F493151

General Info

Members Datasets Scaffolds Average Seq Length
1340 372 1340 196

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10000210|JGI25406J46586_1000021017
Length 219
Sequence MTRTRSGRPPAPRRGRTSAASNAPARGAEFDRRTTETQISGRLVVDGHGRYDVRTGIRFFDHMLELFTRHGGFDLTLHAAGDLDVDQHHTVEDVGIVLGESLLEALGDRRGINRAGYFVMPMDETLAVVAIDLSGRPHAVVDLKVRVRMVGDLQSELVHDFFDGFAMGARANVHAKVLYGRSNHHHIEAVFKAFARALRVACARDPRLAAMLPSTKGLL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
219 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
231 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
251 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
254 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
255 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
256 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
257 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
258 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
259 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
260 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
261 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
262 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
313 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
341 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
342 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
343 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
344 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
363 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
368 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 0.9
Rhizosphere 95.9
Stem 0
Stem Tuber 0
Unclassified 2.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3236978 2162886007 Bacteria 1527
2 SwRhRL2b_contig_3825395 2162886007 Bacteria 1468
3 JGI25406J46586_10000210 3300003203 Bacteria 25956
4 JGI25406J46586_10001441 3300003203 Bacteria 11218
5 Ga0065714_10125624 3300005288 Bacteria 1299
6 Ga0065704_10075134 3300005289 Bacteria 5772
7 Ga0065712_10018271 3300005290 Bacteria 5026
8 Ga0065712_10321009 3300005290 Bacteria 828
9 Ga0065715_10172499 3300005293 Bacteria 1536
10 Ga0065715_10262856 3300005293 Bacteria 1133
11 Ga0065715_10443124 3300005293 Bacteria 834
12 Ga0065715_10505586 3300005293 Bacteria 768
13 Ga0065707_10001927 3300005295 Bacteria 6902
14 Ga0065707_10084472 3300005295 Bacteria 7165
15 Ga0065707_10157109 3300005295 Bacteria 1598
16 Ga0065707_10381309 3300005295 Bacteria 877
17 Ga0070658_10009861 3300005327 Bacteria 7674
18 Ga0070658_10522636 3300005327 Bacteria 1026
19 Ga0070676_10006282 3300005328 Bacteria 6346
20 Ga0070683_100005237 3300005329 Bacteria 10794
21 Ga0070683_100020370 3300005329 Bacteria 5903
22 Ga0070683_100084842 3300005329 Bacteria 2968
23 Ga0070683_100143466 3300005329 Bacteria 2262
24 Ga0070683_100221656 3300005329 Bacteria 1798
25 Ga0070683_100660156 3300005329 Bacteria 1001
26 Ga0070683_100904347 3300005329 Bacteria 847
27 Ga0070690_100249108 3300005330 Bacteria 1256
28 Ga0070670_100004900 3300005331 Bacteria 11261
29 Ga0070670_100030192 3300005331 Bacteria 4668
30 Ga0070670_100030977 3300005331 Bacteria 4607
31 Ga0070670_100087327 3300005331 Bacteria 2680
32 Ga0070670_100157927 3300005331 Bacteria 1965
33 Ga0070670_100418815 3300005331 Bacteria 1184
34 Ga0070670_100593520 3300005331 Bacteria 991
35 Ga0070670_100924952 3300005331 Bacteria 791
36 Ga0070677_10001462 3300005333 Bacteria 7469
37 Ga0070677_10039601 3300005333 Bacteria 1850
38 Ga0070677_10076161 3300005333 Bacteria 1424
39 Ga0070677_10078642 3300005333 Bacteria 1405
40 Ga0070677_10164098 3300005333 Bacteria 1045
41 Ga0068869_100042368 3300005334 Bacteria 3263
42 Ga0068869_100066274 3300005334 Bacteria 2660
43 Ga0068869_100082871 3300005334 Bacteria 2398
44 Ga0068869_100153391 3300005334 Bacteria 1788
45 Ga0070666_10016581 3300005335 Bacteria 4714
46 Ga0070666_10024914 3300005335 Bacteria 3899
47 Ga0070666_10055207 3300005335 Bacteria 2681
48 Ga0070680_100058199 3300005336 Bacteria 3161
49 Ga0070680_100376931 3300005336 Bacteria 1208
50 Ga0070680_100433345 3300005336 Bacteria 1122
51 Ga0070680_101083871 3300005336 Bacteria 692
52 Ga0068868_100011009 3300005338 Bacteria 6572
53 Ga0068868_100062155 3300005338 Bacteria 2959
54 Ga0068868_100169117 3300005338 Bacteria 1809
55 Ga0068868_100488350 3300005338 Archaea 1077
56 Ga0070660_100007244 3300005339 Bacteria 7720
57 Ga0070660_100203357 3300005339 Unclassified 1607
58 Ga0070660_100363369 3300005339 Unclassified 1193
59 Ga0070689_100005732 3300005340 Bacteria 8517
60 Ga0070689_100065829 3300005340 Bacteria 2823
61 Ga0070689_100103680 3300005340 Bacteria 2254
62 Ga0070689_100373115 3300005340 Bacteria 1201
63 Ga0070689_100683925 3300005340 Bacteria 895
64 Ga0070691_10022558 3300005341 Bacteria 2921
65 Ga0070687_100236648 3300005343 Bacteria 1127
66 Ga0070668_100026632 3300005347 Bacteria 4388
67 Ga0070669_100008311 3300005353 Bacteria 7412
68 Ga0070669_100116793 3300005353 Bacteria 2031
69 Ga0070669_100118006 3300005353 Bacteria 2020
70 Ga0070669_100156307 3300005353 Bacteria 1769
71 Ga0070669_100175803 3300005353 Bacteria 1672
72 Ga0070669_100209938 3300005353 Bacteria 1535
73 Ga0070669_100842915 3300005353 Bacteria 781
74 Ga0070675_100000116 3300005354 Bacteria 46828
75 Ga0070675_100001421 3300005354 Bacteria 17587
76 Ga0070675_100004051 3300005354 Bacteria 11124
77 Ga0070675_100010384 3300005354 Bacteria 7273
78 Ga0070675_100030804 3300005354 Bacteria 4332
79 Ga0070675_100031527 3300005354 Bacteria 4285
80 Ga0070675_100610400 3300005354 Archaea 990
81 Ga0070671_100036440 3300005355 Bacteria 4080
82 Ga0070671_100081927 3300005355 Bacteria 2698
83 Ga0070671_100117122 3300005355 Bacteria 2240
84 Ga0070674_100000382 3300005356 Bacteria 22209
85 Ga0070674_100008990 3300005356 Bacteria 5970
86 Ga0070674_100013039 3300005356 Bacteria 5125
87 Ga0070674_100461468 3300005356 Bacteria 1050
88 Ga0070674_100639929 3300005356 Bacteria 903
89 Ga0070674_100651728 3300005356 Bacteria 895
90 Ga0070673_100008003 3300005364 Bacteria 7002
91 Ga0070673_100046554 3300005364 Bacteria 3370
92 Ga0070673_100060396 3300005364 Bacteria 3004
93 Ga0070673_100097279 3300005364 Bacteria 2417
94 Ga0070673_100118062 3300005364 Bacteria 2208
95 Ga0070673_100128742 3300005364 Bacteria 2121
96 Ga0070673_100273180 3300005364 Bacteria 1480
97 Ga0070673_100782076 3300005364 Bacteria 880
98 Ga0070688_100006025 3300005365 Bacteria 6433
99 Ga0070688_100161187 3300005365 Bacteria 1541
100 Ga0070688_100187499 3300005365 Bacteria 1439
101 Ga0070659_100126655 3300005366 Bacteria 2072
102 Ga0070659_100723373 3300005366 Bacteria 862
103 Ga0070659_101276334 3300005366 Bacteria 651
104 Ga0070667_100013784 3300005367 Bacteria 6683
105 Ga0070667_100150934 3300005367 Bacteria 2041
106 Ga0070703_10041178 3300005406 Bacteria 1439
107 Ga0070709_10013766 3300005434 Bacteria 4557
108 Ga0070709_10801774 3300005434 Bacteria 739
109 Ga0070714_100035658 3300005435 Bacteria 4169
110 Ga0070714_100154566 3300005435 Bacteria 2070
111 Ga0070714_100342232 3300005435 Bacteria 1403
112 Ga0070713_100002523 3300005436 Bacteria 11963
113 Ga0070713_100011179 3300005436 Bacteria 6527
114 Ga0070713_100015164 3300005436 Bacteria 5747
115 Ga0070713_100294210 3300005436 Bacteria 1493
116 Ga0070701_10070914 3300005438 Bacteria 1863
117 Ga0070711_100343129 3300005439 Bacteria 1199
118 Ga0070705_100000746 3300005440 Bacteria 18450
119 Ga0070705_100281217 3300005440 Bacteria 1183
120 Ga0070700_100016825 3300005441 Bacteria 4170
121 Ga0070700_100016870 3300005441 Bacteria 4165
122 Ga0070694_100000370 3300005444 Bacteria 24146
123 Ga0070694_100071340 3300005444 Bacteria 2394
124 Ga0070694_100138356 3300005444 Bacteria 1766
125 Ga0070694_100427146 3300005444 Bacteria 1042
126 Ga0070708_100702172 3300005445 Bacteria 952
127 Ga0070663_100028751 3300005455 Bacteria 3789
128 Ga0070663_100312321 3300005455 Bacteria 1262
129 Ga0070678_100007020 3300005456 Bacteria 6656
130 Ga0070678_100048413 3300005456 Bacteria 3061
131 Ga0070678_100064945 3300005456 Bacteria 2707
132 Ga0070678_100102194 3300005456 Bacteria 2224
133 Ga0070678_100139745 3300005456 Bacteria 1936
134 Ga0070678_100717131 3300005456 Unclassified 902
135 Ga0070678_101243119 3300005456 Bacteria 692
136 Ga0070662_100012691 3300005457 Bacteria 5592
137 Ga0070662_100055147 3300005457 Bacteria 2883
138 Ga0070662_100252293 3300005457 Bacteria 1419
139 Ga0070681_10022213 3300005458 Bacteria 6368
140 Ga0070681_10109201 3300005458 Bacteria 2706
141 Ga0070681_10134031 3300005458 Bacteria 2408
142 Ga0070681_10166064 3300005458 Bacteria 2130
143 Ga0070681_10262776 3300005458 Bacteria 1638
144 Ga0070681_10304575 3300005458 Bacteria 1503
145 Ga0068867_100008687 3300005459 Bacteria 7170
146 Ga0068867_100009631 3300005459 Bacteria 6813
147 Ga0068867_100026117 3300005459 Bacteria 4192
148 Ga0068867_100132380 3300005459 Bacteria 1940
149 Ga0068867_100450981 3300005459 Bacteria 1096
150 Ga0068867_100565344 3300005459 Bacteria 987
151 Ga0070685_10014872 3300005466 Bacteria 4128
152 Ga0070685_10112749 3300005466 Bacteria 1678
153 Ga0070685_10543851 3300005466 Bacteria 828
154 Ga0070707_100149785 3300005468 Bacteria 2272
155 Ga0070707_101010398 3300005468 Unclassified 797
156 Ga0070698_100170431 3300005471 Bacteria 2118
157 Ga0070698_100804955 3300005471 Bacteria 884
158 Ga0070699_100006431 3300005518 Bacteria 10232
159 Ga0070699_100012616 3300005518 Bacteria 7288
160 Ga0070699_100018067 3300005518 Bacteria 6058
161 Ga0070699_100018848 3300005518 Bacteria 5930
162 Ga0070699_100069549 3300005518 Bacteria 3059
163 Ga0070679_100000635 3300005530 Bacteria 29869
164 Ga0070679_100029497 3300005530 Bacteria 5413
165 Ga0070679_100109888 3300005530 Bacteria 2743
166 Ga0070679_100129230 3300005530 Bacteria 2508
167 Ga0070684_100000654 3300005535 Bacteria 23885
168 Ga0070684_100072416 3300005535 Bacteria 3034
169 Ga0070684_100150442 3300005535 Bacteria 2108
170 Ga0070684_100152941 3300005535 Unclassified 2091
171 Ga0070684_100250259 3300005535 Unclassified 1620
172 Ga0070684_100279931 3300005535 Bacteria 1528
173 Ga0070684_100313461 3300005535 Bacteria 1441
174 Ga0070697_100014204 3300005536 Bacteria 6256
175 Ga0070697_100156129 3300005536 Bacteria 1926
176 Ga0068853_100018364 3300005539 Bacteria 5788
177 Ga0068853_100088667 3300005539 Bacteria 2716
178 Ga0068853_100180149 3300005539 Bacteria 1916
179 Ga0068853_100295941 3300005539 Bacteria 1495
180 Ga0068853_100460320 3300005539 Bacteria 1197
181 Ga0068853_100623125 3300005539 Bacteria 1025
182 Ga0070672_100008378 3300005543 Bacteria 7067
183 Ga0070672_100134809 3300005543 Bacteria 2033
184 Ga0070672_100145010 3300005543 Bacteria 1961
185 Ga0070672_100154689 3300005543 Bacteria 1899
186 Ga0070672_100279497 3300005543 Bacteria 1411
187 Ga0070672_100371158 3300005543 Bacteria 1222
188 Ga0070672_101107578 3300005543 Bacteria 704
189 Ga0070686_100204013 3300005544 Bacteria 1419
190 Ga0070686_100209399 3300005544 Bacteria 1402
191 Ga0070686_100238683 3300005544 Bacteria 1322
192 Ga0070695_100000707 3300005545 Bacteria 17815
193 Ga0070696_100000965 3300005546 Bacteria 18625
194 Ga0070696_100001772 3300005546 Bacteria 14152
195 Ga0070693_100052188 3300005547 Bacteria 2344
196 Ga0070693_100225284 3300005547 Unclassified 1231
197 Ga0070665_100024814 3300005548 Bacteria 6040
198 Ga0070665_100078224 3300005548 Bacteria 3314
199 Ga0070665_100084437 3300005548 Bacteria 3181
200 Ga0070665_100098208 3300005548 Bacteria 2933
201 Ga0070665_100102784 3300005548 Bacteria 2861
202 Ga0070665_100170827 3300005548 Bacteria 2175
203 Ga0070665_101061086 3300005548 Bacteria 822
204 Ga0070704_100041318 3300005549 Bacteria 3182
205 Ga0070704_100085381 3300005549 Bacteria 2336
206 Ga0070704_100171290 3300005549 Bacteria 1727
207 Ga0068855_100003676 3300005563 Bacteria 18764
208 Ga0068855_100005921 3300005563 Bacteria 14906
209 Ga0068855_100017587 3300005563 Bacteria 8598
210 Ga0068855_100039960 3300005563 Bacteria 5568
211 Ga0068855_100041567 3300005563 Bacteria 5448
212 Ga0068855_100042276 3300005563 Bacteria 5399
213 Ga0068855_100080897 3300005563 Bacteria 3767
214 Ga0068855_100159886 3300005563 Bacteria 2557
215 Ga0068855_100234432 3300005563 Bacteria 2053
216 Ga0068855_100237672 3300005563 Bacteria 2037
217 Ga0070664_100007187 3300005564 Bacteria 8978
218 Ga0070664_100017828 3300005564 Bacteria 5830
219 Ga0070664_100117700 3300005564 Bacteria 2324
220 Ga0070664_100119171 3300005564 Bacteria 2309
221 Ga0070664_100707240 3300005564 Bacteria 939
222 Ga0070664_101048227 3300005564 Bacteria 767
223 Ga0068857_100000367 3300005577 Bacteria 31519
224 Ga0068857_100009431 3300005577 Bacteria 8471
225 Ga0068857_100027469 3300005577 Bacteria 5021
226 Ga0068857_100033257 3300005577 Bacteria 4561
227 Ga0068857_100120196 3300005577 Bacteria 2365
228 Ga0068857_100175980 3300005577 Bacteria 1946
229 Ga0068857_100314205 3300005577 Bacteria 1446
230 Ga0068857_100388523 3300005577 Unclassified 1297
231 Ga0068857_100486453 3300005577 Bacteria 1157
232 Ga0068854_100135573 3300005578 Bacteria 1884
233 Ga0068854_100168051 3300005578 Bacteria 1704
234 Ga0068854_100863546 3300005578 Bacteria 793
235 Ga0068856_100011813 3300005614 Bacteria 8464
236 Ga0068856_100044788 3300005614 Bacteria 4355
237 Ga0068856_100097316 3300005614 Bacteria 2932
238 Ga0068856_100146605 3300005614 Bacteria 2368
239 Ga0068856_100969365 3300005614 Bacteria 869
240 Ga0068856_100988726 3300005614 Bacteria 860
241 Ga0070702_100010489 3300005615 Bacteria 4564
242 Ga0070702_100461343 3300005615 Bacteria 924
243 Ga0068852_100044205 3300005616 Bacteria 3781
244 Ga0068852_100097280 3300005616 Bacteria 2648
245 Ga0068852_100145279 3300005616 Bacteria 2199
246 Ga0068852_101022385 3300005616 Unclassified 845
247 Ga0068859_100017287 3300005617 Bacteria 7243
248 Ga0068859_100038291 3300005617 Bacteria 4811
249 Ga0068859_100057516 3300005617 Bacteria 3917
250 Ga0068859_100419971 3300005617 Bacteria 1434
251 Ga0068859_100476169 3300005617 Bacteria 1344
252 Ga0068859_100863079 3300005617 Bacteria 991
253 Ga0068864_100045866 3300005618 Bacteria 3750
254 Ga0068864_100054532 3300005618 Bacteria 3450
255 Ga0068864_100172999 3300005618 Bacteria 1970
256 Ga0068864_100197203 3300005618 Bacteria 1848
257 Ga0068864_100216991 3300005618 Bacteria 1763
258 Ga0068864_100232359 3300005618 Bacteria 1706
259 Ga0068864_100299541 3300005618 Bacteria 1505
260 Ga0068864_100517583 3300005618 Bacteria 1150
261 Ga0068866_10418329 3300005718 Bacteria 869
262 Ga0068861_100024564 3300005719 Bacteria 4359
263 Ga0068861_100116117 3300005719 Bacteria 2151
264 Ga0068861_100168397 3300005719 Bacteria 1814
265 Ga0068861_100319788 3300005719 Bacteria 1351
266 Ga0068861_100446064 3300005719 Bacteria 1158
267 Ga0068851_10020670 3300005834 Bacteria 3190
268 Ga0068851_10142813 3300005834 Bacteria 1303
269 Ga0068851_10151590 3300005834 Bacteria 1268
270 Ga0068851_10189334 3300005834 Bacteria 1143
271 Ga0068870_10001437 3300005840 Bacteria 9631
272 Ga0068870_10007144 3300005840 Bacteria 4968
273 Ga0068863_100309952 3300005841 Bacteria 1532
274 Ga0068863_100643844 3300005841 Bacteria 1051
275 Ga0068863_101512294 3300005841 Bacteria 680
276 Ga0068858_100054923 3300005842 Bacteria 3683
277 Ga0068858_100057133 3300005842 Bacteria 3606
278 Ga0068858_100060055 3300005842 Bacteria 3514
279 Ga0068858_100073787 3300005842 Bacteria 3167
280 Ga0068858_100130329 3300005842 Bacteria 2358
281 Ga0068858_100194195 3300005842 Bacteria 1918
282 Ga0068858_100220378 3300005842 Bacteria 1796
283 Ga0068858_101369465 3300005842 Bacteria 697
284 Ga0068860_100008416 3300005843 Bacteria 10275
285 Ga0068860_100030930 3300005843 Bacteria 5147
286 Ga0068860_100064152 3300005843 Bacteria 3490
287 Ga0068862_100001194 3300005844 Bacteria 24496
288 Ga0068862_100092822 3300005844 Bacteria 2631
289 Ga0068862_100195317 3300005844 Bacteria 1823
290 Ga0068862_100301161 3300005844 Bacteria 1475
291 Ga0068862_101082649 3300005844 Bacteria 796
292 Ga0081455_10025992 3300005937 Bacteria 5394
293 Ga0081538_10112503 3300005981 Bacteria 1332
294 Ga0081539_10000093 3300005985 Bacteria 207314
295 Ga0081539_10000535 3300005985 Bacteria 78890
296 Ga0081539_10004525 3300005985 Bacteria 15269
297 Ga0081539_10032394 3300005985 Bacteria 3201
298 Ga0070717_10002297 3300006028 Bacteria 13414
299 Ga0070717_10059120 3300006028 Bacteria 3171
300 Ga0070717_10379742 3300006028 Unclassified 1267
301 Ga0070717_10652868 3300006028 Bacteria 955
302 Ga0075364_10396187 3300006051 Bacteria 942
303 Ga0097621_100008977 3300006237 Bacteria 7231
304 Ga0097621_100057379 3300006237 Bacteria 3184
305 Ga0097621_100087349 3300006237 Bacteria 2603
306 Ga0097621_100090626 3300006237 Bacteria 2559
307 Ga0097621_100198007 3300006237 Bacteria 1743
308 Ga0097621_100222910 3300006237 Bacteria 1644
309 Ga0097621_100587832 3300006237 Unclassified 1016
310 Ga0097621_100714379 3300006237 Bacteria 923
311 Ga0068871_100013047 3300006358 Bacteria 6159
312 Ga0068871_100032955 3300006358 Bacteria 4097
313 Ga0068871_100086558 3300006358 Bacteria 2604
314 Ga0068871_100096532 3300006358 Bacteria 2470
315 Ga0068871_100096698 3300006358 Bacteria 2468
316 Ga0068871_100099782 3300006358 Bacteria 2431
317 Ga0068871_100252561 3300006358 Bacteria 1536
318 Ga0068871_100318934 3300006358 Unclassified 1368
319 Ga0068871_100518294 3300006358 Bacteria 1076
320 Ga0075428_100001298 3300006844 Bacteria 26510
321 Ga0075428_100018128 3300006844 Bacteria 7778
322 Ga0075428_100039791 3300006844 Bacteria 5175
323 Ga0075428_100066193 3300006844 Bacteria 3956
324 Ga0075428_101038833 3300006844 Bacteria 867
325 Ga0075430_100079986 3300006846 Bacteria 2738
326 Ga0075430_100099521 3300006846 Bacteria 2428
327 Ga0075430_100131196 3300006846 Unclassified 2088
328 Ga0075430_100245136 3300006846 Bacteria 1485
329 Ga0075430_100268739 3300006846 Bacteria 1412
330 Ga0075431_100016348 3300006847 Bacteria 7528
331 Ga0075431_100017673 3300006847 Bacteria 7250
332 Ga0075431_100026579 3300006847 Bacteria 5938
333 Ga0075431_100077735 3300006847 Bacteria 3425
334 Ga0075431_100081081 3300006847 Bacteria 3350
335 Ga0075431_100152881 3300006847 Bacteria 2376
336 Ga0075433_10001626 3300006852 Bacteria 16666
337 Ga0075433_10003294 3300006852 Bacteria 12470
338 Ga0075433_10004362 3300006852 Bacteria 10995
339 Ga0075433_10062970 3300006852 Bacteria 3249
340 Ga0075433_10195765 3300006852 Bacteria 1798
341 Ga0075433_10613162 3300006852 Bacteria 955
342 Ga0075433_10686973 3300006852 Bacteria 897
343 Ga0075434_100007857 3300006871 Bacteria 9880
344 Ga0075434_100009480 3300006871 Bacteria 9079
345 Ga0075434_100037878 3300006871 Bacteria 4775
346 Ga0075434_100074269 3300006871 Bacteria 3394
347 Ga0075434_100335194 3300006871 Bacteria 1533
348 Ga0075429_100058130 3300006880 Bacteria 3368
349 Ga0075429_100077576 3300006880 Bacteria 2895
350 Ga0075429_100140751 3300006880 Bacteria 2112
