F493207
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1347 | 426 | 2694 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10275917|Ga0163162_102759172 |
| Length | 349 |
| Sequence | VRENLPVAGDERGGGFVAGGFDAENDHHRVLSCQPALVEALPFLHGTRMTRFRLGTRGSPLALTQAGMVRDALCAAHGWSPDAVEIVVIRTTGDRVQDRALAEIGGKALWTKGLDRALHDGDIDCAVHSMKDVETIRPATLSIAAMLPRADVRDRLIGAETLSDLRQGAVVGTSSPRRRAQMLRLRPDLEIVLIRGNVDTRLGRVASGEMDATLLAAAGLDRLGRDDGHAIPTDVMLPAPAQGAVGIEVLARSAAGGIVAAIDHRDTSLCVLTERALLARLGADCHSPVAALASLAGETLTLRAELIAEDGACDVAGSIEGTVDDDLGTALAEDLLARAPASVRRLFSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 131 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 217 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 237 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 238 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 239 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 240 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 242 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 243 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 244 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 245 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 246 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 247 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 248 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 249 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 250 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 251 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 252 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 253 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 254 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 257 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 258 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 259 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 260 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 315 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 316 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 317 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 318 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 319 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 320 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 321 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 322 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 326 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 327 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 335 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 336 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 337 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 338 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 339 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 341 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 342 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 343 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 344 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 347 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 350 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 356 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 357 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 358 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 359 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 361 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 363 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 364 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 365 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 366 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 367 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 369 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 370 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 372 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 373 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 374 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 375 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 377 