 Ga0495583_0000861 3300046506 Bacteria 36885
552 Ga0495583_0000884 3300046506 Bacteria 36045
553 Ga0495583_0003593 3300046506 Bacteria 11646
554 Ga0495583_0006924 3300046506 Bacteria 7281
555 Ga0495583_0007820 3300046506 Bacteria 6641
556 Ga0495583_0009592 3300046506 Bacteria 5766
557 Ga0495583_0012311 3300046506 Bacteria 4851
558 Ga0495583_0019069 3300046506 Bacteria 3590
559 Ga0495583_0030826 3300046506 Bacteria 2606
560 Ga0495583_0039244 3300046506 Bacteria 2231
561 Ga0495583_0050083 3300046506 Bacteria 1910
562 Ga0495606_0000126 3300046507 Bacteria 129862
563 Ga0495606_0001804 3300046507 Bacteria 27243
564 Ga0495606_0012966 3300046507 Bacteria 6633
565 Ga0495606_0013781 3300046507 Bacteria 6357
566 Ga0495606_0014283 3300046507 Bacteria 6209
567 Ga0495606_0021690 3300046507 Bacteria 4699
568 Ga0495606_0035179 3300046507 Bacteria 3427
569 Ga0495606_0040580 3300046507 Bacteria 3128
570 Ga0495606_0046372 3300046507 Bacteria 2873
571 Ga0495606_0051868 3300046507 Bacteria 2673
572 Ga0495606_0052189 3300046507 Bacteria 2660
573 Ga0495606_0054681 3300046507 Bacteria 2584
574 Ga0495606_0220576 3300046507 Bacteria 1068
575 Ga0495610_0008795 3300046512 Bacteria 6476
576 Ga0495610_0008883 3300046512 Bacteria 6436
577 Ga0495610_0013631 3300046512 Bacteria 4821
578 Ga0495610_0014361 3300046512 Bacteria 4654
579 Ga0495610_0014921 3300046512 Bacteria 4542
580 Ga0495610_0016882 3300046512 Bacteria 4182
581 Ga0495610_0017804 3300046512 Bacteria 4039
582 Ga0495610_0027734 3300046512 Bacteria 3004
583 Ga0495610_0030111 3300046512 Bacteria 2848
584 Ga0495610_0030290 3300046512 Bacteria 2837
585 Ga0495610_0054465 3300046512 Bacteria 1932
586 Ga0495616_0007633 3300046513 Bacteria 6471
587 Ga0495616_0007791 3300046513 Bacteria 6391
588 Ga0495616_0007910 3300046513 Bacteria 6340
589 Ga0495616_0033660 3300046513 Bacteria 2667
590 Ga0495616_0033879 3300046513 Bacteria 2656
591 Ga0495616_0038378 3300046513 Bacteria 2459
592 Ga0495616_0049366 3300046513 Bacteria 2109
593 Ga0495616_0080511 3300046513 Bacteria 1559
594 Ga0495620_0000003 3300046515 Bacteria 345923
595 Ga0495620_0000516 3300046515 Bacteria 24935
596 Ga0495620_0000978 3300046515 Bacteria 17616
597 Ga0495620_0003310 3300046515 Bacteria 9242
598 Ga0495620_0005086 3300046515 Bacteria 7364
599 Ga0495620_0007956 3300046515 Bacteria 5716
600 Ga0495620_0009460 3300046515 Bacteria 5182
601 Ga0495620_0017526 3300046515 Bacteria 3567
602 Ga0495620_0019258 3300046515 Bacteria 3361
603 Ga0495620_0022738 3300046515 Bacteria 3012
604 Ga0495620_0033248 3300046515 Bacteria 2342
605 Ga0495620_0041314 3300046515 Bacteria 2023
606 Ga0495620_0045322 3300046515 Bacteria 1905
607 Ga0495630_0013903 3300046517 Bacteria 5854
608 Ga0495630_0123722 3300046517 Bacteria 1962
609 Ga0495631_0001509 3300046518 Bacteria 14031
610 Ga0495631_0004763 3300046518 Bacteria 7164
611 Ga0495631_0006906 3300046518 Bacteria 5821
612 Ga0495631_0007551 3300046518 Bacteria 5528
613 Ga0495631_0009381 3300046518 Bacteria 4889
614 Ga0495631_0009971 3300046518 Bacteria 4722
615 Ga0495631_0025283 3300046518 Bacteria 2736
616 Ga0495631_0029883 3300046518 Bacteria 2476
617 Ga0495631_0038112 3300046518 Bacteria 2138
618 Ga0495632_0001207 3300046519 Bacteria 21937
619 Ga0495632_0005580 3300046519 Bacteria 8284
620 Ga0495632_0007982 3300046519 Bacteria 6569
621 Ga0495632_0009416 3300046519 Bacteria 5894
622 Ga0495632_0009676 3300046519 Bacteria 5787
623 Ga0495632_0011706 3300046519 Bacteria 5106
624 Ga0495632_0012207 3300046519 Bacteria 4962
625 Ga0495632_0018900 3300046519 Bacteria 3766
626 Ga0495632_0025242 3300046519 Bacteria 3145
627 Ga0495632_0030481 3300046519 Bacteria 2798
628 Ga0495632_0030659 3300046519 Bacteria 2788
629 Ga0495632_0053437 3300046519 Bacteria 1983
630 Ga0495632_0065406 3300046519 Bacteria 1756
631 Ga0495637_0000446 3300046520 Bacteria 30145
632 Ga0495637_0001947 3300046520 Bacteria 11672
633 Ga0495637_0002660 3300046520 Bacteria 9771
634 Ga0495637_0006437 3300046520 Bacteria 5893
635 Ga0495637_0007193 3300046520 Bacteria 5541
636 Ga0495637_0008755 3300046520 Bacteria 4959
637 Ga0495637_0018137 3300046520 Bacteria 3268
638 Ga0495637_0022752 3300046520 Bacteria 2855
639 Ga0495637_0026401 3300046520 Bacteria 2607
640 Ga0495637_0028614 3300046520 Bacteria 2487
641 Ga0495637_0028822 3300046520 Bacteria 2476
642 Ga0495637_0029901 3300046520 Bacteria 2420
643 Ga0495637_0032869 3300046520 Bacteria 2282
644 Ga0495637_0032916 3300046520 Bacteria 2280
645 Ga0495637_0035230 3300046520 Bacteria 2187
646 Ga0495643_0004299 3300046522 Bacteria 10036
647 Ga0495643_0004831 3300046522 Bacteria 9285
648 Ga0495643_0006764 3300046522 Bacteria 7498
649 Ga0495643_0007134 3300046522 Bacteria 7252
650 Ga0495643_0008154 3300046522 Bacteria 6666
651 Ga0495643_0009904 3300046522 Bacteria 5892
652 Ga0495643_0012725 3300046522 Bacteria 5064
653 Ga0495643_0023079 3300046522 Bacteria 3540
654 Ga0495643_0037882 3300046522 Bacteria 2642
655 Ga0495643_0044775 3300046522 Bacteria 2403
656 Ga0495643_0065067 3300046522 Bacteria 1925
657 Ga0495644_0003103 3300046523 Bacteria 6577
658 Ga0495644_0003231 3300046523 Bacteria 6438
659 Ga0495644_0006248 3300046523 Bacteria 4626
660 Ga0495644_0021708 3300046523 Bacteria 2447
661 Ga0495644_0022909 3300046523 Bacteria 2379
662 Ga0495644_0027802 3300046523 Bacteria 2142
663 Ga0495648_0004261 3300046524 Bacteria 12272
664 Ga0495648_0004858 3300046524 Bacteria 11342
665 Ga0495648_0008836 3300046524 Bacteria 7884
666 Ga0495648_0012265 3300046524 Bacteria 6402
667 Ga0495648_0013921 3300046524 Bacteria 5922
668 Ga0495648_0021765 3300046524 Bacteria 4433
669 Ga0495648_0042220 3300046524 Bacteria 2871
670 Ga0495648_0042360 3300046524 Bacteria 2864
671 Ga0495648_0047034 3300046524 Bacteria 2670
672 Ga0495648_0047544 3300046524 Bacteria 2650
673 Ga0495648_0053476 3300046524 Bacteria 2446
674 Ga0495648_0056587 3300046524 Bacteria 2358
675 Ga0495648_0066999 3300046524 Bacteria 2101
676 Ga0495648_0069958 3300046524 Bacteria 2040
677 Ga0495648_0077715 3300046524 Bacteria 1901
678 Ga0495648_0090023 3300046524 Bacteria 1720
679 Ga0495666_0005580 3300046526 Bacteria 6339
680 Ga0495666_0006158 3300046526 Bacteria 6035
681 Ga0495666_0050998 3300046526 Bacteria 1989
682 Ga0495642_0003043 3300046528 Bacteria 6675
683 Ga0495642_0003361 3300046528 Bacteria 6321
684 Ga0495642_0022602 3300046528 Bacteria 2478
685 Ga0495654_0001936 3300046530 Bacteria 13693
686 Ga0495654_0002672 3300046530 Bacteria 11298
687 Ga0495654_0002755 3300046530 Bacteria 11076
688 Ga0495654_0005709 3300046530 Bacteria 7174
689 Ga0495654_0006331 3300046530 Bacteria 6731
690 Ga0495654_0008436 3300046530 Bacteria 5692
691 Ga0495654_0009670 3300046530 Bacteria 5280
692 Ga0495654_0011474 3300046530 Bacteria 4793
693 Ga0495654_0013810 3300046530 Bacteria 4311
694 Ga0495654_0015005 3300046530 Bacteria 4116
695 Ga0495654_0017518 3300046530 Bacteria 3765
696 Ga0495654_0029365 3300046530 Bacteria 2804
697 Ga0495654_0030687 3300046530 Bacteria 2733
698 Ga0495654_0030788 3300046530 Bacteria 2728
699 Ga0495654_0034737 3300046530 Bacteria 2542
700 Ga0495654_0041519 3300046530 Bacteria 2287
701 Ga0495654_0043644 3300046530 Bacteria 2221
702 Ga0495654_0050028 3300046530 Bacteria 2043
703 Ga0495654_0065182 3300046530 Bacteria 1739
704 Ga0495654_0069559 3300046530 Bacteria 1671
705 Ga0495654_0078598 3300046530 Bacteria 1551
706 Ga0495654_0091031 3300046530 Bacteria 1415
707 Ga0495587_0024003 3300046536 Bacteria 3742
708 Ga0495587_0064687 3300046536 Bacteria 2136
709 Ga0495609_0000153 3300046538 Bacteria 71744
710 Ga0495609_0000210 3300046538 Bacteria 58516
711 Ga0495609_0000371 3300046538 Bacteria 38670
712 Ga0495609_0005574 3300046538 Bacteria 6571
713 Ga0495609_0014046 3300046538 Bacteria 3771
714 Ga0495609_0017290 3300046538 Bacteria 3349
715 Ga0495609_0020625 3300046538 Bacteria 3043
716 Ga0495609_0025491 3300046538 Bacteria 2710
717 Ga0495609_0044385 3300046538 Bacteria 1993
718 Ga0495609_0058318 3300046538 Bacteria 1707
719 Ga0495597_0000098 3300046542 Bacteria 77976
720 Ga0495597_0005350 3300046542 Bacteria 6804
721 Ga0495597_0009283 3300046542 Bacteria 4869
722 Ga0495597_0013802 3300046542 Bacteria 3861
723 Ga0495597_0019851 3300046542 Bacteria 3138
724 Ga0495597_0022596 3300046542 Bacteria 2915
725 Ga0495597_0024535 3300046542 Bacteria 2782
726 Ga0495597_0029426 3300046542 Bacteria 2507
727 Ga0495597_0048073 3300046542 Bacteria 1887
728 Ga0495597_0056581 3300046542 Bacteria 1717
729 Ga0495597_0064356 3300046542 Bacteria 1592
730 Ga0495645_0096861 3300046543 Bacteria 2102
731 Ga0495622_0004051 3300046557 Bacteria 6839
732 Ga0495622_0009350 3300046557 Bacteria 4533
733 Ga0495622_0010472 3300046557 Bacteria 4283
734 Ga0495622_0023077 3300046557 Bacteria 2900
735 Ga0495622_0028945 3300046557 Bacteria 2588
736 Ga0495622_0033065 3300046557 Bacteria 2414
737 Ga0495633_0000300 3300046558 Bacteria 56356
738 Ga0495633_0025843 3300046558 Bacteria 2887
739 Ga0495633_0034075 3300046558 Bacteria 2451
740 Ga0495633_0034429 3300046558 Bacteria 2436
741 Ga0495633_0118614 3300046558 Bacteria 1226
742 Ga0495633_0137319 3300046558 Bacteria 1131
743 Ga0495656_0005331 3300046615 Bacteria 4433
744 Ga0495668_0008003 3300046616 Bacteria 6661
745 Ga0495668_0008328 3300046616 Bacteria 6492
746 Ga0495668_0023940 3300046616 Bacteria 3475
747 Ga0495668_0034628 3300046616 Bacteria 2831
748 Ga0495668_0050357 3300046616 Bacteria 2308
749 Ga0495668_0076730 3300046616 Bacteria 1834
750 Ga0495634_0011380 3300046642 Bacteria 6481
751 Ga0495611_0000356 3300046648 Bacteria 29864
752 Ga0495611_0007606 3300046648 Bacteria 4597
753 Ga0495611_0021575 3300046648 Bacteria 2781
754 Ga0495625_0000185 3300046660 Bacteria 97863
755 Ga0495625_0013844 3300046660 Bacteria 6460
756 Ga0495625_0014054 3300046660 Bacteria 6409
757 Ga0495625_0027510 3300046660 Bacteria 4280
758 Ga0495625_0038775 3300046660 Bacteria 3484
759 Ga0495625_0062818 3300046660 Bacteria 2623
760 Ga0495625_0079214 3300046660 Bacteria 2291
761 Ga0495625_0096036 3300046660 Bacteria 2042
762 Ga0495635_0010325 3300046663 Bacteria 6530
763 Ga0495635_0048915 3300046663 Bacteria 2914
764 Ga0495659_0002115 3300046664 Bacteria 6480
765 Ga0495659_0022507 3300046664 Bacteria 2133
766 Ga0495661_0000337 3300046665 Bacteria 51165
767 Ga0495661_0001052 3300046665 Bacteria 24486
768 Ga0495661_0001311 3300046665 Bacteria 21132
769 Ga0495661_0009582 3300046665 Bacteria 6638
770 Ga0495661_0010197 3300046665 Bacteria 6420
771 Ga0495661_0021230 3300046665 Bacteria 4235
772 Ga0495661_0028048 3300046665 Bacteria 3609
773 Ga0495661_0029343 3300046665 Bacteria 3511
774 Ga0495661_0035092 3300046665 Bacteria 3151
775 Ga0495661_0043194 3300046665 Bacteria 2772
776 Ga0495661_0056134 3300046665 Bacteria 2357
777 Ga0495661_0057573 3300046665 Bacteria 2320
778 Ga0495661_0114353 3300046665 Bacteria 1499
779 Ga0495588_0004963 3300046674 Bacteria 5906
780 Ga0495623_0077583 3300046679 Bacteria 2059
781 Ga0495646_0064847 3300046680 Bacteria 2163
782 Ga0495646_0080032 3300046680 Bacteria 1906
783 Ga0495669_0007367 3300046684 Bacteria 4612
784 Ga0495613_0083781 3300046689 Bacteria 2315
785 Ga0495613_0148495 3300046689 Bacteria 1673
786 Ga0495624_0041976 3300046690 Bacteria 2923
787 Ga0495670_0004428 3300046691 Bacteria 6889
788 Ga0495670_0006089 3300046691 Bacteria 5917
789 Ga0495670_0028236 3300046691 Bacteria 2781
790 Ga0495670_0030317 3300046691 Bacteria 2687
791 Ga0495670_0030456 3300046691 Bacteria 2680
792 Ga0495670_0059342 3300046691 Bacteria 1920
793 Ga0495670_0208151 3300046691 Bacteria 1037
794 Ga0495671_0003515 3300046692 Bacteria 9592
795 Ga0495671_0006761 3300046692 Bacteria 6598
796 Ga0495671_0008148 3300046692 Bacteria 5912
797 Ga0495671_0012380 3300046692 Bacteria 4662
798 Ga0495671_0013386 3300046692 Bacteria 4445
799 Ga0495671_0015482 3300046692 Bacteria 4085
800 Ga0495671_0015799 3300046692 Bacteria 4040
801 Ga0495671_0018946 3300046692 Bacteria 3645
802 Ga0495671_0029184 3300046692 Bacteria 2835
803 Ga0495671_0033900 3300046692 Bacteria 2598
804 Ga0495671_0041195 3300046692 Bacteria 2326
805 Ga0495671_0042057 3300046692 Bacteria 2298
806 Ga0495671_0043268 3300046692 Bacteria 2260
807 Ga0495671_0059654 3300046692 Bacteria 1884
808 Ga0495671_0113918 3300046692 Bacteria 1320
809 Ga0495649_0004217 3300046694 Bacteria 9430
810 Ga0495649_0007184 3300046694 Bacteria 6834
811 Ga0495649_0007403 3300046694 Bacteria 6696
812 Ga0495649_0007915 3300046694 Bacteria 6431
813 Ga0495649_0008102 3300046694 Bacteria 6340
814 Ga0495649_0016805 3300046694 Bacteria 4142
815 Ga0495649_0020414 3300046694 Bacteria 3716
816 Ga0495649_0024569 3300046694 Bacteria 3358
817 Ga0495649_0032381 3300046694 Bacteria 2879
818 Ga0495649_0037843 3300046694 Bacteria 2647
819 Ga0495649_0041269 3300046694 Bacteria 2524
820 Ga0495649_0043742 3300046694 Bacteria 2444
821 Ga0495649_0048349 3300046694 Bacteria 2311
822 Ga0495649_0059466 3300046694 Bacteria 2057
823 Ga0495649_0066421 3300046694 Bacteria 1935
824 Ga0495649_0066552 3300046694 Bacteria 1933
825 Ga0495649_0078791 3300046694 Bacteria 1762
826 Ga0495649_0082109 3300046694 Bacteria 1722
827 Ga0495589_0008198 3300046794 Bacteria 5464
828 Ga0495589_0010644 3300046794 Bacteria 4784
829 Ga0495589_0012260 3300046794 Bacteria 4445
830 Ga0495589_0012678 3300046794 Bacteria 4359
831 Ga0495589_0018081 3300046794 Bacteria 3617