351 Ga0075429_100195061 3300006880 Bacteria 1774
352 Ga0075429_100313515 3300006880 Bacteria 1373
353 Ga0075429_100361761 3300006880 Unclassified 1270
354 Ga0068865_100036885 3300006881 Bacteria 3298
355 Ga0068865_100044873 3300006881 Bacteria 3028
356 Ga0075436_100004678 3300006914 Bacteria 9385
357 Ga0097620_100017287 3300006931 Bacteria 7243
358 Ga0097620_100038292 3300006931 Bacteria 4811
359 Ga0097620_100057515 3300006931 Bacteria 3917
360 Ga0097620_100419969 3300006931 Bacteria 1434
361 Ga0097620_100476190 3300006931 Bacteria 1344
362 Ga0097620_100863073 3300006931 Bacteria 991
363 Ga0075435_100005103 3300007076 Bacteria 9123
364 Ga0075435_100033031 3300007076 Bacteria 4089
365 Ga0075435_100057482 3300007076 Bacteria 3147
366 Ga0075435_100396863 3300007076 Bacteria 1186
367 Ga0075435_100421943 3300007076 Bacteria 1149
368 Ga0105240_10000137 3300009093 Bacteria 149925
369 Ga0105240_10000725 3300009093 Bacteria 60249
370 Ga0105240_10006267 3300009093 Bacteria 17501
371 Ga0105240_10008603 3300009093 Bacteria 14585
372 Ga0105240_10014192 3300009093 Bacteria 10881
373 Ga0105240_10049742 3300009093 Bacteria 5288
374 Ga0105240_10561268 3300009093 Unclassified 1262
375 Ga0105240_10575124 3300009093 Unclassified 1243
376 Ga0105240_10821146 3300009093 Bacteria 1006
377 Ga0105240_10973917 3300009093 Bacteria 909
378 Ga0105240_11515547 3300009093 Unclassified 703
379 Ga0105240_11596924 3300009093 Bacteria 682
380 Ga0105240_11686691 3300009093 Bacteria 662
381 Ga0111539_10000937 3300009094 Bacteria 38215
382 Ga0111539_10012890 3300009094 Bacteria 10461
383 Ga0111539_10018172 3300009094 Bacteria 8709
384 Ga0111539_10025633 3300009094 Bacteria 7226
385 Ga0111539_10057520 3300009094 Bacteria 4618
386 Ga0111539_10165833 3300009094 Bacteria 2583
387 Ga0111539_10184728 3300009094 Bacteria 2435
388 Ga0111539_11505010 3300009094 Bacteria 780
389 Ga0105245_10002584 3300009098 Bacteria 16303
390 Ga0105245_10031219 3300009098 Bacteria 4713
391 Ga0105245_10092800 3300009098 Bacteria 2781
392 Ga0105245_10122005 3300009098 Bacteria 2436
393 Ga0105245_10143630 3300009098 Bacteria 2250
394 Ga0105245_10192564 3300009098 Bacteria 1954
395 Ga0105245_10441173 3300009098 Bacteria 1308
396 Ga0105245_10481719 3300009098 Bacteria 1254
397 Ga0105245_10723661 3300009098 Bacteria 1030
398 Ga0105247_10036932 3300009101 Bacteria 2979
399 Ga0105247_10081730 3300009101 Bacteria 2038
400 Ga0105247_10381386 3300009101 Bacteria 1000
401 Ga0114129_10000428 3300009147 Bacteria 49983
402 Ga0114129_10012760 3300009147 Bacteria 11960
403 Ga0114129_10013768 3300009147 Bacteria 11526
404 Ga0114129_10016831 3300009147 Bacteria 10409
405 Ga0114129_10017625 3300009147 Bacteria 10167
406 Ga0114129_10060488 3300009147 Bacteria 5296
407 Ga0114129_10082295 3300009147 Bacteria 4473
408 Ga0114129_10178069 3300009147 Bacteria 2895
409 Ga0114129_10207936 3300009147 Bacteria 2647
410 Ga0114129_10426391 3300009147 Bacteria 1744
411 Ga0114129_10483657 3300009147 Unclassified 1619
412 Ga0114129_10489668 3300009147 Bacteria 1608
413 Ga0114129_10625396 3300009147 Bacteria 1392
414 Ga0114129_11680760 3300009147 Bacteria 775
415 Ga0105243_10094326 3300009148 Bacteria 2471
416 Ga0105243_10094586 3300009148 Bacteria 2468
417 Ga0105241_10011127 3300009174 Bacteria 6598
418 Ga0105241_10052017 3300009174 Unclassified 3126
419 Ga0105241_10081489 3300009174 Bacteria 2535
420 Ga0105241_10098267 3300009174 Bacteria 2322
421 Ga0105241_10142579 3300009174 Bacteria 1952
422 Ga0105241_10326669 3300009174 Bacteria 1324
423 Ga0105241_10347029 3300009174 Unclassified 1288
424 Ga0105241_10398817 3300009174 Bacteria 1206
425 Ga0105242_10008301 3300009176 Bacteria 7977
426 Ga0105242_10037404 3300009176 Bacteria 3898
427 Ga0105242_10055620 3300009176 Bacteria 3237
428 Ga0105242_10057510 3300009176 Bacteria 3185
429 Ga0105242_10074164 3300009176 Bacteria 2831
430 Ga0105242_10351275 3300009176 Bacteria 1362
431 Ga0105242_10388503 3300009176 Unclassified 1299
432 Ga0105242_10669786 3300009176 Bacteria 1011
433 Ga0105242_10709865 3300009176 Bacteria 985
434 Ga0105242_11368909 3300009176 Bacteria 734
435 Ga0105242_11515327 3300009176 Bacteria 702
436 Ga0105248_10015334 3300009177 Bacteria 8451
437 Ga0105248_10021914 3300009177 Bacteria 7080
438 Ga0105248_10038535 3300009177 Bacteria 5349
439 Ga0105248_10051528 3300009177 Bacteria 4619
440 Ga0105248_10058795 3300009177 Bacteria 4317
441 Ga0105248_10135318 3300009177 Bacteria 2780
442 Ga0105248_10169783 3300009177 Bacteria 2458
443 Ga0105248_10247604 3300009177 Bacteria 2006
444 Ga0105248_11615924 3300009177 Bacteria 734
445 Ga0105248_12121924 3300009177 Bacteria 639
446 Ga0105237_10011284 3300009545 Bacteria 9454
447 Ga0105237_10015643 3300009545 Bacteria 7886
448 Ga0105237_10022807 3300009545 Bacteria 6423
449 Ga0105237_10047639 3300009545 Bacteria 4308
450 Ga0105237_10076113 3300009545 Bacteria 3347
451 Ga0105237_10135652 3300009545 Bacteria 2455
452 Ga0105237_10163191 3300009545 Bacteria 2227
453 Ga0105237_10296008 3300009545 Bacteria 1621
454 Ga0105237_10485865 3300009545 Bacteria 1241
455 Ga0105237_10895175 3300009545 Bacteria 894
456 Ga0105237_11266348 3300009545 Bacteria 744
457 Ga0105238_10003531 3300009551 Bacteria 15586
458 Ga0105238_10027090 3300009551 Bacteria 5842
459 Ga0105238_10038115 3300009551 Bacteria 4883
460 Ga0105238_10039789 3300009551 Bacteria 4767
461 Ga0105238_10047108 3300009551 Bacteria 4348
462 Ga0105238_10087883 3300009551 Bacteria 3095
463 Ga0105238_10091744 3300009551 Bacteria 3025
464 Ga0105238_10094723 3300009551 Bacteria 2974
465 Ga0105238_10115494 3300009551 Bacteria 2664
466 Ga0105238_10194410 3300009551 Bacteria 2004
467 Ga0105238_10243629 3300009551 Bacteria 1775
468 Ga0105238_10348781 3300009551 Bacteria 1469
469 Ga0105238_10364361 3300009551 Bacteria 1435
470 Ga0105238_10475469 3300009551 Bacteria 1248
471 Ga0105238_10501488 3300009551 Bacteria 1215
472 Ga0105238_11070304 3300009551 Bacteria 828
473 Ga0105249_10001435 3300009553 Bacteria 20875
474 Ga0105249_10025302 3300009553 Bacteria 5342
475 Ga0105249_10166133 3300009553 Bacteria 2136
476 Ga0105249_10264232 3300009553 Bacteria 1711
477 Ga0105239_10005509 3300010375 Bacteria 14830
478 Ga0105239_10009505 3300010375 Bacteria 10949
479 Ga0105239_10019116 3300010375 Bacteria 7571
480 Ga0105239_10020840 3300010375 Bacteria 7232
481 Ga0105239_10061846 3300010375 Bacteria 4110
482 Ga0105239_10101145 3300010375 Bacteria 3188
483 Ga0105239_12377717 3300010375 Bacteria 617
484 Ga0105246_10053857 3300011119 Bacteria 2770
485 Ga0105246_10148180 3300011119 Bacteria 1773
486 Ga0105246_10942538 3300011119 Bacteria 777
487 Ga0105246_10956565 3300011119 Unclassified 772
488 Ga0157373_10091811 3300013100 Archaea 2138
489 Ga0157373_10354183 3300013100 Unclassified 1047
490 Ga0157373_10519418 3300013100 Bacteria 861
491 Ga0157371_10361351 3300013102 Unclassified 1058
492 Ga0157370_10004065 3300013104 Bacteria 16962
493 Ga0157370_10023653 3300013104 Bacteria 6097
494 Ga0157370_10056344 3300013104 Bacteria 3741
495 Ga0157370_10086143 3300013104 Bacteria 2952
496 Ga0157370_10167543 3300013104 Bacteria 2042
497 Ga0157370_10244403 3300013104 Bacteria 1660
498 Ga0157370_10428937 3300013104 Bacteria 1216
499 Ga0157370_10462589 3300013104 Bacteria 1166
500 Ga0157369_10001658 3300013105 Bacteria 27137
501 Ga0157369_10026955 3300013105 Bacteria 6373
502 Ga0157369_10070995 3300013105 Bacteria 3740
503 Ga0157369_10133353 3300013105 Bacteria 2631
504 Ga0157369_10267773 3300013105 Bacteria 1781
505 Ga0157374_10019090 3300013296 Bacteria 6066
506 Ga0157374_10215332 3300013296 Bacteria 1884
507 Ga0157374_10300801 3300013296 Bacteria 1587
508 Ga0157374_10469155 3300013296 Bacteria 1261
509 Ga0157374_10536445 3300013296 Bacteria 1177
510 Ga0157374_10536464 3300013296 Bacteria 1177
511 Ga0157378_10006769 3300013297 Bacteria 10014
512 Ga0157378_10119552 3300013297 Bacteria 2426
513 Ga0157378_10234682 3300013297 Bacteria 1750
514 Ga0157378_10294620 3300013297 Bacteria 1568
515 Ga0157378_11660936 3300013297 Bacteria 685
516 Ga0163162_10009244 3300013306 Bacteria 9589
517 Ga0163162_10056855 3300013306 Bacteria 3940
518 Ga0163162_10113990 3300013306 Bacteria 2802
519 Ga0163162_10412334 3300013306 Bacteria 1483
520 Ga0163162_10653733 3300013306 Unclassified 1175
521 Ga0163162_10792842 3300013306 Bacteria 1065
522 Ga0163162_11003167 3300013306 Bacteria 944
523 Ga0163162_11553556 3300013306 Bacteria 754
524 Ga0163162_11956867 3300013306 Unclassified 671
525 Ga0157372_10019405 3300013307 Bacteria 7328
526 Ga0157372_10023620 3300013307 Bacteria 6670
527 Ga0157372_10045493 3300013307 Bacteria 4870
528 Ga0157372_10050147 3300013307 Bacteria 4644
529 Ga0157372_10356181 3300013307 Bacteria 1705
530 Ga0157372_10926295 3300013307 Unclassified 1010
531 Ga0157372_10962289 3300013307 Bacteria 989
532 Ga0157372_11719590 3300013307 Bacteria 722
533 Ga0157375_10027796 3300013308 Bacteria 5292
534 Ga0157375_10057570 3300013308 Bacteria 3843
535 Ga0157375_10117140 3300013308 Bacteria 2769
536 Ga0157375_10222753 3300013308 Bacteria 2045
537 Ga0157375_10530500 3300013308 Unclassified 1340
538 Ga0157375_11333136 3300013308 Bacteria 844
539 Ga0157375_11958864 3300013308 Bacteria 696
540 Ga0163163_10033602 3300014325 Bacteria 4963
541 Ga0163163_10037531 3300014325 Bacteria 4714
542 Ga0163163_10039812 3300014325 Bacteria 4588
543 Ga0163163_10057030 3300014325 Bacteria 3862
544 Ga0163163_10112756 3300014325 Bacteria 2749
545 Ga0163163_10130349 3300014325 Bacteria 2555
546 Ga0163163_10147461 3300014325 Bacteria 2397
547 Ga0163163_10149270 3300014325 Bacteria 2382
548 Ga0163163_10169333 3300014325 Bacteria 2231
549 Ga0163163_10244900 3300014325 Bacteria 1843
550 Ga0163163_10914752 3300014325 Bacteria 941
551 Ga0157380_10007797 3300014326 Bacteria 7618
552 Ga0157380_10009711 3300014326 Bacteria 6905
553 Ga0157380_10010846 3300014326 Bacteria 6570
554 Ga0157380_10027142 3300014326 Bacteria 4352
555 Ga0157380_10028962 3300014326 Bacteria 4229
556 Ga0157380_10044968 3300014326 Bacteria 3463
557 Ga0157380_10148475 3300014326 Bacteria 2023
558 Ga0157380_10258555 3300014326 Bacteria 1580
559 Ga0157380_10400869 3300014326 Bacteria 1301
560 Ga0157380_11634156 3300014326 Unclassified 700
561 Ga0157377_10017096 3300014745 Bacteria 3746
562 Ga0157377_10089282 3300014745 Bacteria 1817
563 Ga0157377_10157863 3300014745 Bacteria 1408
564 Ga0157377_10564782 3300014745 Bacteria 806
565 Ga0157377_10626905 3300014745 Bacteria 771
566 Ga0157379_10053964 3300014968 Bacteria 3591
567 Ga0157379_10789500 3300014968 Unclassified 896
568 Ga0157379_11285073 3300014968 Bacteria 706
569 Ga0157376_10010690 3300014969 Bacteria 6729
570 Ga0157376_10059844 3300014969 Bacteria 3195
571 Ga0157376_10254235 3300014969 Bacteria 1643
572 Ga0157376_10329167 3300014969 Bacteria 1455
573 Ga0157376_11400287 3300014969 Bacteria 731
574 Ga0163161_10066300 3300017792 Bacteria 2636
575 Ga0163161_10158763 3300017792 Bacteria 1723
576 Ga0213873_10031808 3300021358 Bacteria 1315
577 Ga0213874_10008846 3300021377 Bacteria 2469
578 Ga0213876_10001214 3300021384 Bacteria 16256
579 Ga0213876_10083920 3300021384 Bacteria 1685
580 Ga0213875_10002769 3300021388 Bacteria 10348
581 Ga0213875_10006476 3300021388 Bacteria 6139
582 Ga0213875_10010188 3300021388 Bacteria 4721
583 Ga0213875_10071064 3300021388 Bacteria 1625
584 Ga0213875_10088214 3300021388 Bacteria 1447
585 Ga0213875_10089555 3300021388 Bacteria 1435
586 Ga0213875_10152047 3300021388 Bacteria 1084
587 Ga0213871_10099049 3300021441 Unclassified 851
588 Ga0224712_10225900 3300022467 Bacteria 858
589 Ga0207697_10001282 3300025315 Bacteria 13790
590 Ga0207656_10009659 3300025321 Bacteria 3585
591 Ga0207656_10116763 3300025321 Bacteria 1238
592 Ga0207656_10231557 3300025321 Bacteria 901
593 Ga0207682_10000378 3300025893 Bacteria 20628
594 Ga0207682_10018854 3300025893 Bacteria 2699
595 Ga0207682_10020419 3300025893 Bacteria 2602
596 Ga0207682_10025631 3300025893 Bacteria 2339
597 Ga0207688_10000628 3300025901 Bacteria 17382
598 Ga0207688_10010226 3300025901 Bacteria 5107
599 Ga0207688_10064495 3300025901 Bacteria 2069
600 Ga0207680_10151867 3300025903 Bacteria 1545
601 Ga0207680_10155269 3300025903 Bacteria 1529
602 Ga0207699_10025855 3300025906 Bacteria 3229
603 Ga0207699_10141254 3300025906 Bacteria 1583
604 Ga0207699_10203931 3300025906 Bacteria 1341
605 Ga0207699_10357970 3300025906 Bacteria 1031
606 Ga0207645_10001911 3300025907 Bacteria 16819
607 Ga0207645_10161032 3300025907 Bacteria 1468
608 Ga0207645_10324054 3300025907 Bacteria 1028
609 Ga0207643_10000925 3300025908 Bacteria 17575
610 Ga0207643_10059446 3300025908 Bacteria 2180
611 Ga0207643_10079229 3300025908 Bacteria 1901
612 Ga0207643_10130402 3300025908 Bacteria 1496
613 Ga0207643_10542749 3300025908 Bacteria 746
614 Ga0207705_10009074 3300025909 Bacteria 7247
615 Ga0207705_10056458 3300025909 Bacteria 2831
616 Ga0207684_10127932 3300025910 Bacteria 2180
617 Ga0207654_10007778 3300025911 Bacteria 5409
618 Ga0207654_10040135 3300025911 Bacteria 2636
619 Ga0207654_10045861 3300025911 Unclassified 2490
620 Ga0207654_10864630 3300025911 Bacteria 655
621 Ga0207707_10007135 3300025912 Bacteria 9730
622 Ga0207707_10023281 3300025912 Bacteria 5420
623 Ga0207707_10122403 3300025912 Bacteria 2275
624 Ga0207707_10128104 3300025912 Unclassified 2220
625 Ga0207707_10129369 3300025912 Bacteria 2208
626 Ga0207707_10329341 3300025912 Bacteria 1318
627 Ga0207707_10482139 3300025912 Bacteria 1059
628 Ga0207707_10955132 3300025912 Bacteria 706
629 Ga0207695_10000770 3300025913 Bacteria 60994
630 Ga0207695_10002883 3300025913 Bacteria 24934
631 Ga0207695_10005525 3300025913 Bacteria 16734
632 Ga0207695_10009314 3300025913 Bacteria 12156
633 Ga0207695_10012024 3300025913 Bacteria 10411
634 Ga0207695_10022417 3300025913 Bacteria 7168
635 Ga0207695_10032450 3300025913 Bacteria 5714
636 Ga0207695_10210757 3300025913 Bacteria 1854
637 Ga0207695_10307166 3300025913 Unclassified 1477
638 Ga0207695_10735222 3300025913 Bacteria 867
639 Ga0207671_10053083 3300025914 Bacteria 3004
640 Ga0207671_10136381 3300025914 Bacteria 1887
641 Ga0207671_10149982 3300025914 Unclassified 1801
642 Ga0207671_10424851 3300025914 Bacteria 1057
643 Ga0207663_10668246 3300025916 Bacteria 821
644 Ga0207660_10083025 3300025917 Bacteria 2358
645 Ga0207660_10187192 3300025917 Bacteria 1610
646 Ga0207660_10628553 3300025917 Bacteria 875
647 Ga0207660_11074692 3300025917 Bacteria 656
648 Ga0207662_10009608 3300025918 Bacteria 5329
649 Ga0207662_10018372 3300025918 Bacteria 3966
650 Ga0207662_10029781 3300025918 Bacteria 3165
651 Ga0207657_10007163 3300025919 Bacteria 11456
652 Ga0207657_10230904 3300025919 Unclassified 1480
653 Ga0207657_10239693 3300025919 Bacteria 1448
654 Ga0207649_10228255 3300025920 Bacteria 1330
655 Ga0207652_10016163 3300025921 Bacteria 6088
656 Ga0207652_10080761 3300025921 Bacteria 2843
657 Ga0207652_10147679 3300025921 Bacteria 2104
658 Ga0207681_10046098 3300025923 Bacteria 2931
659 Ga0207681_10108455 3300025923 Bacteria 2015
660 Ga0207681_10125365 3300025923 Bacteria 1890
661 Ga0207681_10179122 3300025923 Bacteria 1613
662 Ga0207681_10264114 3300025923 Bacteria 1349
663 Ga0207681_10593950 3300025923 Bacteria 914
664 Ga0207694_10002138 3300025924 Bacteria 16241
665 Ga0207694_10011929 3300025924 Bacteria 6553
666 Ga0207694_10044456 3300025924 Bacteria 3429
667 Ga0207694_10061145 3300025924 Bacteria 2931
668 Ga0207694_10079285 3300025924 Bacteria 2575
669 Ga0207694_10137183 3300025924 Bacteria 1965
670 Ga0207694_10292997 3300025924 Unclassified 1339
671 Ga0207694_10316567 3300025924 Bacteria 1287
672 Ga0207694_10324519 3300025924 Bacteria 1271
673 Ga0207650_10001613 3300025925 Bacteria 16089
674 Ga0207650_10018995 3300025925 Bacteria 4831
675 Ga0207650_10024950 3300025925 Bacteria 4256
676 Ga0207650_10066823 3300025925 Bacteria 2697
677 Ga0207650_10111038 3300025925 Bacteria 2122
678 Ga0207650_10490652 3300025925 Bacteria 1026
679 Ga0207659_10000064 3300025926 Bacteria 67058
680 Ga0207659_10000228 3300025926 Bacteria 34204
681 Ga0207659_10004292 3300025926 Bacteria 8618
682 Ga0207659_10005992 3300025926 Bacteria 7418
683 Ga0207659_10012850 3300025926 Bacteria 5346
684 Ga0207659_10034223 3300025926 Bacteria 3501
685 Ga0207659_10036318 3300025926 Bacteria 3412
686 Ga0207659_10065120 3300025926 Bacteria 2640
687 Ga0207659_10079734 3300025926 Bacteria 2416
688 Ga0207659_10230452 3300025926 Bacteria 1494
689 Ga0207659_10235648 3300025926 Bacteria 1478
690 Ga0207659_10460799 3300025926 Bacteria 1072
691 Ga0207659_10515366 3300025926 Archaea 1014
692 Ga0207687_10012877 3300025927 Bacteria 5467
693 Ga0207687_10043361 3300025927 Bacteria 3099
694 Ga0207687_10053985 3300025927 Bacteria 2810
695 Ga0207687_10094021 3300025927 Bacteria 2193
696 Ga0207687_10145721 3300025927 Bacteria 1801
697 Ga0207687_10160729 3300025927 Bacteria 1724
698 Ga0207687_10376574 3300025927 Bacteria 1162
699 Ga0207700_10039457 3300025928 Bacteria 3438
700 Ga0207700_10041486 3300025928 Bacteria 3367
701 Ga0207700_10079503 3300025928 Bacteria 2554
702 Ga0207664_10027284 3300025929 Bacteria 4327
703 Ga0207664_10119110 3300025929 Bacteria 2207
704 Ga0207644_10138078 3300025931 Bacteria 1874
705 Ga0207644_10337395 3300025931 Bacteria 1222
706 Ga0207644_10370971 3300025931 Bacteria 1166
707 Ga0207644_10561460 3300025931 Bacteria 945
708 Ga0207644_10582099 3300025931 Bacteria 928
709 Ga0207690_10273408 3300025932 Bacteria 1313
710 Ga0207690_10621099 3300025932 Bacteria 884
711 Ga0207706_10038266 3300025933 Bacteria 4255
712 Ga0207706_10191644 3300025933 Bacteria 1794
713 Ga0207706_10371621 3300025933 Bacteria 1242
714 Ga0207686_10002152 3300025934 Bacteria 10841
715 Ga0207686_10002620 3300025934 Bacteria 9761
716 Ga0207686_10005323 3300025934 Bacteria 6900
717 Ga0207686_10054128 3300025934 Bacteria 2512
718 Ga0207686_10055571 3300025934 Bacteria 2484
719 Ga0207686_10086326 3300025934 Bacteria 2061
720 Ga0207686_10421072 3300025934 Bacteria 1021
721 Ga0207686_10465737 3300025934 Bacteria 975
722 Ga0207709_10019269 3300025935 Bacteria 3833
723 Ga0207709_10027336 3300025935 Bacteria 3286
724 Ga0207709_10233308 3300025935 Bacteria 1334
725 Ga0207670_10004170 3300025936 Bacteria 7753
726 Ga0207670_10071424 3300025936 Bacteria 2401
727 Ga0207670_10211326 3300025936 Bacteria 1480
728 Ga0207670_10327409 3300025936 Bacteria 1207
729 Ga0207670_10535541 3300025936 Bacteria 955
730 Ga0207669_10000517 3300025937 Bacteria 16886
731 Ga0207669_10004725 3300025937 Bacteria 6031
732 Ga0207669_10098920 3300025937 Bacteria 1922
733 Ga0207669_10424911 3300025937 Bacteria 1047
734 Ga0207669_10478367 3300025937 Bacteria 992
735 Ga0207669_10601611 3300025937 Bacteria 894
736 Ga0207704_10004043 3300025938 Bacteria 6681
737 Ga0207704_10006783 3300025938 Bacteria 5362
738 Ga0207704_10067906 3300025938 Bacteria 2245