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 378 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 380 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 382 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 384 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 385 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 386 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 387 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 388 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 389 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 390 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 391 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 392 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 393 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 394 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 395 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 396 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 397 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 398 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 399 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 400 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 401 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 402 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 403 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 404 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 405 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 406 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 407 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 408 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 409 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 410 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 411 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 412 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 413 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 414 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 415 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 416 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 417 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 418 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 419 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 420 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 421 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 422 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 423 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 424 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 425 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 426 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.51 |
| Metatranscriptomes | 0.3 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0 |
| Endosphere | 9.5 |
| Nodule | 0.22 |
| Rhizoplane | 2.97 |
| Rhizosphere | 79.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_10275917 | 3300013306 | Bacteria | 1813 |
| 2 | SwRhRL2b_contig_2018180 | 2162886007 | Bacteria | 8382 |
| 3 | JGI24736J21556_1000218 | 3300001904 | Bacteria | 10349 |
| 4 | JGI24741J21665_1000920 | 3300001915 | Bacteria | 8897 |
| 5 | JGI24741J21665_1001053 | 3300001915 | Bacteria | 8267 |
| 6 | JGI24741J21665_1006080 | 3300001915 | Bacteria | 2460 |
| 7 | JGI24752J21851_1000572 | 3300001976 | Bacteria | 4888 |
| 8 | JGI24752J21851_1002495 | 3300001976 | Bacteria | 2450 |
| 9 | JGI24740J21852_10001935 | 3300001979 | Bacteria | 9482 |
| 10 | JGI24740J21852_10038182 | 3300001979 | Bacteria | 1476 |
| 11 | JGI24739J22299_10033524 | 3300001989 | Bacteria | 1756 |
| 12 | JGI24739J22299_10054056 | 3300001989 | Bacteria | 1287 |
| 13 | JGI24737J22298_10012515 | 3300001990 | Bacteria | 2767 |
| 14 | JGI24737J22298_10013082 | 3300001990 | Bacteria | 2704 |
| 15 | JGI24737J22298_10026054 | 3300001990 | Bacteria | 1847 |
| 16 | JGI24735J21928_10001399 | 3300002067 | Bacteria | 8529 |
| 17 | JGI24735J21928_10003192 | 3300002067 | Bacteria | 5604 |
| 18 | JGI24735J21928_10012661 | 3300002067 | Bacteria | 2664 |
| 19 | JGI24735J21928_10017883 | 3300002067 | Bacteria | 2190 |