832 Ga0495589_0028752 3300046794 Bacteria 2804
833 Ga0495589_0030792 3300046794 Bacteria 2701
834 Ga0495589_0031525 3300046794 Bacteria 2667
835 Ga0495589_0032590 3300046794 Bacteria 2619
836 Ga0495589_0063307 3300046794 Bacteria 1814
837 Ga0495600_0032406 3300046809 Bacteria 3390
838 Ga0495600_0062723 3300046809 Bacteria 2428
839 Ga0495660_0000879 3300046810 Bacteria 22220
840 Ga0495660_0000911 3300046810 Bacteria 21797
841 Ga0495660_0007405 3300046810 Bacteria 6443
842 Ga0495660_0011710 3300046810 Bacteria 5088
843 Ga0495660_0012115 3300046810 Bacteria 5002
844 Ga0495660_0030837 3300046810 Bacteria 3018
845 Ga0495660_0038308 3300046810 Bacteria 2665
846 Ga0495660_0041728 3300046810 Bacteria 2538
847 Ga0495660_0041803 3300046810 Bacteria 2535
848 Ga0495660_0054886 3300046810 Bacteria 2158
849 Ga0495660_0057143 3300046810 Bacteria 2105
850 Ga0495660_0070914 3300046810 Bacteria 1848
851 Ga0495660_0096417 3300046810 Bacteria 1528
852 Ga0495660_0135506 3300046810 Bacteria 1230
853 Ga0495581_0047661 3300047315 Bacteria 2476
854 Ga0495604_0070557 3300047317 Bacteria 2645
855 Ga0495604_0073920 3300047317 Bacteria 2570
856 Ga0495636_0008432 3300047318 Bacteria 4066
857 Ga0495636_0009655 3300047318 Bacteria 3800
858 Ga0495674_0020264 3300047319 Bacteria 6158
859 Ga0495672_0002900 3300047320 Bacteria 15176
860 Ga0495672_0003149 3300047320 Bacteria 14361
861 Ga0495672_0009858 3300047320 Bacteria 6872
862 Ga0495672_0010640 3300047320 Bacteria 6535
863 Ga0495672_0010775 3300047320 Bacteria 6488
864 Ga0495672_0010851 3300047320 Bacteria 6463
865 Ga0495672_0011221 3300047320 Bacteria 6333
866 Ga0495672_0011985 3300047320 Bacteria 6075
867 Ga0495672_0013592 3300047320 Bacteria 5608
868 Ga0495672_0015069 3300047320 Bacteria 5262
869 Ga0495672_0017667 3300047320 Bacteria 4764
870 Ga0495672_0031946 3300047320 Bacteria 3281
871 Ga0495672_0043226 3300047320 Bacteria 2711
872 Ga0495672_0045105 3300047320 Bacteria 2641
873 Ga0495672_0047701 3300047320 Bacteria 2545
874 Ga0495672_0088443 3300047320 Bacteria 1707
875 Ga0495676_0000126 3300047321 Bacteria 58187
876 Ga0495676_0007663 3300047321 Bacteria 9903
877 Ga0495676_0064510 3300047321 Bacteria 2847
878 Ga0495676_0092956 3300047321 Bacteria 2250
879 Ga0495680_0018110 3300047322 Bacteria 5991
880 Ga0495680_0023388 3300047322 Bacteria 5139
881 Ga0495680_0043242 3300047322 Bacteria 3568
882 Ga0495680_0109849 3300047322 Bacteria 2044
883 Ga0495683_0000223 3300047323 Bacteria 53222
884 Ga0495683_0000371 3300047323 Bacteria 36984
885 Ga0495683_0005755 3300047323 Bacteria 6830
886 Ga0495683_0006298 3300047323 Bacteria 6491
887 Ga0495683_0006407 3300047323 Bacteria 6433
888 Ga0495683_0012783 3300047323 Bacteria 4404
889 Ga0495683_0015012 3300047323 Bacteria 4034
890 Ga0495683_0052478 3300047323 Bacteria 2035
891 Ga0495683_0056568 3300047323 Bacteria 1951
892 Ga0495683_0061874 3300047323 Bacteria 1853
893 Ga0495683_0103491 3300047323 Bacteria 1366
894 Ga0495683_0153176 3300047323 Bacteria 1071
895 Ga0495687_007445 3300047443 Bacteria 6444
896 Ga0495687_024756 3300047443 Bacteria 2848
897 Ga0495687_026480 3300047443 Bacteria 2728
898 Ga0495687_026699 3300047443 Bacteria 2713
899 Ga0495675_0007938 3300047444 Bacteria 6561
900 Ga0495677_0013544 3300047445 Bacteria 2968
901 Ga0495679_000697 3300047446 Bacteria 21860
902 Ga0495679_002279 3300047446 Bacteria 9901
903 Ga0495679_004955 3300047446 Bacteria 6005
904 Ga0495679_007094 3300047446 Bacteria 4725
905 Ga0495679_009011 3300047446 Bacteria 4020
906 Ga0495679_016385 3300047446 Bacteria 2682
907 Ga0495679_019183 3300047446 Bacteria 2409
908 Ga0495679_026441 3300047446 Bacteria 1927
909 Ga0495673_0002111 3300047469 Bacteria 14461
910 Ga0495673_0005416 3300047469 Bacteria 7717
911 Ga0495673_0006814 3300047469 Bacteria 6668
912 Ga0495673_0006881 3300047469 Bacteria 6627
913 Ga0495673_0006946 3300047469 Bacteria 6591
914 Ga0495673_0007009 3300047469 Bacteria 6549
915 Ga0495673_0007050 3300047469 Bacteria 6518
916 Ga0495673_0007400 3300047469 Bacteria 6314
917 Ga0495673_0009037 3300047469 Bacteria 5538
918 Ga0495673_0011935 3300047469 Bacteria 4640
919 Ga0495673_0012102 3300047469 Bacteria 4595
920 Ga0495673_0013279 3300047469 Bacteria 4333
921 Ga0495673_0023959 3300047469 Bacteria 2959
922 Ga0495673_0027576 3300047469 Bacteria 2700
923 Ga0495673_0035209 3300047469 Bacteria 2309
924 Ga0495673_0042064 3300047469 Bacteria 2053
925 Ga0495673_0049542 3300047469 Bacteria 1848
926 Ga0495681_0007870 3300047470 Bacteria 6738
927 Ga0495681_0008348 3300047470 Bacteria 6502
928 Ga0495681_0008517 3300047470 Bacteria 6421
929 Ga0495681_0008673 3300047470 Bacteria 6347
930 Ga0495681_0009657 3300047470 Bacteria 5924
931 Ga0495681_0010292 3300047470 Bacteria 5666
932 Ga0495681_0010529 3300047470 Bacteria 5594
933 Ga0495681_0010964 3300047470 Bacteria 5442
934 Ga0495681_0017199 3300047470 Bacteria 4025
935 Ga0495681_0022695 3300047470 Bacteria 3352
936 Ga0495681_0027934 3300047470 Bacteria 2911
937 Ga0495681_0031510 3300047470 Bacteria 2682
938 Ga0495681_0032351 3300047470 Bacteria 2634
939 Ga0495681_0040599 3300047470 Bacteria 2264
940 Ga0495681_0072553 3300047470 Bacteria 1556
941 Ga0495681_0074084 3300047470 Bacteria 1536
942 Ga0495684_0013285 3300047471 Bacteria 6348
943 Ga0495684_0111855 3300047471 Bacteria 2060
944 Ga0495686_0010852 3300047472 Bacteria 6454
945 Ga0495686_0011075 3300047472 Bacteria 6376
946 Ga0495686_0043917 3300047472 Bacteria 2830
947 Ga0495686_0049412 3300047472 Bacteria 2647
948 Ga0495686_0054202 3300047472 Bacteria 2511
949 Ga0495686_0068520 3300047472 Bacteria 2189
950 Ga0495686_0102525 3300047472 Bacteria 1724
951 Ga0495593_0007645 3300047673 Bacteria 6312
952 Ga0495593_0010331 3300047673 Bacteria 5396
953 Ga0495602_0092360 3300048088 Bacteria 2507
954 Ga0495626_0000471 3300048091 Bacteria 41011
955 Ga0495626_0004811 3300048091 Bacteria 8141
956 Ga0495626_0006497 3300048091 Bacteria 6648
957 Ga0495626_0006504 3300048091 Bacteria 6644
958 Ga0495626_0006629 3300048091 Bacteria 6563
959 Ga0495626_0006651 3300048091 Bacteria 6555
960 Ga0495626_0028136 3300048091 Bacteria 2727
961 Ga0495626_0032405 3300048091 Bacteria 2509
962 Ga0495626_0033806 3300048091 Bacteria 2448
963 Ga0496102_0016517 3300048905 Bacteria 6451
964 Ga0496102_0055625 3300048905 Bacteria 3608
965 Ga0496103_0014366 3300048906 Bacteria 4703
966 Ga0496110_0070835 3300048913 Bacteria 3090
967 Ga0496110_0118933 3300048913 Bacteria 2379
968 Ga0496111_0069874 3300048914 Bacteria 2554
969 Ga0496112_0056284 3300048915 Bacteria 3870
970 Ga0496114_0026197 3300048917 Bacteria 4773
971 Ga0496114_0110881 3300048917 Bacteria 2351
972 Ga0496116_0002267 3300048919 Bacteria 20402
973 Ga0496116_0014744 3300048919 Bacteria 6223
974 Ga0496116_0015825 3300048919 Bacteria 5939
975 Ga0496116_0038790 3300048919 Bacteria 3302
976 Ga0496116_0059638 3300048919 Bacteria 2480
977 Ga0496117_0012186 3300048920 Bacteria 7608
978 Ga0496117_0013956 3300048920 Bacteria 6961
979 Ga0496117_0014065 3300048920 Bacteria 6921
980 Ga0496117_0016544 3300048920 Bacteria 6218
981 Ga0496117_0016626 3300048920 Bacteria 6194
982 Ga0496117_0066912 3300048920 Bacteria 2434
983 Ga0496117_0080788 3300048920 Bacteria 2136
984 Ga0496117_0159451 3300048920 Bacteria 1324
985 Ga0496118_0003619 3300048921 Bacteria 19184
986 Ga0496118_0011916 3300048921 Bacteria 8416
987 Ga0496118_0025383 3300048921 Bacteria 5084
988 Ga0496118_0033361 3300048921 Bacteria 4225
989 Ga0496118_0034665 3300048921 Bacteria 4112
990 Ga0496118_0046073 3300048921 Bacteria 3396
991 Ga0496118_0068784 3300048921 Bacteria 2569
992 Ga0496118_0080000 3300048921 Bacteria 2302
993 Ga0496118_0089523 3300048921 Bacteria 2124
994 Ga0496119_0000380 3300048922 Bacteria 61208
995 Ga0496120_0007819 3300048923 Bacteria 7888
996 Ga0496120_0072903 3300048923 Bacteria 1880
997 Ga0496121_0002386 3300048924 Bacteria 28821
998 Ga0496121_0003193 3300048924 Bacteria 23613
999 Ga0496121_0007392 3300048924 Bacteria 13277
1000 Ga0496121_0027681 3300048924 Bacteria 5298
1001 Ga0496121_0030463 3300048924 Bacteria 4955
1002 Ga0496121_0034487 3300048924 Bacteria 4555
1003 Ga0496121_0159513 3300048924 Bacteria 1651
1004 Ga0496122_0002009 3300048925 Bacteria 30251
1005 Ga0496122_0003317 3300048925 Bacteria 21285
1006 Ga0496122_0031342 3300048925 Bacteria 4427
1007 Ga0496122_0034276 3300048925 Bacteria 4157
1008 Ga0496122_0048744 3300048925 Bacteria 3252
1009 Ga0496122_0059415 3300048925 Bacteria 2822
1010 Ga0496122_0086893 3300048925 Bacteria 2150
1011 Ga0496123_0001344 3300048926 Bacteria 34725
1012 Ga0496123_0001758 3300048926 Bacteria 28593
1013 Ga0496123_0025717 3300048926 Bacteria 4429
1014 Ga0496123_0030541 3300048926 Bacteria 3942
1015 Ga0496123_0035630 3300048926 Bacteria 3542
1016 Ga0496123_0043406 3300048926 Bacteria 3089
1017 Ga0496123_0066590 3300048926 Bacteria 2280
1018 Ga0496123_0071951 3300048926 Bacteria 2153
1019 Ga0496124_0000132 3300048927 Bacteria 155405
1020 Ga0496124_0014502 3300048927 Bacteria 7616
1021 Ga0496124_0017278 3300048927 Bacteria 6803
1022 Ga0496124_0018071 3300048927 Bacteria 6619
1023 Ga0496124_0019649 3300048927 Bacteria 6276
1024 Ga0496124_0020651 3300048927 Bacteria 6079
1025 Ga0496124_0021458 3300048927 Bacteria 5949
1026 Ga0496124_0047380 3300048927 Bacteria 3678
1027 Ga0496124_0047939 3300048927 Bacteria 3652
1028 Ga0496124_0055273 3300048927 Bacteria 3355
1029 Ga0496124_0087657 3300048927 Bacteria 2545
1030 Ga0496124_0268916 3300048927 Bacteria 1249
1031 Ga0496125_0005559 3300048928 Bacteria 13938
1032 Ga0496125_0019361 3300048928 Bacteria 6422
1033 Ga0496125_0020440 3300048928 Bacteria 6214
1034 Ga0496125_0020718 3300048928 Bacteria 6164
1035 Ga0496125_0020977 3300048928 Bacteria 6110
1036 Ga0496125_0034931 3300048928 Bacteria 4421
1037 Ga0496125_0044377 3300048928 Bacteria 3760
1038 Ga0496125_0080907 3300048928 Bacteria 2484
1039 Ga0496125_0089524 3300048928 Bacteria 2314
1040 Ga0496125_0126911 3300048928 Bacteria 1805
1041 Ga0496125_0140607 3300048928 Bacteria 1679
1042 Ga0496126_0027166 3300048929 Bacteria 5471
1043 Ga0496126_0030107 3300048929 Bacteria 5148
1044 Ga0496126_0032524 3300048929 Bacteria 4913
1045 Ga0496126_0067389 3300048929 Bacteria 3198
1046 Ga0496126_0103736 3300048929 Bacteria 2484
1047 Ga0495678_000536 3300049459 Bacteria 36666
1048 Ga0495678_001447 3300049459 Bacteria 18697
1049 Ga0495678_003677 3300049459 Bacteria 9287
1050 Ga0495678_007413 3300049459 Bacteria 5685
1051 Ga0495678_016896 3300049459 Bacteria 3320
1052 Ga0495678_019427 3300049459 Bacteria 3030
1053 Ga0495678_022249 3300049459 Bacteria 2774
1054 Ga0495678_023694 3300049459 Bacteria 2663
1055 Ga0495678_025284 3300049459 Bacteria 2553
1056 Ga0495678_025296 3300049459 Bacteria 2551
1057 Ga0495678_032413 3300049459 Bacteria 2167
1058 Ga0495678_032443 3300049459 Bacteria 2165
1059 Ga0495678_041247 3300049459 Bacteria 1848
1060 Ga0495678_061137 3300049459 Bacteria 1414
1061 Ga0495682_0000613 3300049460 Bacteria 24066
1062 Ga0495682_0004277 3300049460 Bacteria 6171
1063 Ga0495682_0011952 3300049460 Bacteria 3336
1064 Ga0495682_0014600 3300049460 Bacteria 2977
1065 Ga0495682_0020901 3300049460 Bacteria 2455
1066 Ga0495682_0033373 3300049460 Bacteria 1899
1067 Ga0501034_0000692 3300049571 Bacteria 51206
1068 Ga0501037_0076604 3300049573 Bacteria 2428
1069 Ga0501241_004789 3300049758 Bacteria 2528
1070 Ga0501035_0210657 3300049822 Bacteria 1663
1071 Ga0501226_000010 3300049853 Bacteria 180094
1072 nmdc:mga03683_20683_c1 3300050489 Bacteria 2529
1073 nmdc:mga00v17_28152_c1 3300050491 Bacteria 3290
1074 Ga0500572_009834 3300053111 Bacteria 2271
1075 Ga0500659_0007118 3300053135 Bacteria 6181
1076 Ga0500634_0015528 3300053161 Bacteria 4045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048923 Ga0496120_0072903 Ga0496120_0072903_887_1867 313
2 3300041997 Ga0439431_0021268 Ga0439431_0021268_563_1510 314
3 3300042000 Ga0439437_001599 Ga0439437_001599_36_983 314
4 3300046501 Ga0495607_0033027 Ga0495607_0033027_57_1046 314
5 3300046558 Ga0495633_0118614 Ga0495633_0118614_242_1210 322
6 3300046810 Ga0495660_0135506 Ga0495660_0135506_14_982 322
7 3300046507 Ga0495606_0220576 Ga0495606_0220576_65_1051 328
8 3300046691 Ga0495670_0208151 Ga0495670_0208151_22_1008 328
9 3300015261 Ga0182006_1050403 Ga0182006_10504032 329
10 3300041411 Ga0439466_0039524 Ga0439466_0039524_566_1555 329
11 3300046455 Ga0495603_0071200 Ga0495603_0071200_49_1038 329
12 3300046459 Ga0495629_0012820 Ga0495629_0012820_4529_5518 329
13 3300046491 Ga0495584_0159988 Ga0495584_0159988_52_1041 329
14 3300046526 Ga0495666_0050998 Ga0495666_0050998_980_1969 329
15 3300046530 Ga0495654_0091031 Ga0495654_0091031_384_1373 329
16 3300046542 Ga0495597_0056581 Ga0495597_0056581_696_1685 329
17 3300046558 Ga0495633_0137319 Ga0495633_0137319_106_1095 329
18 3300046692 Ga0495671_0113918 Ga0495671_0113918_51_1040 329
19 3300047323 Ga0495683_0153176 Ga0495683_0153176_12_1001 329
20 3300047470 Ga0495681_0072553 Ga0495681_0072553_526_1515 329
21 3300009036 Ga0105244_10017103 Ga0105244_100171033 331
22 3300013308 Ga0157375_10023422 Ga0157375_100234223 331
23 3300014497 Ga0182008_10007492 Ga0182008_100074923 331
24 3300025728 Ga0207655_1009126 Ga0207655_10091263 331
25 3300048927 Ga0496124_0268916 Ga0496124_0268916_20_1132 331
26 3300009092 Ga0105250_10018457 Ga0105250_100184571 332