739 Ga0207704_10195005 3300025938 Bacteria 1477
740 Ga0207665_10358373 3300025939 Bacteria 1102
741 Ga0207665_10548819 3300025939 Bacteria 898
742 Ga0207691_10005381 3300025940 Bacteria 12358
743 Ga0207691_10023122 3300025940 Bacteria 5853
744 Ga0207691_10025557 3300025940 Bacteria 5542
745 Ga0207691_10043378 3300025940 Bacteria 4146
746 Ga0207691_10167524 3300025940 Bacteria 1925
747 Ga0207691_10250137 3300025940 Bacteria 1530
748 Ga0207691_10263906 3300025940 Bacteria 1484
749 Ga0207691_10326462 3300025940 Bacteria 1315
750 Ga0207711_10057026 3300025941 Bacteria 3358
751 Ga0207711_10058775 3300025941 Bacteria 3310
752 Ga0207711_10062940 3300025941 Bacteria 3202
753 Ga0207711_10177044 3300025941 Bacteria 1938
754 Ga0207711_10330763 3300025941 Bacteria 1409
755 Ga0207711_10488516 3300025941 Bacteria 1147
756 Ga0207689_10005493 3300025942 Bacteria 11339
757 Ga0207689_10014043 3300025942 Bacteria 6816
758 Ga0207689_10066220 3300025942 Bacteria 2971
759 Ga0207689_10073568 3300025942 Bacteria 2807
760 Ga0207689_10182689 3300025942 Bacteria 1729
761 Ga0207689_10201284 3300025942 Bacteria 1644
762 Ga0207689_10212500 3300025942 Bacteria 1598
763 Ga0207689_10441410 3300025942 Bacteria 1087
764 Ga0207661_10008190 3300025944 Bacteria 7461
765 Ga0207661_10020313 3300025944 Bacteria 4963
766 Ga0207661_10034465 3300025944 Bacteria 3937
767 Ga0207661_10116924 3300025944 Bacteria 2264
768 Ga0207661_10171746 3300025944 Bacteria 1887
769 Ga0207661_10234084 3300025944 Bacteria 1628
770 Ga0207661_10273605 3300025944 Unclassified 1507
771 Ga0207661_10992637 3300025944 Bacteria 773
772 Ga0207679_10030495 3300025945 Bacteria 3766
773 Ga0207679_10056076 3300025945 Bacteria 2908
774 Ga0207679_10208072 3300025945 Bacteria 1639
775 Ga0207667_10001168 3300025949 Bacteria 32962
776 Ga0207667_10002566 3300025949 Bacteria 22601
777 Ga0207667_10008741 3300025949 Bacteria 12005
778 Ga0207667_10042580 3300025949 Bacteria 4825
779 Ga0207667_10083019 3300025949 Bacteria 3318
780 Ga0207667_10444800 3300025949 Unclassified 1317
781 Ga0207667_10591880 3300025949 Bacteria 1119
782 Ga0207651_10002909 3300025960 Bacteria 8271
783 Ga0207651_10038468 3300025960 Bacteria 3145
784 Ga0207651_10134430 3300025960 Bacteria 1899
785 Ga0207651_10230893 3300025960 Bacteria 1502
786 Ga0207651_10247509 3300025960 Bacteria 1456
787 Ga0207651_10256499 3300025960 Bacteria 1433
788 Ga0207651_10375388 3300025960 Bacteria 1204
789 Ga0207712_10020945 3300025961 Bacteria 4289
790 Ga0207712_10029296 3300025961 Bacteria 3691
791 Ga0207712_10239193 3300025961 Bacteria 1461
792 Ga0207712_10616317 3300025961 Bacteria 940
793 Ga0207668_10026763 3300025972 Bacteria 3750
794 Ga0207640_10349165 3300025981 Bacteria 1188
795 Ga0207640_10510639 3300025981 Bacteria 1003
796 Ga0207658_10023883 3300025986 Bacteria 4272
797 Ga0207658_10068874 3300025986 Bacteria 2672
798 Ga0207658_10124428 3300025986 Bacteria 2061
799 Ga0207677_10095049 3300026023 Bacteria 2177
800 Ga0207677_10368856 3300026023 Bacteria 1208
801 Ga0207677_10439843 3300026023 Archaea 1115
802 Ga0207703_10009334 3300026035 Bacteria 7710
803 Ga0207703_10009949 3300026035 Bacteria 7463
804 Ga0207703_10049412 3300026035 Bacteria 3400
805 Ga0207703_10162311 3300026035 Bacteria 1958
806 Ga0207703_10184905 3300026035 Bacteria 1841
807 Ga0207703_10689738 3300026035 Bacteria 971
808 Ga0207639_10073035 3300026041 Bacteria 2688
809 Ga0207639_10204673 3300026041 Bacteria 1695
810 Ga0207639_10257951 3300026041 Bacteria 1523
811 Ga0207639_10605982 3300026041 Unclassified 1010
812 Ga0207639_10951875 3300026041 Bacteria 803
813 Ga0207678_10303308 3300026067 Bacteria 1372
814 Ga0207708_10026932 3300026075 Bacteria 4353
815 Ga0207708_10043189 3300026075 Bacteria 3436
816 Ga0207708_10065842 3300026075 Bacteria 2770
817 Ga0207708_10153111 3300026075 Bacteria 1817
818 Ga0207702_10015048 3300026078 Bacteria 6415
819 Ga0207702_10055899 3300026078 Bacteria 3349
820 Ga0207702_10066986 3300026078 Bacteria 3080
821 Ga0207702_10444450 3300026078 Unclassified 1257
822 Ga0207702_10680981 3300026078 Bacteria 1013
823 Ga0207641_10467193 3300026088 Bacteria 1221
824 Ga0207648_10000163 3300026089 Bacteria 68352
825 Ga0207648_10005974 3300026089 Bacteria 12169
826 Ga0207648_10010408 3300026089 Bacteria 8817
827 Ga0207648_10013761 3300026089 Bacteria 7510
828 Ga0207648_10066022 3300026089 Bacteria 3155
829 Ga0207648_10110545 3300026089 Bacteria 2412
830 Ga0207648_10120681 3300026089 Bacteria 2305
831 Ga0207648_10278070 3300026089 Bacteria 1497
832 Ga0207648_10493976 3300026089 Bacteria 1119
833 Ga0207648_10495649 3300026089 Bacteria 1117
834 Ga0207648_10684417 3300026089 Bacteria 949
835 Ga0207648_10772281 3300026089 Bacteria 893
836 Ga0207648_10839716 3300026089 Bacteria 856
837 Ga0207676_10066179 3300026095 Bacteria 2881
838 Ga0207676_10112821 3300026095 Bacteria 2278
839 Ga0207676_10182371 3300026095 Bacteria 1839
840 Ga0207676_10205587 3300026095 Bacteria 1743
841 Ga0207676_10254592 3300026095 Bacteria 1582
842 Ga0207676_10383972 3300026095 Unclassified 1308
843 Ga0207676_10409678 3300026095 Bacteria 1269
844 Ga0207676_10882436 3300026095 Unclassified 876
845 Ga0207674_10000166 3300026116 Bacteria 79149
846 Ga0207674_10030026 3300026116 Bacteria 5719
847 Ga0207674_10035376 3300026116 Bacteria 5212
848 Ga0207674_10065120 3300026116 Bacteria 3674
849 Ga0207674_10158407 3300026116 Bacteria 2219
850 Ga0207674_10346522 3300026116 Bacteria 1436
851 Ga0207674_10521358 3300026116 Unclassified 1148
852 Ga0207674_10618213 3300026116 Bacteria 1046
853 Ga0207674_10709974 3300026116 Bacteria 971
854 Ga0207675_100007871 3300026118 Bacteria 10056
855 Ga0207675_100157346 3300026118 Bacteria 2166
856 Ga0207675_100177235 3300026118 Bacteria 2040
857 Ga0207675_100207046 3300026118 Bacteria 1885
858 Ga0207683_10018406 3300026121 Bacteria 5961
859 Ga0207683_10046567 3300026121 Bacteria 3796
860 Ga0207683_10067010 3300026121 Bacteria 3167
861 Ga0207683_10078532 3300026121 Bacteria 2925
862 Ga0207683_10106347 3300026121 Bacteria 2509
863 Ga0207683_10108233 3300026121 Bacteria 2487
864 Ga0207683_10295213 3300026121 Bacteria 1482
865 Ga0207683_10545968 3300026121 Archaea 1071
866 Ga0207698_10044678 3300026142 Bacteria 3331
867 Ga0207698_10185000 3300026142 Bacteria 1849
868 Ga0207698_10217328 3300026142 Bacteria 1724
869 Ga0207698_11058134 3300026142 Bacteria 823
870 Ga0207698_11107193 3300026142 Bacteria 805
871 Ga0207698_11681131 3300026142 Unclassified 650
872 Ga0209974_10027219 3300027876 Bacteria 1891
873 Ga0209974_10047241 3300027876 Unclassified 1441
874 Ga0207428_10001370 3300027907 Bacteria 25833
875 Ga0207428_10001377 3300027907 Bacteria 25761
876 Ga0207428_10003130 3300027907 Bacteria 16230
877 Ga0207428_10072291 3300027907 Bacteria 2708
878 Ga0207428_10188549 3300027907 Bacteria 1555
879 Ga0268266_10061402 3300028379 Bacteria 3242
880 Ga0268266_10070582 3300028379 Bacteria 3027
881 Ga0268266_10306151 3300028379 Bacteria 1484
882 Ga0268266_10372573 3300028379 Bacteria 1345
883 Ga0268266_11063237 3300028379 Bacteria 783
884 Ga0268265_10023143 3300028380 Bacteria 4376
885 Ga0268265_10089292 3300028380 Bacteria 2458
886 Ga0268265_10231499 3300028380 Bacteria 1624
887 Ga0268265_10295874 3300028380 Bacteria 1455
888 Ga0268265_10557409 3300028380 Bacteria 1089
889 Ga0268265_11113616 3300028380 Bacteria 784
890 Ga0268264_10003737 3300028381 Bacteria 13072
891 Ga0268264_10009037 3300028381 Bacteria 8267
892 Ga0268264_10243591 3300028381 Bacteria 1666
893 Ga0268264_10420460 3300028381 Bacteria 1289
894 Ga0268264_10483648 3300028381 Bacteria 1205
895 Ga0265323_10001994 3300028653 Bacteria 9627
896 Ga0265338_10137740 3300028800 Bacteria 1916
897 Ga0265760_10219868 3300031090 Unclassified 647
898 Ga0265320_10001179 3300031240 Bacteria 19255
899 Ga0265325_10003125 3300031241 Bacteria 10924
900 Ga0265325_10012734 3300031241 Bacteria 4801
901 Ga0265340_10022045 3300031247 Bacteria 3260
902 Ga0265331_10069063 3300031250 Bacteria 1655
903 Ga0265316_10001444 3300031344 Bacteria 25507
904 Ga0265316_10004197 3300031344 Bacteria 14404
905 Ga0265316_10118693 3300031344 Bacteria 1998
906 Ga0265316_10245706 3300031344 Bacteria 1315
907 Ga0265316_10444213 3300031344 Bacteria 931
908 Ga0307408_100007941 3300031548 Bacteria 7016
909 Ga0307408_100016620 3300031548 Bacteria 4915
910 Ga0265313_10027055 3300031595 Bacteria 3008
911 Ga0265314_10000282 3300031711 Bacteria 73865
912 Ga0265314_10000961 3300031711 Bacteria 33842
913 Ga0265314_10025644 3300031711 Bacteria 4442
914 Ga0265314_10089002 3300031711 Bacteria 2015
915 Ga0265342_10049765 3300031712 Bacteria 2506
916 Ga0307405_10013982 3300031731 Bacteria 4301
917 Ga0307405_10336380 3300031731 Bacteria 1159
918 Ga0307413_10366244 3300031824 Bacteria 1118
919 Ga0307410_10141551 3300031852 Bacteria 1780
920 Ga0307406_10233116 3300031901 Bacteria 1376
921 Ga0307406_10455426 3300031901 Bacteria 1027
922 Ga0307407_10146428 3300031903 Unclassified 1530
923 Ga0307412_10177391 3300031911 Bacteria 1599
924 Ga0307412_10352083 3300031911 Bacteria 1183
925 Ga0307412_10406641 3300031911 Bacteria 1110
926 Ga0307412_10562196 3300031911 Unclassified 960
927 Ga0307409_100024156 3300031995 Bacteria 4233
928 Ga0307409_100033309 3300031995 Bacteria 3748
929 Ga0307409_100387479 3300031995 Bacteria 1331
930 Ga0307409_100412144 3300031995 Bacteria 1294
931 Ga0307409_100965143 3300031995 Bacteria 869
932 Ga0307416_100009691 3300032002 Bacteria 6324
933 Ga0307416_100034952 3300032002 Bacteria 3832
934 Ga0307416_100198348 3300032002 Bacteria 1901
935 Ga0307416_100258351 3300032002 Bacteria 1701
936 Ga0307416_100367049 3300032002 Bacteria 1464
937 Ga0307416_100765140 3300032002 Bacteria 1059
938 Ga0307416_101171400 3300032002 Unclassified 874
939 Ga0307416_101678148 3300032002 Bacteria 740
940 Ga0307414_10367557 3300032004 Bacteria 1240
941 Ga0307414_10669985 3300032004 Bacteria 937
942 Ga0307414_11061783 3300032004 Bacteria 747
943 Ga0307411_10005955 3300032005 Bacteria 6058
944 Ga0307411_10016736 3300032005 Bacteria 4157
945 Ga0307411_10168931 3300032005 Bacteria 1647
946 Ga0307411_10287175 3300032005 Bacteria 1312
947 Ga0307411_10306516 3300032005 Bacteria 1276
948 Ga0307411_10843652 3300032005 Bacteria 810
949 Ga0307415_100511887 3300032126 Bacteria 1052
950 Ga0307415_100801156 3300032126 Unclassified 860
951 Ga0373950_0029730 3300034818 Bacteria 1006
952 Ga0373938_0035448 3300034957 Bacteria 1088
953 Ga0373926_0066528 3300035083 Bacteria 1319
954 Ga0373934_0001945 3300035086 Bacteria 7572
955 Ga0373934_0137732 3300035086 Bacteria 997
956 Ga0373940_0005259 3300035088 Bacteria 2792
957 Ga0373949_0035044 3300035090 Bacteria 1212
958 Ga0373923_0274862 3300035111 Unclassified 793
959 Ga0373923_0360644 3300035111 Bacteria 695
960 Ga0373932_0053834 3300035112 Bacteria 1202
961 Ga0373939_0010404 3300035114 Bacteria 2325
962 Ga0373953_0135848 3300035117 Bacteria 1050
963 Ga0373954_0001726 3300035118 Bacteria 8948
964 Ga0373954_0004906 3300035118 Bacteria 5775
965 Ga0373956_0020307 3300035119 Bacteria 2825
966 Ga0373956_0075491 3300035119 Bacteria 1542
967 Ga0373957_0012652 3300035120 Bacteria 2846
968 Ga0373960_0012930 3300035121 Bacteria 2084
969 Ga0373960_0115612 3300035121 Bacteria 885
970 Ga0373960_0207769 3300035121 Bacteria 695
971 Ga0373943_0316264 3300035170 Bacteria 889
972 Ga0373946_0038006 3300035171 Bacteria 1959
973 Ga0373955_0056036 3300035172 Bacteria 2161
974 Ga0373955_0133431 3300035172 Bacteria 1451
975 Ga0373955_0217186 3300035172 Bacteria 1141
976 Ga0373955_0235734 3300035172 Bacteria 1095
977 Ga0373961_0083350 3300035241 Bacteria 1009
978 Ga0373924_0240676 3300035410 Bacteria 801
979 Ga0373931_0078914 3300035691 Bacteria 1812
980 Ga0373935_0044795 3300035692 Bacteria 2790
981 Ga0373935_0116314 3300035692 Bacteria 1781
982 Ga0373927_0000498 3300035695 Bacteria 29897
983 Ga0373927_0002081 3300035695 Bacteria 14775
984 Ga0373927_0007350 3300035695 Bacteria 7457
985 Ga0373927_0042674 3300035695 Bacteria 2939
986 Ga0373933_0128788 3300035724 Unclassified 1590
987 Ga0373933_0183833 3300035724 Bacteria 1334
988 Ga0373947_0001083 3300035725 Bacteria 16688
989 Ga0373947_0013876 3300035725 Bacteria 4620
990 Ga0373947_0021389 3300035725 Bacteria 3744
991 Ga0373937_0017647 3300036401 Bacteria 6366
992 Ga0373937_0061324 3300036401 Bacteria 3457
993 Ga0373937_0084305 3300036401 Bacteria 2940
994 Ga0373937_0089365 3300036401 Bacteria 2852
995 Ga0373937_0323934 3300036401 Bacteria 1458
996 Ga0373937_0387906 3300036401 Bacteria 1325
997 Ga0373937_0418446 3300036401 Bacteria 1272
998 Ga0373937_0459359 3300036401 Bacteria 1209
999 Ga0373937_0747975 3300036401 Bacteria 925
1000 Ga0373925_0000281 3300037068 Bacteria 53236
1001 Ga0373925_0036609 3300037068 Bacteria 3622
1002 Ga0373925_0119629 3300037068 Bacteria 2043
1003 Ga0373925_0160195 3300037068 Bacteria 1772
1004 Ga0373925_0231751 3300037068 Bacteria 1477
1005 Ga0373925_0248232 3300037068 Bacteria 1427
1006 Ga0373925_0266953 3300037068 Bacteria 1376
1007 Ga0373925_0626934 3300037068 Unclassified 886
1008 Ga0436364_0062454 3300037853 Bacteria 1604
1009 Ga0436364_0298586 3300037853 Bacteria 4338
1010 Ga0436364_0349717 3300037853 Bacteria 2676
1011 Ga0436364_0365940 3300037853 Bacteria 2488
1012 Ga0436364_0509131 3300037853 Bacteria 1939
1013 Ga0436364_0555496 3300037853 Bacteria 1971
1014 Ga0436364_0618208 3300037853 Bacteria 688
1015 Ga0436364_0633516 3300037853 Bacteria 25573
1016 Ga0436364_0674901 3300037853 Bacteria 3046
1017 Ga0436364_0818237 3300037853 Bacteria 6615
1018 Ga0436364_0835808 3300037853 Bacteria 4462
1019 Ga0436364_0991276 3300037853 Bacteria 2683
1020 Ga0436364_1046318 3300037853 Unclassified 2118
1021 Ga0436364_1080095 3300037853 Bacteria 2864
1022 Ga0436364_1193035 3300037853 Bacteria 6898
1023 Ga0436364_1295092 3300037853 Bacteria 1458
1024 Ga0395901_0142089 3300038443 Bacteria 2523
1025 Ga0436365_0082371 3300039437 Bacteria 1967
1026 Ga0436365_0344744 3300039437 Bacteria 9555
1027 Ga0436365_0512169 3300039437 Unclassified 2020
1028 Ga0436365_0650674 3300039437 Bacteria 3958
1029 Ga0436365_1778817 3300039437 Bacteria 29645
1030 Ga0436360_0580543 3300039438 Bacteria 14902
1031 Ga0436360_0677337 3300039438 Bacteria 922
1032 Ga0436360_0882145 3300039438 Bacteria 1311
1033 Ga0436361_0793152 3300039447 Bacteria 90360
1034 Ga0436361_1149713 3300039447 Bacteria 2715
1035 Ga0436363_0651938 3300039450 Bacteria 1132
1036 Ga0436363_0673922 3300039450 Bacteria 841
1037 Ga0436363_0858902 3300039450 Bacteria 2994
1038 Ga0436363_1297791 3300039450 Bacteria 3582
1039 Ga0436363_1382872 3300039450 Bacteria 674
1040 Ga0436363_1694135 3300039450 Bacteria 980
1041 Ga0436362_0155526 3300039453 Bacteria 907
1042 Ga0436362_0701537 3300039453 Unclassified 751
1043 Ga0436362_0890342 3300039453 Bacteria 5717
1044 Ga0451843_0968640 3300041509 Bacteria 1036
1045 Ga0451853_1530684 3300041512 Bacteria 638
1046 Ga0439441_072265 3300042001 Bacteria 741
1047 Ga0439454_012362 3300042011 Bacteria 1157
1048 Ga0450920_027248 3300042122 Bacteria 1118
1049 Ga0439446_0046055 3300042156 Bacteria 1295
1050 Ga0450908_015851 3300042184 Bacteria 1347
1051 Ga0439434_0067418 3300042435 Bacteria 1124
1052 Ga0439435_0015984 3300042436 Bacteria 1875
1053 Ga0439444_0007370 3300042437 Bacteria 1688
1054 Ga0439460_0057087 3300042461 Bacteria 1184
1055 Ga0450916_005898 3300042530 Bacteria 1430
1056 Ga0450916_012289 3300042530 Bacteria 1091
1057 Ga0451577_0469755 3300042876 Bacteria 1142
1058 Ga0439440_0043722 3300042993 Bacteria 1099
1059 Ga0453683_0672215 3300044673 Bacteria 678
1060 Ga0466966_0113650 3300044684 Bacteria 1667
1061 Ga0466963_0178329 3300044694 Bacteria 1483
1062 Ga0466963_0525925 3300044694 Bacteria 835
1063 Ga0451576_0048913 3300045051 Bacteria 4438
1064 Ga0451576_0201094 3300045051 Bacteria 2081
1065 Ga0451576_0229180 3300045051 Bacteria 1940
1066 Ga0495592_0059402 3300046454 Bacteria 2816
1067 Ga0495603_0059674 3300046455 Bacteria 2255
1068 Ga0495603_0101562 3300046455 Bacteria 1679
1069 Ga0495603_0117581 3300046455 Bacteria 1550
1070 Ga0495603_0140246 3300046455 Bacteria 1406
1071 Ga0495651_0002965 3300046462 Bacteria 13114
1072 Ga0495651_0211998 3300046462 Bacteria 1347
1073 Ga0495651_0365259 3300046462 Bacteria 950
1074 Ga0495580_0014096 3300046472 Bacteria 6077
1075 Ga0495580_0073689 3300046472 Bacteria 2384
1076 Ga0495580_0103321 3300046472 Bacteria 1981
1077 Ga0495580_0146563 3300046472 Bacteria 1636
1078 Ga0495580_0205857 3300046472 Bacteria 1355
1079 Ga0495580_0339995 3300046472 Bacteria 1018
1080 Ga0495580_0375568 3300046472 Bacteria 961
1081 Ga0495580_0408976 3300046472 Unclassified 914
1082 Ga0495582_0092109 3300046473 Bacteria 1691
1083 Ga0495582_0201521 3300046473 Bacteria 1136
1084 Ga0495582_0352007 3300046473 Bacteria 848
1085 Ga0495639_0224658 3300046475 Bacteria 924
1086 Ga0495664_0087302 3300046477 Bacteria 1874
1087 Ga0495664_0164764 3300046477 Bacteria 1345
1088 Ga0495664_0208754 3300046477 Bacteria 1183
1089 Ga0495664_0385348 3300046477 Bacteria 843
1090 Ga0495594_0004891 3300046499 Bacteria 6897
1091 Ga0495594_0114077 3300046499 Bacteria 1525
1092 Ga0495608_0423284 3300046511 Bacteria 812
1093 Ga0495643_0003489 3300046522 Bacteria 11463
1094 Ga0495663_0203336 3300046525 Bacteria 692
1095 Ga0495666_0096729 3300046526 Bacteria 1392
1096 Ga0495652_0036329 3300046529 Bacteria 4286
1097 Ga0495652_0116086 3300046529 Bacteria 2144
1098 Ga0495665_0139085 3300046531 Bacteria 1269
1099 Ga0495665_0338815 3300046531 Bacteria 767
1100 Ga0495586_0381494 3300046535 Bacteria 811
1101 Ga0495587_0006862 3300046536 Bacteria 7406
1102 Ga0495587_0423880 3300046536 Bacteria 738
1103 Ga0495621_0020422 3300046539 Bacteria 2174
1104 Ga0495621_0270016 3300046539 Bacteria 699
1105 Ga0495645_0019007 3300046543 Bacteria 4945
1106 Ga0495645_0209763 3300046543 Bacteria 1316
1107 Ga0495645_0281329 3300046543 Bacteria 1094
1108 Ga0495645_0298586 3300046543 Bacteria 1053
1109 Ga0495645_0301265 3300046543 Bacteria 1047
1110 Ga0495645_0349397 3300046543 Bacteria 953
1111 Ga0495633_0271185 3300046558 Bacteria 772
1112 Ga0495667_0081241 3300046559 Bacteria 2107
1113 Ga0495656_0075421 3300046615 Bacteria 1509
1114 Ga0495635_0047094 3300046663 Bacteria 2975
1115 Ga0495635_0160477 3300046663 Bacteria 1530
1116 Ga0495635_0181987 3300046663 Bacteria 1428
1117 Ga0495659_0036011 3300046664 Bacteria 1746
1118 Ga0495588_0030217 3300046674 Bacteria 2722
1119 Ga0495599_0003371 3300046678 Bacteria 9341
1120 Ga0495599_0063543 3300046678 Bacteria 2307
1121 Ga0495599_0081458 3300046678 Bacteria 2022
1122 Ga0495599_0521714 3300046678 Bacteria 698
1123 Ga0495623_0207215 3300046679 Bacteria 1124
1124 Ga0495623_0306250 3300046679 Unclassified 876
1125 Ga0495646_0208377 3300046680 Bacteria 1062
1126 Ga0495647_0146881 3300046681 Bacteria 1009
1127 Ga0495647_0353485 3300046681 Bacteria 669
1128 Ga0495658_0277003 3300046683 Unclassified 1058