| 20 | JGI24735J21928_10025640 | 3300002067 | Bacteria | 1778 |
| 21 | JGI24738J21930_10001121 | 3300002075 | Bacteria | 7568 |
| 22 | JGI24738J21930_10015417 | 3300002075 | Bacteria | 1626 |
| 23 | JGI24749J21850_1000242 | 3300002076 | Bacteria | 8540 |
| 24 | JGI24751J29686_10000195 | 3300002459 | Bacteria | 26688 |
| 25 | JGI25150J39212_1000189 | 3300002774 | Bacteria | 34828 |
| 26 | JGI25165J46597_1000023 | 3300003214 | Bacteria | 338873 |
| 27 | JGI25153J46596_10000045 | 3300003215 | Bacteria | 149347 |
| 28 | JGI25153J46596_10000125 | 3300003215 | Bacteria | 86065 |
| 29 | rootL2_10207868 | 3300003322 | Bacteria | 2066 |
| 30 | Ga0055525_1000119 | 3300003759 | Bacteria | 120272 |
| 31 | Ga0055542_1000142 | 3300003762 | Bacteria | 89813 |
| 32 | Ga0055542_1006997 | 3300003762 | Bacteria | 2342 |
| 33 | Ga0055529_1000167 | 3300003763 | Bacteria | 90966 |
| 34 | Ga0055526_1008886 | 3300003771 | Bacteria | 4932 |
| 35 | Ga0055537_1000787 | 3300003773 | Bacteria | 15930 |
| 36 | Ga0055537_1002802 | 3300003773 | Bacteria | 5605 |
| 37 | Ga0055537_1011990 | 3300003773 | Bacteria | 1717 |
| 38 | Ga0055524_1000221 | 3300003775 | Bacteria | 60461 |
| 39 | Ga0055524_1000387 | 3300003775 | Bacteria | 37906 |
| 40 | Ga0055536_1038756 | 3300003781 | Bacteria | 1152 |
| 41 | Ga0055530_10000269 | 3300003791 | Bacteria | 47045 |
| 42 | Ga0055530_10011428 | 3300003791 | Bacteria | 3188 |
| 43 | Ga0055530_10020041 | 3300003791 | Bacteria | 2010 |
| 44 | Ga0055540_1004110 | 3300003792 | Bacteria | 6737 |
| 45 | Ga0055531_10000318 | 3300003794 | Bacteria | 47203 |
| 46 | Ga0055531_10011173 | 3300003794 | Bacteria | 4367 |
| 47 | Ga0055543_1009876 | 3300004625 | Bacteria | 2028 |
| 48 | Ga0065165_1001532 | 3300005262 | Bacteria | 24175 |
| 49 | Ga0065165_1002366 | 3300005262 | Bacteria | 16298 |
| 50 | Ga0065165_1004263 | 3300005262 | Bacteria | 9033 |
| 51 | Ga0065165_1037780 | 3300005262 | Bacteria | 1461 |
| 52 | Ga0065165_1038879 | 3300005262 | Bacteria | 1430 |
| 53 | Ga0065704_10073584 | 3300005289 | Bacteria | 6988 |
| 54 | Ga0065704_10096430 | 3300005289 | Bacteria | 2442 |
| 55 | Ga0065715_10213345 | 3300005293 | Bacteria | 1304 |
| 56 | Ga0065707_10082561 | 3300005295 | Bacteria | 13721 |
| 57 | Ga0065707_10133594 | 3300005295 | Bacteria | 1879 |
| 58 | Ga0070658_10000143 | 3300005327 | Bacteria | 63183 |
| 59 | Ga0070658_10009867 | 3300005327 | Bacteria | 7672 |
| 60 | Ga0070658_10010686 | 3300005327 | Bacteria | 7354 |
| 61 | Ga0070658_10015184 | 3300005327 | Bacteria | 6161 |
| 62 | Ga0070658_10036159 | 3300005327 | Bacteria | 3980 |
| 63 | Ga0070658_10114371 | 3300005327 | Bacteria | 2237 |
| 64 | Ga0070658_10117779 | 3300005327 | Bacteria | 2205 |
| 65 | Ga0070658_10135797 | 3300005327 | Bacteria | 2052 |
| 66 | Ga0070676_10000104 | 3300005328 | Bacteria | 30258 |
| 67 | Ga0070676_10017471 | 3300005328 | Bacteria | 3970 |
| 68 | Ga0070676_10067142 | 3300005328 | Bacteria | 2144 |
| 69 | Ga0070676_10082353 | 3300005328 | Bacteria | 1955 |
| 70 | Ga0070683_100018140 | 3300005329 | Bacteria | 6229 |
| 71 | Ga0070683_100025921 | 3300005329 | Bacteria | 5272 |
| 72 | Ga0070670_100000033 | 3300005331 | Bacteria | 158509 |
| 73 | Ga0070670_100001972 | 3300005331 | Bacteria | 16797 |
| 74 | Ga0070670_100013480 | 3300005331 | Bacteria | 7002 |
| 75 | Ga0070670_100022250 | 3300005331 | Bacteria | 5456 |
| 76 | Ga0070670_100035125 | 3300005331 | Bacteria | 4315 |
| 77 | Ga0070670_100048591 | 3300005331 | Bacteria | 3651 |
| 78 | Ga0070670_100386006 | 3300005331 | Bacteria | 1234 |
| 79 | Ga0070670_100532687 | 3300005331 | Bacteria | 1047 |
| 80 | Ga0068869_100002907 | 3300005334 | Bacteria | 10406 |
| 81 | Ga0068869_100016838 | 3300005334 | Bacteria | 4940 |
| 82 | Ga0068869_100066878 | 3300005334 | Bacteria | 2649 |
| 83 | Ga0068869_100148069 | 3300005334 | Bacteria | 1819 |
| 84 | Ga0068869_100164656 | 3300005334 | Bacteria | 1728 |
| 85 | Ga0070666_10000286 | 3300005335 | Bacteria | 33235 |
| 86 | Ga0070666_10074837 | 3300005335 | Bacteria | 2309 |
| 87 | Ga0070666_10173768 | 3300005335 | Bacteria | 1510 |