27 3300046507 Ga0495606_0051868 Ga0495606_0051868_748_1860 332
28 3300005288 Ga0065714_10003654 Ga0065714_100036543 333
29 3300005289 Ga0065704_10118033 Ga0065704_101180331 333
30 3300005331 Ga0070670_100014586 Ga0070670_1000145863 333
31 3300005344 Ga0070661_100000219 Ga0070661_10000021931 333
32 3300005564 Ga0070664_100001287 Ga0070664_10000128726 333
33 3300006051 Ga0075364_10151126 Ga0075364_101511262 333
34 3300009036 Ga0105244_10002831 Ga0105244_1000283113 333
35 3300009092 Ga0105250_10004308 Ga0105250_100043083 333
36 3300009176 Ga0105242_10001117 Ga0105242_100011179 333
37 3300009545 Ga0105237_10000196 Ga0105237_1000019658 333
38 3300013100 Ga0157373_10018490 Ga0157373_100184906 333
39 3300013100 Ga0157373_10057829 Ga0157373_100578293 333
40 3300013100 Ga0157373_10085256 Ga0157373_100852562 333
41 3300013105 Ga0157369_10029419 Ga0157369_100294198 333
42 3300013308 Ga0157375_10117585 Ga0157375_101175853 333
43 3300013308 Ga0157375_10127299 Ga0157375_101272992 333
44 3300015261 Ga0182006_1005031 Ga0182006_10050317 333
45 3300015262 Ga0182007_10020124 Ga0182007_100201243 333
46 3300017792 Ga0163161_10085500 Ga0163161_100855002 333
47 3300017792 Ga0163161_10106081 Ga0163161_101060812 333
48 3300025711 Ga0207696_1000221 Ga0207696_100022123 333
49 3300025728 Ga0207655_1000563 Ga0207655_100056333 333
50 3300025735 Ga0207713_1001704 Ga0207713_100170418 333
51 3300025914 Ga0207671_10000019 Ga0207671_10000019201 333
52 3300025920 Ga0207649_10000002 Ga0207649_10000002465 333
53 3300025925 Ga0207650_10000198 Ga0207650_1000019835 333
54 3300025934 Ga0207686_10002119 Ga0207686_1000211914 333
55 3300025945 Ga0207679_10000006 Ga0207679_1000000625 333
56 3300031731 Ga0307405_10004727 Ga0307405_100047273 333
57 3300042006 Ga0439432_002957 Ga0439432_002957_1058_2170 333
58 3300046506 Ga0495583_0039244 Ga0495583_0039244_944_2056 333
59 3300046530 Ga0495654_0009670 Ga0495654_0009670_3169_4281 333
60 3300047446 Ga0495679_007094 Ga0495679_007094_877_1989 333
61 3300048928 Ga0496125_0044377 Ga0496125_0044377_2056_3168 333
62 3300048928 Ga0496125_0080907 Ga0496125_0080907_532_1644 333
63 3300046463 Ga0495653_0018252 Ga0495653_0018252_853_1920 334
64 3300046492 Ga0495585_0002713 Ga0495585_0002713_875_1942 334
65 3300046507 Ga0495606_0013781 Ga0495606_0013781_4304_5371 334
66 3300046665 Ga0495661_0009582 Ga0495661_0009582_980_2047 334
67 3300049459 Ga0495678_025284 Ga0495678_025284_47_1114 334
68 3300013105 Ga0157369_10258666 Ga0157369_102586663 336
69 3300048920 Ga0496117_0016626 Ga0496117_0016626_1147_2259 337
70 3300048921 Ga0496118_0034665 Ga0496118_0034665_691_1803 337
71 3300048927 Ga0496124_0087657 Ga0496124_0087657_910_2022 337
72 3300048929 Ga0496126_0027166 Ga0496126_0027166_426_1538 337
73 3300049573 Ga0501037_0076604 Ga0501037_0076604_942_2021 337
74 3300046512 Ga0495610_0014921 Ga0495610_0014921_1212_2324 340
75 3300011119 Ga0105246_10007385 Ga0105246_100073856 343
76 3300005288 Ga0065714_10080417 Ga0065714_100804173 344
77 3300005353 Ga0070669_100011057 Ga0070669_1000110573 344
78 3300005457 Ga0070662_100002558 Ga0070662_1000025583 344
79 3300005539 Ga0068853_100006809 Ga0068853_1000068099 344
80 3300005564 Ga0070664_100048699 Ga0070664_1000486993 344
81 3300005578 Ga0068854_100003783 Ga0068854_1000037832 344
82 3300005834 Ga0068851_10000037 Ga0068851_1000003731 344
83 3300009011 Ga0105251_10008502 Ga0105251_100085026 344
84 3300009177 Ga0105248_10048021 Ga0105248_100480212 344
85 3300009545 Ga0105237_10205898 Ga0105237_102058982 344
86 3300013100 Ga0157373_10088533 Ga0157373_100885332 344
87 3300013105 Ga0157369_10139264 Ga0157369_101392643 344
88 3300014497 Ga0182008_10047439 Ga0182008_100474392 344
89 3300025321 Ga0207656_10000014 Ga0207656_1000001476 344
90 3300025735 Ga0207713_1002013 Ga0207713_100201312 344
91 3300025914 Ga0207671_10165529 Ga0207671_101655292 344
92 3300025923 Ga0207681_10000149 Ga0207681_1000014933 344
93 3300025933 Ga0207706_10016327 Ga0207706_100163273 344
94 3300025941 Ga0207711_10027344 Ga0207711_100273446 344
95 3300025945 Ga0207679_10045261 Ga0207679_100452613 344
96 3300025981 Ga0207640_10022738 Ga0207640_100227382 344
97 3300026041 Ga0207639_10011804 Ga0207639_100118044 344
98 3300027876 Ga0209974_10027442 Ga0209974_100274421 345
99 iso_pu_bacteria 3007315729 3007319610 347
100 iso_pu_bacteria 3007252601 3007256207 350
101 3300003856 Ga0058692_1016075 Ga0058692_10160751 351
102 3300005331 Ga0070670_100001403 Ga0070670_10000140315 351
103 3300015261 Ga0182006_1005984 Ga0182006_10059843 351
104 3300025925 Ga0207650_10000363 Ga0207650_1000036327 351
105 3300027312 Ga0209371_1000142 Ga0209371_100014257 351
106 3300030500 Ga0268256_1000111 Ga0268256_100011169 351
107 3300042439 Ga0439464_0001948 Ga0439464_0001948_312_1373 351
108 3300042439 Ga0439464_0007327 Ga0439464_0007327_461_1522 351
109 iso_pu_bacteria 2554235132 2554813692 351
110 iso_pu_bacteria 2606217733 2608381143 351
111 iso_pu_bacteria 2808606379 2808939417 351
112 iso_pu_bacteria 2842805378 2842809397 351
113 iso_pu_bacteria 2990196909 2990200454 351
114 iso_pu_bacteria 2600254954 2600443166 352
115 iso_pu_bacteria 2600255389 2602009345 352
116 iso_pu_bacteria 2811994881 2812371060 352
117 iso_pu_bacteria 2823421272 2823424795 352
118 iso_pu_bacteria 2919501602 2919504524 352
119 iso_pu_bacteria 2923519811 2923525167 352
120 iso_pu_bacteria 2926063275 2926064903 352
121 iso_pu_bacteria 8011350971 8011356796 352
122 iso_pu_bacteria 8034962539 8034962773 352
123 iso_pu_bacteria 2738543020 2739286625 353
124 iso_pu_bacteria 2738543021 2739291938 353
125 iso_pu_bacteria 2808606373 2808907014 353
126 iso_pu_bacteria 2917832318 2917833691 353
127 iso_pu_bacteria 2919125081 2919129138 353
128 iso_pu_bacteria 2984504281 2984507946 353
129 iso_pu_bacteria 8016728285 8016729885 353
130 3300046538 Ga0495609_0000210 Ga0495609_0000210_19849_20967 354
131 3300047469 Ga0495673_0009037 Ga0495673_0009037_3754_4872 354
132 iso_pu_bacteria 2510065053 2510283482 354
133 iso_pu_bacteria 2510065055 2510292690 354
134 iso_pu_bacteria 2510065058 2510311782 354
135 iso_pu_bacteria 2773857672 2774128751 354
136 iso_pu_bacteria 2974298342 2974299127 354
137 iso_pu_bacteria 2984499530 2984501440 354
138 3300013104 Ga0157370_10000379 Ga0157370_1000037954 355
139 3300013307 Ga0157372_10000663 Ga0157372_1000066320 355
140 3300015261 Ga0182006_1007804 Ga0182006_10078042 355
141 3300028786 Ga0307517_10145124 Ga0307517_101451242 355
142 3300031507 Ga0307509_10168619 Ga0307509_101686193 355
143 3300046501 Ga0495607_0010798 Ga0495607_0010798_4139_5260 355
144 3300046520 Ga0495637_0008755 Ga0495637_0008755_2412_3533 355
145 3300046665 Ga0495661_0021230 Ga0495661_0021230_2230_3342 355
146 3300046694 Ga0495649_0007915 Ga0495649_0007915_968_2089 355
147 3300047320 Ga0495672_0011221 Ga0495672_0011221_655_1770 355
148 3300047321 Ga0495676_0007663 Ga0495676_0007663_2025_3146 355
149 3300047446 Ga0495679_004955 Ga0495679_004955_3977_5089 355
150 3300048922 Ga0496119_0000380 Ga0496119_0000380_19010_20119 355
151 3300048923 Ga0496120_0007819 Ga0496120_0007819_1121_2230 355
152 3300048925 Ga0496122_0034276 Ga0496122_0034276_1972_3084 355
153 3300048926 Ga0496123_0030541 Ga0496123_0030541_1966_3078 355
154 3300048928 Ga0496125_0020977 Ga0496125_0020977_872_1984 355
155 3300053161 Ga0500634_0015528 Ga0500634_0015528_900_2012 355
156 iso_pu_bacteria 2728369097 2729145315 355
157 iso_pu_bacteria 640427133 640487463 355
158 iso_pu_bacteria 651053060 651175402 355
159 3300003751 Ga0055538_1000073 Ga0055538_100007356 356
160 3300003752 Ga0055539_1000109 Ga0055539_100010956 356
161 3300003756 Ga0055533_1000117 Ga0055533_100011756 356
162 3300003758 Ga0055532_1000120 Ga0055532_100012067 356
163 3300003759 Ga0055525_1000156 Ga0055525_100015656 356
164 3300003841 Ga0055541_1000074 Ga0055541_100007456 356
165 3300005289 Ga0065704_10099076 Ga0065704_100990763 356
166 3300009011 Ga0105251_10008037 Ga0105251_100080376 356
167 3300009092 Ga0105250_10017669 Ga0105250_100176692 356
168 3300017792 Ga0163161_10016215 Ga0163161_100162156 356
169 3300017792 Ga0163161_10066975 Ga0163161_100669752 356
170 3300025206 Ga0209435_100620 Ga0209435_1006202 356
171 3300025224 Ga0209784_100015 Ga0209784_10001588 356
172 3300025225 Ga0209566_100012 Ga0209566_10001288 356
173 3300025226 Ga0209674_100027 Ga0209674_10002788 356
174 3300025229 Ga0209147_100019 Ga0209147_10001988 356
175 3300025230 Ga0209563_100031 Ga0209563_10003188 356
176 3300025242 Ga0209258_100296 Ga0209258_10029636 356
177 3300025246 Ga0209646_1000213 Ga0209646_100021355 356
178 3300025253 Ga0209677_100016 Ga0209677_10001688 356
179 3300025735 Ga0207713_1011794 Ga0207713_10117944 356
180 3300031548 Ga0307408_100000025 Ga0307408_10000002584 356
181 3300031824 Ga0307413_10024705 Ga0307413_100247053 356
182 3300046453 Ga0495627_005036 Ga0495627_005036_3397_4506 356
183 3300046458 Ga0495591_005095 Ga0495591_005095_4175_5284 356
184 3300046501 Ga0495607_0052900 Ga0495607_0052900_913_2022 356
185 3300046507 Ga0495606_0014283 Ga0495606_0014283_4215_5324 356
186 3300046515 Ga0495620_0017526 Ga0495620_0017526_2364_3473 356
187 3300046519 Ga0495632_0009676 Ga0495632_0009676_984_2093 356
188 3300046665 Ga0495661_0010197 Ga0495661_0010197_1094_2203 356
189 3300046794 Ga0495589_0012678 Ga0495589_0012678_2582_3691 356
190 3300046810 Ga0495660_0041728 Ga0495660_0041728_1186_2262 356
191 3300047470 Ga0495681_0022695 Ga0495681_0022695_404_1513 356
192 3300048920 Ga0496117_0016544 Ga0496117_0016544_886_1995 356
193 3300048921 Ga0496118_0046073 Ga0496118_0046073_1362_2474 356
194 3300048921 Ga0496118_0089523 Ga0496118_0089523_842_1951 356
195 3300048927 Ga0496124_0021458 Ga0496124_0021458_903_2012 356
196 3300048928 Ga0496125_0019361 Ga0496125_0019361_4219_5328 356
197 3300048928 Ga0496125_0034931 Ga0496125_0034931_908_2020 356
198 3300048929 Ga0496126_0067389 Ga0496126_0067389_783_1892 356
199 3300048929 Ga0496126_0103736 Ga0496126_0103736_827_1939 356
200 3300013102 Ga0157371_10001003 Ga0157371_100010038 357
201 3300013105 Ga0157369_10008221 Ga0157369_100082217 357
202 3300013307 Ga0157372_10187018 Ga0157372_101870182 357
203 3300015261 Ga0182006_1041770 Ga0182006_10417702 357
204 3300025735 Ga0207713_1030125 Ga0207713_10301253 357
205 3300041411 Ga0439466_0000852 Ga0439466_0000852_894_1973 357
206 3300042115 Ga0450911_000005 Ga0450911_000005_160380_161459 357
207 3300042139 Ga0450904_000002 Ga0450904_000002_10195_11274 357
208 3300042532 Ga0450893_0001345 Ga0450893_0001345_728_1807 357
209 3300046474 Ga0495605_0000323 Ga0495605_0000323_20516_21634 357
210 3300046506 Ga0495583_0019069 Ga0495583_0019069_1303_2421 357
211 3300046507 Ga0495606_0000126 Ga0495606_0000126_105900_106988 357
212 3300046522 Ga0495643_0004299 Ga0495643_0004299_990_2078 357
213 3300046522 Ga0495643_0004831 Ga0495643_0004831_7291_8379 357
214 3300046538 Ga0495609_0014046 Ga0495609_0014046_686_1804 357
215 3300046692 Ga0495671_0012380 Ga0495671_0012380_968_2056 357
216 3300046694 Ga0495649_0004217 Ga0495649_0004217_912_2000 357
217 3300046694 Ga0495649_0078791 Ga0495649_0078791_400_1488 357
218 3300047323 Ga0495683_0000223 Ga0495683_0000223_40857_41978 357
219 3300047470 Ga0495681_0074084 Ga0495681_0074084_71_1159 357
220 3300047472 Ga0495686_0068520 Ga0495686_0068520_644_1732 357
221 3300049853 Ga0501226_000010 Ga0501226_000010_109438_110517 357
222 3300025256 Ga0209759_1003694 Ga0209759_10036946 358
223 3300046471 Ga0495650_0030766 Ga0495650_0030766_1116_2234 358
224 3300046506 Ga0495583_0003593 Ga0495583_0003593_1153_2271 358
225 3300046519 Ga0495632_0001207 Ga0495632_0001207_4656_5774 358
226 3300046520 Ga0495637_0028822 Ga0495637_0028822_329_1447 358
227 3300046665 Ga0495661_0000337 Ga0495661_0000337_40498_41616 358
228 3300009011 Ga0105251_10030173 Ga0105251_100301731 359
229 3300009036 Ga0105244_10013873 Ga0105244_100138734 359
230 3300025728 Ga0207655_1025870 Ga0207655_10258703 359
231 3300046453 Ga0495627_001316 Ga0495627_001316_12163_13281 359
232 3300046474 Ga0495605_0000449 Ga0495605_0000449_15983_17101 359
233 3300046499 Ga0495594_0003153 Ga0495594_0003153_1644_2762 359
234 3300046506 Ga0495583_0000861 Ga0495583_0000861_19800_20918 359
235 3300046512 Ga0495610_0016882 Ga0495610_0016882_2736_3854 359
236 3300046515 Ga0495620_0000516 Ga0495620_0000516_5513_6631 359
237 3300046518 Ga0495631_0007551 Ga0495631_0007551_2650_3768 359
238 3300046524 Ga0495648_0004858 Ga0495648_0004858_4707_5825 359
239 3300046530 Ga0495654_0002672 Ga0495654_0002672_8158_9276 359
240 3300046538 Ga0495609_0000153 Ga0495609_0000153_19898_21016 359
241 3300046542 Ga0495597_0009283 Ga0495597_0009283_913_2031 359
242 3300046558 Ga0495633_0000300 Ga0495633_0000300_35429_36547 359
243 3300046648 Ga0495611_0007606 Ga0495611_0007606_582_1700 359
244 3300046665 Ga0495661_0001311 Ga0495661_0001311_15025_16143 359
245 3300046691 Ga0495670_0004428 Ga0495670_0004428_459_1577 359
246 3300046692 Ga0495671_0003515 Ga0495671_0003515_6527_7645 359
247 3300046810 Ga0495660_0000879 Ga0495660_0000879_4427_5545 359
248 3300047323 Ga0495683_0000371 Ga0495683_0000371_19830_20948 359
249 3300047446 Ga0495679_002279 Ga0495679_002279_5519_6637 359
250 3300048925 Ga0496122_0031342 Ga0496122_0031342_553_1671 359
251 3300048926 Ga0496123_0025717 Ga0496123_0025717_1046_2164 359