1129 Ga0495658_0564125 3300046683 Bacteria 729
1130 Ga0495658_0700151 3300046683 Bacteria 649
1131 Ga0495604_0060748 3300047317 Bacteria 2893
1132 Ga0495604_0186718 3300047317 Bacteria 1447
1133 Ga0495636_0037685 3300047318 Bacteria 1997
1134 Ga0495636_0065943 3300047318 Bacteria 1538
1135 Ga0495674_0077054 3300047319 Bacteria 2867
1136 Ga0495674_0083109 3300047319 Bacteria 2745
1137 Ga0495674_0320258 3300047319 Bacteria 1263
1138 Ga0495675_0288190 3300047444 Bacteria 978
1139 Ga0495684_0005866 3300047471 Bacteria 9545
1140 Ga0495684_0094188 3300047471 Bacteria 2268
1141 Ga0495684_0104527 3300047471 Bacteria 2140
1142 Ga0495684_0112073 3300047471 Bacteria 2058
1143 Ga0495684_0113952 3300047471 Bacteria 2038
1144 Ga0495684_0246229 3300047471 Bacteria 1302
1145 Ga0495684_0278866 3300047471 Bacteria 1207
1146 Ga0495602_0012640 3300048088 Bacteria 8661
1147 Ga0495602_0043456 3300048088 Bacteria 4085
1148 Ga0496104_0085600 3300048907 Bacteria 3009
1149 Ga0496104_0571391 3300048907 Unclassified 1041
1150 Ga0496104_0745116 3300048907 Bacteria 887
1151 Ga0496106_0164867 3300048909 Bacteria 1754
1152 Ga0496109_0048511 3300048912 Bacteria 3864
1153 Ga0496110_0290872 3300048913 Bacteria 1488
1154 Ga0496110_0339636 3300048913 Bacteria 1368
1155 Ga0496112_0169095 3300048915 Bacteria 2152
1156 Ga0496113_0205790 3300048916 Bacteria 1565
1157 Ga0496114_0267889 3300048917 Bacteria 1505
1158 Ga0496115_0144934 3300048918 Bacteria 1960
1159 Ga0496115_0190661 3300048918 Bacteria 1694
1160 Ga0501291_003827 3300049514 Bacteria 1891
1161 Ga0501291_007243 3300049514 Bacteria 1499
1162 Ga0501298_016445 3300049521 Bacteria 1341
1163 Ga0501031_0020202 3300049568 Bacteria 4341
1164 Ga0501032_0001366 3300049569 Bacteria 19354
1165 Ga0501033_0015134 3300049570 Bacteria 5853
1166 Ga0501033_0206514 3300049570 Bacteria 1402
1167 Ga0501034_0026807 3300049571 Bacteria 5862
1168 Ga0501036_0001154 3300049572 Bacteria 20080
1169 Ga0501036_0063750 3300049572 Bacteria 3120
1170 Ga0501036_0081431 3300049572 Bacteria 2736
1171 Ga0501036_0244084 3300049572 Bacteria 1506
1172 Ga0501037_0005354 3300049573 Bacteria 9335
1173 Ga0501038_0000838 3300049574 Bacteria 27356
1174 Ga0501038_0188613 3300049574 Bacteria 1660
1175 Ga0501038_0273276 3300049574 Bacteria 1332
1176 Ga0501039_0005534 3300049575 Bacteria 9561
1177 Ga0501039_0030051 3300049575 Bacteria 4187
1178 Ga0501039_0052695 3300049575 Bacteria 3147
1179 Ga0501039_0118927 3300049575 Bacteria 2070
1180 Ga0501040_0020549 3300049576 Bacteria 4402
1181 Ga0501040_0085853 3300049576 Bacteria 2185
1182 Ga0501040_0467044 3300049576 Bacteria 909
1183 Ga0501040_0623788 3300049576 Unclassified 779
1184 Ga0501040_0682928 3300049576 Bacteria 742
1185 Ga0501041_0019686 3300049577 Bacteria 4032
1186 Ga0501042_0005920 3300049578 Bacteria 7909
1187 Ga0501042_0018389 3300049578 Bacteria 4837
1188 Ga0501042_0027614 3300049578 Bacteria 3992
1189 Ga0501043_0031914 3300049579 Bacteria 4139
1190 Ga0501043_0067928 3300049579 Bacteria 2799
1191 Ga0501043_0513089 3300049579 Bacteria 894
1192 Ga0501046_0024267 3300049580 Bacteria 4977
1193 Ga0501046_0026841 3300049580 Bacteria 4703
1194 Ga0501046_0138773 3300049580 Bacteria 1841
1195 Ga0501046_0351759 3300049580 Bacteria 1070
1196 Ga0501047_0064494 3300049581 Bacteria 3532
1197 Ga0501047_0226882 3300049581 Bacteria 1722
1198 Ga0501048_0026632 3300049582 Bacteria 4209
1199 Ga0501048_0032255 3300049582 Bacteria 3786
1200 Ga0501048_0106806 3300049582 Bacteria 1976
1201 Ga0501067_0033450 3300049583 Bacteria 2852
1202 Ga0501068_0001809 3300049584 Bacteria 11364
1203 Ga0501069_0011896 3300049585 Bacteria 4616
1204 Ga0501070_0018049 3300049586 Bacteria 5921
1205 Ga0501070_0065536 3300049586 Bacteria 3007
1206 Ga0501070_0200056 3300049586 Bacteria 1641
1207 Ga0501071_0198807 3300049587 Bacteria 1505
1208 Ga0501072_0003019 3300049588 Bacteria 12694
1209 Ga0501072_0084843 3300049588 Bacteria 2512
1210 Ga0501072_0198084 3300049588 Bacteria 1601
1211 Ga0501073_0001367 3300049589 Bacteria 18010
1212 Ga0501073_0167321 3300049589 Bacteria 1522
1213 Ga0501073_0743464 3300049589 Bacteria 676
1214 Ga0501074_0010960 3300049590 Bacteria 6581
1215 Ga0501075_0116492 3300049591 Bacteria 2031
1216 Ga0501075_0211629 3300049591 Bacteria 1479
1217 Ga0501075_0611791 3300049591 Bacteria 831
1218 Ga0501075_0832920 3300049591 Unclassified 702
1219 Ga0501076_0035470 3300049592 Bacteria 3902
1220 Ga0501076_0044751 3300049592 Bacteria 3492
1221 Ga0501076_0120849 3300049592 Bacteria 2121
1222 Ga0501076_0853483 3300049592 Bacteria 751
1223 Ga0501077_0018748 3300049593 Bacteria 4377
1224 Ga0501077_0087085 3300049593 Bacteria 1980
1225 Ga0501202_032463 3300049652 Bacteria 1096
1226 Ga0501217_150745 3300049661 Bacteria 695
1227 Ga0501233_075282 3300049668 Bacteria 861
1228 Ga0501243_059450 3300049675 Bacteria 706
1229 Ga0501249_014980 3300049679 Bacteria 1656
1230 Ga0501249_034932 3300049679 Bacteria 1129
1231 Ga0501249_063792 3300049679 Bacteria 855
1232 Ga0501079_0009365 3300049741 Bacteria 7421
1233 Ga0501079_0047546 3300049741 Bacteria 3310
1234 Ga0501079_0049621 3300049741 Bacteria 3239
1235 Ga0501080_0000243 3300049742 Bacteria 40903
1236 Ga0501080_0141503 3300049742 Bacteria 2224
1237 Ga0501080_0210814 3300049742 Bacteria 1780
1238 Ga0501081_0053824 3300049743 Bacteria 2779
1239 Ga0501081_0060120 3300049743 Bacteria 2632
1240 Ga0501081_0185443 3300049743 Bacteria 1506
1241 Ga0501081_0224102 3300049743 Bacteria 1368
1242 Ga0501081_0283204 3300049743 Bacteria 1214
1243 Ga0501081_0416991 3300049743 Bacteria 995
1244 Ga0501083_0004506 3300049744 Bacteria 9839
1245 Ga0501083_0217186 3300049744 Bacteria 1246
1246 Ga0501283_022383 3300049779 Bacteria 1019
1247 Ga0501035_0081046 3300049822 Bacteria 2864
1248 Ga0501035_0242560 3300049822 Unclassified 1532
1249 Ga0501035_0658421 3300049822 Bacteria 848
1250 Ga0501044_0001257 3300049823 Bacteria 29993
1251 Ga0501044_0014994 3300049823 Bacteria 8355
1252 Ga0501044_0033042 3300049823 Bacteria 5436
1253 Ga0501044_0085577 3300049823 Bacteria 3185
1254 Ga0501045_0039403 3300049824 Bacteria 3438
1255 Ga0501045_0053881 3300049824 Bacteria 2940
1256 Ga0501045_0706923 3300049824 Bacteria 743
1257 Ga0501045_0781592 3300049824 Unclassified 703
1258 nmdc:mga00v17_675120_c1 3300050491 Unclassified 663
1259 nmdc:mga06z11_262520_c1 3300050494 Bacteria 1019
1260 nmdc:mga05p37_1080949_c1 3300050507 Bacteria 842
1261 nmdc:mga05p37_171260_c1 3300050507 Bacteria 2647
1262 nmdc:mga05p37_177921_c1 3300050507 Bacteria 2590
1263 nmdc:mga05p37_2419_c1 3300050507 Bacteria 21703
1264 nmdc:mga05p37_437550_c1 3300050507 Unclassified 1518
1265 nmdc:mga05p37_437754_c1 3300050507 Bacteria 1517
1266 nmdc:mga05p37_44782_c1 3300050507 Bacteria 5443
1267 nmdc:mga05p37_483596_c1 3300050507 Bacteria 1425
1268 nmdc:mga05p37_84148_c1 3300050507 Bacteria 3919
1269 nmdc:mga09592_177681_c1 3300050508 Bacteria 1841
1270 nmdc:mga09592_19125_c1 3300050508 Bacteria 5621
1271 nmdc:mga09592_27132_c1 3300050508 Bacteria 4751
1272 nmdc:mga09592_35835_c1 3300050508 Bacteria 4155
1273 nmdc:mga09592_50982_c1 3300050508 Bacteria 3491
1274 nmdc:mga09592_74264_c1 3300050508 Bacteria 2890
1275 nmdc:mga0qj67_102877_c1 3300050509 Bacteria 2303
1276 nmdc:mga0qj67_134553_c1 3300050509 Bacteria 2003
1277 nmdc:mga0qj67_17604_c1 3300050509 Bacteria 5435
1278 nmdc:mga0qj67_216745_c1 3300050509 Bacteria 1554
1279 nmdc:mga0qj67_444188_c1 3300050509 Bacteria 1045
1280 nmdc:mga0qj67_59487_c1 3300050509 Bacteria 3030
1281 nmdc:mga0qj67_60595_c1 3300050509 Bacteria 3004
1282 nmdc:mga06r32_263078_c1 3300050510 Unclassified 1713
1283 nmdc:mga06r32_336659_c1 3300050510 Bacteria 1494
1284 nmdc:mga06r32_55695_c1 3300050510 Bacteria 3794
1285 nmdc:mga06r32_7152_c1 3300050510 Bacteria 10057
1286 nmdc:mga06r32_752330_c1 3300050510 Bacteria 938
1287 nmdc:mga06r32_77979_c1 3300050510 Bacteria 3219
1288 nmdc:mga06r32_7934_c1 3300050510 Bacteria 9542
1289 nmdc:mga08y16_142240_c1 3300050511 Bacteria 2494
1290 nmdc:mga08y16_156827_c1 3300050511 Bacteria 2365
1291 nmdc:mga08y16_16007_c1 3300050511 Bacteria 7883
1292 nmdc:mga08y16_227274_c1 3300050511 Bacteria 1931
1293 nmdc:mga08y16_23988_c1 3300050511 Bacteria 6443
1294 nmdc:mga08y16_28438_c1 3300050511 Bacteria 5894
1295 nmdc:mga08y16_444180_c1 3300050511 Bacteria 1323
1296 nmdc:mga08y16_52853_c1 3300050511 Bacteria 4249
1297 nmdc:mga08y16_667382_c1 3300050511 Bacteria 1042
1298 nmdc:mga08y16_743_c1 3300050511 Bacteria 31040
1299 nmdc:mga0n895_12115_c1 3300050512 Bacteria 7717
1300 nmdc:mga0n895_18663_c1 3300050512 Bacteria 6424
1301 nmdc:mga0n895_19455_c1 3300050512 Bacteria 6312
1302 nmdc:mga0n895_239890_c1 3300050512 Bacteria 1839
1303 nmdc:mga0n895_31629_c1 3300050512 Bacteria 5069
1304 nmdc:mga0n895_4506_c2 3300050512 Bacteria 10814
1305 nmdc:mga0n895_90797_c1 3300050512 Bacteria 3057
1306 nmdc:mga0rr50_148320_c1 3300050513 Bacteria 1893
1307 nmdc:mga0rr50_155539_c1 3300050513 Bacteria 1852
1308 nmdc:mga0rr50_6700_c1 3300050513 Bacteria 7047
1309 nmdc:mga0rr50_7227_c1 3300050513 Bacteria 6829
1310 nmdc:mga08x19_128473_c1 3300050514 Bacteria 1703
1311 nmdc:mga08x19_394968_c1 3300050514 Bacteria 969
1312 nmdc:mga0a205_17414_c1 3300050515 Bacteria 6736
1313 nmdc:mga0a205_2187_c1 3300050515 Bacteria 17201
1314 nmdc:mga0a205_224344_c1 3300050515 Bacteria 1764
1315 nmdc:mga0a205_29117_c1 3300050515 Bacteria 5285
1316 nmdc:mga0a205_2928_c1 3300050515 Bacteria 15120
1317 nmdc:mga0a205_49577_c1 3300050515 Bacteria 4054
1318 nmdc:mga0a205_5356_c1 3300050515 Bacteria 11561
1319 nmdc:mga0a205_79452_c1 3300050515 Bacteria 3170
1320 Ga0495619_0191817 3300053085 Bacteria 1414
1321 Ga0500645_000386 3300053730 Bacteria 30983
1322 Ga0501084_0000227 3300054114 Bacteria 42697
1323 Ga0501084_0081371 3300054114 Bacteria 2716
1324 Ga0501084_0098210 3300054114 Bacteria 2459
1325 Ga0501084_0114826 3300054114 Bacteria 2264
1326 Ga0501084_0155670 3300054114 Bacteria 1927
1327 Ga0501084_0174185 3300054114 Bacteria 1816
1328 Ga0590071_000168 3300059421 Bacteria 18744
1329 Ga0590071_029512 3300059421 Bacteria 1304
1330 Ga0590074_001533 3300059423 Bacteria 3743
1331 Ga0590075_000104 3300059424 Bacteria 21627
1332 Ga0590075_005298 3300059424 Bacteria 3047
1333 Ga0590077_000085 3300059426 Bacteria 23923
1334 Ga0590077_028077 3300059426 Bacteria 1221
1335 Ga0501082_0000199 3300060353 Bacteria 52195
1336 Ga0501082_0004396 3300060353 Bacteria 12305
1337 Ga0501082_0131626 3300060353 Bacteria 2170
1338 Ga0501082_0457589 3300060353 Unclassified 1115
1339 Ga0530510_0009133 3300061734 Bacteria 6947
1340 Ga0530510_0285840 3300061734 Archaea 1233

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_10370971 Ga0207644_103709712 176
2 3300026121 Ga0207683_10046567 Ga0207683_100465674 176
3 3300045051 Ga0451576_0201094 Ga0451576_0201094_35_622 176
4 3300046455 Ga0495603_0059674 Ga0495603_0059674_883_1470 176
5 3300046535 Ga0495586_0381494 Ga0495586_0381494_108_638 176
6 3300046681 Ga0495647_0353485 Ga0495647_0353485_42_629 176
7 3300042001 Ga0439441_072265 Ga0439441_072265_193_726 177
8 3300042876 Ga0451577_0469755 Ga0451577_0469755_257_844 177
9 3300027876 Ga0209974_10047241 Ga0209974_100472412 178
10 3300005331 Ga0070670_100030192 Ga0070670_1000301922 179
11 3300005564 Ga0070664_100119171 Ga0070664_1001191712 179
12 3300010375 Ga0105239_12377717 Ga0105239_123777171 179
13 3300025925 Ga0207650_10018995 Ga0207650_100189952 179
14 3300025945 Ga0207679_10208072 Ga0207679_102080722 179
15 3300049576 Ga0501040_0623788 Ga0501040_0623788_224_763 179
16 3300050511 nmdc:mga08y16_227274_c1 nmdc:mga08y16_227274_c1_187_726 179
17 3300053730 Ga0500645_000386 Ga0500645_000386_5903_6442 179
18 3300005364 Ga0070673_100046554 Ga0070673_1000465543 181
19 3300017792 Ga0163161_10066300 Ga0163161_100663003 181
20 3300025908 Ga0207643_10130402 Ga0207643_101304022 181
21 3300009094 Ga0111539_10165833 Ga0111539_101658333 189
22 3300025941 Ga0207711_10177044 Ga0207711_101770442 189
23 3300050511 nmdc:mga08y16_156827_c1 nmdc:mga08y16_156827_c1_1385_1972 189
24 3300005539 Ga0068853_100088667 Ga0068853_1000886674 190
25 3300005563 Ga0068855_100042276 Ga0068855_1000422764 190
26 3300005578 Ga0068854_100135573 Ga0068854_1001355733 190
27 3300005616 Ga0068852_101022385 Ga0068852_1010223852 190
28 3300006237 Ga0097621_100057379 Ga0097621_1000573793 190
29 3300006358 Ga0068871_100318934 Ga0068871_1003189342 190
30 3300013100 Ga0157373_10091811 Ga0157373_100918113 190
31 3300013105 Ga0157369_10001658 Ga0157369_1000165821 190
32 3300014969 Ga0157376_11400287 Ga0157376_114002872 190
33 3300026142 Ga0207698_11107193 Ga0207698_111071931 190
34 3300048907 Ga0496104_0571391 Ga0496104_0571391_99_671 190
35 3300048912 Ga0496109_0048511 Ga0496109_0048511_103_675 190
36 3300048913 Ga0496110_0290872 Ga0496110_0290872_583_1155 190
37 3300014326 Ga0157380_11634156 Ga0157380_116341561 191
38 3300041512 Ga0451853_1530684 Ga0451853_1530684_48_623 191
39 3300025913 Ga0207695_10735222 Ga0207695_107352222 192
40 3300025942 Ga0207689_10441410 Ga0207689_104414101 192
41 3300049679 Ga0501249_034932 Ga0501249_034932_448_1035 193
42 3300005293 Ga0065715_10172499 Ga0065715_101724993 194
43 3300005327 Ga0070658_10522636 Ga0070658_105226361 194
44 3300005329 Ga0070683_100005237 Ga0070683_1000052378 194
45 3300005329 Ga0070683_100020370 Ga0070683_1000203707 194
46 3300005329 Ga0070683_100143466 Ga0070683_1001434662 194
47 3300005329 Ga0070683_100221656 Ga0070683_1002216562 194
48 3300005329 Ga0070683_100660156 Ga0070683_1006601562 194
49 3300005329 Ga0070683_100904347 Ga0070683_1009043471 194
50 3300005331 Ga0070670_100418815 Ga0070670_1004188152 194
51 3300005331 Ga0070670_100593520 Ga0070670_1005935201 194
52 3300005331 Ga0070670_100924952 Ga0070670_1009249521 194
53 3300005334 Ga0068869_100066274 Ga0068869_1000662742 194
54 3300005336 Ga0070680_100433345 Ga0070680_1004333452 194
55 3300005339 Ga0070660_100203357 Ga0070660_1002033572 194
56 3300005339 Ga0070660_100363369 Ga0070660_1003633692 194
57 3300005340 Ga0070689_100373115 Ga0070689_1003731151 194
58 3300005341 Ga0070691_10022558 Ga0070691_100225582 194
59 3300005353 Ga0070669_100116793 Ga0070669_1001167932 194
60 3300005353 Ga0070669_100842915 Ga0070669_1008429151 194
61 3300005354 Ga0070675_100000116 Ga0070675_10000011611 194
62 3300005354 Ga0070675_100031527 Ga0070675_1000315272 194
63 3300005355 Ga0070671_100081927 Ga0070671_1000819272 194
64 3300005355 Ga0070671_100117122 Ga0070671_1001171222 194
65 3300005356 Ga0070674_100461468 Ga0070674_1004614682 194
66 3300005356 Ga0070674_100639929 Ga0070674_1006399292 194
67 3300005356 Ga0070674_100651728 Ga0070674_1006517282 194
68 3300005364 Ga0070673_100128742 Ga0070673_1001287422 194
69 3300005364 Ga0070673_100273180 Ga0070673_1002731802 194
70 3300005364 Ga0070673_100782076 Ga0070673_1007820762 194
71 3300005365 Ga0070688_100161187 Ga0070688_1001611872 194
72 3300005366 Ga0070659_100126655 Ga0070659_1001266553 194
73 3300005434 Ga0070709_10013766 Ga0070709_100137666 194
74 3300005434 Ga0070709_10801774 Ga0070709_108017742 194
75 3300005435 Ga0070714_100035658 Ga0070714_1000356583 194
76 3300005435 Ga0070714_100154566 Ga0070714_1001545662 194
77 3300005435 Ga0070714_100342232 Ga0070714_1003422322 194
78 3300005436 Ga0070713_100002523 Ga0070713_1000025233 194
79 3300005436 Ga0070713_100011179 Ga0070713_1000111797 194
80 3300005436 Ga0070713_100015164 Ga0070713_1000151643 194
81 3300005436 Ga0070713_100294210 Ga0070713_1002942102 194
82 3300005439 Ga0070711_100343129 Ga0070711_1003431292 194
83 3300005444 Ga0070694_100138356 Ga0070694_1001383563 194
84 3300005455 Ga0070663_100028751 Ga0070663_1000287515 194
85 3300005456 Ga0070678_100048413 Ga0070678_1000484133 194
86 3300005456 Ga0070678_100717131 Ga0070678_1007171311 194
87 3300005456 Ga0070678_101243119 Ga0070678_1012431191 194
88 3300005457 Ga0070662_100012691 Ga0070662_1000126916 194
89 3300005458 Ga0070681_10022213 Ga0070681_100222135 194
90 3300005458 Ga0070681_10134031 Ga0070681_101340312 194
91 3300005458 Ga0070681_10262776 Ga0070681_102627761 194
92 3300005459 Ga0068867_100132380 Ga0068867_1001323803 194
93 3300005459 Ga0068867_100565344 Ga0068867_1005653442 194
94 3300005468 Ga0070707_101010398 Ga0070707_1010103982 194
95 3300005518 Ga0070699_100012616 Ga0070699_1000126164 194
96 3300005518 Ga0070699_100069549 Ga0070699_1000695495 194
97 3300005530 Ga0070679_100000635 Ga0070679_10000063521 194
98 3300005530 Ga0070679_100029497 Ga0070679_1000294975 194
99 3300005530 Ga0070679_100129230 Ga0070679_1001292304 194
100 3300005535 Ga0070684_100000654 Ga0070684_1000006548 194
101 3300005535 Ga0070684_100072416 Ga0070684_1000724162 194
102 3300005535 Ga0070684_100150442 Ga0070684_1001504423 194
103 3300005535 Ga0070684_100152941 Ga0070684_1001529413 194
104 3300005535 Ga0070684_100250259 Ga0070684_1002502592 194
105 3300005535 Ga0070684_100279931 Ga0070684_1002799313 194
106 3300005535 Ga0070684_100313461 Ga0070684_1003134612 194
107 3300005539 Ga0068853_100018364 Ga0068853_1000183644 194
108 3300005539 Ga0068853_100180149 Ga0068853_1001801492 194
109 3300005539 Ga0068853_100295941 Ga0068853_1002959412 194
110 3300005539 Ga0068853_100460320 Ga0068853_1004603201 194
111 3300005543 Ga0070672_101107578 Ga0070672_1011075782 194
112 3300005546 Ga0070696_100001772 Ga0070696_1000017724 194
113 3300005547 Ga0070693_100052188 Ga0070693_1000521883 194
114 3300005547 Ga0070693_100225284 Ga0070693_1002252842 194
115 3300005548 Ga0070665_100078224 Ga0070665_1000782242 194
116 3300005548 Ga0070665_100102784 Ga0070665_1001027843 194
117 3300005548 Ga0070665_101061086 Ga0070665_1010610862 194
118 3300005563 Ga0068855_100005921 Ga0068855_1000059219 194
119 3300005563 Ga0068855_100039960 Ga0068855_1000399603 194
120 3300005563 Ga0068855_100041567 Ga0068855_1000415673 194
121 3300005563 Ga0068855_100080897 Ga0068855_1000808973 194
122 3300005563 Ga0068855_100234432 Ga0068855_1002344321 194
123 3300005563 Ga0068855_100237672 Ga0068855_1002376723 194
124 3300005564 Ga0070664_100117700 Ga0070664_1001177003 194
125 3300005564 Ga0070664_100707240 Ga0070664_1007072402 194
126 3300005564 Ga0070664_101048227 Ga0070664_1010482272 194
127 3300005577 Ga0068857_100000367 Ga0068857_1000003679 194
128 3300005577 Ga0068857_100120196 Ga0068857_1001201963 194
129 3300005577 Ga0068857_100314205 Ga0068857_1003142053 194
130 3300005577 Ga0068857_100388523 Ga0068857_1003885232 194
131 3300005578 Ga0068854_100168051 Ga0068854_1001680512 194
132 3300005578 Ga0068854_100863546 Ga0068854_1008635462 194
133 3300005614 Ga0068856_100011813 Ga0068856_1000118139 194
134 3300005614 Ga0068856_100044788 Ga0068856_1000447882 194
135 3300005614 Ga0068856_100097316 Ga0068856_1000973163 194
136 3300005614 Ga0068856_100969365 Ga0068856_1009693651 194
137 3300005614 Ga0068856_100988726 Ga0068856_1009887261 194