| 88 | Ga0070680_100003296 | 3300005336 | Bacteria | 12049 |
| 89 | Ga0070680_100038230 | 3300005336 | Bacteria | 3881 |
| 90 | Ga0070680_100047487 | 3300005336 | Bacteria | 3496 |
| 91 | Ga0070680_100147180 | 3300005336 | Bacteria | 1976 |
| 92 | Ga0070682_100033480 | 3300005337 | Bacteria | 3122 |
| 93 | Ga0070682_100049566 | 3300005337 | Bacteria | 2618 |
| 94 | Ga0068868_100000032 | 3300005338 | Bacteria | 75803 |
| 95 | Ga0068868_100000073 | 3300005338 | Bacteria | 58910 |
| 96 | Ga0068868_100033767 | 3300005338 | Bacteria | 3946 |
| 97 | Ga0070660_100000200 | 3300005339 | Bacteria | 39931 |
| 98 | Ga0070660_100002030 | 3300005339 | Bacteria | 13961 |
| 99 | Ga0070660_100011462 | 3300005339 | Bacteria | 6301 |
| 100 | Ga0070660_100015446 | 3300005339 | Bacteria | 5514 |
| 101 | Ga0070660_100044942 | 3300005339 | Bacteria | 3379 |
| 102 | Ga0070660_100064600 | 3300005339 | Bacteria | 2847 |
| 103 | Ga0070660_100069844 | 3300005339 | Bacteria | 2740 |
| 104 | Ga0070660_100115988 | 3300005339 | Bacteria | 2135 |
| 105 | Ga0070660_100151670 | 3300005339 | Bacteria | 1864 |
| 106 | Ga0070660_100224655 | 3300005339 | Bacteria | 1527 |
| 107 | Ga0070689_100241634 | 3300005340 | Bacteria | 1487 |
| 108 | Ga0070689_100269916 | 3300005340 | Bacteria | 1408 |
| 109 | Ga0070691_10001770 | 3300005341 | Bacteria | 9393 |
| 110 | Ga0070661_100021883 | 3300005344 | Bacteria | 4573 |
| 111 | Ga0070661_100029595 | 3300005344 | Bacteria | 3954 |
| 112 | Ga0070661_100102198 | 3300005344 | Bacteria | 2133 |
| 113 | Ga0070661_100187233 | 3300005344 | Bacteria | 1577 |
| 114 | Ga0070668_100000003 | 3300005347 | Bacteria | 195738 |
| 115 | Ga0070668_100000011 | 3300005347 | Bacteria | 123099 |
| 116 | Ga0070668_100005153 | 3300005347 | Bacteria | 9692 |
| 117 | Ga0070668_100016688 | 3300005347 | Bacteria | 5488 |
| 118 | Ga0070668_100017250 | 3300005347 | Bacteria | 5405 |
| 119 | Ga0070668_100022525 | 3300005347 | Bacteria | 4763 |
| 120 | Ga0070668_100027223 | 3300005347 | Bacteria | 4340 |
| 121 | Ga0070668_100029946 | 3300005347 | Bacteria | 4136 |
| 122 | Ga0070668_100044453 | 3300005347 | Bacteria | 3407 |
| 123 | Ga0070668_100064361 | 3300005347 | Bacteria | 2843 |
| 124 | Ga0070668_100130510 | 3300005347 | Bacteria | 2017 |
| 125 | Ga0070669_100000004 | 3300005353 | Bacteria | 314707 |
| 126 | Ga0070669_100000005 | 3300005353 | Bacteria | 309134 |
| 127 | Ga0070669_100000080 | 3300005353 | Bacteria | 92960 |
| 128 | Ga0070669_100006816 | 3300005353 | Bacteria | 8219 |
| 129 | Ga0070669_100029782 | 3300005353 | Bacteria | 3938 |
| 130 | Ga0070669_100033355 | 3300005353 | Bacteria | 3724 |
| 131 | Ga0070669_100058340 | 3300005353 | Bacteria | 2832 |
| 132 | Ga0070669_100067227 | 3300005353 | Bacteria | 2643 |
| 133 | Ga0070669_100143822 | 3300005353 | Bacteria | 1841 |
| 134 | Ga0070669_100501224 | 3300005353 | Bacteria | 1007 |
| 135 | Ga0070675_100015090 | 3300005354 | Bacteria | 6101 |
| 136 | Ga0070675_100027624 | 3300005354 | Bacteria | 4561 |
| 137 | Ga0070675_100028394 | 3300005354 | Bacteria | 4503 |
| 138 | Ga0070675_100152732 | 3300005354 | Bacteria | 1980 |
| 139 | Ga0070671_100000004 | 3300005355 | Bacteria | 262155 |
| 140 | Ga0070671_100000061 | 3300005355 | Bacteria | 73646 |
| 141 | Ga0070671_100000707 | 3300005355 | Bacteria | 23997 |
| 142 | Ga0070671_100002229 | 3300005355 | Bacteria | 14965 |
| 143 | Ga0070671_100014989 | 3300005355 | Bacteria | 6260 |
| 144 | Ga0070671_100016884 | 3300005355 | Bacteria | 5906 |
| 145 | Ga0070671_100041223 | 3300005355 | Bacteria | 3837 |
| 146 | Ga0070671_100114964 | 3300005355 | Bacteria | 2262 |
| 147 | Ga0070674_100003200 | 3300005356 | Bacteria | 9130 |
| 148 | Ga0070674_100003367 | 3300005356 | Bacteria | 8959 |
| 149 | Ga0070674_100051126 | 3300005356 | Bacteria | 2847 |
| 150 | Ga0070673_100000047 | 3300005364 | Bacteria | 50070 |
| 151 | Ga0070673_100006160 | 3300005364 | Bacteria | 7772 |
| 152 | Ga0070673_100018722 | 3300005364 | Bacteria | 4956 |
| 153 | Ga0070673_100035764 | 3300005364 | Bacteria | 3769 |
| 154 | Ga0070673_100178991 | 3300005364 | Bacteria | 1814 |