252 3300048927 Ga0496124_0014502 Ga0496124_0014502_5443_6558 359
253 3300049459 Ga0495678_000536 Ga0495678_000536_19866_20984 359
254 3300049822 Ga0501035_0210657 Ga0501035_0210657_239_1330 359
255 3300041404 Ga0439436_0000093 Ga0439436_0000093_19650_20747 362
256 3300041405 Ga0439438_012190 Ga0439438_012190_1248_2345 362
257 3300041407 Ga0439447_000651 Ga0439447_000651_11512_12609 362
258 3300041411 Ga0439466_0008081 Ga0439466_0008081_1756_2853 362
259 3300042006 Ga0439432_003789 Ga0439432_003789_2911_4008 362
260 3300042010 Ga0439452_006834 Ga0439452_006834_883_1980 362
261 3300042156 Ga0439446_0006568 Ga0439446_0006568_1632_2729 362
262 3300042435 Ga0439434_0014034 Ga0439434_0014034_212_1309 362
263 3300048905 Ga0496102_0055625 Ga0496102_0055625_1411_2526 363
264 3300048924 Ga0496121_0003193 Ga0496121_0003193_21741_22856 363
265 3300048926 Ga0496123_0043406 Ga0496123_0043406_1115_2230 363
266 3300046458 Ga0495591_051607 Ga0495591_051607_13_1107 364
267 3300047322 Ga0495680_0109849 Ga0495680_0109849_928_2022 364
268 3300047673 Ga0495593_0007645 Ga0495593_0007645_1190_2284 364
269 iso_pu_bacteria 2738541271 2738689975 364
270 iso_pu_bacteria 2738543016 2739265749 364
271 iso_pu_bacteria 2919155634 2919158767 364
272 iso_pu_bacteria 2597489888 2597862451 365
273 iso_pu_bacteria 2597489889 2597868227 365
274 iso_pu_bacteria 2599185155 2599328487 365
275 iso_pu_bacteria 2599185167 2599396956 365
276 iso_pu_bacteria 2599185179 2599448934 365
277 iso_pu_bacteria 2599185189 2599508935 365
278 iso_pu_bacteria 2599185190 2599511307 365
279 iso_pu_bacteria 2599185191 2599517753 365
280 iso_pu_bacteria 2599185288 2599879764 365
281 iso_pu_bacteria 2599185290 2599890681 365
282 iso_pu_bacteria 2599185303 2599948273 365
283 iso_pu_bacteria 2600255296 2601691049 365
284 iso_pu_bacteria 2619619299 2621301409 365
285 iso_pu_bacteria 2643221571 2643873324 365
286 iso_pu_bacteria 2643221713 2644624131 365
287 iso_pu_bacteria 2675903420 2677897613 365
288 iso_pu_bacteria 2721755607 2723247342 365
289 iso_pu_bacteria 2738541265 2738673644 365
290 iso_pu_bacteria 2738541282 2738752037 365
291 iso_pu_bacteria 2738541294 2738809226 365
292 iso_pu_bacteria 2738541303 2738861078 365
293 iso_pu_bacteria 2738541309 2738896586 365
294 iso_pu_bacteria 2808606385 2808975372 365
295 iso_pu_bacteria 2808606388 2808990989 365
296 iso_pu_bacteria 2816332298 2817489223 365
297 iso_pu_bacteria 2834028612 2834029128 365
298 iso_pu_bacteria 2842826826 2842828837 365
299 iso_pu_bacteria 2842837860 2842842572 365
300 iso_pu_bacteria 2852612431 2852615391 365
301 iso_pu_bacteria 2852667396 2852670359 365
302 iso_pu_bacteria 2860867994 2860869150 365
303 iso_pu_bacteria 2908446538 2908448044 365
304 iso_pu_bacteria 2929189879 2929191149 365
305 iso_pu_bacteria 2931390751 2931392142 365
306 iso_pu_bacteria 2945928738 2945929433 365
307 iso_pu_bacteria 2945961074 2945965697 365
308 iso_pu_bacteria 2946006987 2946011694 365
309 iso_pu_bacteria 2946027586 2946029389 365
310 iso_pu_bacteria 2947233263 2947235977 365
311 iso_pu_bacteria 8054285046 8054291126 365
312 iso_pu_bacteria 8054347763 8054348420 365
313 iso_pu_bacteria 8054503363 8054504719 365
314 iso_pu_bacteria 8055817908 8055819162 365
315 iso_pu_bacteria 8056131705 8056133083 365
316 iso_pu_bacteria 8056148874 8056149270 365
317 iso_pu_bacteria 8056161164 8056166751 365
318 iso_pu_bacteria 2600255283 2601626450 366
319 iso_pu_bacteria 2511231006 2511264507 367
320 iso_pu_bacteria 2512047018 2512326303 367
321 iso_pu_bacteria 2554235231 2555245828 367
322 iso_pu_bacteria 2582580891 2583790808 367
323 iso_pu_bacteria 2597489887 2597856430 367
324 iso_pu_bacteria 2599185185 2599483317 367
325 iso_pu_bacteria 2599185257 2599805218 367
326 iso_pu_bacteria 2599185307 2599973891 367
327 iso_pu_bacteria 2600254931 2600363929 367
328 iso_pu_bacteria 2671180172 2671768047 367
329 iso_pu_bacteria 2713897148 2715752911 367
330 iso_pu_bacteria 2740892503 2743735843 367
331 iso_pu_bacteria 2765235841 2765582435 367
332 iso_pu_bacteria 2806310737 2807409769 367
333 iso_pu_bacteria 2806310745 2807458104 367
334 iso_pu_bacteria 2826581358 2826584252 367
335 iso_pu_bacteria 2842815866 2842817937 367
336 iso_pu_bacteria 2842832357 2842835537 367
337 iso_pu_bacteria 2842843487 2842847276 367
338 iso_pu_bacteria 2842849001 2842849573 367
339 iso_pu_bacteria 2912963787 2912965031 367
340 iso_pu_bacteria 2919385768 2919386004 367
341 iso_pu_bacteria 2919487758 2919490793 367
342 iso_pu_bacteria 2923153595 2923154852 367
343 iso_pu_bacteria 2939651529 2939653391 367
344 iso_pu_bacteria 2974289157 2974292594 367
345 iso_pu_bacteria 2984286254 2984291178 367
346 iso_pu_bacteria 2998139840 2998141207 367
347 iso_pu_bacteria 3007395558 3007400371 367
348 iso_pu_bacteria 3007803356 3007808675 367
349 iso_pu_bacteria 3007872151 3007874495 367
350 iso_pu_bacteria 8015687852 8015689082 367
351 iso_pu_bacteria 8029995093 8029999537 367
352 iso_pu_bacteria 8052494512 8052495811 367
353 iso_pu_bacteria 8054929484 8054934037 367
354 iso_pu_bacteria 8055770955 8055772201 367
355 iso_pu_bacteria 8055878733 8055884301 367
356 iso_pu_bacteria 8056115690 8056120084 367
357 iso_pu_bacteria 8056120720 8056124733 367
358 iso_pu_bacteria 8056137416 8056141720 367
359 iso_pu_bacteria 8056166840 8056169847 367
360 3300017792 Ga0163161_10065947 Ga0163161_100659473 368
361 3300046453 Ga0495627_000496 Ga0495627_000496_5506_6636 368
362 3300046518 Ga0495631_0004763 Ga0495631_0004763_690_1820 368
363 3300046519 Ga0495632_0025242 Ga0495632_0025242_365_1495 368
364 3300046530 Ga0495654_0001936 Ga0495654_0001936_3845_4975 368
365 3300047320 Ga0495672_0002900 Ga0495672_0002900_10076_11206 368
366 3300048927 Ga0496124_0000132 Ga0496124_0000132_19698_20804 368
367 iso_pu_bacteria 2511231004 2511258164 368
368 iso_pu_bacteria 2511231007 2511273535 368
369 iso_pu_bacteria 2511231008 2511279013 368
370 iso_pu_bacteria 2511231010 2511290146 368
371 iso_pu_bacteria 2511231011 2511295672 368
372 iso_pu_bacteria 2511231012 2511299768 368
373 iso_pu_bacteria 2511231014 2511315693 368
374 iso_pu_bacteria 2511231015 2511319609 368
375 iso_pu_bacteria 2511231016 2511326630 368
376 iso_pu_bacteria 2511231017 2511333447 368
377 iso_pu_bacteria 2511231018 2511338864 368
378 iso_pu_bacteria 2511231019 2511343935 368
379 iso_pu_bacteria 2511231020 2511353236 368
380 iso_pu_bacteria 2511231021 2511357226 368
381 iso_pu_bacteria 2511231022 2511363704 368
382 iso_pu_bacteria 2511231023 2511366608 368
383 iso_pu_bacteria 2511231031 2511410929 368
384 iso_pu_bacteria 2511231156 2511823183 368
385 iso_pu_bacteria 2554235341 2555668210 368
386 iso_pu_bacteria 2599185160 2599355211 368
387 iso_pu_bacteria 2599185161 2599360966 368
388 iso_pu_bacteria 2599185162 2599367288 368
389 iso_pu_bacteria 2599185163 2599374078 368
390 iso_pu_bacteria 2599185164 2599380317 368
391 iso_pu_bacteria 2599185165 2599386764 368
392 iso_pu_bacteria 2599185166 2599392936 368
393 iso_pu_bacteria 2599185168 2599404703 368
394 iso_pu_bacteria 2599185181 2599462045 368
395 iso_pu_bacteria 2599185182 2599466912 368
396 iso_pu_bacteria 2599185186 2599490862 368
397 iso_pu_bacteria 2599185188 2599501301 368
398 iso_pu_bacteria 2599185212 2599616330 368
399 iso_pu_bacteria 2599185248 2599770632 368
400 iso_pu_bacteria 2599185289 2599886514 368
401 iso_pu_bacteria 2599185291 2599896879 368
402 iso_pu_bacteria 2599185300 2599933980 368
403 iso_pu_bacteria 2599185302 2599945609 368
404 iso_pu_bacteria 2599185304 2599957545 368
405 iso_pu_bacteria 2599185305 2599959586 368
406 iso_pu_bacteria 2599185306 2599966149 368
407 iso_pu_bacteria 2599185308 2599978237 368
408 iso_pu_bacteria 2599185309 2599986006 368
409 iso_pu_bacteria 2599185310 2599987099 368
410 iso_pu_bacteria 2599185311 2599996956 368
411 iso_pu_bacteria 2599185312 2600002609 368
412 iso_pu_bacteria 2599185313 2600006432 368
413 iso_pu_bacteria 2599185314 2600012293 368
414 iso_pu_bacteria 2599185315 2600016781 368
415 iso_pu_bacteria 2599185316 2600024804 368
416 iso_pu_bacteria 2599185317 2600032848 368
417 iso_pu_bacteria 2599185318 2600035366 368
418 iso_pu_bacteria 2599185319 2600041197 368
419 iso_pu_bacteria 2599185320 2600045421 368
420 iso_pu_bacteria 2599185321 2600054847 368
421 iso_pu_bacteria 2599185322 2600058318 368
422 iso_pu_bacteria 2599185323 2600064005 368
423 iso_pu_bacteria 2599185325 2600079388 368
424 iso_pu_bacteria 2599185356 2600214667 368
425 iso_pu_bacteria 2600254930 2600360101 368
426 iso_pu_bacteria 2600255313 2601774628 368
427 iso_pu_bacteria 2600255318 2601800252 368
428 iso_pu_bacteria 2603880185 2606074481 368
429 iso_pu_bacteria 2603880199 2606127344 368
430 iso_pu_bacteria 2623620443 2624479005 368
431 iso_pu_bacteria 2623620446 2624493997 368
432 iso_pu_bacteria 2643221565 2643845375 368
433 iso_pu_bacteria 2643221589 2643952135 368
434 iso_pu_bacteria 2643221602 2644024103 368
435 iso_pu_bacteria 2643221633 2644184781 368
436 iso_pu_bacteria 2643221650 2644285548 368
437 iso_pu_bacteria 2651869719 2652546535 368
438 iso_pu_bacteria 2667528170 2671092235 368
439 iso_pu_bacteria 2667528171 2671097812 368
440 iso_pu_bacteria 2667528176 2671127540 368
441 iso_pu_bacteria 2675903515 2678261721 368
442 iso_pu_bacteria 2713897149 2715758725 368
443 iso_pu_bacteria 2718217725 2718632890 368
444 iso_pu_bacteria 2738543004 2739198540 368
445 iso_pu_bacteria 2738543015 2739256698 368
446 iso_pu_bacteria 2738543025 2739312960 368
447 iso_pu_bacteria 2744054620 2745008070 368
448 iso_pu_bacteria 2773857670 2774121583 368
449 iso_pu_bacteria 2773857673 2774136201 368
450 iso_pu_bacteria 2784132063 2784260274 368
451 iso_pu_bacteria 2784132072 2784317361 368
452 iso_pu_bacteria 2791355520 2794594527 368
453 iso_pu_bacteria 2808606361 2808856495 368
454 iso_pu_bacteria 2808606376 2808924581 368
455 iso_pu_bacteria 2808606377 2808929459 368
456 iso_pu_bacteria 2808606378 2808936357 368
457 iso_pu_bacteria 2808606380 2808946586 368
458 iso_pu_bacteria 2808606381 2808951433 368
459 iso_pu_bacteria 2808606382 2808960366 368
460 iso_pu_bacteria 2808606383 2808964778 368
461 iso_pu_bacteria 2808606389 2808999670 368
462 iso_pu_bacteria 2808606445 2809215977 368
463 iso_pu_bacteria 2818991456 2819658556 368
464 iso_pu_bacteria 2818991464 2819702896 368
465 iso_pu_bacteria 2825651385 2825653551 368
466 iso_pu_bacteria 2842854478 2842857101 368
467 iso_pu_bacteria 2844665904 2844668733 368
468 iso_pu_bacteria 2852657418 2852658501 368
469 iso_pu_bacteria 2860339153 2860340487 368
470 iso_pu_bacteria 2878029506 2878030963 368
471 iso_pu_bacteria 2880230671 2880231880 368
472 iso_pu_bacteria 2904518522 2904520917 368
473 iso_pu_bacteria 2904550169 2904551729 368
474 iso_pu_bacteria 2913036834 2913038074 368
475 iso_pu_bacteria 2917070673 2917071975 368
476 iso_pu_bacteria 2919063839 2919064523 368
477 iso_pu_bacteria 2919456309 2919458150 368
478 iso_pu_bacteria 2919481497 2919482981 368
479 iso_pu_bacteria 2919697872 2919700086 368
480 iso_pu_bacteria 2923586266 2923590807 368
481 iso_pu_bacteria 2929144301 2929145514 368
482 iso_pu_bacteria 2931369376 2931371151 368
483 iso_pu_bacteria 2931396565 2931399610 368
484 iso_pu_bacteria 2935353572 2935354147 368
485 iso_pu_bacteria 2939636861 2939637900 368
486 iso_pu_bacteria 2969304461 2969305786 368
487 iso_pu_bacteria 2988728565 2988733062 368
488 iso_pu_bacteria 3007419365 3007420891 368
489 iso_pu_bacteria 3007511990 3007512579 368
490 iso_pu_bacteria 3007614139 3007618244 368
491 iso_pu_bacteria 3007619802 3007623012 368
492 iso_pu_bacteria 3007718800 3007720951 368
493 iso_pu_bacteria 3007855910 3007860360 368
494 iso_pu_bacteria 3007861166 3007863552 368
495 iso_pu_bacteria 3007866637 3007871406 368
496 iso_pu_bacteria 637000220 637318573 368
497 iso_pu_bacteria 8019769354 8019770776 368
498 iso_pu_bacteria 8019775933 8019776753 368
499 iso_pu_bacteria 8056125926 8056127265 368
500 iso_pu_bacteria 8056143049 8056147755 368
501 iso_pu_bacteria 8056155041 8056159563 368
502 iso_pu_bacteria 8056172158 8056175951 368
503 iso_pu_bacteria 8056177738 8056180397 368
504 iso_pu_bacteria 8056569372 8056569874 368
505 iso_pu_bacteria 8057798959 8057803528 368
506 3300025728 Ga0207655_1002193 Ga0207655_10021933 369
507 3300013100 Ga0157373_10168644 Ga0157373_101686442 370
508 3300046501 Ga0495607_0000841 Ga0495607_0000841_16876_17988 370
509 2162886007 SwRhRL2b_contig_2911292 SwRhRL2b_0609.00005190 371
510 3300003781 Ga0055536_1004135 Ga0055536_10041359 371
511 3300003781 Ga0055536_1004967 Ga0055536_10049678 371
512 3300003791 Ga0055530_10002285 Ga0055530_1000228515 371
513 3300003792 Ga0055540_1003658 Ga0055540_10036589 371
514 3300005289 Ga0065704_10075425 Ga0065704_100754258 371
515 3300005290 Ga0065712_10067760 Ga0065712_1006776019 371
516 3300006944 Ga0099823_1000119 Ga0099823_100011913 371
517 3300009011 Ga0105251_10011477 Ga0105251_100114775 371
518 3300009011 Ga0105251_10028951 Ga0105251_100289513 371
519 3300009036 Ga0105244_10004314 Ga0105244_100043146 371
520 3300009036 Ga0105244_10007970 Ga0105244_100079707 371
521 3300009036 Ga0105244_10012945 Ga0105244_100129454 371
522 3300009036 Ga0105244_10034986 Ga0105244_100349864 371
523 3300009036 Ga0105244_10035455 Ga0105244_100354552 371
524 3300009036 Ga0105244_10054187 Ga0105244_100541873 371