138 3300005616 Ga0068852_100097280 Ga0068852_1000972804 194
139 3300005616 Ga0068852_100145279 Ga0068852_1001452793 194
140 3300005617 Ga0068859_100476169 Ga0068859_1004761692 194
141 3300005719 Ga0068861_100446064 Ga0068861_1004460642 194
142 3300005834 Ga0068851_10142813 Ga0068851_101428132 194
143 3300005834 Ga0068851_10189334 Ga0068851_101893342 194
144 3300005841 Ga0068863_100309952 Ga0068863_1003099522 194
145 3300005841 Ga0068863_100643844 Ga0068863_1006438442 194
146 3300005841 Ga0068863_101512294 Ga0068863_1015122941 194
147 3300005842 Ga0068858_100194195 Ga0068858_1001941953 194
148 3300005842 Ga0068858_100220378 Ga0068858_1002203782 194
149 3300005842 Ga0068858_101369465 Ga0068858_1013694651 194
150 3300005843 Ga0068860_100030930 Ga0068860_1000309305 194
151 3300005844 Ga0068862_100195317 Ga0068862_1001953173 194
152 3300005844 Ga0068862_101082649 Ga0068862_1010826491 194
153 3300005937 Ga0081455_10025992 Ga0081455_100259922 194
154 3300006028 Ga0070717_10002297 Ga0070717_100022974 194
155 3300006028 Ga0070717_10059120 Ga0070717_100591203 194
156 3300006028 Ga0070717_10379742 Ga0070717_103797422 194
157 3300006028 Ga0070717_10652868 Ga0070717_106528682 194
158 3300006237 Ga0097621_100090626 Ga0097621_1000906263 194
159 3300006237 Ga0097621_100587832 Ga0097621_1005878322 194
160 3300006358 Ga0068871_100013047 Ga0068871_1000130477 194
161 3300006358 Ga0068871_100032955 Ga0068871_1000329554 194
162 3300006358 Ga0068871_100096532 Ga0068871_1000965323 194
163 3300006358 Ga0068871_100096698 Ga0068871_1000966983 194
164 3300006358 Ga0068871_100252561 Ga0068871_1002525611 194
165 3300006358 Ga0068871_100518294 Ga0068871_1005182942 194
166 3300006847 Ga0075431_100077735 Ga0075431_1000777353 194
167 3300006847 Ga0075431_100081081 Ga0075431_1000810813 194
168 3300006852 Ga0075433_10613162 Ga0075433_106131622 194
169 3300006880 Ga0075429_100313515 Ga0075429_1003135152 194
170 3300006881 Ga0068865_100044873 Ga0068865_1000448732 194
171 3300006914 Ga0075436_100004678 Ga0075436_10000467810 194
172 3300006931 Ga0097620_100476190 Ga0097620_1004761902 194
173 3300007076 Ga0075435_100057482 Ga0075435_1000574823 194
174 3300007076 Ga0075435_100396863 Ga0075435_1003968632 194
175 3300007076 Ga0075435_100421943 Ga0075435_1004219432 194
176 3300009093 Ga0105240_10000137 Ga0105240_1000013722 194
177 3300009093 Ga0105240_10000725 Ga0105240_100007254 194
178 3300009093 Ga0105240_10006267 Ga0105240_1000626714 194
179 3300009093 Ga0105240_10014192 Ga0105240_100141926 194
180 3300009093 Ga0105240_10049742 Ga0105240_100497425 194
181 3300009093 Ga0105240_11596924 Ga0105240_115969241 194
182 3300009093 Ga0105240_11686691 Ga0105240_116866911 194
183 3300009098 Ga0105245_10002584 Ga0105245_1000258414 194
184 3300009098 Ga0105245_10031219 Ga0105245_100312195 194
185 3300009098 Ga0105245_10092800 Ga0105245_100928002 194
186 3300009098 Ga0105245_10441173 Ga0105245_104411732 194
187 3300009098 Ga0105245_10723661 Ga0105245_107236612 194
188 3300009147 Ga0114129_10013768 Ga0114129_100137688 194
189 3300009147 Ga0114129_10016831 Ga0114129_100168312 194
190 3300009147 Ga0114129_10207936 Ga0114129_102079363 194
191 3300009147 Ga0114129_10489668 Ga0114129_104896683 194
192 3300009147 Ga0114129_11680760 Ga0114129_116807601 194
193 3300009148 Ga0105243_10094326 Ga0105243_100943262 194
194 3300009174 Ga0105241_10052017 Ga0105241_100520173 194
195 3300009174 Ga0105241_10142579 Ga0105241_101425792 194
196 3300009174 Ga0105241_10398817 Ga0105241_103988172 194
197 3300009176 Ga0105242_10008301 Ga0105242_100083018 194
198 3300009176 Ga0105242_10037404 Ga0105242_100374043 194
199 3300009176 Ga0105242_10074164 Ga0105242_100741643 194
200 3300009176 Ga0105242_10351275 Ga0105242_103512753 194
201 3300009176 Ga0105242_10388503 Ga0105242_103885032 194
202 3300009176 Ga0105242_10669786 Ga0105242_106697862 194
203 3300009176 Ga0105242_10709865 Ga0105242_107098652 194
204 3300009176 Ga0105242_11515327 Ga0105242_115153272 194
205 3300009177 Ga0105248_10021914 Ga0105248_100219148 194
206 3300009177 Ga0105248_10051528 Ga0105248_100515283 194
207 3300009177 Ga0105248_10135318 Ga0105248_101353183 194
208 3300009177 Ga0105248_10169783 Ga0105248_101697831 194
209 3300009177 Ga0105248_12121924 Ga0105248_121219241 194
210 3300009545 Ga0105237_10011284 Ga0105237_100112843 194
211 3300009545 Ga0105237_10015643 Ga0105237_100156435 194
212 3300009545 Ga0105237_10022807 Ga0105237_100228078 194
213 3300009545 Ga0105237_10047639 Ga0105237_100476393 194
214 3300009545 Ga0105237_10135652 Ga0105237_101356523 194
215 3300009545 Ga0105237_10163191 Ga0105237_101631913 194
216 3300009545 Ga0105237_10485865 Ga0105237_104858652 194
217 3300009545 Ga0105237_10895175 Ga0105237_108951751 194
218 3300009551 Ga0105238_10027090 Ga0105238_100270904 194
219 3300009551 Ga0105238_10039789 Ga0105238_100397892 194
220 3300009551 Ga0105238_10047108 Ga0105238_100471082 194
221 3300009551 Ga0105238_10091744 Ga0105238_100917443 194
222 3300009551 Ga0105238_10094723 Ga0105238_100947233 194
223 3300009551 Ga0105238_10115494 Ga0105238_101154943 194
224 3300009551 Ga0105238_10243629 Ga0105238_102436292 194
225 3300009551 Ga0105238_10348781 Ga0105238_103487811 194
226 3300009551 Ga0105238_10364361 Ga0105238_103643611 194
227 3300009551 Ga0105238_10475469 Ga0105238_104754692 194
228 3300009551 Ga0105238_10501488 Ga0105238_105014882 194
229 3300009551 Ga0105238_11070304 Ga0105238_110703041 194
230 3300009553 Ga0105249_10166133 Ga0105249_101661333 194
231 3300009553 Ga0105249_10264232 Ga0105249_102642323 194
232 3300010375 Ga0105239_10005509 Ga0105239_1000550914 194
233 3300010375 Ga0105239_10020840 Ga0105239_100208407 194
234 3300010375 Ga0105239_10061846 Ga0105239_100618464 194
235 3300010375 Ga0105239_10101145 Ga0105239_101011452 194
236 3300011119 Ga0105246_10148180 Ga0105246_101481802 194
237 3300011119 Ga0105246_10942538 Ga0105246_109425381 194
238 3300011119 Ga0105246_10956565 Ga0105246_109565651 194
239 3300013100 Ga0157373_10354183 Ga0157373_103541832 194
240 3300013100 Ga0157373_10519418 Ga0157373_105194182 194
241 3300013102 Ga0157371_10361351 Ga0157371_103613512 194
242 3300013104 Ga0157370_10004065 Ga0157370_1000406517 194
243 3300013104 Ga0157370_10086143 Ga0157370_100861431 194
244 3300013104 Ga0157370_10244403 Ga0157370_102444033 194
245 3300013104 Ga0157370_10428937 Ga0157370_104289371 194
246 3300013104 Ga0157370_10462589 Ga0157370_104625892 194
247 3300013105 Ga0157369_10026955 Ga0157369_100269556 194
248 3300013105 Ga0157369_10133353 Ga0157369_101333532 194
249 3300013296 Ga0157374_10215332 Ga0157374_102153323 194
250 3300013296 Ga0157374_10469155 Ga0157374_104691552 194
251 3300013297 Ga0157378_10006769 Ga0157378_100067693 194
252 3300013297 Ga0157378_11660936 Ga0157378_116609361 194
253 3300013306 Ga0163162_10113990 Ga0163162_101139903 194
254 3300013306 Ga0163162_10412334 Ga0163162_104123343 194
255 3300013306 Ga0163162_10653733 Ga0163162_106537332 194
256 3300013306 Ga0163162_10792842 Ga0163162_107928422 194
257 3300013306 Ga0163162_11003167 Ga0163162_110031672 194
258 3300013306 Ga0163162_11956867 Ga0163162_119568671 194
259 3300013307 Ga0157372_10019405 Ga0157372_100194054 194
260 3300013307 Ga0157372_10050147 Ga0157372_100501474 194
261 3300013307 Ga0157372_10356181 Ga0157372_103561812 194
262 3300013307 Ga0157372_10926295 Ga0157372_109262952 194
263 3300013307 Ga0157372_10962289 Ga0157372_109622891 194
264 3300013307 Ga0157372_11719590 Ga0157372_117195902 194
265 3300013308 Ga0157375_10530500 Ga0157375_105305001 194
266 3300013308 Ga0157375_11958864 Ga0157375_119588641 194
267 3300014325 Ga0163163_10112756 Ga0163163_101127563 194
268 3300014325 Ga0163163_10169333 Ga0163163_101693333 194
269 3300014325 Ga0163163_10244900 Ga0163163_102449002 194
270 3300014325 Ga0163163_10914752 Ga0163163_109147522 194
271 3300014326 Ga0157380_10027142 Ga0157380_100271422 194
272 3300014326 Ga0157380_10028962 Ga0157380_100289623 194
273 3300014326 Ga0157380_10044968 Ga0157380_100449685 194
274 3300014326 Ga0157380_10148475 Ga0157380_101484753 194
275 3300014745 Ga0157377_10564782 Ga0157377_105647822 194
276 3300014968 Ga0157379_10789500 Ga0157379_107895002 194
277 3300014969 Ga0157376_10059844 Ga0157376_100598443 194
278 3300014969 Ga0157376_10254235 Ga0157376_102542352 194
279 3300014969 Ga0157376_10329167 Ga0157376_103291672 194
280 3300021358 Ga0213873_10031808 Ga0213873_100318082 194
281 3300021377 Ga0213874_10008846 Ga0213874_100088463 194
282 3300021384 Ga0213876_10001214 Ga0213876_1000121411 194
283 3300021384 Ga0213876_10083920 Ga0213876_100839202 194
284 3300021388 Ga0213875_10002769 Ga0213875_100027696 194
285 3300021388 Ga0213875_10006476 Ga0213875_100064765 194
286 3300021388 Ga0213875_10010188 Ga0213875_100101882 194
287 3300021388 Ga0213875_10071064 Ga0213875_100710642 194
288 3300021388 Ga0213875_10088214 Ga0213875_100882143 194
289 3300021388 Ga0213875_10089555 Ga0213875_100895553 194
290 3300021388 Ga0213875_10152047 Ga0213875_101520472 194
291 3300021441 Ga0213871_10099049 Ga0213871_100990492 194
292 3300022467 Ga0224712_10225900 Ga0224712_102259001 194
293 3300025315 Ga0207697_10001282 Ga0207697_100012828 194
294 3300025321 Ga0207656_10116763 Ga0207656_101167632 194
295 3300025901 Ga0207688_10010226 Ga0207688_100102263 194
296 3300025906 Ga0207699_10025855 Ga0207699_100258553 194
297 3300025906 Ga0207699_10203931 Ga0207699_102039311 194
298 3300025906 Ga0207699_10357970 Ga0207699_103579702 194
299 3300025909 Ga0207705_10056458 Ga0207705_100564584 194
300 3300025910 Ga0207684_10127932 Ga0207684_101279323 194
301 3300025911 Ga0207654_10045861 Ga0207654_100458612 194
302 3300025911 Ga0207654_10864630 Ga0207654_108646301 194
303 3300025912 Ga0207707_10007135 Ga0207707_100071358 194
304 3300025912 Ga0207707_10122403 Ga0207707_101224032 194
305 3300025912 Ga0207707_10128104 Ga0207707_101281043 194
306 3300025912 Ga0207707_10129369 Ga0207707_101293693 194
307 3300025913 Ga0207695_10000770 Ga0207695_1000077054 194
308 3300025913 Ga0207695_10002883 Ga0207695_100028832 194
309 3300025913 Ga0207695_10005525 Ga0207695_100055259 194
310 3300025913 Ga0207695_10012024 Ga0207695_100120248 194
311 3300025913 Ga0207695_10032450 Ga0207695_100324502 194
312 3300025913 Ga0207695_10210757 Ga0207695_102107572 194
313 3300025914 Ga0207671_10053083 Ga0207671_100530832 194
314 3300025914 Ga0207671_10136381 Ga0207671_101363813 194
315 3300025914 Ga0207671_10149982 Ga0207671_101499823 194
316 3300025916 Ga0207663_10668246 Ga0207663_106682461 194
317 3300025917 Ga0207660_11074692 Ga0207660_110746921 194
318 3300025919 Ga0207657_10230904 Ga0207657_102309042 194
319 3300025919 Ga0207657_10239693 Ga0207657_102396932 194
320 3300025920 Ga0207649_10228255 Ga0207649_102282552 194
321 3300025921 Ga0207652_10016163 Ga0207652_100161635 194
322 3300025921 Ga0207652_10147679 Ga0207652_101476792 194
323 3300025923 Ga0207681_10264114 Ga0207681_102641142 194
324 3300025924 Ga0207694_10002138 Ga0207694_1000213810 194
325 3300025924 Ga0207694_10011929 Ga0207694_100119294 194
326 3300025924 Ga0207694_10061145 Ga0207694_100611453 194
327 3300025924 Ga0207694_10137183 Ga0207694_101371833 194
328 3300025924 Ga0207694_10292997 Ga0207694_102929972 194
329 3300025924 Ga0207694_10316567 Ga0207694_103165672 194
330 3300025924 Ga0207694_10324519 Ga0207694_103245192 194
331 3300025926 Ga0207659_10000064 Ga0207659_1000006431 194
332 3300025926 Ga0207659_10079734 Ga0207659_100797341 194
333 3300025926 Ga0207659_10460799 Ga0207659_104607992 194
334 3300025927 Ga0207687_10012877 Ga0207687_100128775 194
335 3300025927 Ga0207687_10043361 Ga0207687_100433611 194
336 3300025927 Ga0207687_10053985 Ga0207687_100539851 194
337 3300025927 Ga0207687_10160729 Ga0207687_101607292 194
338 3300025928 Ga0207700_10039457 Ga0207700_100394572 194
339 3300025928 Ga0207700_10041486 Ga0207700_100414864 194
340 3300025928 Ga0207700_10079503 Ga0207700_100795034 194
341 3300025929 Ga0207664_10027284 Ga0207664_100272843 194
342 3300025929 Ga0207664_10119110 Ga0207664_101191103 194
343 3300025931 Ga0207644_10138078 Ga0207644_101380782 194
344 3300025931 Ga0207644_10561460 Ga0207644_105614602 194
345 3300025931 Ga0207644_10582099 Ga0207644_105820992 194
346 3300025932 Ga0207690_10273408 Ga0207690_102734082 194
347 3300025933 Ga0207706_10038266 Ga0207706_100382663 194
348 3300025933 Ga0207706_10371621 Ga0207706_103716212 194
349 3300025934 Ga0207686_10002152 Ga0207686_100021526 194
350 3300025934 Ga0207686_10054128 Ga0207686_100541282 194
351 3300025934 Ga0207686_10055571 Ga0207686_100555713 194
352 3300025934 Ga0207686_10086326 Ga0207686_100863262 194
353 3300025934 Ga0207686_10465737 Ga0207686_104657372 194
354 3300025935 Ga0207709_10233308 Ga0207709_102333082 194
355 3300025936 Ga0207670_10211326 Ga0207670_102113263 194
356 3300025936 Ga0207670_10327409 Ga0207670_103274092 194
357 3300025937 Ga0207669_10478367 Ga0207669_104783672 194
358 3300025937 Ga0207669_10601611 Ga0207669_106016112 194
359 3300025938 Ga0207704_10067906 Ga0207704_100679062 194
360 3300025939 Ga0207665_10548819 Ga0207665_105488192 194
361 3300025941 Ga0207711_10057026 Ga0207711_100570263 194
362 3300025941 Ga0207711_10058775 Ga0207711_100587754 194
363 3300025941 Ga0207711_10062940 Ga0207711_100629403 194
364 3300025942 Ga0207689_10014043 Ga0207689_100140433 194
365 3300025942 Ga0207689_10066220 Ga0207689_100662203 194
366 3300025944 Ga0207661_10008190 Ga0207661_100081905 194
367 3300025944 Ga0207661_10020313 Ga0207661_100203132 194
368 3300025944 Ga0207661_10034465 Ga0207661_100344654 194
369 3300025944 Ga0207661_10171746 Ga0207661_101717462 194
370 3300025944 Ga0207661_10234084 Ga0207661_102340842 194
371 3300025944 Ga0207661_10273605 Ga0207661_102736052 194
372 3300025944 Ga0207661_10992637 Ga0207661_109926372 194
373 3300025945 Ga0207679_10030495 Ga0207679_100304954 194
374 3300025949 Ga0207667_10001168 Ga0207667_1000116828 194
375 3300025949 Ga0207667_10002566 Ga0207667_1000256622 194
376 3300025949 Ga0207667_10083019 Ga0207667_100830193 194
377 3300025960 Ga0207651_10002909 Ga0207651_100029094 194
378 3300025960 Ga0207651_10247509 Ga0207651_102475092 194
379 3300025960 Ga0207651_10375388 Ga0207651_103753882 194
380 3300025961 Ga0207712_10029296 Ga0207712_100292963 194
381 3300025981 Ga0207640_10510639 Ga0207640_105106392 194
382 3300026023 Ga0207677_10368856 Ga0207677_103688562 194
383 3300026035 Ga0207703_10162311 Ga0207703_101623113 194
384 3300026035 Ga0207703_10689738 Ga0207703_106897382 194
385 3300026041 Ga0207639_10204673 Ga0207639_102046732 194
386 3300026041 Ga0207639_10257951 Ga0207639_102579513 194
387 3300026041 Ga0207639_10605982 Ga0207639_106059822 194
388 3300026075 Ga0207708_10065842 Ga0207708_100658422 194
389 3300026075 Ga0207708_10153111 Ga0207708_101531112 194
390 3300026078 Ga0207702_10015048 Ga0207702_100150484 194
391 3300026078 Ga0207702_10066986 Ga0207702_100669863 194
392 3300026078 Ga0207702_10680981 Ga0207702_106809812 194
393 3300026088 Ga0207641_10467193 Ga0207641_104671932 194
394 3300026089 Ga0207648_10278070 Ga0207648_102780702 194
395 3300026089 Ga0207648_10684417 Ga0207648_106844171 194
396 3300026089 Ga0207648_10772281 Ga0207648_107722811 194
397 3300026089 Ga0207648_10839716 Ga0207648_108397161 194
398 3300026095 Ga0207676_10205587 Ga0207676_102055872 194
399 3300026095 Ga0207676_10383972 Ga0207676_103839722 194
400 3300026116 Ga0207674_10000166 Ga0207674_1000016668 194
401 3300026116 Ga0207674_10158407 Ga0207674_101584073 194
402 3300026116 Ga0207674_10521358 Ga0207674_105213582 194
403 3300026118 Ga0207675_100007871 Ga0207675_1000078713 194
404 3300026121 Ga0207683_10067010 Ga0207683_100670103 194
405 3300026121 Ga0207683_10295213 Ga0207683_102952131 194
406 3300026142 Ga0207698_10185000 Ga0207698_101850003 194
407 3300026142 Ga0207698_10217328 Ga0207698_102173283 194
408 3300026142 Ga0207698_11058134 Ga0207698_110581341 194
409 3300028379 Ga0268266_11063237 Ga0268266_110632372 194
410 3300028380 Ga0268265_10295874 Ga0268265_102958742 194
411 3300028380 Ga0268265_11113616 Ga0268265_111136161 194
412 3300028381 Ga0268264_10009037 Ga0268264_100090375 194
413 3300028653 Ga0265323_10001994 Ga0265323_1000199411 194
414 3300031090 Ga0265760_10219868 Ga0265760_102198681 194
415 3300031240 Ga0265320_10001179 Ga0265320_100011797 194
416 3300031241 Ga0265325_10003125 Ga0265325_100031252 194
417 3300031241 Ga0265325_10012734 Ga0265325_100127341 194
418 3300031247 Ga0265340_10022045 Ga0265340_100220454 194
419 3300031250 Ga0265331_10069063 Ga0265331_100690632 194
420 3300031344 Ga0265316_10001444 Ga0265316_1000144413 194
421 3300031344 Ga0265316_10004197 Ga0265316_100041979 194
422 3300031344 Ga0265316_10118693 Ga0265316_101186933 194
423 3300031344 Ga0265316_10245706 Ga0265316_102457062 194
424 3300031344 Ga0265316_10444213 Ga0265316_104442132 194
425 3300031548 Ga0307408_100007941 Ga0307408_1000079413 194
426 3300031548 Ga0307408_100016620 Ga0307408_1000166202 194
427 3300031595 Ga0265313_10027055 Ga0265313_100270553 194
428 3300031711 Ga0265314_10000282 Ga0265314_1000028254 194
429 3300031711 Ga0265314_10025644 Ga0265314_100256445 194
430 3300031711 Ga0265314_10089002 Ga0265314_100890023 194
431 3300031712 Ga0265342_10049765 Ga0265342_100497652 194
432 3300031731 Ga0307405_10013982 Ga0307405_100139825 194
433 3300031731 Ga0307405_10336380 Ga0307405_103363801 194
434 3300031901 Ga0307406_10233116 Ga0307406_102331162 194
435 3300031901 Ga0307406_10455426 Ga0307406_104554262 194
436 3300031903 Ga0307407_10146428 Ga0307407_101464282 194
437 3300031911 Ga0307412_10352083 Ga0307412_103520832 194
438 3300031911 Ga0307412_10406641 Ga0307412_104066412 194
439 3300031911 Ga0307412_10562196 Ga0307412_105621961 194
440 3300031995 Ga0307409_100024156 Ga0307409_1000241565 194
441 3300031995 Ga0307409_100033309 Ga0307409_1000333092 194
442 3300031995 Ga0307409_100387479 Ga0307409_1003874792 194
443 3300031995 Ga0307409_100965143 Ga0307409_1009651432 194
444 3300032002 Ga0307416_100009691 Ga0307416_1000096913 194
445 3300032002 Ga0307416_100198348 Ga0307416_1001983482 194
446 3300032002 Ga0307416_100367049 Ga0307416_1003670492 194
447 3300032002 Ga0307416_100765140 Ga0307416_1007651402 194
448 3300032002 Ga0307416_101171400 Ga0307416_1011714002 194
449 3300032004 Ga0307414_10669985 Ga0307414_106699852 194
450 3300032005 Ga0307411_10005955 Ga0307411_100059552 194
451 3300032005 Ga0307411_10287175 Ga0307411_102871752 194
452 3300032005 Ga0307411_10843652 Ga0307411_108436521 194
453 3300032126 Ga0307415_100511887 Ga0307415_1005118872 194
454 3300032126 Ga0307415_100801156 Ga0307415_1008011562 194
455 3300035083 Ga0373926_0066528 Ga0373926_0066528_368_955 194
456 3300035086 Ga0373934_0001945 Ga0373934_0001945_491_1078 194
457 3300035086 Ga0373934_0137732 Ga0373934_0137732_274_861 194
458 3300035111 Ga0373923_0274862 Ga0373923_0274862_130_717 194