| 155 | Ga0070673_100436710 | 3300005364 | Bacteria | 1176 |
| 156 | Ga0070659_100000005 | 3300005366 | Bacteria | 259902 |
| 157 | Ga0070659_100004006 | 3300005366 | Bacteria | 10482 |
| 158 | Ga0070659_100007944 | 3300005366 | Bacteria | 7729 |
| 159 | Ga0070659_100019152 | 3300005366 | Bacteria | 5179 |
| 160 | Ga0070659_100027682 | 3300005366 | Bacteria | 4369 |
| 161 | Ga0070659_100068801 | 3300005366 | Bacteria | 2809 |
| 162 | Ga0070659_100115301 | 3300005366 | Bacteria | 2171 |
| 163 | Ga0070659_100117057 | 3300005366 | Bacteria | 2155 |
| 164 | Ga0070659_100120593 | 3300005366 | Bacteria | 2124 |
| 165 | Ga0070659_100125475 | 3300005366 | Bacteria | 2082 |
| 166 | Ga0070667_100000035 | 3300005367 | Bacteria | 173461 |
| 167 | Ga0070667_100000089 | 3300005367 | Bacteria | 113661 |
| 168 | Ga0070667_100005092 | 3300005367 | Bacteria | 11004 |
| 169 | Ga0070667_100012916 | 3300005367 | Bacteria | 6902 |
| 170 | Ga0070667_100014340 | 3300005367 | Bacteria | 6550 |
| 171 | Ga0070667_100022265 | 3300005367 | Bacteria | 5258 |
| 172 | Ga0070667_100023510 | 3300005367 | Bacteria | 5114 |
| 173 | Ga0070667_100029928 | 3300005367 | Bacteria | 4540 |
| 174 | Ga0070667_100039833 | 3300005367 | Bacteria | 3939 |
| 175 | Ga0070667_100079713 | 3300005367 | Bacteria | 2800 |
| 176 | Ga0070705_100003446 | 3300005440 | Bacteria | 7759 |
| 177 | Ga0070694_100034881 | 3300005444 | Bacteria | 3321 |
| 178 | Ga0070663_100005176 | 3300005455 | Bacteria | 7723 |
| 179 | Ga0070663_100017609 | 3300005455 | Bacteria | 4667 |
| 180 | Ga0070663_100122022 | 3300005455 | Bacteria | 1969 |
| 181 | Ga0070663_100249401 | 3300005455 | Bacteria | 1404 |
| 182 | Ga0070678_100000636 | 3300005456 | Bacteria | 17176 |
| 183 | Ga0070678_100052058 | 3300005456 | Bacteria | 2971 |
| 184 | Ga0070662_100115782 | 3300005457 | Bacteria | 2048 |
| 185 | Ga0070681_10030827 | 3300005458 | Bacteria | 5382 |
| 186 | Ga0070681_10053958 | 3300005458 | Bacteria | 4005 |
| 187 | Ga0070681_10076524 | 3300005458 | Bacteria | 3304 |
| 188 | Ga0070681_10280189 | 3300005458 | Bacteria | 1578 |
| 189 | Ga0068867_100000119 | 3300005459 | Bacteria | 50149 |
| 190 | Ga0068867_100078814 | 3300005459 | Bacteria | 2478 |
| 191 | Ga0070679_100120739 | 3300005530 | Bacteria | 2606 |
| 192 | Ga0070679_100125251 | 3300005530 | Bacteria | 2552 |
| 193 | Ga0070679_100196527 | 3300005530 | Bacteria | 1984 |
| 194 | Ga0070679_100404038 | 3300005530 | Bacteria | 1312 |
| 195 | Ga0070684_100001970 | 3300005535 | Bacteria | 15086 |
| 196 | Ga0068853_100000181 | 3300005539 | Bacteria | 44176 |
| 197 | Ga0068853_100009279 | 3300005539 | Bacteria | 7933 |
| 198 | Ga0068853_100013443 | 3300005539 | Bacteria | 6682 |
| 199 | Ga0068853_100023982 | 3300005539 | Bacteria | 5114 |
| 200 | Ga0068853_100030853 | 3300005539 | Bacteria | 4529 |
| 201 | Ga0068853_100033970 | 3300005539 | Bacteria | 4327 |
| 202 | Ga0068853_100076818 | 3300005539 | Bacteria | 2917 |
| 203 | Ga0068853_100091868 | 3300005539 | Bacteria | 2670 |
| 204 | Ga0068853_100247384 | 3300005539 | Bacteria | 1635 |
| 205 | Ga0070672_100024461 | 3300005543 | Bacteria | 4465 |
| 206 | Ga0070686_100000884 | 3300005544 | Bacteria | 17414 |
| 207 | Ga0070695_100015510 | 3300005545 | Bacteria | 4602 |
| 208 | Ga0070696_100000325 | 3300005546 | Bacteria | 28995 |
| 209 | Ga0070696_100025395 | 3300005546 | Bacteria | 4028 |
| 210 | Ga0070693_100054683 | 3300005547 | Bacteria | 2297 |
| 211 | Ga0070665_100000067 | 3300005548 | Bacteria | 204787 |
| 212 | Ga0070665_100000148 | 3300005548 | Bacteria | 128573 |
| 213 | Ga0070665_100008797 | 3300005548 | Bacteria | 10219 |
| 214 | Ga0070665_100010552 | 3300005548 | Bacteria | 9349 |
| 215 | Ga0070665_100039812 | 3300005548 | Bacteria | 4725 |
| 216 | Ga0070665_100039844 | 3300005548 | Bacteria | 4723 |
| 217 | Ga0070665_100041106 | 3300005548 | Bacteria | 4646 |
| 218 | Ga0070665_100071179 | 3300005548 | Bacteria | 3484 |
| 219 | Ga0070665_100074754 | 3300005548 | Bacteria | 3394 |
| 220 | Ga0070665_100103312 | 3300005548 | Bacteria | 2853 |
| 221 | Ga0070665_100353004 | 3300005548 | Bacteria | 1476 |