525 3300009148 Ga0105243_10008251 Ga0105243_1000825110 371
526 3300013100 Ga0157373_10089230 Ga0157373_100892301 371
527 3300013102 Ga0157371_10013592 Ga0157371_100135923 371
528 3300013104 Ga0157370_10153605 Ga0157370_101536051 371
529 3300013105 Ga0157369_10105675 Ga0157369_101056753 371
530 3300013306 Ga0163162_10405391 Ga0163162_104053911 371
531 3300015261 Ga0182006_1004989 Ga0182006_10049898 371
532 3300025292 Ga0209676_1000080 Ga0209676_1000080245 371
533 3300025292 Ga0209676_1000397 Ga0209676_100039768 371
534 3300025292 Ga0209676_1000973 Ga0209676_100097337 371
535 3300025298 Ga0209050_1000117 Ga0209050_1000117199 371
536 3300025303 Ga0209051_1000077 Ga0209051_1000077199 371
537 3300025711 Ga0207696_1000144 Ga0207696_10001441 371
538 3300025711 Ga0207696_1004122 Ga0207696_10041225 371
539 3300025711 Ga0207696_1005797 Ga0207696_10057972 371
540 3300025711 Ga0207696_1022179 Ga0207696_10221792 371
541 3300025728 Ga0207655_1001253 Ga0207655_100125319 371
542 3300025728 Ga0207655_1002689 Ga0207655_10026897 371
543 3300025728 Ga0207655_1012187 Ga0207655_10121877 371
544 3300025728 Ga0207655_1022539 Ga0207655_10225394 371
545 3300025735 Ga0207713_1000098 Ga0207713_1000098130 371
546 3300025735 Ga0207713_1000999 Ga0207713_100099926 371
547 3300025735 Ga0207713_1001749 Ga0207713_100174911 371
548 3300025735 Ga0207713_1012117 Ga0207713_10121176 371
549 3300025735 Ga0207713_1019531 Ga0207713_10195314 371
550 3300025935 Ga0207709_10010352 Ga0207709_100103526 371
551 3300025935 Ga0207709_10050279 Ga0207709_100502791 371
552 3300027111 Ga0209281_1002821 Ga0209281_10028214 371
553 3300027296 Ga0209389_1000205 Ga0209389_100020533 371
554 3300027296 Ga0209389_1071430 Ga0209389_10714303 371
555 3300027312 Ga0209371_1000584 Ga0209371_100058413 371
556 3300027312 Ga0209371_1007191 Ga0209371_10071912 371
557 3300030500 Ga0268256_1000436 Ga0268256_100043629 371
558 3300030735 Ga0316178_1009525 Ga0316178_100952557 371
559 3300031548 Ga0307408_100091211 Ga0307408_1000912113 371
560 3300031548 Ga0307408_100097838 Ga0307408_1000978381 371
561 3300031731 Ga0307405_10163014 Ga0307405_101630141 371
562 3300031824 Ga0307413_10083500 Ga0307413_100835002 371
563 3300031911 Ga0307412_10158503 Ga0307412_101585031 371
564 3300031995 Ga0307409_100010041 Ga0307409_1000100417 371
565 3300033180 Ga0307510_10133120 Ga0307510_101331203 371
566 3300041405 Ga0439438_004964 Ga0439438_004964_669_1784 371
567 3300041405 Ga0439438_010669 Ga0439438_010669_904_2019 371
568 3300041407 Ga0439447_017697 Ga0439447_017697_439_1554 371
569 3300041411 Ga0439466_0003023 Ga0439466_0003023_937_2052 371
570 3300041411 Ga0439466_0021160 Ga0439466_0021160_819_1934 371
571 3300042006 Ga0439432_008167 Ga0439432_008167_1254_2372 371
572 3300042006 Ga0439432_047018 Ga0439432_047018_78_1193 371
573 3300042010 Ga0439452_002747 Ga0439452_002747_4380_5495 371
574 3300042013 Ga0439456_000040 Ga0439456_000040_1070_2188 371
575 3300042013 Ga0439456_023210 Ga0439456_023210_174_1289 371
576 3300042016 Ga0439463_000561 Ga0439463_000561_5387_6502 371
577 3300042115 Ga0450911_002943 Ga0450911_002943_1025_2140 371
578 3300042136 Ga0450900_001524 Ga0450900_001524_1088_2218 371
579 3300042137 Ga0450902_001735 Ga0450902_001735_904_2019 371
580 3300042137 Ga0450902_002578 Ga0450902_002578_373_1503 371
581 3300042142 Ga0450905_001357 Ga0450905_001357_1327_2442 371
582 3300042531 Ga0450918_005008 Ga0450918_005008_631_1746 371
583 3300042533 Ga0450901_000214 Ga0450901_000214_1004_2134 371
584 3300042993 Ga0439440_0002345 Ga0439440_0002345_2371_3486 371
585 3300046453 Ga0495627_000424 Ga0495627_000424_15850_16965 371
586 3300046458 Ga0495591_002195 Ga0495591_002195_4414_5529 371
587 3300046471 Ga0495650_0001154 Ga0495650_0001154_20287_21402 371
588 3300046474 Ga0495605_0000461 Ga0495605_0000461_18031_19146 371
589 3300046474 Ga0495605_0001417 Ga0495605_0001417_13022_14152 371
590 3300046474 Ga0495605_0010728 Ga0495605_0010728_3870_4985 371
591 3300046491 Ga0495584_0008332 Ga0495584_0008332_1055_2170 371
592 3300046501 Ga0495607_0000490 Ga0495607_0000490_16904_18019 371
593 3300046501 Ga0495607_0000544 Ga0495607_0000544_19687_20817 371
594 3300046501 Ga0495607_0013540 Ga0495607_0013540_2343_3458 371
595 3300046501 Ga0495607_0024779 Ga0495607_0024779_670_1785 371
596 3300046506 Ga0495583_0000884 Ga0495583_0000884_17817_18932 371
597 3300046506 Ga0495583_0006924 Ga0495583_0006924_1119_2234 371
598 3300046506 Ga0495583_0012311 Ga0495583_0012311_2780_3895 371
599 3300046507 Ga0495606_0001804 Ga0495606_0001804_18705_19820 371
600 3300046512 Ga0495610_0017804 Ga0495610_0017804_2333_3448 371
601 3300046515 Ga0495620_0000003 Ga0495620_0000003_197185_198303 371
602 3300046515 Ga0495620_0000978 Ga0495620_0000978_15345_16460 371
603 3300046515 Ga0495620_0005086 Ga0495620_0005086_5220_6335 371
604 3300046515 Ga0495620_0019258 Ga0495620_0019258_1948_3063 371
605 3300046518 Ga0495631_0006906 Ga0495631_0006906_4483_5598 371
606 3300046518 Ga0495631_0009971 Ga0495631_0009971_1506_2621 371
607 3300046519 Ga0495632_0009416 Ga0495632_0009416_146_1264 371
608 3300046520 Ga0495637_0000446 Ga0495637_0000446_5605_6720 371
609 3300046520 Ga0495637_0001947 Ga0495637_0001947_5055_6170 371
610 3300046520 Ga0495637_0035230 Ga0495637_0035230_609_1724 371
611 3300046522 Ga0495643_0006764 Ga0495643_0006764_4570_5688 371
612 3300046522 Ga0495643_0007134 Ga0495643_0007134_1206_2321 371
613 3300046523 Ga0495644_0021708 Ga0495644_0021708_453_1568 371
614 3300046524 Ga0495648_0008836 Ga0495648_0008836_1111_2226 371
615 3300046524 Ga0495648_0013921 Ga0495648_0013921_142_1260 371
616 3300046530 Ga0495654_0002755 Ga0495654_0002755_6539_7654 371
617 3300046530 Ga0495654_0005709 Ga0495654_0005709_411_1526 371
618 3300046538 Ga0495609_0000371 Ga0495609_0000371_17744_18859 371
619 3300046538 Ga0495609_0017290 Ga0495609_0017290_1233_2348 371
620 3300046557 Ga0495622_0004051 Ga0495622_0004051_430_1545 371
621 3300046616 Ga0495668_0023940 Ga0495668_0023940_434_1549 371
622 3300046616 Ga0495668_0050357 Ga0495668_0050357_1140_2255 371
623 3300046648 Ga0495611_0000356 Ga0495611_0000356_78_1193 371
624 3300046660 Ga0495625_0000185 Ga0495625_0000185_1494_2609 371
625 3300046665 Ga0495661_0001052 Ga0495661_0001052_5625_6740 371
626 3300046665 Ga0495661_0035092 Ga0495661_0035092_945_2060 371
627 3300046692 Ga0495671_0008148 Ga0495671_0008148_2392_3507 371
628 3300046692 Ga0495671_0042057 Ga0495671_0042057_498_1613 371
629 3300046694 Ga0495649_0007184 Ga0495649_0007184_1788_2903 371
630 3300046810 Ga0495660_0011710 Ga0495660_0011710_3268_4383 371
631 3300047320 Ga0495672_0015069 Ga0495672_0015069_3348_4463 371
632 3300047320 Ga0495672_0045105 Ga0495672_0045105_25_1155 371
633 3300047321 Ga0495676_0000126 Ga0495676_0000126_20358_21473 371
634 3300047323 Ga0495683_0015012 Ga0495683_0015012_2689_3804 371
635 3300047446 Ga0495679_000697 Ga0495679_000697_5641_6756 371
636 3300047469 Ga0495673_0002111 Ga0495673_0002111_1736_2851 371
637 3300047469 Ga0495673_0005416 Ga0495673_0005416_1024_2139 371
638 3300047469 Ga0495673_0007009 Ga0495673_0007009_4516_5631 371
639 3300047469 Ga0495673_0011935 Ga0495673_0011935_842_1957 371
640 3300047469 Ga0495673_0023959 Ga0495673_0023959_1097_2212 371
641 3300047469 Ga0495673_0042064 Ga0495673_0042064_508_1623 371
642 3300047470 Ga0495681_0008673 Ga0495681_0008673_1082_2197 371
643 3300047472 Ga0495686_0102525 Ga0495686_0102525_180_1295 371
644 3300048091 Ga0495626_0000471 Ga0495626_0000471_20048_21163 371
645 3300048914 Ga0496111_0069874 Ga0496111_0069874_1038_2156 371
646 3300048917 Ga0496114_0026197 Ga0496114_0026197_3608_4726 371
647 3300048920 Ga0496117_0012186 Ga0496117_0012186_100_1218 371
648 3300048920 Ga0496117_0013956 Ga0496117_0013956_4671_5792 371
649 3300048920 Ga0496117_0014065 Ga0496117_0014065_4649_5767 371
650 3300048920 Ga0496117_0159451 Ga0496117_0159451_19_1134 371
651 3300048921 Ga0496118_0003619 Ga0496118_0003619_13490_14608 371
652 3300048921 Ga0496118_0011916 Ga0496118_0011916_991_2112 371
653 3300048921 Ga0496118_0033361 Ga0496118_0033361_1139_2254 371
654 3300048924 Ga0496121_0002386 Ga0496121_0002386_5568_6683 371
655 3300048924 Ga0496121_0034487 Ga0496121_0034487_3327_4445 371
656 3300048924 Ga0496121_0159513 Ga0496121_0159513_96_1217 371
657 3300048925 Ga0496122_0002009 Ga0496122_0002009_12012_13133 371
658 3300048925 Ga0496122_0003317 Ga0496122_0003317_1156_2271 371
659 3300048925 Ga0496122_0048744 Ga0496122_0048744_788_1906 371
660 3300048926 Ga0496123_0001344 Ga0496123_0001344_18377_19492 371
661 3300048926 Ga0496123_0001758 Ga0496123_0001758_7035_8156 371
662 3300048927 Ga0496124_0017278 Ga0496124_0017278_1143_2261 371
663 3300048927 Ga0496124_0019649 Ga0496124_0019649_870_1988 371
664 3300048927 Ga0496124_0020651 Ga0496124_0020651_4863_5984 371
665 3300048927 Ga0496124_0047380 Ga0496124_0047380_744_1862 371
666 3300048927 Ga0496124_0055273 Ga0496124_0055273_915_2033 371
667 3300048928 Ga0496125_0005559 Ga0496125_0005559_6459_7577 371
668 3300048928 Ga0496125_0020718 Ga0496125_0020718_903_2021 371
669 3300048928 Ga0496125_0126911 Ga0496125_0126911_14_1135 371
670 3300048929 Ga0496126_0032524 Ga0496126_0032524_105_1223 371
671 3300049459 Ga0495678_001447 Ga0495678_001447_10248_11363 371
672 3300049459 Ga0495678_003677 Ga0495678_003677_841_1956 371
673 3300049459 Ga0495678_032443 Ga0495678_032443_854_1969 371
674 3300049460 Ga0495682_0000613 Ga0495682_0000613_6063_7178 371
675 3300049571 Ga0501034_0000692 Ga0501034_0000692_33010_34128 371
676 3300053135 Ga0500659_0007118 Ga0500659_0007118_3885_5003 371
677 2162886007 SwRhRL2b_contig_1517485 SwRhRL2b_0515.00007290 372
678 3300002737 JGI25162J39368_1000884 JGI25162J39368_10008843 372
679 3300002737 JGI25162J39368_1000907 JGI25162J39368_100090718 372
680 3300002771 JGI25163J39215_1000928 JGI25163J39215_10009283 372
681 3300002771 JGI25163J39215_1000957 JGI25163J39215_10009577 372
682 3300002772 JGI25164J39214_1000487 JGI25164J39214_10004873 372
683 3300002772 JGI25164J39214_1000499 JGI25164J39214_10004993 372
684 3300003214 JGI25165J46597_1000962 JGI25165J46597_10009623 372
685 3300003214 JGI25165J46597_1000976 JGI25165J46597_10009763 372
686 3300003578 Ga0006562J51391_1005900 Ga0006562J51391_10059001 372
687 3300003781 Ga0055536_1004536 Ga0055536_10045368 372
688 3300003791 Ga0055530_10001227 Ga0055530_1000122720 372
689 3300003791 Ga0055530_10001233 Ga0055530_1000123320 372
690 3300003792 Ga0055540_1000720 Ga0055540_10007203 372
691 3300003792 Ga0055540_1003724 Ga0055540_10037249 372
692 3300003794 Ga0055531_10000458 Ga0055531_1000045822 372
693 3300005288 Ga0065714_10000080 Ga0065714_100000808 372
694 3300005288 Ga0065714_10004349 Ga0065714_100043493 372
695 3300005288 Ga0065714_10006895 Ga0065714_100068953 372
696 3300005288 Ga0065714_10008537 Ga0065714_100085373 372
697 3300005288 Ga0065714_10011906 Ga0065714_100119063 372
698 3300005288 Ga0065714_10012136 Ga0065714_100121363 372
699 3300005288 Ga0065714_10024207 Ga0065714_100242071 372
700 3300005288 Ga0065714_10067384 Ga0065714_100673843 372
701 3300005288 Ga0065714_10100864 Ga0065714_101008642 372
702 3300005288 Ga0065714_10101290 Ga0065714_101012902 372
703 3300005288 Ga0065714_10101832 Ga0065714_101018321 372
704 3300005289 Ga0065704_10006457 Ga0065704_100064572 372
705 3300005289 Ga0065704_10073380 Ga0065704_100733809 372
706 3300005290 Ga0065712_10002656 Ga0065712_100026563 372
707 3300005293 Ga0065715_10002680 Ga0065715_100026808 372
708 3300005548 Ga0070665_100204999 Ga0070665_1002049992 372
709 3300006051 Ga0075364_10038227 Ga0075364_100382273 372
710 3300006051 Ga0075364_10081776 Ga0075364_100817763 372
711 3300006051 Ga0075364_10120826 Ga0075364_101208262 372
712 3300006058 Ga0075432_10001964 Ga0075432_100019648 372
713 3300006058 Ga0075432_10003091 Ga0075432_100030913 372
714 3300006058 Ga0075432_10020219 Ga0075432_100202193 372
715 3300006946 Ga0079104_1000461 Ga0079104_100046126 372
716 3300006946 Ga0079104_1001117 Ga0079104_100111719 372
717 3300009011 Ga0105251_10001804 Ga0105251_1000180417 372
718 3300009011 Ga0105251_10007457 Ga0105251_100074573 372
719 3300009011 Ga0105251_10040456 Ga0105251_100404562 372
720 3300009011 Ga0105251_10063301 Ga0105251_100633011 372
721 3300009036 Ga0105244_10007287 Ga0105244_100072873 372
722 3300009036 Ga0105244_10009411 Ga0105244_100094118 372
723 3300009036 Ga0105244_10009684 Ga0105244_100096842 372
724 3300009036 Ga0105244_10014177 Ga0105244_100141772 372
725 3300009036 Ga0105244_10018575 Ga0105244_100185753 372
726 3300009036 Ga0105244_10057058 Ga0105244_100570583 372
727 3300009036 Ga0105244_10078342 Ga0105244_100783422 372
728 3300009092 Ga0105250_10003455 Ga0105250_100034553 372
729 3300009092 Ga0105250_10004255 Ga0105250_100042558 372
730 3300009092 Ga0105250_10014325 Ga0105250_100143253 372
731 3300009148 Ga0105243_10001595 Ga0105243_100015953 372
732 3300009148 Ga0105243_10009844 Ga0105243_100098448 372
733 3300009148 Ga0105243_10010135 Ga0105243_100101353 372
734 3300009553 Ga0105249_10116218 Ga0105249_101162182 372
735 3300011119 Ga0105246_10006476 Ga0105246_100064763 372
736 3300012498 Ga0157345_1000469 Ga0157345_10004693 372
737 3300013100 Ga0157373_10004821 Ga0157373_1000482110 372
738 3300013100 Ga0157373_10048042 Ga0157373_100480423 372
739 3300013100 Ga0157373_10062558 Ga0157373_100625583 372