459 3300035111 Ga0373923_0360644 Ga0373923_0360644_33_620 194
460 3300035117 Ga0373953_0135848 Ga0373953_0135848_130_717 194
461 3300035118 Ga0373954_0001726 Ga0373954_0001726_4430_5017 194
462 3300035118 Ga0373954_0004906 Ga0373954_0004906_4391_4978 194
463 3300035119 Ga0373956_0020307 Ga0373956_0020307_602_1189 194
464 3300035119 Ga0373956_0075491 Ga0373956_0075491_85_672 194
465 3300035120 Ga0373957_0012652 Ga0373957_0012652_1027_1614 194
466 3300035121 Ga0373960_0115612 Ga0373960_0115612_54_641 194
467 3300035171 Ga0373946_0038006 Ga0373946_0038006_1105_1692 194
468 3300035172 Ga0373955_0056036 Ga0373955_0056036_670_1257 194
469 3300035172 Ga0373955_0133431 Ga0373955_0133431_443_1030 194
470 3300035172 Ga0373955_0217186 Ga0373955_0217186_373_960 194
471 3300035172 Ga0373955_0235734 Ga0373955_0235734_166_753 194
472 3300035410 Ga0373924_0240676 Ga0373924_0240676_109_696 194
473 3300035692 Ga0373935_0044795 Ga0373935_0044795_96_683 194
474 3300035692 Ga0373935_0116314 Ga0373935_0116314_365_952 194
475 3300035695 Ga0373927_0000498 Ga0373927_0000498_12450_13037 194
476 3300035695 Ga0373927_0002081 Ga0373927_0002081_6744_7331 194
477 3300035695 Ga0373927_0007350 Ga0373927_0007350_4723_5310 194
478 3300035695 Ga0373927_0042674 Ga0373927_0042674_1600_2187 194
479 3300035724 Ga0373933_0128788 Ga0373933_0128788_467_1054 194
480 3300035724 Ga0373933_0183833 Ga0373933_0183833_50_637 194
481 3300035725 Ga0373947_0001083 Ga0373947_0001083_3596_4183 194
482 3300035725 Ga0373947_0021389 Ga0373947_0021389_42_629 194
483 3300036401 Ga0373937_0017647 Ga0373937_0017647_1624_2211 194
484 3300036401 Ga0373937_0061324 Ga0373937_0061324_2512_3099 194
485 3300036401 Ga0373937_0084305 Ga0373937_0084305_2275_2862 194
486 3300036401 Ga0373937_0089365 Ga0373937_0089365_2136_2723 194
487 3300036401 Ga0373937_0323934 Ga0373937_0323934_754_1341 194
488 3300036401 Ga0373937_0387906 Ga0373937_0387906_657_1244 194
489 3300036401 Ga0373937_0418446 Ga0373937_0418446_492_1079 194
490 3300036401 Ga0373937_0459359 Ga0373937_0459359_385_972 194
491 3300036401 Ga0373937_0747975 Ga0373937_0747975_192_779 194
492 3300037068 Ga0373925_0000281 Ga0373925_0000281_36381_36968 194
493 3300037068 Ga0373925_0119629 Ga0373925_0119629_188_775 194
494 3300037068 Ga0373925_0160195 Ga0373925_0160195_1028_1615 194
495 3300037068 Ga0373925_0231751 Ga0373925_0231751_595_1182 194
496 3300037068 Ga0373925_0248232 Ga0373925_0248232_612_1199 194
497 3300037068 Ga0373925_0266953 Ga0373925_0266953_759_1346 194
498 3300037068 Ga0373925_0626934 Ga0373925_0626934_213_800 194
499 3300037853 Ga0436364_0062454 Ga0436364_0062454_885_1472 194
500 3300037853 Ga0436364_0298586 Ga0436364_0298586_3199_3786 194
501 3300037853 Ga0436364_0349717 Ga0436364_0349717_1390_1977 194
502 3300037853 Ga0436364_0365940 Ga0436364_0365940_1737_2324 194
503 3300037853 Ga0436364_0509131 Ga0436364_0509131_1299_1886 194
504 3300037853 Ga0436364_0555496 Ga0436364_0555496_536_1123 194
505 3300037853 Ga0436364_0618208 Ga0436364_0618208_15_602 194
506 3300037853 Ga0436364_0633516 Ga0436364_0633516_20966_21553 194
507 3300037853 Ga0436364_0674901 Ga0436364_0674901_1000_1587 194
508 3300037853 Ga0436364_0818237 Ga0436364_0818237_1745_2332 194
509 3300037853 Ga0436364_0835808 Ga0436364_0835808_237_824 194
510 3300037853 Ga0436364_0991276 Ga0436364_0991276_786_1373 194
511 3300037853 Ga0436364_1046318 Ga0436364_1046318_1199_1786 194
512 3300037853 Ga0436364_1080095 Ga0436364_1080095_616_1203 194
513 3300037853 Ga0436364_1193035 Ga0436364_1193035_5547_6134 194
514 3300038443 Ga0395901_0142089 Ga0395901_0142089_931_1518 194
515 3300039437 Ga0436365_0082371 Ga0436365_0082371_584_1171 194
516 3300039437 Ga0436365_0344744 Ga0436365_0344744_8928_9515 194
517 3300039437 Ga0436365_0512169 Ga0436365_0512169_1024_1611 194
518 3300039437 Ga0436365_0650674 Ga0436365_0650674_3331_3918 194
519 3300039437 Ga0436365_1778817 Ga0436365_1778817_8314_8901 194
520 3300039438 Ga0436360_0580543 Ga0436360_0580543_6377_6964 194
521 3300039438 Ga0436360_0677337 Ga0436360_0677337_267_854 194
522 3300039438 Ga0436360_0882145 Ga0436360_0882145_281_868 194
523 3300039447 Ga0436361_0793152 Ga0436361_0793152_10537_11124 194
524 3300039447 Ga0436361_1149713 Ga0436361_1149713_1717_2304 194
525 3300039450 Ga0436363_0651938 Ga0436363_0651938_64_651 194
526 3300039450 Ga0436363_0673922 Ga0436363_0673922_120_707 194
527 3300039450 Ga0436363_0858902 Ga0436363_0858902_725_1312 194
528 3300039450 Ga0436363_1297791 Ga0436363_1297791_2589_3176 194
529 3300039450 Ga0436363_1382872 Ga0436363_1382872_64_651 194
530 3300039450 Ga0436363_1694135 Ga0436363_1694135_346_933 194
531 3300039453 Ga0436362_0701537 Ga0436362_0701537_12_599 194
532 3300039453 Ga0436362_0890342 Ga0436362_0890342_1578_2165 194
533 3300042011 Ga0439454_012362 Ga0439454_012362_45_632 194
534 3300042122 Ga0450920_027248 Ga0450920_027248_100_687 194
535 3300042156 Ga0439446_0046055 Ga0439446_0046055_349_936 194
536 3300042435 Ga0439434_0067418 Ga0439434_0067418_52_639 194
537 3300042461 Ga0439460_0057087 Ga0439460_0057087_340_927 194
538 3300042530 Ga0450916_012289 Ga0450916_012289_435_1022 194
539 3300044684 Ga0466966_0113650 Ga0466966_0113650_98_685 194
540 3300044694 Ga0466963_0178329 Ga0466963_0178329_537_1124 194
541 3300044694 Ga0466963_0525925 Ga0466963_0525925_139_726 194
542 3300045051 Ga0451576_0229180 Ga0451576_0229180_17_604 194
543 3300046454 Ga0495592_0059402 Ga0495592_0059402_123_710 194
544 3300046455 Ga0495603_0117581 Ga0495603_0117581_871_1458 194
545 3300046462 Ga0495651_0002965 Ga0495651_0002965_3441_4028 194
546 3300046462 Ga0495651_0211998 Ga0495651_0211998_551_1138 194
547 3300046462 Ga0495651_0365259 Ga0495651_0365259_270_857 194
548 3300046472 Ga0495580_0014096 Ga0495580_0014096_844_1431 194
549 3300046472 Ga0495580_0073689 Ga0495580_0073689_1498_2085 194
550 3300046472 Ga0495580_0103321 Ga0495580_0103321_399_986 194
551 3300046472 Ga0495580_0146563 Ga0495580_0146563_900_1487 194
552 3300046472 Ga0495580_0205857 Ga0495580_0205857_663_1250 194
553 3300046472 Ga0495580_0375568 Ga0495580_0375568_191_778 194
554 3300046473 Ga0495582_0092109 Ga0495582_0092109_384_971 194
555 3300046473 Ga0495582_0352007 Ga0495582_0352007_156_743 194
556 3300046475 Ga0495639_0224658 Ga0495639_0224658_10_597 194
557 3300046477 Ga0495664_0087302 Ga0495664_0087302_190_777 194
558 3300046477 Ga0495664_0164764 Ga0495664_0164764_373_960 194
559 3300046477 Ga0495664_0208754 Ga0495664_0208754_251_838 194
560 3300046477 Ga0495664_0385348 Ga0495664_0385348_136_723 194
561 3300046511 Ga0495608_0423284 Ga0495608_0423284_157_744 194
562 3300046529 Ga0495652_0036329 Ga0495652_0036329_1993_2580 194
563 3300046529 Ga0495652_0116086 Ga0495652_0116086_188_775 194
564 3300046531 Ga0495665_0139085 Ga0495665_0139085_553_1140 194
565 3300046531 Ga0495665_0338815 Ga0495665_0338815_139_726 194
566 3300046536 Ga0495587_0006862 Ga0495587_0006862_3818_4405 194
567 3300046536 Ga0495587_0423880 Ga0495587_0423880_85_672 194
568 3300046543 Ga0495645_0019007 Ga0495645_0019007_2695_3282 194
569 3300046543 Ga0495645_0209763 Ga0495645_0209763_147_734 194
570 3300046543 Ga0495645_0281329 Ga0495645_0281329_380_967 194
571 3300046543 Ga0495645_0298586 Ga0495645_0298586_268_855 194
572 3300046543 Ga0495645_0301265 Ga0495645_0301265_284_871 194
573 3300046543 Ga0495645_0349397 Ga0495645_0349397_18_605 194
574 3300046558 Ga0495633_0271185 Ga0495633_0271185_112_699 194
575 3300046559 Ga0495667_0081241 Ga0495667_0081241_1067_1654 194
576 3300046663 Ga0495635_0047094 Ga0495635_0047094_241_828 194
577 3300046663 Ga0495635_0160477 Ga0495635_0160477_837_1424 194
578 3300046663 Ga0495635_0181987 Ga0495635_0181987_374_961 194
579 3300046678 Ga0495599_0003371 Ga0495599_0003371_7720_8307 194
580 3300046678 Ga0495599_0063543 Ga0495599_0063543_749_1336 194
581 3300046678 Ga0495599_0081458 Ga0495599_0081458_393_980 194
582 3300046678 Ga0495599_0521714 Ga0495599_0521714_42_629 194
583 3300046679 Ga0495623_0207215 Ga0495623_0207215_290_877 194
584 3300046679 Ga0495623_0306250 Ga0495623_0306250_76_663 194
585 3300046680 Ga0495646_0208377 Ga0495646_0208377_342_929 194
586 3300046681 Ga0495647_0146881 Ga0495647_0146881_96_683 194
587 3300046683 Ga0495658_0277003 Ga0495658_0277003_351_938 194
588 3300046683 Ga0495658_0564125 Ga0495658_0564125_130_717 194
589 3300046683 Ga0495658_0700151 Ga0495658_0700151_43_630 194
590 3300047317 Ga0495604_0060748 Ga0495604_0060748_226_813 194
591 3300047317 Ga0495604_0186718 Ga0495604_0186718_422_1009 194
592 3300047319 Ga0495674_0077054 Ga0495674_0077054_2069_2656 194
593 3300047319 Ga0495674_0083109 Ga0495674_0083109_770_1357 194
594 3300047444 Ga0495675_0288190 Ga0495675_0288190_363_950 194
595 3300047471 Ga0495684_0005866 Ga0495684_0005866_7648_8235 194
596 3300047471 Ga0495684_0094188 Ga0495684_0094188_1405_1992 194
597 3300047471 Ga0495684_0104527 Ga0495684_0104527_160_747 194
598 3300047471 Ga0495684_0112073 Ga0495684_0112073_1352_1939 194
599 3300047471 Ga0495684_0113952 Ga0495684_0113952_899_1486 194
600 3300047471 Ga0495684_0246229 Ga0495684_0246229_20_607 194
601 3300047471 Ga0495684_0278866 Ga0495684_0278866_279_866 194
602 3300048088 Ga0495602_0012640 Ga0495602_0012640_1738_2325 194
603 3300048088 Ga0495602_0043456 Ga0495602_0043456_1333_1920 194
604 3300048907 Ga0496104_0085600 Ga0496104_0085600_186_773 194
605 3300048907 Ga0496104_0745116 Ga0496104_0745116_165_752 194
606 3300048909 Ga0496106_0164867 Ga0496106_0164867_158_745 194
607 3300048915 Ga0496112_0169095 Ga0496112_0169095_1004_1591 194
608 3300048917 Ga0496114_0267889 Ga0496114_0267889_131_718 194
609 3300048918 Ga0496115_0144934 Ga0496115_0144934_605_1192 194
610 3300048918 Ga0496115_0190661 Ga0496115_0190661_1045_1632 194
611 3300049514 Ga0501291_003827 Ga0501291_003827_197_784 194
612 3300049514 Ga0501291_007243 Ga0501291_007243_630_1217 194
613 3300049521 Ga0501298_016445 Ga0501298_016445_27_614 194
614 3300049568 Ga0501031_0020202 Ga0501031_0020202_1273_1860 194
615 3300049569 Ga0501032_0001366 Ga0501032_0001366_5598_6185 194
616 3300049570 Ga0501033_0015134 Ga0501033_0015134_1961_2548 194
617 3300049571 Ga0501034_0026807 Ga0501034_0026807_4599_5186 194
618 3300049572 Ga0501036_0001154 Ga0501036_0001154_6542_7129 194
619 3300049572 Ga0501036_0063750 Ga0501036_0063750_2340_2927 194
620 3300049573 Ga0501037_0005354 Ga0501037_0005354_3306_3893 194
621 3300049574 Ga0501038_0000838 Ga0501038_0000838_20790_21377 194
622 3300049574 Ga0501038_0188613 Ga0501038_0188613_590_1177 194
623 3300049574 Ga0501038_0273276 Ga0501038_0273276_82_669 194
624 3300049575 Ga0501039_0005534 Ga0501039_0005534_6775_7362 194
625 3300049575 Ga0501039_0118927 Ga0501039_0118927_585_1172 194
626 3300049576 Ga0501040_0085853 Ga0501040_0085853_1065_1652 194
627 3300049576 Ga0501040_0467044 Ga0501040_0467044_82_669 194
628 3300049578 Ga0501042_0027614 Ga0501042_0027614_993_1580 194
629 3300049579 Ga0501043_0031914 Ga0501043_0031914_2407_2994 194
630 3300049579 Ga0501043_0513089 Ga0501043_0513089_219_806 194
631 3300049580 Ga0501046_0026841 Ga0501046_0026841_3805_4392 194
632 3300049580 Ga0501046_0138773 Ga0501046_0138773_890_1477 194
633 3300049580 Ga0501046_0351759 Ga0501046_0351759_457_1044 194
634 3300049581 Ga0501047_0064494 Ga0501047_0064494_2486_3073 194
635 3300049581 Ga0501047_0226882 Ga0501047_0226882_637_1224 194
636 3300049582 Ga0501048_0026632 Ga0501048_0026632_1220_1807 194
637 3300049582 Ga0501048_0106806 Ga0501048_0106806_193_780 194
638 3300049583 Ga0501067_0033450 Ga0501067_0033450_305_892 194
639 3300049584 Ga0501068_0001809 Ga0501068_0001809_4781_5368 194
640 3300049585 Ga0501069_0011896 Ga0501069_0011896_1163_1750 194
641 3300049586 Ga0501070_0018049 Ga0501070_0018049_2012_2599 194
642 3300049586 Ga0501070_0065536 Ga0501070_0065536_460_1047 194
643 3300049586 Ga0501070_0200056 Ga0501070_0200056_495_1082 194
644 3300049588 Ga0501072_0003019 Ga0501072_0003019_4599_5186 194
645 3300049588 Ga0501072_0084843 Ga0501072_0084843_1249_1836 194
646 3300049589 Ga0501073_0001367 Ga0501073_0001367_1477_2064 194
647 3300049589 Ga0501073_0167321 Ga0501073_0167321_893_1480 194
648 3300049590 Ga0501074_0010960 Ga0501074_0010960_305_892 194
649 3300049591 Ga0501075_0211629 Ga0501075_0211629_777_1364 194
650 3300049591 Ga0501075_0611791 Ga0501075_0611791_136_723 194
651 3300049591 Ga0501075_0832920 Ga0501075_0832920_102_689 194
652 3300049592 Ga0501076_0120849 Ga0501076_0120849_1293_1880 194
653 3300049593 Ga0501077_0018748 Ga0501077_0018748_1131_1718 194
654 3300049652 Ga0501202_032463 Ga0501202_032463_80_667 194
655 3300049668 Ga0501233_075282 Ga0501233_075282_150_737 194
656 3300049675 Ga0501243_059450 Ga0501243_059450_59_646 194
657 3300049679 Ga0501249_014980 Ga0501249_014980_1017_1604 194
658 3300049741 Ga0501079_0009365 Ga0501079_0009365_5562_6149 194
659 3300049742 Ga0501080_0000243 Ga0501080_0000243_15398_15985 194
660 3300049743 Ga0501081_0060120 Ga0501081_0060120_439_1026 194
661 3300049743 Ga0501081_0224102 Ga0501081_0224102_739_1326 194
662 3300049743 Ga0501081_0283204 Ga0501081_0283204_67_654 194
663 3300049744 Ga0501083_0004506 Ga0501083_0004506_1833_2420 194
664 3300049779 Ga0501283_022383 Ga0501283_022383_68_655 194
665 3300049822 Ga0501035_0081046 Ga0501035_0081046_1146_1733 194
666 3300049822 Ga0501035_0242560 Ga0501035_0242560_285_872 194
667 3300049822 Ga0501035_0658421 Ga0501035_0658421_130_717 194
668 3300049823 Ga0501044_0001257 Ga0501044_0001257_7558_8145 194
669 3300049823 Ga0501044_0014994 Ga0501044_0014994_7081_7668 194
670 3300049823 Ga0501044_0033042 Ga0501044_0033042_2685_3272 194
671 3300049823 Ga0501044_0085577 Ga0501044_0085577_460_1047 194
672 3300049824 Ga0501045_0053881 Ga0501045_0053881_168_755 194
673 3300049824 Ga0501045_0781592 Ga0501045_0781592_21_608 194
674 3300050494 nmdc:mga06z11_262520_c1 nmdc:mga06z11_262520_c1_36_623 194
675 3300050507 nmdc:mga05p37_1080949_c1 nmdc:mga05p37_1080949_c1_65_652 194
676 3300050507 nmdc:mga05p37_171260_c1 nmdc:mga05p37_171260_c1_1460_2047 194
677 3300050510 nmdc:mga06r32_77979_c1 nmdc:mga06r32_77979_c1_758_1345 194
678 3300050510 nmdc:mga06r32_7934_c1 nmdc:mga06r32_7934_c1_6441_7028 194
679 3300050512 nmdc:mga0n895_18663_c1 nmdc:mga0n895_18663_c1_2158_2745 194
680 3300050513 nmdc:mga0rr50_7227_c1 nmdc:mga0rr50_7227_c1_716_1303 194
681 3300050514 nmdc:mga08x19_128473_c1 nmdc:mga08x19_128473_c1_444_1031 194
682 3300050515 nmdc:mga0a205_49577_c1 nmdc:mga0a205_49577_c1_2216_2803 194
683 3300053085 Ga0495619_0191817 Ga0495619_0191817_349_936 194
684 3300054114 Ga0501084_0000227 Ga0501084_0000227_37643_38230 194
685 3300054114 Ga0501084_0114826 Ga0501084_0114826_150_737 194
686 3300054114 Ga0501084_0155670 Ga0501084_0155670_664_1251 194
687 3300054114 Ga0501084_0174185 Ga0501084_0174185_186_773 194
688 3300060353 Ga0501082_0000199 Ga0501082_0000199_31430_32017 194
689 3300060353 Ga0501082_0131626 Ga0501082_0131626_1124_1711 194
690 3300060353 Ga0501082_0457589 Ga0501082_0457589_11_598 194
691 3300061734 Ga0530510_0285840 Ga0530510_0285840_476_1063 194
692 3300005327 Ga0070658_10009861 Ga0070658_100098619 195
693 3300005329 Ga0070683_100084842 Ga0070683_1000848423 195
694 3300005335 Ga0070666_10016581 Ga0070666_100165815 195
695 3300005336 Ga0070680_100376931 Ga0070680_1003769312 195
696 3300005336 Ga0070680_101083871 Ga0070680_1010838711 195
697 3300005338 Ga0068868_100011009 Ga0068868_1000110095 195
698 3300005338 Ga0068868_100169117 Ga0068868_1001691173 195
699 3300005339 Ga0070660_100007244 Ga0070660_1000072447 195
700 3300005355 Ga0070671_100036440 Ga0070671_1000364404 195
701 3300005367 Ga0070667_100013784 Ga0070667_1000137844 195
702 3300005367 Ga0070667_100150934 Ga0070667_1001509342 195
703 3300005458 Ga0070681_10109201 Ga0070681_101092012 195
704 3300005458 Ga0070681_10166064 Ga0070681_101660641 195
705 3300005458 Ga0070681_10304575 Ga0070681_103045752 195
706 3300005459 Ga0068867_100009631 Ga0068867_1000096317 195
707 3300005530 Ga0070679_100109888 Ga0070679_1001098883 195
708 3300005539 Ga0068853_100623125 Ga0068853_1006231252 195
709 3300005548 Ga0070665_100084437 Ga0070665_1000844373 195
710 3300005548 Ga0070665_100098208 Ga0070665_1000982082 195
711 3300005548 Ga0070665_100170827 Ga0070665_1001708273 195
712 3300005563 Ga0068855_100003676 Ga0068855_10000367610 195
713 3300005563 Ga0068855_100017587 Ga0068855_1000175874 195
714 3300005563 Ga0068855_100159886 Ga0068855_1001598862 195
715 3300005577 Ga0068857_100009431 Ga0068857_1000094318 195
716 3300005577 Ga0068857_100027469 Ga0068857_1000274693 195
717 3300005614 Ga0068856_100146605 Ga0068856_1001466052 195
718 3300005616 Ga0068852_100044205 Ga0068852_1000442056 195
719 3300005617 Ga0068859_100057516 Ga0068859_1000575163 195
720 3300005618 Ga0068864_100172999 Ga0068864_1001729991 195
721 3300005618 Ga0068864_100517583 Ga0068864_1005175832 195
722 3300005834 Ga0068851_10151590 Ga0068851_101515901 195
723 3300005842 Ga0068858_100060055 Ga0068858_1000600553 195
724 3300005842 Ga0068858_100073787 Ga0068858_1000737874 195
725 3300005843 Ga0068860_100008416 Ga0068860_1000084168 195
726 3300006237 Ga0097621_100087349 Ga0097621_1000873492 195
727 3300006237 Ga0097621_100198007 Ga0097621_1001980072 195
728 3300006358 Ga0068871_100086558 Ga0068871_1000865584 195
729 3300006358 Ga0068871_100099782 Ga0068871_1000997822 195
730 3300006881 Ga0068865_100036885 Ga0068865_1000368853 195
731 3300006931 Ga0097620_100057515 Ga0097620_1000575153 195
732 3300009093 Ga0105240_10008603 Ga0105240_100086039 195
733 3300009093 Ga0105240_10561268 Ga0105240_105612681 195
734 3300009093 Ga0105240_10575124 Ga0105240_105751242 195
735 3300009093 Ga0105240_10821146 Ga0105240_108211462 195
736 3300009093 Ga0105240_10973917 Ga0105240_109739172 195
737 3300009093 Ga0105240_11515547 Ga0105240_115155471 195
738 3300009094 Ga0111539_10000937 Ga0111539_1000093731 195
739 3300009098 Ga0105245_10122005 Ga0105245_101220051 195
740 3300009098 Ga0105245_10143630 Ga0105245_101436302 195
741 3300009098 Ga0105245_10192564 Ga0105245_101925642 195
742 3300009101 Ga0105247_10036932 Ga0105247_100369323 195
743 3300009101 Ga0105247_10081730 Ga0105247_100817302 195
744 3300009101 Ga0105247_10381386 Ga0105247_103813862 195
745 3300009174 Ga0105241_10011127 Ga0105241_100111276 195
746 3300009174 Ga0105241_10081489 Ga0105241_100814892 195
747 3300009174 Ga0105241_10098267 Ga0105241_100982672 195
748 3300009174 Ga0105241_10326669 Ga0105241_103266692 195
749 3300009174 Ga0105241_10347029 Ga0105241_103470292 195
750 3300009176 Ga0105242_10055620 Ga0105242_100556203 195
751 3300009176 Ga0105242_10057510 Ga0105242_100575103 195
752 3300009176 Ga0105242_11368909 Ga0105242_113689092 195
753 3300009177 Ga0105248_10015334 Ga0105248_100153343 195
754 3300009177 Ga0105248_10058795 Ga0105248_100587953 195
755 3300009545 Ga0105237_10076113 Ga0105237_100761133 195