| 222 | Ga0068855_100000207 | 3300005563 | Bacteria | 75310 |
| 223 | Ga0068855_100000468 | 3300005563 | Bacteria | 49550 |
| 224 | Ga0068855_100128226 | 3300005563 | Bacteria | 2899 |
| 225 | Ga0068855_100150706 | 3300005563 | Bacteria | 2645 |
| 226 | Ga0068855_100199379 | 3300005563 | Bacteria | 2254 |
| 227 | Ga0068855_100218568 | 3300005563 | Bacteria | 2138 |
| 228 | Ga0068855_100283884 | 3300005563 | Bacteria | 1837 |
| 229 | Ga0068855_100305039 | 3300005563 | Bacteria | 1763 |
| 230 | Ga0068855_100336688 | 3300005563 | Bacteria | 1665 |
| 231 | Ga0068855_100634770 | 3300005563 | Bacteria | 1149 |
| 232 | Ga0070664_100005465 | 3300005564 | Bacteria | 10201 |
| 233 | Ga0070664_100011359 | 3300005564 | Bacteria | 7225 |
| 234 | Ga0070664_100011682 | 3300005564 | Bacteria | 7126 |
| 235 | Ga0070664_100071906 | 3300005564 | Bacteria | 2965 |
| 236 | Ga0070664_100074109 | 3300005564 | Bacteria | 2921 |
| 237 | Ga0070664_100101369 | 3300005564 | Bacteria | 2504 |
| 238 | Ga0070664_100180736 | 3300005564 | Bacteria | 1875 |
| 239 | Ga0070664_100279813 | 3300005564 | Bacteria | 1504 |
| 240 | Ga0068857_100016562 | 3300005577 | Bacteria | 6458 |
| 241 | Ga0068857_100052526 | 3300005577 | Bacteria | 3616 |
| 242 | Ga0068857_100102730 | 3300005577 | Bacteria | 2566 |
| 243 | Ga0068857_100216769 | 3300005577 | Bacteria | 1747 |
| 244 | Ga0068857_100239755 | 3300005577 | Bacteria | 1660 |
| 245 | Ga0068854_100000874 | 3300005578 | Bacteria | 18073 |
| 246 | Ga0068854_100001419 | 3300005578 | Bacteria | 14478 |
| 247 | Ga0068854_100002336 | 3300005578 | Bacteria | 11699 |
| 248 | Ga0068854_100010980 | 3300005578 | Bacteria | 5877 |
| 249 | Ga0068854_100016007 | 3300005578 | Bacteria | 4987 |
| 250 | Ga0068854_100053156 | 3300005578 | Bacteria | 2907 |
| 251 | Ga0068854_100087547 | 3300005578 | Bacteria | 2311 |
| 252 | Ga0068854_100143193 | 3300005578 | Bacteria | 1836 |
| 253 | Ga0068854_100385002 | 3300005578 | Bacteria | 1157 |
| 254 | Ga0068856_100004000 | 3300005614 | Bacteria | 14763 |
| 255 | Ga0068856_100022632 | 3300005614 | Bacteria | 6110 |
| 256 | Ga0068856_100165255 | 3300005614 | Bacteria | 2224 |
| 257 | Ga0068856_100206084 | 3300005614 | Bacteria | 1981 |
| 258 | Ga0068856_100262852 | 3300005614 | Bacteria | 1741 |
| 259 | Ga0068852_100005304 | 3300005616 | Bacteria | 9200 |
| 260 | Ga0068852_100005418 | 3300005616 | Bacteria | 9127 |
| 261 | Ga0068852_100094326 | 3300005616 | Bacteria | 2684 |
| 262 | Ga0068852_100154739 | 3300005616 | Bacteria | 2135 |
| 263 | Ga0068852_100729260 | 3300005616 | Bacteria | 1002 |
| 264 | Ga0068859_100000104 | 3300005617 | Bacteria | 78653 |
| 265 | Ga0068859_100000286 | 3300005617 | Bacteria | 50373 |
| 266 | Ga0068859_100002190 | 3300005617 | Bacteria | 19848 |
| 267 | Ga0068859_100002837 | 3300005617 | Bacteria | 17580 |
| 268 | Ga0068859_100009889 | 3300005617 | Bacteria | 9633 |
| 269 | Ga0068859_100013205 | 3300005617 | Bacteria | 8291 |
| 270 | Ga0068859_100019147 | 3300005617 | Bacteria | 6875 |
| 271 | Ga0068859_100024626 | 3300005617 | Bacteria | 6039 |
| 272 | Ga0068859_100064186 | 3300005617 | Bacteria | 3704 |
| 273 | Ga0068859_100076580 | 3300005617 | Bacteria | 3386 |
| 274 | Ga0068859_100120161 | 3300005617 | Bacteria | 2694 |
| 275 | Ga0068864_100000042 | 3300005618 | Bacteria | 162930 |
| 276 | Ga0068864_100000118 | 3300005618 | Bacteria | 77800 |
| 277 | Ga0068864_100002169 | 3300005618 | Bacteria | 16205 |
| 278 | Ga0068864_100003096 | 3300005618 | Bacteria | 13743 |
| 279 | Ga0068864_100003259 | 3300005618 | Bacteria | 13416 |
| 280 | Ga0068864_100008581 | 3300005618 | Bacteria | 8435 |
| 281 | Ga0068864_100017649 | 3300005618 | Bacteria | 5951 |
| 282 | Ga0068864_100018007 | 3300005618 | Bacteria | 5895 |
| 283 | Ga0068864_100141363 | 3300005618 | Bacteria | 2171 |
| 284 | Ga0068866_10063726 | 3300005718 | Bacteria | 1922 |
| 285 | Ga0068866_10156508 | 3300005718 | Bacteria | 1325 |
| 286 | Ga0068861_100000109 | 3300005719 | Bacteria | 41453 |
| 287 | Ga0068861_100007704 | 3300005719 | Bacteria | 7393 |
| 288 | Ga0068861_100105187 | 3300005719 | Bacteria | 2253 |