740 3300013100 Ga0157373_10080182 Ga0157373_100801823 372
741 3300013100 Ga0157373_10174245 Ga0157373_101742452 372
742 3300013102 Ga0157371_10010283 Ga0157371_100102833 372
743 3300013102 Ga0157371_10014075 Ga0157371_100140758 372
744 3300013104 Ga0157370_10040737 Ga0157370_100407371 372
745 3300013104 Ga0157370_10156709 Ga0157370_101567092 372
746 3300013104 Ga0157370_10242675 Ga0157370_102426751 372
747 3300013105 Ga0157369_10096632 Ga0157369_100966324 372
748 3300013306 Ga0163162_10005867 Ga0163162_1000586715 372
749 3300013307 Ga0157372_10065016 Ga0157372_100650163 372
750 3300013308 Ga0157375_10271941 Ga0157375_102719411 372
751 3300014497 Ga0182008_10005424 Ga0182008_100054248 372
752 3300014497 Ga0182008_10006712 Ga0182008_100067128 372
753 3300014497 Ga0182008_10008395 Ga0182008_100083957 372
754 3300014497 Ga0182008_10024766 Ga0182008_100247663 372
755 3300014497 Ga0182008_10027930 Ga0182008_100279303 372
756 3300015261 Ga0182006_1006065 Ga0182006_10060653 372
757 3300015261 Ga0182006_1017379 Ga0182006_10173793 372
758 3300015261 Ga0182006_1039104 Ga0182006_10391042 372
759 3300015262 Ga0182007_10012548 Ga0182007_100125483 372
760 3300015265 Ga0182005_1002532 Ga0182005_10025323 372
761 3300015265 Ga0182005_1007638 Ga0182005_10076383 372
762 3300017792 Ga0163161_10010864 Ga0163161_100108648 372
763 3300017792 Ga0163161_10041881 Ga0163161_100418814 372
764 3300017792 Ga0163161_10051432 Ga0163161_100514323 372
765 3300017792 Ga0163161_10077187 Ga0163161_100771873 372
766 3300017792 Ga0163161_10160482 Ga0163161_101604821 372
767 3300025207 Ga0209760_100046 Ga0209760_10004617 372
768 3300025207 Ga0209760_100318 Ga0209760_1003183 372
769 3300025231 Ga0207427_100001 Ga0207427_100001403 372
770 3300025231 Ga0207427_100029 Ga0207427_100029280 372
771 3300025233 Ga0209437_100003 Ga0209437_100003969 372
772 3300025233 Ga0209437_100009 Ga0209437_100009535 372
773 3300025261 Ga0209233_1000007 Ga0209233_1000007403 372
774 3300025261 Ga0209233_1000032 Ga0209233_1000032535 372
775 3300025291 Ga0209675_1003103 Ga0209675_10031038 372
776 3300025292 Ga0209676_1000016 Ga0209676_1000016126 372
777 3300025292 Ga0209676_1005078 Ga0209676_10050784 372
778 3300025298 Ga0209050_1000588 Ga0209050_100058825 372
779 3300025298 Ga0209050_1001195 Ga0209050_10011953 372
780 3300025298 Ga0209050_1003119 Ga0209050_10031193 372
781 3300025303 Ga0209051_1000219 Ga0209051_100021973 372
782 3300025303 Ga0209051_1000422 Ga0209051_100042225 372
783 3300025303 Ga0209051_1016203 Ga0209051_10162033 372
784 3300025304 Ga0209257_1000342 Ga0209257_100034230 372
785 3300025304 Ga0209257_1014089 Ga0209257_10140893 372
786 3300025711 Ga0207696_1000032 Ga0207696_1000032344 372
787 3300025711 Ga0207696_1000141 Ga0207696_100014189 372
788 3300025711 Ga0207696_1006936 Ga0207696_10069365 372
789 3300025711 Ga0207696_1010537 Ga0207696_10105373 372
790 3300025711 Ga0207696_1012284 Ga0207696_10122843 372
791 3300025711 Ga0207696_1014106 Ga0207696_10141063 372
792 3300025728 Ga0207655_1000005 Ga0207655_1000005545 372
793 3300025728 Ga0207655_1000930 Ga0207655_100093016 372
794 3300025728 Ga0207655_1003258 Ga0207655_100325814 372
795 3300025728 Ga0207655_1004244 Ga0207655_100424412 372
796 3300025728 Ga0207655_1012023 Ga0207655_10120235 372
797 3300025728 Ga0207655_1018134 Ga0207655_10181343 372
798 3300025728 Ga0207655_1021522 Ga0207655_10215223 372
799 3300025728 Ga0207655_1033085 Ga0207655_10330852 372
800 3300025728 Ga0207655_1037320 Ga0207655_10373203 372
801 3300025735 Ga0207713_1000085 Ga0207713_100008531 372
802 3300025735 Ga0207713_1002569 Ga0207713_100256912 372
803 3300025735 Ga0207713_1003301 Ga0207713_10033019 372
804 3300025735 Ga0207713_1005235 Ga0207713_10052355 372
805 3300025735 Ga0207713_1007333 Ga0207713_10073332 372
806 3300025735 Ga0207713_1008659 Ga0207713_10086593 372
807 3300025735 Ga0207713_1016770 Ga0207713_10167703 372
808 3300025935 Ga0207709_10000228 Ga0207709_1000022863 372
809 3300025935 Ga0207709_10009665 Ga0207709_100096653 372
810 3300025935 Ga0207709_10028654 Ga0207709_100286542 372
811 3300027111 Ga0209281_1000013 Ga0209281_1000013418 372
812 3300027111 Ga0209281_1000015 Ga0209281_1000015547 372
813 3300027876 Ga0209974_10024025 Ga0209974_100240252 372
814 3300027907 Ga0207428_10036429 Ga0207428_100364293 372
815 3300027907 Ga0207428_10046472 Ga0207428_100464723 372
816 3300027907 Ga0207428_10059352 Ga0207428_100593522 372
817 3300027907 Ga0207428_10093391 Ga0207428_100933912 372
818 3300028379 Ga0268266_10015218 Ga0268266_100152183 372
819 3300030521 Ga0307511_10089532 Ga0307511_100895321 372
820 3300030731 Ga0316177_1013888 Ga0316177_10138882 372
821 3300030744 Ga0316181_1203960 Ga0316181_12039603 372
822 3300031548 Ga0307408_100009974 Ga0307408_1000099747 372
823 3300031548 Ga0307408_100050067 Ga0307408_1000500673 372
824 3300031548 Ga0307408_100205357 Ga0307408_1002053572 372
825 3300031731 Ga0307405_10003250 Ga0307405_100032508 372
826 3300031731 Ga0307405_10031170 Ga0307405_100311704 372
827 3300031731 Ga0307405_10045062 Ga0307405_100450623 372
828 3300031901 Ga0307406_10020867 Ga0307406_100208675 372
829 3300031901 Ga0307406_10029874 Ga0307406_100298743 372
830 3300031911 Ga0307412_10006760 Ga0307412_100067603 372
831 3300031911 Ga0307412_10018741 Ga0307412_100187414 372
832 3300031911 Ga0307412_10095610 Ga0307412_100956101 372
833 3300031911 Ga0307412_10115168 Ga0307412_101151683 372
834 3300032002 Ga0307416_100214941 Ga0307416_1002149412 372
835 3300032004 Ga0307414_10083843 Ga0307414_100838433 372
836 3300032005 Ga0307411_10005099 Ga0307411_100050997 372
837 3300033180 Ga0307510_10028379 Ga0307510_100283798 372
838 3300041405 Ga0439438_003254 Ga0439438_003254_4529_5647 372
839 3300041405 Ga0439438_004409 Ga0439438_004409_3821_4939 372
840 3300041405 Ga0439438_005843 Ga0439438_005843_2338_3456 372
841 3300041405 Ga0439438_006030 Ga0439438_006030_2315_3433 372
842 3300041405 Ga0439438_009212 Ga0439438_009212_1514_2632 372
843 3300041407 Ga0439447_002546 Ga0439447_002546_4501_5619 372
844 3300041407 Ga0439447_003754 Ga0439447_003754_3339_4457 372
845 3300041407 Ga0439447_004819 Ga0439447_004819_38_1156 372
846 3300041407 Ga0439447_007053 Ga0439447_007053_919_2037 372
847 3300041407 Ga0439447_007796 Ga0439447_007796_868_1986 372
848 3300041407 Ga0439447_010551 Ga0439447_010551_767_1885 372
849 3300041407 Ga0439447_024010 Ga0439447_024010_130_1248 372
850 3300041411 Ga0439466_0002187 Ga0439466_0002187_5549_6667 372
851 3300041411 Ga0439466_0003485 Ga0439466_0003485_730_1848 372
852 3300041411 Ga0439466_0012899 Ga0439466_0012899_929_2047 372
853 3300041411 Ga0439466_0013905 Ga0439466_0013905_817_1935 372
854 3300041411 Ga0439466_0041114 Ga0439466_0041114_44_1162 372
855 3300041997 Ga0439431_0004876 Ga0439431_0004876_1467_2585 372
856 3300042006 Ga0439432_003013 Ga0439432_003013_3663_4781 372
857 3300042006 Ga0439432_005523 Ga0439432_005523_176_1294 372
858 3300042006 Ga0439432_006565 Ga0439432_006565_579_1697 372
859 3300042006 Ga0439432_021041 Ga0439432_021041_674_1792 372
860 3300042009 Ga0439451_002017 Ga0439451_002017_619_1737 372
861 3300042010 Ga0439452_002598 Ga0439452_002598_4463_5581 372
862 3300042010 Ga0439452_006199 Ga0439452_006199_2158_3276 372
863 3300042013 Ga0439456_004857 Ga0439456_004857_834_1952 372
864 3300042016 Ga0439463_015148 Ga0439463_015148_293_1411 372
865 3300042115 Ga0450911_001924 Ga0450911_001924_823_1941 372
866 3300042115 Ga0450911_002077 Ga0450911_002077_2167_3285 372
867 3300042115 Ga0450911_003696 Ga0450911_003696_769_1887 372
868 3300042121 Ga0450919_000955 Ga0450919_000955_2548_3666 372
869 3300042122 Ga0450920_001171 Ga0450920_001171_2314_3432 372
870 3300042124 Ga0450922_000599 Ga0450922_000599_851_1969 372
871 3300042127 Ga0450890_000840 Ga0450890_000840_755_1873 372
872 3300042138 Ga0450903_001143 Ga0450903_001143_3235_4353 372
873 3300042145 Ga0450906_002331 Ga0450906_002331_2287_3405 372
874 3300042145 Ga0450906_003212 Ga0450906_003212_736_1854 372
875 3300042146 Ga0450907_003483 Ga0450907_003483_1031_2149 372
876 3300042156 Ga0439446_0004584 Ga0439446_0004584_1644_2762 372
877 3300042156 Ga0439446_0007496 Ga0439446_0007496_1419_2537 372
878 3300042184 Ga0450908_002663 Ga0450908_002663_1800_2918 372
879 3300042184 Ga0450908_006620 Ga0450908_006620_167_1285 372
880 3300042185 Ga0450909_000803 Ga0450909_000803_648_1766 372
881 3300042461 Ga0439460_0005683 Ga0439460_0005683_1015_2133 372
882 3300042461 Ga0439460_0011540 Ga0439460_0011540_151_1269 372
883 3300042993 Ga0439440_0004880 Ga0439440_0004880_382_1500 372
884 3300046452 Ga0495617_003091 Ga0495617_003091_665_1783 372
885 3300046452 Ga0495617_003447 Ga0495617_003447_851_1969 372
886 3300046452 Ga0495617_010871 Ga0495617_010871_542_1660 372
887 3300046452 Ga0495617_018335 Ga0495617_018335_501_1619 372
888 3300046452 Ga0495617_026339 Ga0495617_026339_480_1598 372
889 3300046452 Ga0495617_035093 Ga0495617_035093_114_1232 372
890 3300046453 Ga0495627_004068 Ga0495627_004068_1013_2131 372
891 3300046453 Ga0495627_013431 Ga0495627_013431_705_1823 372
892 3300046453 Ga0495627_014503 Ga0495627_014503_799_1917 372
893 3300046453 Ga0495627_021734 Ga0495627_021734_494_1612 372
894 3300046453 Ga0495627_031744 Ga0495627_031744_33_1151 372
895 3300046454 Ga0495592_0094847 Ga0495592_0094847_392_1510 372
896 3300046455 Ga0495603_0161537 Ga0495603_0161537_24_1142 372
897 3300046457 Ga0495590_0003495 Ga0495590_0003495_4507_5625 372
898 3300046457 Ga0495590_0003677 Ga0495590_0003677_828_1946 372
899 3300046457 Ga0495590_0004086 Ga0495590_0004086_4563_5681 372
900 3300046457 Ga0495590_0007358 Ga0495590_0007358_753_1871 372
901 3300046457 Ga0495590_0014884 Ga0495590_0014884_1032_2150 372
902 3300046458 Ga0495591_000705 Ga0495591_000705_19639_20757 372
903 3300046458 Ga0495591_014480 Ga0495591_014480_904_2022 372
904 3300046458 Ga0495591_014727 Ga0495591_014727_986_2104 372
905 3300046458 Ga0495591_015504 Ga0495591_015504_678_1796 372
906 3300046458 Ga0495591_015764 Ga0495591_015764_782_1900 372
907 3300046458 Ga0495591_017816 Ga0495591_017816_255_1373 372
908 3300046458 Ga0495591_022496 Ga0495591_022496_452_1570 372
909 3300046458 Ga0495591_028401 Ga0495591_028401_230_1348 372
910 3300046458 Ga0495591_043357 Ga0495591_043357_92_1210 372
911 3300046460 Ga0495638_0006152 Ga0495638_0006152_3137_4255 372
912 3300046460 Ga0495638_0009903 Ga0495638_0009903_1048_2166 372
913 3300046460 Ga0495638_0009918 Ga0495638_0009918_1018_2136 372
914 3300046460 Ga0495638_0023683 Ga0495638_0023683_786_1904 372
915 3300046460 Ga0495638_0038736 Ga0495638_0038736_859_1977 372
916 3300046460 Ga0495638_0039400 Ga0495638_0039400_375_1493 372
917 3300046460 Ga0495638_0049828 Ga0495638_0049828_782_1900 372
918 3300046460 Ga0495638_0055790 Ga0495638_0055790_962_2080 372
919 3300046460 Ga0495638_0090252 Ga0495638_0090252_627_1745 372
920 3300046460 Ga0495638_0165385 Ga0495638_0165385_98_1216 372
921 3300046463 Ga0495653_0014045 Ga0495653_0014045_3883_5001 372
922 3300046463 Ga0495653_0035518 Ga0495653_0035518_1865_2983 372
923 3300046463 Ga0495653_0062795 Ga0495653_0062795_886_2004 372
924 3300046471 Ga0495650_0012313 Ga0495650_0012313_2659_3777 372
925 3300046471 Ga0495650_0026664 Ga0495650_0026664_714_1832 372
926 3300046471 Ga0495650_0026942 Ga0495650_0026942_879_1997 372
927 3300046471 Ga0495650_0029516 Ga0495650_0029516_724_1842 372
928 3300046471 Ga0495650_0033501 Ga0495650_0033501_1006_2124 372
929 3300046471 Ga0495650_0036117 Ga0495650_0036117_329_1447 372
930 3300046474 Ga0495605_0006537 Ga0495605_0006537_1007_2125 372
931 3300046474 Ga0495605_0025145 Ga0495605_0025145_1016_2134 372
932 3300046474 Ga0495605_0036277 Ga0495605_0036277_720_1838 372
933 3300046474 Ga0495605_0045077 Ga0495605_0045077_665_1783 372
934 3300046474 Ga0495605_0078396 Ga0495605_0078396_286_1404 372
935 3300046475 Ga0495639_0003672 Ga0495639_0003672_976_2094 372
936 3300046491 Ga0495584_0005790 Ga0495584_0005790_4492_5610 372
937 3300046491 Ga0495584_0007014 Ga0495584_0007014_483_1601 372
938 3300046491 Ga0495584_0008693 Ga0495584_0008693_3991_5109 372
939 3300046491 Ga0495584_0023749 Ga0495584_0023749_1645_2763 372
940 3300046491 Ga0495584_0028508 Ga0495584_0028508_733_1851 372
941 3300046491 Ga0495584_0031381 Ga0495584_0031381_742_1860 372
942 3300046491 Ga0495584_0032736 Ga0495584_0032736_923_2041 372
943 3300046491 Ga0495584_0033183 Ga0495584_0033183_883_2001 372
944 3300046491 Ga0495584_0037625 Ga0495584_0037625_862_1980 372
945 3300046491 Ga0495584_0046416 Ga0495584_0046416_544_1662 372
946 3300046491 Ga0495584_0061524 Ga0495584_0061524_648_1766 372
947 3300046492 Ga0495585_0001500 Ga0495585_0001500_15629_16747 372
948 3300046492 Ga0495585_0008592 Ga0495585_0008592_750_1868 372
949 3300046492 Ga0495585_0019144 Ga0495585_0019144_622_1740 372
950 3300046492 Ga0495585_0032159 Ga0495585_0032159_833_1951 372
951 3300046492 Ga0495585_0040650 Ga0495585_0040650_931_2049 372
952 3300046492 Ga0495585_0043611 Ga0495585_0043611_725_1843 372
953 3300046499 Ga0495594_0044200 Ga0495594_0044200_530_1648 372
954 3300046500 Ga0495596_0001940 Ga0495596_0001940_8772_9890 372
955 3300046500 Ga0495596_0021699 Ga0495596_0021699_701_1819 372
956 3300046500 Ga0495596_0036024 Ga0495596_0036024_33_1151 372
957 3300046501 Ga0495607_0009593 Ga0495607_0009593_4960_6078 372