756 3300009545 Ga0105237_10296008 Ga0105237_102960082 195
757 3300009551 Ga0105238_10003531 Ga0105238_100035318 195
758 3300009551 Ga0105238_10038115 Ga0105238_100381153 195
759 3300009551 Ga0105238_10087883 Ga0105238_100878834 195
760 3300010375 Ga0105239_10009505 Ga0105239_100095059 195
761 3300010375 Ga0105239_10019116 Ga0105239_100191163 195
762 3300011119 Ga0105246_10053857 Ga0105246_100538574 195
763 3300013104 Ga0157370_10023653 Ga0157370_100236536 195
764 3300013104 Ga0157370_10056344 Ga0157370_100563444 195
765 3300013104 Ga0157370_10167543 Ga0157370_101675432 195
766 3300013105 Ga0157369_10070995 Ga0157369_100709953 195
767 3300013105 Ga0157369_10267773 Ga0157369_102677732 195
768 3300013296 Ga0157374_10019090 Ga0157374_100190907 195
769 3300013296 Ga0157374_10300801 Ga0157374_103008012 195
770 3300013296 Ga0157374_10536445 Ga0157374_105364452 195
771 3300013296 Ga0157374_10536464 Ga0157374_105364642 195
772 3300013297 Ga0157378_10119552 Ga0157378_101195521 195
773 3300013297 Ga0157378_10234682 Ga0157378_102346822 195
774 3300013306 Ga0163162_10009244 Ga0163162_100092445 195
775 3300013306 Ga0163162_11553556 Ga0163162_115535561 195
776 3300013307 Ga0157372_10023620 Ga0157372_100236202 195
777 3300013307 Ga0157372_10045493 Ga0157372_100454932 195
778 3300013308 Ga0157375_10117140 Ga0157375_101171404 195
779 3300013308 Ga0157375_10222753 Ga0157375_102227533 195
780 3300014325 Ga0163163_10033602 Ga0163163_100336023 195
781 3300014325 Ga0163163_10039812 Ga0163163_100398122 195
782 3300014325 Ga0163163_10149270 Ga0163163_101492703 195
783 3300014968 Ga0157379_11285073 Ga0157379_112850731 195
784 3300014969 Ga0157376_10010690 Ga0157376_100106907 195
785 3300025321 Ga0207656_10231557 Ga0207656_102315572 195
786 3300025903 Ga0207680_10155269 Ga0207680_101552692 195
787 3300025906 Ga0207699_10141254 Ga0207699_101412543 195
788 3300025908 Ga0207643_10079229 Ga0207643_100792292 195
789 3300025909 Ga0207705_10009074 Ga0207705_100090745 195
790 3300025911 Ga0207654_10007778 Ga0207654_100077784 195
791 3300025911 Ga0207654_10040135 Ga0207654_100401352 195
792 3300025912 Ga0207707_10023281 Ga0207707_100232813 195
793 3300025912 Ga0207707_10329341 Ga0207707_103293412 195
794 3300025912 Ga0207707_10482139 Ga0207707_104821392 195
795 3300025912 Ga0207707_10955132 Ga0207707_109551321 195
796 3300025913 Ga0207695_10009314 Ga0207695_100093149 195
797 3300025913 Ga0207695_10022417 Ga0207695_100224174 195
798 3300025913 Ga0207695_10307166 Ga0207695_103071662 195
799 3300025914 Ga0207671_10424851 Ga0207671_104248512 195
800 3300025917 Ga0207660_10187192 Ga0207660_101871922 195
801 3300025917 Ga0207660_10628553 Ga0207660_106285531 195
802 3300025919 Ga0207657_10007163 Ga0207657_1000716310 195
803 3300025921 Ga0207652_10080761 Ga0207652_100807613 195
804 3300025924 Ga0207694_10079285 Ga0207694_100792854 195
805 3300025927 Ga0207687_10094021 Ga0207687_100940212 195
806 3300025927 Ga0207687_10145721 Ga0207687_101457212 195
807 3300025927 Ga0207687_10376574 Ga0207687_103765742 195
808 3300025934 Ga0207686_10002620 Ga0207686_100026206 195
809 3300025934 Ga0207686_10005323 Ga0207686_100053236 195
810 3300025938 Ga0207704_10004043 Ga0207704_100040437 195
811 3300025939 Ga0207665_10358373 Ga0207665_103583732 195
812 3300025941 Ga0207711_10488516 Ga0207711_104885161 195
813 3300025944 Ga0207661_10116924 Ga0207661_101169242 195
814 3300025949 Ga0207667_10008741 Ga0207667_100087418 195
815 3300025949 Ga0207667_10042580 Ga0207667_100425804 195
816 3300025949 Ga0207667_10444800 Ga0207667_104448002 195
817 3300025949 Ga0207667_10591880 Ga0207667_105918802 195
818 3300025986 Ga0207658_10023883 Ga0207658_100238832 195
819 3300025986 Ga0207658_10124428 Ga0207658_101244282 195
820 3300026023 Ga0207677_10095049 Ga0207677_100950492 195
821 3300026035 Ga0207703_10009334 Ga0207703_100093343 195
822 3300026035 Ga0207703_10049412 Ga0207703_100494124 195
823 3300026041 Ga0207639_10073035 Ga0207639_100730354 195
824 3300026041 Ga0207639_10951875 Ga0207639_109518752 195
825 3300026078 Ga0207702_10055899 Ga0207702_100558993 195
826 3300026078 Ga0207702_10444450 Ga0207702_104444502 195
827 3300026089 Ga0207648_10010408 Ga0207648_100104087 195
828 3300026095 Ga0207676_10066179 Ga0207676_100661791 195
829 3300026095 Ga0207676_10409678 Ga0207676_104096782 195
830 3300026116 Ga0207674_10035376 Ga0207674_100353763 195
831 3300026116 Ga0207674_10065120 Ga0207674_100651203 195
832 3300026142 Ga0207698_10044678 Ga0207698_100446785 195
833 3300026142 Ga0207698_11681131 Ga0207698_116811311 195
834 3300027907 Ga0207428_10001370 Ga0207428_1000137011 195
835 3300028379 Ga0268266_10061402 Ga0268266_100614024 195
836 3300028379 Ga0268266_10306151 Ga0268266_103061511 195
837 3300028381 Ga0268264_10243591 Ga0268264_102435912 195
838 3300028381 Ga0268264_10420460 Ga0268264_104204602 195
839 3300028800 Ga0265338_10137740 Ga0265338_101377402 195
840 3300031711 Ga0265314_10000961 Ga0265314_100009615 195
841 3300035170 Ga0373943_0316264 Ga0373943_0316264_256_849 195
842 3300035725 Ga0373947_0013876 Ga0373947_0013876_3760_4353 195
843 3300037068 Ga0373925_0036609 Ga0373925_0036609_2495_3088 195
844 3300039453 Ga0436362_0155526 Ga0436362_0155526_58_660 195
845 3300046472 Ga0495580_0408976 Ga0495580_0408976_95_691 195
846 3300046473 Ga0495582_0201521 Ga0495582_0201521_515_1108 195
847 3300047319 Ga0495674_0320258 Ga0495674_0320258_629_1222 195
848 3300049570 Ga0501033_0206514 Ga0501033_0206514_466_1053 195
849 3300049575 Ga0501039_0052695 Ga0501039_0052695_1763_2350 195
850 3300049576 Ga0501040_0020549 Ga0501040_0020549_1193_1780 195
851 3300049578 Ga0501042_0005920 Ga0501042_0005920_5105_5692 195
852 3300049588 Ga0501072_0198084 Ga0501072_0198084_129_716 195
853 3300049592 Ga0501076_0035470 Ga0501076_0035470_2623_3210 195
854 3300049741 Ga0501079_0049621 Ga0501079_0049621_715_1302 195
855 3300049742 Ga0501080_0210814 Ga0501080_0210814_1063_1650 195
856 3300049824 Ga0501045_0706923 Ga0501045_0706923_67_654 195
857 3300050511 nmdc:mga08y16_743_c1 nmdc:mga08y16_743_c1_24425_25012 195
858 3300054114 Ga0501084_0081371 Ga0501084_0081371_655_1242 195
859 3300060353 Ga0501082_0004396 Ga0501082_0004396_10429_11016 195
860 2162886007 SwRhRL2b_contig_3236978 SwRhRL2b_0518.00005990 196
861 2162886007 SwRhRL2b_contig_3825395 SwRhRL2b_0119.00006180 196
862 3300003203 JGI25406J46586_10000210 JGI25406J46586_1000021017 196
863 3300003203 JGI25406J46586_10001441 JGI25406J46586_100014415 196
864 3300005288 Ga0065714_10125624 Ga0065714_101256242 196
865 3300005289 Ga0065704_10075134 Ga0065704_100751343 196
866 3300005290 Ga0065712_10018271 Ga0065712_100182716 196
867 3300005290 Ga0065712_10321009 Ga0065712_103210092 196
868 3300005293 Ga0065715_10262856 Ga0065715_102628561 196
869 3300005293 Ga0065715_10443124 Ga0065715_104431242 196
870 3300005293 Ga0065715_10505586 Ga0065715_105055862 196
871 3300005295 Ga0065707_10001927 Ga0065707_100019274 196
872 3300005295 Ga0065707_10084472 Ga0065707_100844724 196
873 3300005295 Ga0065707_10157109 Ga0065707_101571093 196
874 3300005295 Ga0065707_10381309 Ga0065707_103813092 196
875 3300005328 Ga0070676_10006282 Ga0070676_100062826 196
876 3300005330 Ga0070690_100249108 Ga0070690_1002491082 196
877 3300005331 Ga0070670_100004900 Ga0070670_10000490010 196
878 3300005331 Ga0070670_100030977 Ga0070670_1000309774 196
879 3300005331 Ga0070670_100087327 Ga0070670_1000873271 196
880 3300005331 Ga0070670_100157927 Ga0070670_1001579273 196
881 3300005333 Ga0070677_10001462 Ga0070677_100014624 196
882 3300005333 Ga0070677_10039601 Ga0070677_100396013 196
883 3300005333 Ga0070677_10076161 Ga0070677_100761612 196
884 3300005333 Ga0070677_10078642 Ga0070677_100786422 196
885 3300005333 Ga0070677_10164098 Ga0070677_101640981 196
886 3300005334 Ga0068869_100042368 Ga0068869_1000423683 196
887 3300005334 Ga0068869_100082871 Ga0068869_1000828713 196
888 3300005334 Ga0068869_100153391 Ga0068869_1001533912 196
889 3300005335 Ga0070666_10024914 Ga0070666_100249144 196
890 3300005335 Ga0070666_10055207 Ga0070666_100552072 196
891 3300005336 Ga0070680_100058199 Ga0070680_1000581993 196
892 3300005338 Ga0068868_100062155 Ga0068868_1000621553 196
893 3300005338 Ga0068868_100488350 Ga0068868_1004883502 196
894 3300005340 Ga0070689_100005732 Ga0070689_1000057323 196
895 3300005340 Ga0070689_100065829 Ga0070689_1000658294 196
896 3300005340 Ga0070689_100103680 Ga0070689_1001036802 196
897 3300005340 Ga0070689_100683925 Ga0070689_1006839252 196
898 3300005343 Ga0070687_100236648 Ga0070687_1002366481 196
899 3300005347 Ga0070668_100026632 Ga0070668_1000266323 196
900 3300005353 Ga0070669_100008311 Ga0070669_1000083113 196
901 3300005353 Ga0070669_100118006 Ga0070669_1001180062 196
902 3300005353 Ga0070669_100156307 Ga0070669_1001563072 196
903 3300005353 Ga0070669_100175803 Ga0070669_1001758032 196
904 3300005353 Ga0070669_100209938 Ga0070669_1002099382 196
905 3300005354 Ga0070675_100001421 Ga0070675_10000142116 196
906 3300005354 Ga0070675_100004051 Ga0070675_1000040515 196
907 3300005354 Ga0070675_100010384 Ga0070675_1000103846 196
908 3300005354 Ga0070675_100030804 Ga0070675_1000308043 196
909 3300005354 Ga0070675_100610400 Ga0070675_1006104002 196
910 3300005356 Ga0070674_100000382 Ga0070674_1000003824 196
911 3300005356 Ga0070674_100008990 Ga0070674_1000089907 196
912 3300005356 Ga0070674_100013039 Ga0070674_1000130392 196
913 3300005364 Ga0070673_100008003 Ga0070673_1000080034 196
914 3300005364 Ga0070673_100060396 Ga0070673_1000603964 196
915 3300005364 Ga0070673_100097279 Ga0070673_1000972792 196
916 3300005364 Ga0070673_100118062 Ga0070673_1001180622 196
917 3300005365 Ga0070688_100006025 Ga0070688_1000060256 196
918 3300005365 Ga0070688_100187499 Ga0070688_1001874992 196
919 3300005366 Ga0070659_100723373 Ga0070659_1007233732 196
920 3300005366 Ga0070659_101276334 Ga0070659_1012763341 196
921 3300005406 Ga0070703_10041178 Ga0070703_100411782 196
922 3300005438 Ga0070701_10070914 Ga0070701_100709143 196
923 3300005440 Ga0070705_100000746 Ga0070705_1000007469 196
924 3300005440 Ga0070705_100281217 Ga0070705_1002812172 196
925 3300005441 Ga0070700_100016825 Ga0070700_1000168253 196
926 3300005441 Ga0070700_100016870 Ga0070700_1000168702 196
927 3300005444 Ga0070694_100000370 Ga0070694_10000037011 196
928 3300005444 Ga0070694_100071340 Ga0070694_1000713401 196
929 3300005444 Ga0070694_100427146 Ga0070694_1004271462 196
930 3300005445 Ga0070708_100702172 Ga0070708_1007021722 196
931 3300005455 Ga0070663_100312321 Ga0070663_1003123211 196
932 3300005456 Ga0070678_100007020 Ga0070678_1000070205 196
933 3300005456 Ga0070678_100064945 Ga0070678_1000649452 196
934 3300005456 Ga0070678_100102194 Ga0070678_1001021942 196
935 3300005456 Ga0070678_100139745 Ga0070678_1001397452 196
936 3300005457 Ga0070662_100055147 Ga0070662_1000551472 196
937 3300005457 Ga0070662_100252293 Ga0070662_1002522932 196
938 3300005459 Ga0068867_100008687 Ga0068867_1000086877 196
939 3300005459 Ga0068867_100026117 Ga0068867_1000261173 196
940 3300005459 Ga0068867_100450981 Ga0068867_1004509811 196
941 3300005466 Ga0070685_10014872 Ga0070685_100148723 196
942 3300005466 Ga0070685_10112749 Ga0070685_101127492 196
943 3300005466 Ga0070685_10543851 Ga0070685_105438512 196
944 3300005468 Ga0070707_100149785 Ga0070707_1001497852 196
945 3300005471 Ga0070698_100170431 Ga0070698_1001704312 196
946 3300005471 Ga0070698_100804955 Ga0070698_1008049552 196
947 3300005518 Ga0070699_100006431 Ga0070699_10000643111 196
948 3300005518 Ga0070699_100018067 Ga0070699_1000180672 196
949 3300005518 Ga0070699_100018848 Ga0070699_1000188483 196
950 3300005536 Ga0070697_100014204 Ga0070697_1000142043 196
951 3300005536 Ga0070697_100156129 Ga0070697_1001561293 196
952 3300005543 Ga0070672_100008378 Ga0070672_1000083783 196
953 3300005543 Ga0070672_100134809 Ga0070672_1001348092 196
954 3300005543 Ga0070672_100145010 Ga0070672_1001450103 196
955 3300005543 Ga0070672_100154689 Ga0070672_1001546892 196
956 3300005543 Ga0070672_100279497 Ga0070672_1002794972 196
957 3300005543 Ga0070672_100371158 Ga0070672_1003711582 196
958 3300005544 Ga0070686_100204013 Ga0070686_1002040132 196
959 3300005544 Ga0070686_100209399 Ga0070686_1002093992 196
960 3300005544 Ga0070686_100238683 Ga0070686_1002386831 196
961 3300005545 Ga0070695_100000707 Ga0070695_1000007073 196
962 3300005546 Ga0070696_100000965 Ga0070696_10000096516 196
963 3300005548 Ga0070665_100024814 Ga0070665_1000248145 196
964 3300005549 Ga0070704_100041318 Ga0070704_1000413183 196
965 3300005549 Ga0070704_100085381 Ga0070704_1000853813 196
966 3300005549 Ga0070704_100171290 Ga0070704_1001712902 196
967 3300005564 Ga0070664_100007187 Ga0070664_1000071871 196
968 3300005564 Ga0070664_100017828 Ga0070664_1000178285 196
969 3300005577 Ga0068857_100033257 Ga0068857_1000332573 196
970 3300005577 Ga0068857_100175980 Ga0068857_1001759802 196
971 3300005577 Ga0068857_100486453 Ga0068857_1004864532 196
972 3300005615 Ga0070702_100010489 Ga0070702_1000104892 196
973 3300005615 Ga0070702_100461343 Ga0070702_1004613431 196
974 3300005617 Ga0068859_100017287 Ga0068859_1000172873 196
975 3300005617 Ga0068859_100038291 Ga0068859_1000382914 196
976 3300005617 Ga0068859_100419971 Ga0068859_1004199713 196
977 3300005617 Ga0068859_100863079 Ga0068859_1008630792 196
978 3300005618 Ga0068864_100045866 Ga0068864_1000458665 196
979 3300005618 Ga0068864_100054532 Ga0068864_1000545322 196
980 3300005618 Ga0068864_100197203 Ga0068864_1001972032 196
981 3300005618 Ga0068864_100216991 Ga0068864_1002169912 196
982 3300005618 Ga0068864_100232359 Ga0068864_1002323592 196
983 3300005618 Ga0068864_100299541 Ga0068864_1002995412 196
984 3300005718 Ga0068866_10418329 Ga0068866_104183292 196
985 3300005719 Ga0068861_100024564 Ga0068861_1000245643 196
986 3300005719 Ga0068861_100116117 Ga0068861_1001161172 196
987 3300005719 Ga0068861_100168397 Ga0068861_1001683972 196
988 3300005719 Ga0068861_100319788 Ga0068861_1003197882 196
989 3300005834 Ga0068851_10020670 Ga0068851_100206703 196
990 3300005840 Ga0068870_10001437 Ga0068870_100014378 196
991 3300005840 Ga0068870_10007144 Ga0068870_100071446 196
992 3300005842 Ga0068858_100054923 Ga0068858_1000549232 196
993 3300005842 Ga0068858_100057133 Ga0068858_1000571333 196
994 3300005842 Ga0068858_100130329 Ga0068858_1001303293 196
995 3300005843 Ga0068860_100064152 Ga0068860_1000641523 196
996 3300005844 Ga0068862_100001194 Ga0068862_10000119414 196
997 3300005844 Ga0068862_100092822 Ga0068862_1000928222 196
998 3300005844 Ga0068862_100301161 Ga0068862_1003011612 196
999 3300005981 Ga0081538_10112503 Ga0081538_101125032 196
1000 3300005985 Ga0081539_10000093 Ga0081539_1000009356 196
1001 3300005985 Ga0081539_10000535 Ga0081539_1000053547 196
1002 3300005985 Ga0081539_10004525 Ga0081539_100045252 196
1003 3300005985 Ga0081539_10032394 Ga0081539_100323945 196
1004 3300006051 Ga0075364_10396187 Ga0075364_103961871 196
1005 3300006237 Ga0097621_100008977 Ga0097621_1000089776 196
1006 3300006237 Ga0097621_100222910 Ga0097621_1002229102 196
1007 3300006237 Ga0097621_100714379 Ga0097621_1007143792 196
1008 3300006844 Ga0075428_100001298 Ga0075428_1000012988 196
1009 3300006844 Ga0075428_100018128 Ga0075428_1000181286 196
1010 3300006844 Ga0075428_100039791 Ga0075428_1000397914 196
1011 3300006844 Ga0075428_100066193 Ga0075428_1000661934 196
1012 3300006844 Ga0075428_101038833 Ga0075428_1010388331 196
1013 3300006846 Ga0075430_100079986 Ga0075430_1000799863 196
1014 3300006846 Ga0075430_100099521 Ga0075430_1000995212 196
1015 3300006846 Ga0075430_100131196 Ga0075430_1001311963 196
1016 3300006846 Ga0075430_100245136 Ga0075430_1002451362 196
1017 3300006846 Ga0075430_100268739 Ga0075430_1002687392 196
1018 3300006847 Ga0075431_100016348 Ga0075431_1000163482 196
1019 3300006847 Ga0075431_100017673 Ga0075431_1000176737 196
1020 3300006847 Ga0075431_100026579 Ga0075431_1000265792 196
1021 3300006847 Ga0075431_100152881 Ga0075431_1001528812 196
1022 3300006852 Ga0075433_10001626 Ga0075433_100016263 196
1023 3300006852 Ga0075433_10003294 Ga0075433_1000329411 196
1024 3300006852 Ga0075433_10004362 Ga0075433_100043626 196
1025 3300006852 Ga0075433_10062970 Ga0075433_100629702 196
1026 3300006852 Ga0075433_10195765 Ga0075433_101957653 196
1027 3300006852 Ga0075433_10686973 Ga0075433_106869732 196
1028 3300006871 Ga0075434_100007857 Ga0075434_1000078577 196
1029 3300006871 Ga0075434_100009480 Ga0075434_1000094803 196
1030 3300006871 Ga0075434_100037878 Ga0075434_1000378783 196
1031 3300006871 Ga0075434_100074269 Ga0075434_1000742693 196
1032 3300006871 Ga0075434_100335194 Ga0075434_1003351942 196
1033 3300006880 Ga0075429_100058130 Ga0075429_1000581303 196
1034 3300006880 Ga0075429_100077576 Ga0075429_1000775763 196
1035 3300006880 Ga0075429_100140751 Ga0075429_1001407512 196
1036 3300006880 Ga0075429_100195061 Ga0075429_1001950612 196
1037 3300006880 Ga0075429_100361761 Ga0075429_1003617612 196
1038 3300006931 Ga0097620_100017287 Ga0097620_1000172873 196
1039 3300006931 Ga0097620_100038292 Ga0097620_1000382924 196
1040 3300006931 Ga0097620_100419969 Ga0097620_1004199693 196
1041 3300006931 Ga0097620_100863073 Ga0097620_1008630732 196
1042 3300007076 Ga0075435_100005103 Ga0075435_1000051039 196
1043 3300007076 Ga0075435_100033031 Ga0075435_1000330313 196
1044 3300009094 Ga0111539_10012890 Ga0111539_1001289010 196
1045 3300009094 Ga0111539_10018172 Ga0111539_100181722 196
1046 3300009094 Ga0111539_10025633 Ga0111539_100256338 196
1047 3300009094 Ga0111539_10057520 Ga0111539_100575203 196
1048 3300009094 Ga0111539_10184728 Ga0111539_101847283 196
1049 3300009094 Ga0111539_11505010 Ga0111539_115050102 196
1050 3300009098 Ga0105245_10481719 Ga0105245_104817192 196
1051 3300009147 Ga0114129_10000428 Ga0114129_1000042824 196
1052 3300009147 Ga0114129_10012760 Ga0114129_100127609 196
1053 3300009147 Ga0114129_10017625 Ga0114129_100176259 196
1054 3300009147 Ga0114129_10060488 Ga0114129_100604884 196
1055 3300009147 Ga0114129_10082295 Ga0114129_100822952 196
1056 3300009147 Ga0114129_10178069 Ga0114129_101780695 196
1057 3300009147 Ga0114129_10426391 Ga0114129_104263912 196
1058 3300009147 Ga0114129_10483657 Ga0114129_104836573 196
1059 3300009147 Ga0114129_10625396 Ga0114129_106253962 196
1060 3300009148 Ga0105243_10094586 Ga0105243_100945861 196
1061 3300009177 Ga0105248_10038535 Ga0105248_100385355 196
1062 3300009177 Ga0105248_10247604 Ga0105248_102476043 196
1063 3300009177 Ga0105248_11615924 Ga0105248_116159241 196
1064 3300009545 Ga0105237_11266348 Ga0105237_112663482 196
1065 3300009551 Ga0105238_10194410 Ga0105238_101944102 196
1066 3300009553 Ga0105249_10001435 Ga0105249_1000143515 196
1067 3300009553 Ga0105249_10025302 Ga0105249_100253025 196
1068 3300013297 Ga0157378_10294620 Ga0157378_102946202 196