| 289 | Ga0068861_100167586 | 3300005719 | Bacteria | 1818 |
| 290 | Ga0068861_100298103 | 3300005719 | Bacteria | 1395 |
| 291 | Ga0068851_10020234 | 3300005834 | Bacteria | 3220 |
| 292 | Ga0068863_100000152 | 3300005841 | Bacteria | 72823 |
| 293 | Ga0068863_100000186 | 3300005841 | Bacteria | 65963 |
| 294 | Ga0068863_100001950 | 3300005841 | Bacteria | 20502 |
| 295 | Ga0068863_100003849 | 3300005841 | Bacteria | 14841 |
| 296 | Ga0068863_100004680 | 3300005841 | Bacteria | 13485 |
| 297 | Ga0068863_100015933 | 3300005841 | Bacteria | 7210 |
| 298 | Ga0068863_100019579 | 3300005841 | Bacteria | 6473 |
| 299 | Ga0068863_100020111 | 3300005841 | Bacteria | 6386 |
| 300 | Ga0068863_100040042 | 3300005841 | Bacteria | 4456 |
| 301 | Ga0068863_100066623 | 3300005841 | Bacteria | 3406 |
| 302 | Ga0068863_100066670 | 3300005841 | Bacteria | 3405 |
| 303 | Ga0068858_100000274 | 3300005842 | Bacteria | 55319 |
| 304 | Ga0068858_100000561 | 3300005842 | Bacteria | 38777 |
| 305 | Ga0068858_100000723 | 3300005842 | Bacteria | 34436 |
| 306 | Ga0068858_100012034 | 3300005842 | Bacteria | 8155 |
| 307 | Ga0068858_100014401 | 3300005842 | Bacteria | 7457 |
| 308 | Ga0068858_100025676 | 3300005842 | Bacteria | 5481 |
| 309 | Ga0068860_100000106 | 3300005843 | Bacteria | 133556 |
| 310 | Ga0068860_100000148 | 3300005843 | Bacteria | 113661 |
| 311 | Ga0068860_100003623 | 3300005843 | Bacteria | 15881 |
| 312 | Ga0068860_100004806 | 3300005843 | Bacteria | 13753 |
| 313 | Ga0068860_100007728 | 3300005843 | Bacteria | 10747 |
| 314 | Ga0068860_100009573 | 3300005843 | Bacteria | 9627 |
| 315 | Ga0068860_100072001 | 3300005843 | Bacteria | 3284 |
| 316 | Ga0068862_100000005 | 3300005844 | Bacteria | 350713 |
| 317 | Ga0068862_100000014 | 3300005844 | Bacteria | 251552 |
| 318 | Ga0068862_100000714 | 3300005844 | Bacteria | 33769 |
| 319 | Ga0068862_100001201 | 3300005844 | Bacteria | 24437 |
| 320 | Ga0068862_100002361 | 3300005844 | Bacteria | 16806 |
| 321 | Ga0068862_100002421 | 3300005844 | Bacteria | 16567 |
| 322 | Ga0068862_100014819 | 3300005844 | Bacteria | 6475 |
| 323 | Ga0068862_100026085 | 3300005844 | Bacteria | 4912 |
| 324 | Ga0068862_100028111 | 3300005844 | Bacteria | 4736 |
| 325 | Ga0068862_100090943 | 3300005844 | Bacteria | 2657 |
| 326 | Ga0068862_100139938 | 3300005844 | Bacteria | 2147 |
| 327 | Ga0081539_10046059 | 3300005985 | Bacteria | 2502 |
| 328 | Ga0075363_100037474 | 3300006048 | Bacteria | 2547 |
| 329 | Ga0075364_10196977 | 3300006051 | Bacteria | 1365 |
| 330 | Ga0075367_10012146 | 3300006178 | Bacteria | 4581 |
| 331 | Ga0075366_10063278 | 3300006195 | Bacteria | 2199 |
| 332 | Ga0075366_10100927 | 3300006195 | Bacteria | 1732 |
| 333 | Ga0097621_100051110 | 3300006237 | Bacteria | 3363 |
| 334 | Ga0097621_100082125 | 3300006237 | Bacteria | 2683 |
| 335 | Ga0097621_100273498 | 3300006237 | Bacteria | 1485 |
| 336 | Ga0075370_10050943 | 3300006353 | Bacteria | 2349 |
| 337 | Ga0075370_10054405 | 3300006353 | Bacteria | 2273 |
| 338 | Ga0068871_100012676 | 3300006358 | Bacteria | 6227 |
| 339 | Ga0068871_100051342 | 3300006358 | Bacteria | 3338 |
| 340 | Ga0068871_100500398 | 3300006358 | Bacteria | 1095 |
| 341 | Ga0075428_100442091 | 3300006844 | Bacteria | 1393 |
| 342 | Ga0075434_100166593 | 3300006871 | Bacteria | 2224 |
| 343 | Ga0068865_100000005 | 3300006881 | Bacteria | 213248 |
| 344 | Ga0068865_100171660 | 3300006881 | Bacteria | 1663 |
| 345 | Ga0097620_100000104 | 3300006931 | Bacteria | 78653 |
| 346 | Ga0097620_100000286 | 3300006931 | Bacteria | 50373 |
| 347 | Ga0097620_100002190 | 3300006931 | Bacteria | 19848 |
| 348 | Ga0097620_100002837 | 3300006931 | Bacteria | 17580 |
| 349 | Ga0097620_100009888 | 3300006931 | Bacteria | 9633 |
| 350 | Ga0097620_100013205 | 3300006931 | Bacteria | 8291 |
| 351 | Ga0097620_100019145 | 3300006931 | Bacteria | 6875 |
| 352 | Ga0097620_100024626 | 3300006931 | Bacteria | 6039 |
| 353 | Ga0097620_100064190 | 3300006931 | Bacteria | 3704 |
| 354 | Ga0097620_100076580 | 3300006931 | Bacteria | 3386 |
| 355 | Ga0097620_100120158 | 3300006931 | Bacteria | 2694 |