958 3300046501 Ga0495607_0014789 Ga0495607_0014789_3094_4212 372
959 3300046501 Ga0495607_0017407 Ga0495607_0017407_1115_2233 372
960 3300046501 Ga0495607_0039066 Ga0495607_0039066_888_2006 372
961 3300046501 Ga0495607_0044385 Ga0495607_0044385_615_1733 372
962 3300046501 Ga0495607_0045368 Ga0495607_0045368_607_1725 372
963 3300046501 Ga0495607_0057922 Ga0495607_0057922_531_1649 372
964 3300046506 Ga0495583_0007820 Ga0495583_0007820_1188_2306 372
965 3300046506 Ga0495583_0030826 Ga0495583_0030826_589_1707 372
966 3300046506 Ga0495583_0050083 Ga0495583_0050083_612_1730 372
967 3300046507 Ga0495606_0012966 Ga0495606_0012966_1003_2121 372
968 3300046507 Ga0495606_0021690 Ga0495606_0021690_346_1464 372
969 3300046507 Ga0495606_0040580 Ga0495606_0040580_855_1973 372
970 3300046507 Ga0495606_0046372 Ga0495606_0046372_752_1870 372
971 3300046507 Ga0495606_0052189 Ga0495606_0052189_938_2056 372
972 3300046507 Ga0495606_0054681 Ga0495606_0054681_811_1929 372
973 3300046512 Ga0495610_0008795 Ga0495610_0008795_853_1971 372
974 3300046512 Ga0495610_0008883 Ga0495610_0008883_972_2090 372
975 3300046512 Ga0495610_0013631 Ga0495610_0013631_2838_3956 372
976 3300046512 Ga0495610_0014361 Ga0495610_0014361_821_1939 372
977 3300046512 Ga0495610_0027734 Ga0495610_0027734_1168_2286 372
978 3300046512 Ga0495610_0030111 Ga0495610_0030111_1031_2149 372
979 3300046512 Ga0495610_0030290 Ga0495610_0030290_972_2090 372
980 3300046512 Ga0495610_0054465 Ga0495610_0054465_730_1848 372
981 3300046513 Ga0495616_0007791 Ga0495616_0007791_4522_5640 372
982 3300046513 Ga0495616_0007910 Ga0495616_0007910_4351_5469 372
983 3300046513 Ga0495616_0033660 Ga0495616_0033660_611_1729 372
984 3300046513 Ga0495616_0033879 Ga0495616_0033879_695_1813 372
985 3300046513 Ga0495616_0038378 Ga0495616_0038378_994_2112 372
986 3300046513 Ga0495616_0049366 Ga0495616_0049366_905_2023 372
987 3300046513 Ga0495616_0080511 Ga0495616_0080511_224_1342 372
988 3300046515 Ga0495620_0003310 Ga0495620_0003310_7094_8212 372
989 3300046515 Ga0495620_0007956 Ga0495620_0007956_789_1907 372
990 3300046515 Ga0495620_0009460 Ga0495620_0009460_668_1786 372
991 3300046515 Ga0495620_0022738 Ga0495620_0022738_915_2033 372
992 3300046515 Ga0495620_0033248 Ga0495620_0033248_697_1815 372
993 3300046515 Ga0495620_0041314 Ga0495620_0041314_33_1151 372
994 3300046515 Ga0495620_0045322 Ga0495620_0045322_67_1185 372
995 3300046517 Ga0495630_0013903 Ga0495630_0013903_423_1541 372
996 3300046517 Ga0495630_0123722 Ga0495630_0123722_778_1896 372
997 3300046518 Ga0495631_0001509 Ga0495631_0001509_11911_13029 372
998 3300046518 Ga0495631_0009381 Ga0495631_0009381_2831_3949 372
999 3300046518 Ga0495631_0025283 Ga0495631_0025283_862_1980 372
1000 3300046518 Ga0495631_0029883 Ga0495631_0029883_956_2074 372
1001 3300046518 Ga0495631_0038112 Ga0495631_0038112_431_1549 372
1002 3300046519 Ga0495632_0005580 Ga0495632_0005580_5409_6527 372
1003 3300046519 Ga0495632_0011706 Ga0495632_0011706_775_1893 372
1004 3300046519 Ga0495632_0012207 Ga0495632_0012207_3189_4307 372
1005 3300046519 Ga0495632_0018900 Ga0495632_0018900_2243_3361 372
1006 3300046519 Ga0495632_0030481 Ga0495632_0030481_841_1959 372
1007 3300046519 Ga0495632_0030659 Ga0495632_0030659_728_1846 372
1008 3300046519 Ga0495632_0053437 Ga0495632_0053437_545_1663 372
1009 3300046519 Ga0495632_0065406 Ga0495632_0065406_622_1740 372
1010 3300046520 Ga0495637_0002660 Ga0495637_0002660_4161_5279 372
1011 3300046520 Ga0495637_0006437 Ga0495637_0006437_400_1518 372
1012 3300046520 Ga0495637_0007193 Ga0495637_0007193_674_1792 372
1013 3300046520 Ga0495637_0018137 Ga0495637_0018137_778_1896 372
1014 3300046520 Ga0495637_0022752 Ga0495637_0022752_835_1953 372
1015 3300046520 Ga0495637_0026401 Ga0495637_0026401_1032_2150 372
1016 3300046520 Ga0495637_0029901 Ga0495637_0029901_1129_2247 372
1017 3300046520 Ga0495637_0032869 Ga0495637_0032869_760_1878 372
1018 3300046520 Ga0495637_0032916 Ga0495637_0032916_574_1692 372
1019 3300046522 Ga0495643_0008154 Ga0495643_0008154_4507_5625 372
1020 3300046522 Ga0495643_0009904 Ga0495643_0009904_523_1641 372
1021 3300046522 Ga0495643_0012725 Ga0495643_0012725_998_2116 372
1022 3300046522 Ga0495643_0037882 Ga0495643_0037882_632_1750 372
1023 3300046522 Ga0495643_0044775 Ga0495643_0044775_885_2003 372
1024 3300046522 Ga0495643_0065067 Ga0495643_0065067_198_1316 372
1025 3300046523 Ga0495644_0003103 Ga0495644_0003103_4439_5557 372
1026 3300046523 Ga0495644_0003231 Ga0495644_0003231_4312_5430 372
1027 3300046523 Ga0495644_0006248 Ga0495644_0006248_856_1974 372
1028 3300046523 Ga0495644_0022909 Ga0495644_0022909_398_1516 372
1029 3300046523 Ga0495644_0027802 Ga0495644_0027802_617_1735 372
1030 3300046524 Ga0495648_0004261 Ga0495648_0004261_1053_2171 372
1031 3300046524 Ga0495648_0012265 Ga0495648_0012265_765_1883 372
1032 3300046524 Ga0495648_0021765 Ga0495648_0021765_1543_2661 372
1033 3300046524 Ga0495648_0042220 Ga0495648_0042220_969_2087 372
1034 3300046524 Ga0495648_0042360 Ga0495648_0042360_773_1891 372
1035 3300046524 Ga0495648_0047034 Ga0495648_0047034_791_1909 372
1036 3300046524 Ga0495648_0047544 Ga0495648_0047544_754_1872 372
1037 3300046524 Ga0495648_0053476 Ga0495648_0053476_619_1737 372
1038 3300046524 Ga0495648_0056587 Ga0495648_0056587_415_1533 372
1039 3300046524 Ga0495648_0066999 Ga0495648_0066999_897_2015 372
1040 3300046524 Ga0495648_0069958 Ga0495648_0069958_860_1978 372
1041 3300046524 Ga0495648_0077715 Ga0495648_0077715_691_1809 372
1042 3300046524 Ga0495648_0090023 Ga0495648_0090023_16_1134 372
1043 3300046526 Ga0495666_0005580 Ga0495666_0005580_1282_2400 372
1044 3300046528 Ga0495642_0003043 Ga0495642_0003043_1033_2151 372
1045 3300046528 Ga0495642_0022602 Ga0495642_0022602_727_1845 372
1046 3300046530 Ga0495654_0006331 Ga0495654_0006331_2321_3439 372
1047 3300046530 Ga0495654_0008436 Ga0495654_0008436_620_1738 372
1048 3300046530 Ga0495654_0013810 Ga0495654_0013810_2173_3291 372
1049 3300046530 Ga0495654_0015005 Ga0495654_0015005_722_1840 372
1050 3300046530 Ga0495654_0029365 Ga0495654_0029365_514_1632 372
1051 3300046530 Ga0495654_0030687 Ga0495654_0030687_865_1983 372
1052 3300046530 Ga0495654_0030788 Ga0495654_0030788_706_1824 372
1053 3300046530 Ga0495654_0034737 Ga0495654_0034737_1033_2151 372
1054 3300046530 Ga0495654_0041519 Ga0495654_0041519_1007_2125 372
1055 3300046530 Ga0495654_0043644 Ga0495654_0043644_329_1447 372
1056 3300046530 Ga0495654_0050028 Ga0495654_0050028_206_1324 372
1057 3300046530 Ga0495654_0065182 Ga0495654_0065182_523_1641 372
1058 3300046530 Ga0495654_0069559 Ga0495654_0069559_11_1129 372
1059 3300046530 Ga0495654_0078598 Ga0495654_0078598_33_1151 372
1060 3300046536 Ga0495587_0064687 Ga0495587_0064687_611_1729 372
1061 3300046538 Ga0495609_0020625 Ga0495609_0020625_559_1677 372
1062 3300046538 Ga0495609_0025491 Ga0495609_0025491_894_2012 372
1063 3300046538 Ga0495609_0044385 Ga0495609_0044385_789_1907 372
1064 3300046538 Ga0495609_0058318 Ga0495609_0058318_402_1520 372
1065 3300046542 Ga0495597_0005350 Ga0495597_0005350_5030_6148 372
1066 3300046542 Ga0495597_0019851 Ga0495597_0019851_600_1718 372
1067 3300046542 Ga0495597_0022596 Ga0495597_0022596_1050_2168 372
1068 3300046542 Ga0495597_0024535 Ga0495597_0024535_860_1978 372
1069 3300046542 Ga0495597_0029426 Ga0495597_0029426_513_1631 372
1070 3300046542 Ga0495597_0048073 Ga0495597_0048073_583_1701 372
1071 3300046543 Ga0495645_0096861 Ga0495645_0096861_429_1547 372
1072 3300046557 Ga0495622_0009350 Ga0495622_0009350_2402_3520 372
1073 3300046557 Ga0495622_0023077 Ga0495622_0023077_1223_2341 372
1074 3300046557 Ga0495622_0028945 Ga0495622_0028945_801_1919 372
1075 3300046558 Ga0495633_0025843 Ga0495633_0025843_1021_2139 372
1076 3300046558 Ga0495633_0034075 Ga0495633_0034075_518_1636 372
1077 3300046558 Ga0495633_0034429 Ga0495633_0034429_543_1661 372
1078 3300046616 Ga0495668_0008003 Ga0495668_0008003_4521_5639 372
1079 3300046616 Ga0495668_0008328 Ga0495668_0008328_4331_5449 372
1080 3300046616 Ga0495668_0034628 Ga0495668_0034628_873_1991 372
1081 3300046616 Ga0495668_0076730 Ga0495668_0076730_447_1565 372
1082 3300046642 Ga0495634_0011380 Ga0495634_0011380_4341_5459 372
1083 3300046648 Ga0495611_0021575 Ga0495611_0021575_760_1878 372
1084 3300046660 Ga0495625_0013844 Ga0495625_0013844_1030_2148 372
1085 3300046660 Ga0495625_0014054 Ga0495625_0014054_772_1890 372
1086 3300046660 Ga0495625_0027510 Ga0495625_0027510_692_1810 372
1087 3300046660 Ga0495625_0038775 Ga0495625_0038775_542_1660 372
1088 3300046660 Ga0495625_0062818 Ga0495625_0062818_1026_2144 372
1089 3300046660 Ga0495625_0079214 Ga0495625_0079214_618_1736 372
1090 3300046663 Ga0495635_0048915 Ga0495635_0048915_813_1931 372
1091 3300046664 Ga0495659_0002115 Ga0495659_0002115_843_1961 372
1092 3300046665 Ga0495661_0028048 Ga0495661_0028048_918_2036 372
1093 3300046665 Ga0495661_0043194 Ga0495661_0043194_1009_2127 372
1094 3300046665 Ga0495661_0056134 Ga0495661_0056134_690_1808 372
1095 3300046665 Ga0495661_0057573 Ga0495661_0057573_543_1661 372
1096 3300046665 Ga0495661_0114353 Ga0495661_0114353_303_1421 372
1097 3300046679 Ga0495623_0077583 Ga0495623_0077583_558_1676 372
1098 3300046680 Ga0495646_0064847 Ga0495646_0064847_828_1946 372
1099 3300046680 Ga0495646_0080032 Ga0495646_0080032_771_1889 372
1100 3300046689 Ga0495613_0083781 Ga0495613_0083781_547_1665 372
1101 3300046689 Ga0495613_0148495 Ga0495613_0148495_41_1159 372
1102 3300046690 Ga0495624_0041976 Ga0495624_0041976_888_2006 372
1103 3300046691 Ga0495670_0006089 Ga0495670_0006089_4060_5178 372
1104 3300046691 Ga0495670_0028236 Ga0495670_0028236_939_2057 372
1105 3300046691 Ga0495670_0030317 Ga0495670_0030317_782_1900 372
1106 3300046691 Ga0495670_0030456 Ga0495670_0030456_889_2007 372
1107 3300046692 Ga0495671_0006761 Ga0495671_0006761_4474_5592 372
1108 3300046692 Ga0495671_0013386 Ga0495671_0013386_1683_2801 372
1109 3300046692 Ga0495671_0015482 Ga0495671_0015482_576_1694 372
1110 3300046692 Ga0495671_0015799 Ga0495671_0015799_833_1951 372
1111 3300046692 Ga0495671_0018946 Ga0495671_0018946_1009_2127 372
1112 3300046692 Ga0495671_0029184 Ga0495671_0029184_1490_2608 372
1113 3300046692 Ga0495671_0033900 Ga0495671_0033900_870_1988 372
1114 3300046692 Ga0495671_0041195 Ga0495671_0041195_853_1971 372
1115 3300046692 Ga0495671_0043268 Ga0495671_0043268_663_1781 372
1116 3300046694 Ga0495649_0007403 Ga0495649_0007403_4564_5682 372
1117 3300046694 Ga0495649_0008102 Ga0495649_0008102_767_1885 372
1118 3300046694 Ga0495649_0016805 Ga0495649_0016805_2355_3473 372
1119 3300046694 Ga0495649_0020414 Ga0495649_0020414_2381_3499 372
1120 3300046694 Ga0495649_0024569 Ga0495649_0024569_944_2062 372
1121 3300046694 Ga0495649_0032381 Ga0495649_0032381_833_1951 372
1122 3300046694 Ga0495649_0037843 Ga0495649_0037843_633_1751 372
1123 3300046694 Ga0495649_0041269 Ga0495649_0041269_966_2084 372
1124 3300046694 Ga0495649_0043742 Ga0495649_0043742_547_1665 372
1125 3300046694 Ga0495649_0048349 Ga0495649_0048349_561_1679 372
1126 3300046694 Ga0495649_0059466 Ga0495649_0059466_280_1398 372
1127 3300046694 Ga0495649_0066421 Ga0495649_0066421_789_1907 372
1128 3300046694 Ga0495649_0066552 Ga0495649_0066552_787_1905 372
1129 3300046694 Ga0495649_0082109 Ga0495649_0082109_67_1185 372
1130 3300046794 Ga0495589_0008198 Ga0495589_0008198_3669_4787 372
1131 3300046794 Ga0495589_0010644 Ga0495589_0010644_2891_4009 372
1132 3300046794 Ga0495589_0018081 Ga0495589_0018081_1016_2134 372
1133 3300046794 Ga0495589_0028752 Ga0495589_0028752_792_1910 372
1134 3300046794 Ga0495589_0030792 Ga0495589_0030792_897_2015 372
1135 3300046794 Ga0495589_0031525 Ga0495589_0031525_660_1778 372
1136 3300046794 Ga0495589_0032590 Ga0495589_0032590_700_1818 372
1137 3300046794 Ga0495589_0063307 Ga0495589_0063307_53_1171 372
1138 3300046809 Ga0495600_0062723 Ga0495600_0062723_822_1940 372
1139 3300046810 Ga0495660_0007405 Ga0495660_0007405_4310_5428 372
1140 3300046810 Ga0495660_0012115 Ga0495660_0012115_3667_4785 372
1141 3300046810 Ga0495660_0030837 Ga0495660_0030837_1005_2123 372
1142 3300046810 Ga0495660_0038308 Ga0495660_0038308_892_2010 372
1143 3300046810 Ga0495660_0041803 Ga0495660_0041803_560_1678 372
1144 3300046810 Ga0495660_0057143 Ga0495660_0057143_606_1724 372
1145 3300046810 Ga0495660_0070914 Ga0495660_0070914_667_1785 372
1146 3300046810 Ga0495660_0096417 Ga0495660_0096417_383_1501 372
1147 3300047315 Ga0495581_0047661 Ga0495581_0047661_892_2010 372
1148 3300047317 Ga0495604_0070557 Ga0495604_0070557_775_1893 372
1149 3300047317 Ga0495604_0073920 Ga0495604_0073920_701_1819 372
1150 3300047318 Ga0495636_0009655 Ga0495636_0009655_853_1971 372
1151 3300047319 Ga0495674_0020264 Ga0495674_0020264_952_2070 372
1152 3300047320 Ga0495672_0003149 Ga0495672_0003149_4312_5430 372
1153 3300047320 Ga0495672_0009858 Ga0495672_0009858_4801_5919 372
1154 3300047320 Ga0495672_0010640 Ga0495672_0010640_843_1961 372
1155 3300047320 Ga0495672_0010775 Ga0495672_0010775_580_1698 372
1156 3300047320 Ga0495672_0010851 Ga0495672_0010851_998_2116 372
1157 3300047320 Ga0495672_0011985 Ga0495672_0011985_4202_5320 372
1158 3300047320 Ga0495672_0013592 Ga0495672_0013592_697_1815 372
1159 3300047320 Ga0495672_0017667 Ga0495672_0017667_707_1825 372
1160 3300047320 Ga0495672_0031946 Ga0495672_0031946_456_1574 372
1161 3300047320 Ga0495672_0043226 Ga0495672_0043226_573_1697 372