1069 3300013306 Ga0163162_10056855 Ga0163162_100568552 196
1070 3300013308 Ga0157375_10027796 Ga0157375_100277966 196
1071 3300013308 Ga0157375_10057570 Ga0157375_100575703 196
1072 3300013308 Ga0157375_11333136 Ga0157375_113331362 196
1073 3300014325 Ga0163163_10037531 Ga0163163_100375312 196
1074 3300014325 Ga0163163_10057030 Ga0163163_100570303 196
1075 3300014325 Ga0163163_10130349 Ga0163163_101303492 196
1076 3300014325 Ga0163163_10147461 Ga0163163_101474612 196
1077 3300014326 Ga0157380_10007797 Ga0157380_100077974 196
1078 3300014326 Ga0157380_10009711 Ga0157380_100097117 196
1079 3300014326 Ga0157380_10010846 Ga0157380_100108464 196
1080 3300014326 Ga0157380_10258555 Ga0157380_102585552 196
1081 3300014326 Ga0157380_10400869 Ga0157380_104008692 196
1082 3300014745 Ga0157377_10017096 Ga0157377_100170964 196
1083 3300014745 Ga0157377_10089282 Ga0157377_100892822 196
1084 3300014745 Ga0157377_10157863 Ga0157377_101578633 196
1085 3300014745 Ga0157377_10626905 Ga0157377_106269051 196
1086 3300014968 Ga0157379_10053964 Ga0157379_100539644 196
1087 3300017792 Ga0163161_10158763 Ga0163161_101587632 196
1088 3300025321 Ga0207656_10009659 Ga0207656_100096593 196
1089 3300025893 Ga0207682_10000378 Ga0207682_1000037815 196
1090 3300025893 Ga0207682_10018854 Ga0207682_100188541 196
1091 3300025893 Ga0207682_10020419 Ga0207682_100204192 196
1092 3300025893 Ga0207682_10025631 Ga0207682_100256312 196
1093 3300025901 Ga0207688_10000628 Ga0207688_100006284 196
1094 3300025901 Ga0207688_10064495 Ga0207688_100644952 196
1095 3300025903 Ga0207680_10151867 Ga0207680_101518672 196
1096 3300025907 Ga0207645_10001911 Ga0207645_100019119 196
1097 3300025907 Ga0207645_10161032 Ga0207645_101610322 196
1098 3300025907 Ga0207645_10324054 Ga0207645_103240542 196
1099 3300025908 Ga0207643_10000925 Ga0207643_1000092514 196
1100 3300025908 Ga0207643_10059446 Ga0207643_100594462 196
1101 3300025908 Ga0207643_10542749 Ga0207643_105427492 196
1102 3300025917 Ga0207660_10083025 Ga0207660_100830252 196
1103 3300025918 Ga0207662_10009608 Ga0207662_100096086 196
1104 3300025918 Ga0207662_10018372 Ga0207662_100183724 196
1105 3300025918 Ga0207662_10029781 Ga0207662_100297813 196
1106 3300025923 Ga0207681_10046098 Ga0207681_100460982 196
1107 3300025923 Ga0207681_10108455 Ga0207681_101084553 196
1108 3300025923 Ga0207681_10125365 Ga0207681_101253652 196
1109 3300025923 Ga0207681_10179122 Ga0207681_101791222 196
1110 3300025923 Ga0207681_10593950 Ga0207681_105939502 196
1111 3300025924 Ga0207694_10044456 Ga0207694_100444562 196
1112 3300025925 Ga0207650_10001613 Ga0207650_100016135 196
1113 3300025925 Ga0207650_10024950 Ga0207650_100249502 196
1114 3300025925 Ga0207650_10066823 Ga0207650_100668233 196
1115 3300025925 Ga0207650_10111038 Ga0207650_101110383 196
1116 3300025925 Ga0207650_10490652 Ga0207650_104906522 196
1117 3300025926 Ga0207659_10000228 Ga0207659_1000022835 196
1118 3300025926 Ga0207659_10004292 Ga0207659_100042925 196
1119 3300025926 Ga0207659_10005992 Ga0207659_100059926 196
1120 3300025926 Ga0207659_10012850 Ga0207659_100128504 196
1121 3300025926 Ga0207659_10034223 Ga0207659_100342234 196
1122 3300025926 Ga0207659_10036318 Ga0207659_100363183 196
1123 3300025926 Ga0207659_10065120 Ga0207659_100651203 196
1124 3300025926 Ga0207659_10230452 Ga0207659_102304522 196
1125 3300025926 Ga0207659_10235648 Ga0207659_102356482 196
1126 3300025926 Ga0207659_10515366 Ga0207659_105153662 196
1127 3300025931 Ga0207644_10337395 Ga0207644_103373952 196
1128 3300025932 Ga0207690_10621099 Ga0207690_106210992 196
1129 3300025933 Ga0207706_10191644 Ga0207706_101916443 196
1130 3300025934 Ga0207686_10421072 Ga0207686_104210722 196
1131 3300025935 Ga0207709_10019269 Ga0207709_100192693 196
1132 3300025935 Ga0207709_10027336 Ga0207709_100273362 196
1133 3300025936 Ga0207670_10004170 Ga0207670_100041704 196
1134 3300025936 Ga0207670_10071424 Ga0207670_100714242 196
1135 3300025936 Ga0207670_10535541 Ga0207670_105355412 196
1136 3300025937 Ga0207669_10000517 Ga0207669_1000051712 196
1137 3300025937 Ga0207669_10004725 Ga0207669_100047252 196
1138 3300025937 Ga0207669_10098920 Ga0207669_100989202 196
1139 3300025937 Ga0207669_10424911 Ga0207669_104249112 196
1140 3300025938 Ga0207704_10006783 Ga0207704_100067833 196
1141 3300025938 Ga0207704_10195005 Ga0207704_101950053 196
1142 3300025940 Ga0207691_10005381 Ga0207691_1000538111 196
1143 3300025940 Ga0207691_10023122 Ga0207691_100231223 196
1144 3300025940 Ga0207691_10025557 Ga0207691_100255574 196
1145 3300025940 Ga0207691_10043378 Ga0207691_100433783 196
1146 3300025940 Ga0207691_10167524 Ga0207691_101675242 196
1147 3300025940 Ga0207691_10250137 Ga0207691_102501372 196
1148 3300025940 Ga0207691_10263906 Ga0207691_102639062 196
1149 3300025940 Ga0207691_10326462 Ga0207691_103264622 196
1150 3300025941 Ga0207711_10330763 Ga0207711_103307632 196
1151 3300025942 Ga0207689_10005493 Ga0207689_1000549313 196
1152 3300025942 Ga0207689_10073568 Ga0207689_100735683 196
1153 3300025942 Ga0207689_10182689 Ga0207689_101826892 196
1154 3300025942 Ga0207689_10201284 Ga0207689_102012842 196
1155 3300025942 Ga0207689_10212500 Ga0207689_102125003 196
1156 3300025945 Ga0207679_10056076 Ga0207679_100560762 196
1157 3300025960 Ga0207651_10038468 Ga0207651_100384683 196
1158 3300025960 Ga0207651_10134430 Ga0207651_101344303 196
1159 3300025960 Ga0207651_10230893 Ga0207651_102308932 196
1160 3300025960 Ga0207651_10256499 Ga0207651_102564992 196
1161 3300025961 Ga0207712_10020945 Ga0207712_100209453 196
1162 3300025961 Ga0207712_10239193 Ga0207712_102391932 196
1163 3300025961 Ga0207712_10616317 Ga0207712_106163172 196
1164 3300025972 Ga0207668_10026763 Ga0207668_100267633 196
1165 3300025981 Ga0207640_10349165 Ga0207640_103491652 196
1166 3300025986 Ga0207658_10068874 Ga0207658_100688743 196
1167 3300026023 Ga0207677_10439843 Ga0207677_104398432 196
1168 3300026035 Ga0207703_10009949 Ga0207703_100099496 196
1169 3300026035 Ga0207703_10184905 Ga0207703_101849052 196
1170 3300026067 Ga0207678_10303308 Ga0207678_103033082 196
1171 3300026075 Ga0207708_10026932 Ga0207708_100269324 196
1172 3300026075 Ga0207708_10043189 Ga0207708_100431893 196
1173 3300026089 Ga0207648_10000163 Ga0207648_1000016341 196
1174 3300026089 Ga0207648_10005974 Ga0207648_1000597410 196
1175 3300026089 Ga0207648_10013761 Ga0207648_100137617 196
1176 3300026089 Ga0207648_10066022 Ga0207648_100660223 196
1177 3300026089 Ga0207648_10110545 Ga0207648_101105454 196
1178 3300026089 Ga0207648_10120681 Ga0207648_101206812 196
1179 3300026089 Ga0207648_10493976 Ga0207648_104939761 196
1180 3300026089 Ga0207648_10495649 Ga0207648_104956492 196
1181 3300026095 Ga0207676_10112821 Ga0207676_101128213 196
1182 3300026095 Ga0207676_10182371 Ga0207676_101823712 196
1183 3300026095 Ga0207676_10254592 Ga0207676_102545922 196
1184 3300026095 Ga0207676_10882436 Ga0207676_108824362 196
1185 3300026116 Ga0207674_10030026 Ga0207674_100300263 196
1186 3300026116 Ga0207674_10346522 Ga0207674_103465222 196
1187 3300026116 Ga0207674_10618213 Ga0207674_106182132 196
1188 3300026116 Ga0207674_10709974 Ga0207674_107099742 196
1189 3300026118 Ga0207675_100157346 Ga0207675_1001573462 196
1190 3300026118 Ga0207675_100177235 Ga0207675_1001772353 196
1191 3300026118 Ga0207675_100207046 Ga0207675_1002070462 196
1192 3300026121 Ga0207683_10018406 Ga0207683_100184064 196
1193 3300026121 Ga0207683_10078532 Ga0207683_100785323 196
1194 3300026121 Ga0207683_10106347 Ga0207683_101063472 196
1195 3300026121 Ga0207683_10108233 Ga0207683_101082332 196
1196 3300026121 Ga0207683_10545968 Ga0207683_105459682 196
1197 3300027876 Ga0209974_10027219 Ga0209974_100272192 196
1198 3300027907 Ga0207428_10001377 Ga0207428_1000137712 196
1199 3300027907 Ga0207428_10003130 Ga0207428_1000313012 196
1200 3300027907 Ga0207428_10072291 Ga0207428_100722913 196
1201 3300027907 Ga0207428_10188549 Ga0207428_101885492 196
1202 3300028379 Ga0268266_10070582 Ga0268266_100705823 196
1203 3300028379 Ga0268266_10372573 Ga0268266_103725732 196
1204 3300028380 Ga0268265_10023143 Ga0268265_100231434 196
1205 3300028380 Ga0268265_10089292 Ga0268265_100892922 196
1206 3300028380 Ga0268265_10231499 Ga0268265_102314993 196
1207 3300028380 Ga0268265_10557409 Ga0268265_105574091 196
1208 3300028381 Ga0268264_10003737 Ga0268264_1000373713 196
1209 3300028381 Ga0268264_10483648 Ga0268264_104836482 196
1210 3300031824 Ga0307413_10366244 Ga0307413_103662442 196
1211 3300031852 Ga0307410_10141551 Ga0307410_101415512 196
1212 3300031911 Ga0307412_10177391 Ga0307412_101773912 196
1213 3300031995 Ga0307409_100412144 Ga0307409_1004121442 196
1214 3300032002 Ga0307416_100034952 Ga0307416_1000349522 196
1215 3300032002 Ga0307416_100258351 Ga0307416_1002583511 196
1216 3300032002 Ga0307416_101678148 Ga0307416_1016781481 196
1217 3300032004 Ga0307414_10367557 Ga0307414_103675572 196
1218 3300032004 Ga0307414_11061783 Ga0307414_110617832 196
1219 3300032005 Ga0307411_10016736 Ga0307411_100167364 196
1220 3300032005 Ga0307411_10168931 Ga0307411_101689312 196
1221 3300032005 Ga0307411_10306516 Ga0307411_103065162 196
1222 3300034818 Ga0373950_0029730 Ga0373950_0029730_53_649 196
1223 3300034957 Ga0373938_0035448 Ga0373938_0035448_210_806 196
1224 3300035088 Ga0373940_0005259 Ga0373940_0005259_1433_2029 196
1225 3300035090 Ga0373949_0035044 Ga0373949_0035044_62_658 196
1226 3300035112 Ga0373932_0053834 Ga0373932_0053834_178_774 196
1227 3300035114 Ga0373939_0010404 Ga0373939_0010404_1591_2187 196
1228 3300035121 Ga0373960_0012930 Ga0373960_0012930_738_1328 196
1229 3300035121 Ga0373960_0207769 Ga0373960_0207769_30_620 196
1230 3300035241 Ga0373961_0083350 Ga0373961_0083350_336_932 196
1231 3300035691 Ga0373931_0078914 Ga0373931_0078914_259_849 196
1232 3300037853 Ga0436364_1295092 Ga0436364_1295092_836_1447 196
1233 3300041509 Ga0451843_0968640 Ga0451843_0968640_252_869 196
1234 3300042184 Ga0450908_015851 Ga0450908_015851_469_1059 196
1235 3300042436 Ga0439435_0015984 Ga0439435_0015984_1252_1842 196
1236 3300042437 Ga0439444_0007370 Ga0439444_0007370_992_1582 196
1237 3300042530 Ga0450916_005898 Ga0450916_005898_387_977 196
1238 3300042993 Ga0439440_0043722 Ga0439440_0043722_165_767 196
1239 3300044673 Ga0453683_0672215 Ga0453683_0672215_24_614 196
1240 3300045051 Ga0451576_0048913 Ga0451576_0048913_3229_3825 196
1241 3300046455 Ga0495603_0101562 Ga0495603_0101562_618_1226 196
1242 3300046455 Ga0495603_0140246 Ga0495603_0140246_564_1154 196
1243 3300046472 Ga0495580_0339995 Ga0495580_0339995_382_972 196
1244 3300046499 Ga0495594_0004891 Ga0495594_0004891_4743_5333 196
1245 3300046499 Ga0495594_0114077 Ga0495594_0114077_450_1058 196
1246 3300046522 Ga0495643_0003489 Ga0495643_0003489_911_1522 196
1247 3300046525 Ga0495663_0203336 Ga0495663_0203336_50_640 196
1248 3300046526 Ga0495666_0096729 Ga0495666_0096729_700_1290 196
1249 3300046539 Ga0495621_0020422 Ga0495621_0020422_628_1218 196
1250 3300046539 Ga0495621_0270016 Ga0495621_0270016_55_672 196
1251 3300046615 Ga0495656_0075421 Ga0495656_0075421_447_1043 196
1252 3300046664 Ga0495659_0036011 Ga0495659_0036011_441_1031 196
1253 3300046674 Ga0495588_0030217 Ga0495588_0030217_1478_2068 196
1254 3300047318 Ga0495636_0037685 Ga0495636_0037685_389_979 196
1255 3300047318 Ga0495636_0065943 Ga0495636_0065943_580_1170 196
1256 3300048913 Ga0496110_0339636 Ga0496110_0339636_740_1330 196
1257 3300048916 Ga0496113_0205790 Ga0496113_0205790_401_991 196
1258 3300049572 Ga0501036_0081431 Ga0501036_0081431_1637_2239 196
1259 3300049572 Ga0501036_0244084 Ga0501036_0244084_346_966 196
1260 3300049575 Ga0501039_0030051 Ga0501039_0030051_156_758 196
1261 3300049576 Ga0501040_0682928 Ga0501040_0682928_113_712 196
1262 3300049577 Ga0501041_0019686 Ga0501041_0019686_2060_2662 196
1263 3300049578 Ga0501042_0018389 Ga0501042_0018389_1867_2469 196
1264 3300049579 Ga0501043_0067928 Ga0501043_0067928_1756_2358 196
1265 3300049580 Ga0501046_0024267 Ga0501046_0024267_2683_3285 196
1266 3300049582 Ga0501048_0032255 Ga0501048_0032255_249_851 196
1267 3300049587 Ga0501071_0198807 Ga0501071_0198807_815_1435 196
1268 3300049589 Ga0501073_0743464 Ga0501073_0743464_11_631 196
1269 3300049591 Ga0501075_0116492 Ga0501075_0116492_259_861 196
1270 3300049592 Ga0501076_0044751 Ga0501076_0044751_555_1157 196
1271 3300049592 Ga0501076_0853483 Ga0501076_0853483_42_632 196
1272 3300049593 Ga0501077_0087085 Ga0501077_0087085_811_1416 196
1273 3300049661 Ga0501217_150745 Ga0501217_150745_48_638 196
1274 3300049679 Ga0501249_063792 Ga0501249_063792_22_612 196
1275 3300049741 Ga0501079_0047546 Ga0501079_0047546_168_770 196
1276 3300049742 Ga0501080_0141503 Ga0501080_0141503_986_1588 196
1277 3300049743 Ga0501081_0053824 Ga0501081_0053824_1175_1777 196
1278 3300049743 Ga0501081_0185443 Ga0501081_0185443_509_1114 196
1279 3300049743 Ga0501081_0416991 Ga0501081_0416991_262_864 196
1280 3300049744 Ga0501083_0217186 Ga0501083_0217186_429_1037 196
1281 3300049824 Ga0501045_0039403 Ga0501045_0039403_1545_2147 196
1282 3300050491 nmdc:mga00v17_675120_c1 nmdc:mga00v17_675120_c1_10_627 196
1283 3300050507 nmdc:mga05p37_177921_c1 nmdc:mga05p37_177921_c1_1491_2081 196
1284 3300050507 nmdc:mga05p37_2419_c1 nmdc:mga05p37_2419_c1_19180_19770 196
1285 3300050507 nmdc:mga05p37_437550_c1 nmdc:mga05p37_437550_c1_755_1345 196
1286 3300050507 nmdc:mga05p37_437754_c1 nmdc:mga05p37_437754_c1_509_1111 196
1287 3300050507 nmdc:mga05p37_44782_c1 nmdc:mga05p37_44782_c1_2537_3127 196
1288 3300050507 nmdc:mga05p37_483596_c1 nmdc:mga05p37_483596_c1_213_815 196
1289 3300050507 nmdc:mga05p37_84148_c1 nmdc:mga05p37_84148_c1_3057_3656 196
1290 3300050508 nmdc:mga09592_177681_c1 nmdc:mga09592_177681_c1_927_1517 196
1291 3300050508 nmdc:mga09592_19125_c1 nmdc:mga09592_19125_c1_4955_5545 196
1292 3300050508 nmdc:mga09592_27132_c1 nmdc:mga09592_27132_c1_1734_2324 196
1293 3300050508 nmdc:mga09592_35835_c1 nmdc:mga09592_35835_c1_2327_2929 196
1294 3300050508 nmdc:mga09592_50982_c1 nmdc:mga09592_50982_c1_670_1266 196
1295 3300050508 nmdc:mga09592_74264_c1 nmdc:mga09592_74264_c1_1550_2140 196
1296 3300050509 nmdc:mga0qj67_102877_c1 nmdc:mga0qj67_102877_c1_1583_2173 196
1297 3300050509 nmdc:mga0qj67_134553_c1 nmdc:mga0qj67_134553_c1_1138_1740 196
1298 3300050509 nmdc:mga0qj67_17604_c1 nmdc:mga0qj67_17604_c1_462_1052 196
1299 3300050509 nmdc:mga0qj67_216745_c1 nmdc:mga0qj67_216745_c1_511_1101 196
1300 3300050509 nmdc:mga0qj67_444188_c1 nmdc:mga0qj67_444188_c1_281_877 196
1301 3300050509 nmdc:mga0qj67_59487_c1 nmdc:mga0qj67_59487_c1_1991_2608 196
1302 3300050509 nmdc:mga0qj67_60595_c1 nmdc:mga0qj67_60595_c1_2272_2862 196
1303 3300050510 nmdc:mga06r32_263078_c1 nmdc:mga06r32_263078_c1_1037_1627 196
1304 3300050510 nmdc:mga06r32_336659_c1 nmdc:mga06r32_336659_c1_866_1462 196
1305 3300050510 nmdc:mga06r32_55695_c1 nmdc:mga06r32_55695_c1_3078_3668 196
1306 3300050510 nmdc:mga06r32_7152_c1 nmdc:mga06r32_7152_c1_2753_3343 196
1307 3300050510 nmdc:mga06r32_752330_c1 nmdc:mga06r32_752330_c1_297_887 196
1308 3300050511 nmdc:mga08y16_142240_c1 nmdc:mga08y16_142240_c1_1242_1832 196
1309 3300050511 nmdc:mga08y16_16007_c1 nmdc:mga08y16_16007_c1_2202_2792 196
1310 3300050511 nmdc:mga08y16_23988_c1 nmdc:mga08y16_23988_c1_5653_6249 196
1311 3300050511 nmdc:mga08y16_28438_c1 nmdc:mga08y16_28438_c1_715_1311 196
1312 3300050511 nmdc:mga08y16_444180_c1 nmdc:mga08y16_444180_c1_18_626 196
1313 3300050511 nmdc:mga08y16_52853_c1 nmdc:mga08y16_52853_c1_2103_2699 196
1314 3300050511 nmdc:mga08y16_667382_c1 nmdc:mga08y16_667382_c1_236_856 196
1315 3300050512 nmdc:mga0n895_12115_c1 nmdc:mga0n895_12115_c1_1849_2439 196
1316 3300050512 nmdc:mga0n895_19455_c1 nmdc:mga0n895_19455_c1_821_1411 196
1317 3300050512 nmdc:mga0n895_239890_c1 nmdc:mga0n895_239890_c1_909_1499 196
1318 3300050512 nmdc:mga0n895_31629_c1 nmdc:mga0n895_31629_c1_3750_4340 196
1319 3300050512 nmdc:mga0n895_4506_c2 nmdc:mga0n895_4506_c2_4593_5183 196
1320 3300050512 nmdc:mga0n895_90797_c1 nmdc:mga0n895_90797_c1_1761_2357 196
1321 3300050513 nmdc:mga0rr50_148320_c1 nmdc:mga0rr50_148320_c1_1001_1597 196
1322 3300050513 nmdc:mga0rr50_155539_c1 nmdc:mga0rr50_155539_c1_68_691 196
1323 3300050513 nmdc:mga0rr50_6700_c1 nmdc:mga0rr50_6700_c1_3163_3753 196
1324 3300050514 nmdc:mga08x19_394968_c1 nmdc:mga08x19_394968_c1_336_959 196
1325 3300050515 nmdc:mga0a205_17414_c1 nmdc:mga0a205_17414_c1_2865_3455 196
1326 3300050515 nmdc:mga0a205_2187_c1 nmdc:mga0a205_2187_c1_8127_8717 196
1327 3300050515 nmdc:mga0a205_224344_c1 nmdc:mga0a205_224344_c1_815_1405 196
1328 3300050515 nmdc:mga0a205_29117_c1 nmdc:mga0a205_29117_c1_4422_5012 196
1329 3300050515 nmdc:mga0a205_2928_c1 nmdc:mga0a205_2928_c1_8386_8982 196
1330 3300050515 nmdc:mga0a205_5356_c1 nmdc:mga0a205_5356_c1_2477_3067 196
1331 3300050515 nmdc:mga0a205_79452_c1 nmdc:mga0a205_79452_c1_296_886 196
1332 3300054114 Ga0501084_0098210 Ga0501084_0098210_51_653 196
1333 3300059421 Ga0590071_000168 Ga0590071_000168_4082_4681 196
1334 3300059421 Ga0590071_029512 Ga0590071_029512_631_1230 196
1335 3300059423 Ga0590074_001533 Ga0590074_001533_3126_3725 196
1336 3300059424 Ga0590075_000104 Ga0590075_000104_12940_13539 196
1337 3300059424 Ga0590075_005298 Ga0590075_005298_1721_2320 196
1338 3300059426 Ga0590077_000085 Ga0590077_000085_18948_19547 196
1339 3300059426 Ga0590077_028077 Ga0590077_028077_277_876 196
1340 3300061734 Ga0530510_0009133 Ga0530510_0009133_3232_3834 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

55

198

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fwh-assembly1.cif.gz_A acanthamoeba igpd in complex with r-c348 to 1.7a resolution 0.9816 1 182
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9798 4 182
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9783 1 184
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9768 1 184
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9685 3 184
ID Description Score Start End Superfamily
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9746 2 89 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9728 1 89 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9702 91 181 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9674 91 182 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9599 91 181 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A7C3DXF6-F1-model_v4 Imidazoleglycerol-phosphate dehydratase HisB 0.9953 1 175 GO:0000105
GO:0004424
AF-A0A3B9I1R9-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 0.9882 3 168 GO:0000105
GO:0004424
GO:0005737
AF-A0A355VD00-F1-model_v4 deleted 0.9874 4 70
AF-A0A7C4ZAG7-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9869 3 83 GO:0000105
GO:0004424
AF-A0A1Z9GWE8-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9867 3 84 GO:0000105
GO:0004424

Feature Viewer

pLDDT pTM Quality
92.83 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map