1162 3300047320 Ga0495672_0047701 Ga0495672_0047701_466_1584 372
1163 3300047321 Ga0495676_0064510 Ga0495676_0064510_899_2017 372
1164 3300047321 Ga0495676_0092956 Ga0495676_0092956_658_1776 372
1165 3300047322 Ga0495680_0018110 Ga0495680_0018110_2069_3187 372
1166 3300047322 Ga0495680_0043242 Ga0495680_0043242_1455_2573 372
1167 3300047323 Ga0495683_0005755 Ga0495683_0005755_4318_5436 372
1168 3300047323 Ga0495683_0006298 Ga0495683_0006298_4370_5488 372
1169 3300047323 Ga0495683_0006407 Ga0495683_0006407_1003_2121 372
1170 3300047323 Ga0495683_0012783 Ga0495683_0012783_2251_3369 372
1171 3300047323 Ga0495683_0052478 Ga0495683_0052478_284_1402 372
1172 3300047323 Ga0495683_0056568 Ga0495683_0056568_478_1596 372
1173 3300047323 Ga0495683_0061874 Ga0495683_0061874_251_1369 372
1174 3300047323 Ga0495683_0103491 Ga0495683_0103491_223_1341 372
1175 3300047443 Ga0495687_007445 Ga0495687_007445_825_1943 372
1176 3300047443 Ga0495687_024756 Ga0495687_024756_779_1897 372
1177 3300047443 Ga0495687_026480 Ga0495687_026480_783_1901 372
1178 3300047443 Ga0495687_026699 Ga0495687_026699_1044_2162 372
1179 3300047446 Ga0495679_009011 Ga0495679_009011_2223_3341 372
1180 3300047446 Ga0495679_016385 Ga0495679_016385_873_1991 372
1181 3300047446 Ga0495679_019183 Ga0495679_019183_862_1980 372
1182 3300047446 Ga0495679_026441 Ga0495679_026441_468_1586 372
1183 3300047469 Ga0495673_0006814 Ga0495673_0006814_4865_5983 372
1184 3300047469 Ga0495673_0006881 Ga0495673_0006881_1000_2118 372
1185 3300047469 Ga0495673_0006946 Ga0495673_0006946_1037_2155 372
1186 3300047469 Ga0495673_0007050 Ga0495673_0007050_4391_5509 372
1187 3300047469 Ga0495673_0007400 Ga0495673_0007400_4415_5533 372
1188 3300047469 Ga0495673_0012102 Ga0495673_0012102_2604_3722 372
1189 3300047469 Ga0495673_0013279 Ga0495673_0013279_2199_3317 372
1190 3300047469 Ga0495673_0027576 Ga0495673_0027576_880_1998 372
1191 3300047469 Ga0495673_0035209 Ga0495673_0035209_578_1696 372
1192 3300047469 Ga0495673_0049542 Ga0495673_0049542_513_1631 372
1193 3300047470 Ga0495681_0008348 Ga0495681_0008348_4487_5605 372
1194 3300047470 Ga0495681_0008517 Ga0495681_0008517_819_1937 372
1195 3300047470 Ga0495681_0009657 Ga0495681_0009657_874_1992 372
1196 3300047470 Ga0495681_0010292 Ga0495681_0010292_2842_3960 372
1197 3300047470 Ga0495681_0010529 Ga0495681_0010529_725_1843 372
1198 3300047470 Ga0495681_0010964 Ga0495681_0010964_3537_4655 372
1199 3300047470 Ga0495681_0017199 Ga0495681_0017199_2246_3364 372
1200 3300047470 Ga0495681_0027934 Ga0495681_0027934_977_2095 372
1201 3300047470 Ga0495681_0031510 Ga0495681_0031510_822_1940 372
1202 3300047470 Ga0495681_0032351 Ga0495681_0032351_800_1918 372
1203 3300047470 Ga0495681_0040599 Ga0495681_0040599_693_1811 372
1204 3300047471 Ga0495684_0013285 Ga0495684_0013285_4480_5598 372
1205 3300047471 Ga0495684_0111855 Ga0495684_0111855_412_1530 372
1206 3300047472 Ga0495686_0010852 Ga0495686_0010852_4474_5592 372
1207 3300047472 Ga0495686_0011075 Ga0495686_0011075_1036_2154 372
1208 3300047472 Ga0495686_0043917 Ga0495686_0043917_892_2010 372
1209 3300047472 Ga0495686_0049412 Ga0495686_0049412_1017_2135 372
1210 3300047472 Ga0495686_0054202 Ga0495686_0054202_723_1841 372
1211 3300047673 Ga0495593_0010331 Ga0495593_0010331_3283_4401 372
1212 3300048088 Ga0495602_0092360 Ga0495602_0092360_547_1665 372
1213 3300048091 Ga0495626_0004811 Ga0495626_0004811_5430_6548 372
1214 3300048091 Ga0495626_0006497 Ga0495626_0006497_997_2115 372
1215 3300048091 Ga0495626_0006504 Ga0495626_0006504_1018_2136 372
1216 3300048091 Ga0495626_0006651 Ga0495626_0006651_953_2071 372
1217 3300048091 Ga0495626_0028136 Ga0495626_0028136_716_1834 372
1218 3300048091 Ga0495626_0032405 Ga0495626_0032405_516_1634 372
1219 3300048091 Ga0495626_0033806 Ga0495626_0033806_314_1432 372
1220 3300048905 Ga0496102_0016517 Ga0496102_0016517_4353_5471 372
1221 3300048906 Ga0496103_0014366 Ga0496103_0014366_1141_2259 372
1222 3300048915 Ga0496112_0056284 Ga0496112_0056284_1887_3008 372
1223 3300048917 Ga0496114_0110881 Ga0496114_0110881_245_1363 372
1224 3300048919 Ga0496116_0002267 Ga0496116_0002267_18278_19396 372
1225 3300048919 Ga0496116_0014744 Ga0496116_0014744_223_1341 372
1226 3300048919 Ga0496116_0015825 Ga0496116_0015825_4148_5266 372
1227 3300048919 Ga0496116_0038790 Ga0496116_0038790_969_2087 372
1228 3300048919 Ga0496116_0059638 Ga0496116_0059638_870_1988 372
1229 3300048920 Ga0496117_0066912 Ga0496117_0066912_629_1747 372
1230 3300048920 Ga0496117_0080788 Ga0496117_0080788_429_1547 372
1231 3300048921 Ga0496118_0025383 Ga0496118_0025383_882_2000 372
1232 3300048921 Ga0496118_0068784 Ga0496118_0068784_717_1835 372
1233 3300048921 Ga0496118_0080000 Ga0496118_0080000_716_1834 372
1234 3300048924 Ga0496121_0007392 Ga0496121_0007392_10672_11790 372
1235 3300048924 Ga0496121_0027681 Ga0496121_0027681_3741_4859 372
1236 3300048925 Ga0496122_0059415 Ga0496122_0059415_731_1849 372
1237 3300048925 Ga0496122_0086893 Ga0496122_0086893_392_1510 372
1238 3300048926 Ga0496123_0035630 Ga0496123_0035630_942_2060 372
1239 3300048926 Ga0496123_0066590 Ga0496123_0066590_665_1783 372
1240 3300048926 Ga0496123_0071951 Ga0496123_0071951_599_1717 372
1241 3300048927 Ga0496124_0018071 Ga0496124_0018071_992_2110 372
1242 3300048927 Ga0496124_0047939 Ga0496124_0047939_2411_3529 372
1243 3300048928 Ga0496125_0089524 Ga0496125_0089524_643_1761 372
1244 3300048928 Ga0496125_0140607 Ga0496125_0140607_193_1311 372
1245 3300048929 Ga0496126_0030107 Ga0496126_0030107_3033_4151 372
1246 3300049459 Ga0495678_007413 Ga0495678_007413_3817_4935 372
1247 3300049459 Ga0495678_016896 Ga0495678_016896_1258_2376 372
1248 3300049459 Ga0495678_019427 Ga0495678_019427_665_1783 372
1249 3300049459 Ga0495678_022249 Ga0495678_022249_860_1978 372
1250 3300049459 Ga0495678_023694 Ga0495678_023694_910_2028 372
1251 3300049459 Ga0495678_025296 Ga0495678_025296_571_1689 372
1252 3300049459 Ga0495678_032413 Ga0495678_032413_936_2054 372
1253 3300049459 Ga0495678_041247 Ga0495678_041247_513_1631 372
1254 3300049459 Ga0495678_061137 Ga0495678_061137_10_1128 372
1255 3300049460 Ga0495682_0004277 Ga0495682_0004277_4331_5449 372
1256 3300049460 Ga0495682_0014600 Ga0495682_0014600_963_2081 372
1257 3300049460 Ga0495682_0020901 Ga0495682_0020901_715_1833 372
1258 3300049758 Ga0501241_004789 Ga0501241_004789_555_1673 372
1259 3300050489 nmdc:mga03683_20683_c1 nmdc:mga03683_20683_c1_337_1455 372
1260 3300050491 nmdc:mga00v17_28152_c1 nmdc:mga00v17_28152_c1_424_1542 372
1261 3300053111 Ga0500572_009834 Ga0500572_009834_518_1636 372
1262 3300046810 Ga0495660_0000911 Ga0495660_0000911_4321_5466 375
1263 3300009036 Ga0105244_10001467 Ga0105244_1000146718 376
1264 3300046458 Ga0495591_000212 Ga0495591_000212_16027_17163 377
1265 3300046474 Ga0495605_0003084 Ga0495605_0003084_385_1521 377
1266 3300046474 Ga0495605_0042518 Ga0495605_0042518_70_1209 377
1267 3300046501 Ga0495607_0000276 Ga0495607_0000276_35570_36706 377
1268 3300046507 Ga0495606_0035179 Ga0495606_0035179_846_1985 377
1269 3300046542 Ga0495597_0000098 Ga0495597_0000098_35970_37106 377
1270 3300047320 Ga0495672_0088443 Ga0495672_0088443_128_1264 377
1271 3300009011 Ga0105251_10000444 Ga0105251_1000044421 378
1272 3300041411 Ga0439466_0010364 Ga0439466_0010364_646_1797 378
1273 3300046458 Ga0495591_000849 Ga0495591_000849_5531_6673 378
1274 3300046458 Ga0495591_003156 Ga0495591_003156_6470_7612 378
1275 3300048913 Ga0496110_0070835 Ga0496110_0070835_1044_2186 378
1276 2124908027 MRS2a_Contig_5 MRS2a_00381930 389
1277 3300013100 Ga0157373_10033833 Ga0157373_100338334 389
1278 3300013104 Ga0157370_10025382 Ga0157370_100253822 389
1279 3300013105 Ga0157369_10088577 Ga0157369_100885774 389
1280 3300013306 Ga0163162_10023433 Ga0163162_100234332 389
1281 3300015261 Ga0182006_1010985 Ga0182006_10109855 389
1282 3300041405 Ga0439438_008478 Ga0439438_008478_1251_2420 389
1283 3300041407 Ga0439447_007931 Ga0439447_007931_1009_2178 389
1284 3300041411 Ga0439466_0003523 Ga0439466_0003523_1012_2181 389
1285 3300042006 Ga0439432_003671 Ga0439432_003671_806_1975 389
1286 3300042009 Ga0439451_003275 Ga0439451_003275_1203_2372 389
1287 3300042013 Ga0439456_001602 Ga0439456_001602_2818_3987 389
1288 3300042146 Ga0450907_000909 Ga0450907_000909_4865_6034 389
1289 3300042156 Ga0439446_0001273 Ga0439446_0001273_3717_4886 389
1290 3300042185 Ga0450909_001988 Ga0450909_001988_841_2010 389
1291 3300042435 Ga0439434_0001746 Ga0439434_0001746_837_2006 389
1292 3300042461 Ga0439460_0003622 Ga0439460_0003622_1609_2778 389
1293 3300046460 Ga0495638_0012321 Ga0495638_0012321_997_2166 389
1294 3300046460 Ga0495638_0069703 Ga0495638_0069703_132_1301 389
1295 3300046471 Ga0495650_0025606 Ga0495650_0025606_819_1988 389
1296 3300046474 Ga0495605_0041984 Ga0495605_0041984_213_1382 389
1297 3300046491 Ga0495584_0009943 Ga0495584_0009943_1006_2175 389
1298 3300046499 Ga0495594_0007071 Ga0495594_0007071_4317_5486 389
1299 3300046499 Ga0495594_0058014 Ga0495594_0058014_437_1606 389
1300 3300046501 Ga0495607_0079470 Ga0495607_0079470_425_1594 389
1301 3300046506 Ga0495583_0009592 Ga0495583_0009592_4359_5528 389
1302 3300046513 Ga0495616_0007633 Ga0495616_0007633_843_2012 389
1303 3300046519 Ga0495632_0007982 Ga0495632_0007982_4362_5531 389
1304 3300046520 Ga0495637_0028614 Ga0495637_0028614_554_1723 389
1305 3300046522 Ga0495643_0023079 Ga0495643_0023079_2150_3319 389
1306 3300046526 Ga0495666_0006158 Ga0495666_0006158_4361_5539 389
1307 3300046528 Ga0495642_0003361 Ga0495642_0003361_1015_2184 389
1308 3300046530 Ga0495654_0011474 Ga0495654_0011474_3348_4517 389
1309 3300046530 Ga0495654_0017518 Ga0495654_0017518_239_1408 389
1310 3300046536 Ga0495587_0024003 Ga0495587_0024003_1562_2740 389
1311 3300046538 Ga0495609_0005574 Ga0495609_0005574_4362_5531 389
1312 3300046542 Ga0495597_0013802 Ga0495597_0013802_2271_3440 389
1313 3300046542 Ga0495597_0064356 Ga0495597_0064356_212_1381 389
1314 3300046557 Ga0495622_0010472 Ga0495622_0010472_1011_2180 389
1315 3300046557 Ga0495622_0033065 Ga0495622_0033065_761_1930 389
1316 3300046615 Ga0495656_0005331 Ga0495656_0005331_1009_2178 389
1317 3300046660 Ga0495625_0096036 Ga0495625_0096036_186_1355 389
1318 3300046663 Ga0495635_0010325 Ga0495635_0010325_4334_5512 389
1319 3300046664 Ga0495659_0022507 Ga0495659_0022507_201_1370 389
1320 3300046665 Ga0495661_0029343 Ga0495661_0029343_2150_3319 389
1321 3300046674 Ga0495588_0004963 Ga0495588_0004963_3828_4997 389
1322 3300046684 Ga0495669_0007367 Ga0495669_0007367_2417_3586 389
1323 3300046691 Ga0495670_0059342 Ga0495670_0059342_610_1779 389
1324 3300046692 Ga0495671_0059654 Ga0495671_0059654_505_1674 389
1325 3300046794 Ga0495589_0012260 Ga0495589_0012260_1021_2190 389
1326 3300046809 Ga0495600_0032406 Ga0495600_0032406_1014_2192 389
1327 3300046810 Ga0495660_0054886 Ga0495660_0054886_433_1602 389
1328 3300047318 Ga0495636_0008432 Ga0495636_0008432_213_1382 389
1329 3300047322 Ga0495680_0023388 Ga0495680_0023388_1021_2199 389
1330 3300047444 Ga0495675_0007938 Ga0495675_0007938_4365_5543 389
1331 3300047445 Ga0495677_0013544 Ga0495677_0013544_812_1981 389
1332 3300047470 Ga0495681_0007870 Ga0495681_0007870_1016_2185 389
1333 3300048091 Ga0495626_0006629 Ga0495626_0006629_1032_2201 389
1334 3300048913 Ga0496110_0118933 Ga0496110_0118933_512_1681 389
1335 3300048924 Ga0496121_0030463 Ga0496121_0030463_3610_4779 389
1336 3300048928 Ga0496125_0020440 Ga0496125_0020440_4072_5241 389
1337 3300049460 Ga0495682_0011952 Ga0495682_0011952_1013_2182 389
1338 3300049460 Ga0495682_0033373 Ga0495682_0033373_44_1213 389

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

145

282

0.84

PF18306

LDcluster4

SLOG cluster4 family

104

264

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zi9-assembly1.cif.gz_A crystal structure of type-ii log from streptomyces coelicolor a3 0.925 102 281
5wq3-assembly1.cif.gz_B-2 crystal structure of type-ii log from corynebacterium glutamicum 0.9236 81 279
5wq3-assembly1.cif.gz_C-3 crystal structure of type-ii log from corynebacterium glutamicum 0.9207 74 279
5zi9-assembly1.cif.gz_B crystal structure of type-ii log from streptomyces coelicolor a3 0.9074 74 281
1wek-assembly1.cif.gz_F crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9009 73 280
ID Description Score Start End Superfamily
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9236 81 279 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9075 81 280 3.40.50.450
af_Q8I1V0_170_336_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8907 134 282 3.40.50.450
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8861 102 279 3.40.50.450
af_Q9XH06_2_128_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8859 183 280 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A7Y8CHU3-F1-model_v4 LOG family protein 0.9884 101 205 GO:0005829
AF-A0A3M5W5B4-F1-model_v4 Uncharacterized protein 0.9814 268 372
AF-A0A349BCU6-F1-model_v4 Rossman fold protein, TIGR00730 family 0.9784 89 189 GO:0005829
AF-A0A534VJR4-F1-model_v4 TIGR00730 family Rossman fold protein 0.9767 62 366 GO:0005829
GO:0008714
GO:0009691
AF-A0A656GK56-F1-model_v4 AMP nucleosidase (EC 3.2.2.4) (AMP nucleosidase) 0.9756 136 260 GO:0005829
GO:0008714

Feature Viewer

pLDDT pTM Quality
85.57 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map