| 356 | Ga0105251_10033964 | 3300009011 | Bacteria | 2528 |
| 357 | Ga0105250_10026890 | 3300009092 | Bacteria | 2318 |
| 358 | Ga0105240_10001296 | 3300009093 | Bacteria | 43229 |
| 359 | Ga0105240_10127643 | 3300009093 | Bacteria | 3054 |
| 360 | Ga0105240_10251832 | 3300009093 | Bacteria | 2042 |
| 361 | Ga0105240_10262200 | 3300009093 | Bacteria | 1993 |
| 362 | Ga0105240_10273647 | 3300009093 | Bacteria | 1943 |
| 363 | Ga0111539_10096650 | 3300009094 | Bacteria | 3469 |
| 364 | Ga0105245_10000281 | 3300009098 | Bacteria | 48386 |
| 365 | Ga0105245_10001668 | 3300009098 | Bacteria | 20218 |
| 366 | Ga0105245_10030282 | 3300009098 | Bacteria | 4785 |
| 367 | Ga0105247_10000465 | 3300009101 | Bacteria | 34000 |
| 368 | Ga0105247_10000830 | 3300009101 | Bacteria | 23517 |
| 369 | Ga0114129_10380427 | 3300009147 | Bacteria | 1864 |
| 370 | Ga0105243_10000411 | 3300009148 | Bacteria | 44928 |
| 371 | Ga0105243_10003479 | 3300009148 | Bacteria | 12715 |
| 372 | Ga0105243_10013311 | 3300009148 | Bacteria | 6221 |
| 373 | Ga0105243_10102179 | 3300009148 | Bacteria | 2382 |
| 374 | Ga0105241_10003317 | 3300009174 | Bacteria | 11976 |
| 375 | Ga0105241_10164866 | 3300009174 | Bacteria | 1825 |
| 376 | Ga0105241_10209566 | 3300009174 | Bacteria | 1632 |
| 377 | Ga0105241_10213212 | 3300009174 | Bacteria | 1619 |
| 378 | Ga0105242_10001969 | 3300009176 | Bacteria | 16156 |
| 379 | Ga0105242_10063280 | 3300009176 | Bacteria | 3047 |
| 380 | Ga0105248_10000171 | 3300009177 | Bacteria | 75565 |
| 381 | Ga0105248_10000295 | 3300009177 | Bacteria | 59247 |
| 382 | Ga0105248_10000626 | 3300009177 | Bacteria | 40130 |
| 383 | Ga0105248_10013669 | 3300009177 | Bacteria | 8936 |
| 384 | Ga0105248_10045875 | 3300009177 | Bacteria | 4899 |
| 385 | Ga0105248_10058317 | 3300009177 | Bacteria | 4335 |
| 386 | Ga0105248_10105335 | 3300009177 | Bacteria | 3180 |
| 387 | Ga0105248_10502025 | 3300009177 | Bacteria | 1368 |
| 388 | Ga0105248_10547821 | 3300009177 | Bacteria | 1305 |
| 389 | Ga0105237_10004686 | 3300009545 | Bacteria | 15740 |
| 390 | Ga0105237_10022015 | 3300009545 | Bacteria | 6542 |
| 391 | Ga0105237_10036941 | 3300009545 | Bacteria | 4939 |
| 392 | Ga0105237_10066353 | 3300009545 | Bacteria | 3604 |
| 393 | Ga0105237_10068401 | 3300009545 | Bacteria | 3545 |
| 394 | Ga0105238_10002027 | 3300009551 | Bacteria | 20446 |
| 395 | Ga0105238_10096439 | 3300009551 | Bacteria | 2943 |
| 396 | Ga0105238_10098405 | 3300009551 | Bacteria | 2909 |
| 397 | Ga0105238_10134776 | 3300009551 | Bacteria | 2447 |
| 398 | Ga0105238_10505608 | 3300009551 | Bacteria | 1210 |
| 399 | Ga0105238_10520312 | 3300009551 | Bacteria | 1192 |
| 400 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 401 | Ga0105249_10003111 | 3300009553 | Bacteria | 14339 |
| 402 | Ga0105249_10006352 | 3300009553 | Bacteria | 10274 |
| 403 | Ga0105249_10009826 | 3300009553 | Bacteria | 8385 |
| 404 | Ga0105249_10033704 | 3300009553 | Bacteria | 4637 |
| 405 | Ga0105249_10051833 | 3300009553 | Bacteria | 3745 |
| 406 | Ga0105249_10077586 | 3300009553 | Bacteria | 3081 |
| 407 | Ga0105249_10116167 | 3300009553 | Bacteria | 2536 |
| 408 | Ga0105148_100047 | 3300009978 | Bacteria | 18470 |
| 409 | Ga0105239_10000266 | 3300010375 | Bacteria | 77602 |
| 410 | Ga0105239_10085122 | 3300010375 | Bacteria | 3484 |
| 411 | Ga0105239_10110126 | 3300010375 | Bacteria | 3052 |
| 412 | Ga0105246_10002967 | 3300011119 | Bacteria | 10282 |
| 413 | Ga0105246_10039643 | 3300011119 | Bacteria | 3175 |
| 414 | Ga0157326_1000559 | 3300012513 | Bacteria | 4412 |
| 415 | Ga0157373_10009957 | 3300013100 | Bacteria | 7005 |
| 416 | Ga0157373_10010481 | 3300013100 | Bacteria | 6819 |
| 417 | Ga0157373_10013343 | 3300013100 | Bacteria | 6027 |
| 418 | Ga0157373_10022838 | 3300013100 | Bacteria | 4536 |
| 419 | Ga0157373_10092834 | 3300013100 | Bacteria | 2126 |
| 420 | Ga0157373_10162908 | 3300013100 | Bacteria | 1569 |
| 421 | Ga0157373_10165562 | 3300013100 | Bacteria | 1556 |
| 422 | Ga0157371_10000062 | 3300013102 | Bacteria | 169669 |
| 423 | Ga0157371_10040988 | 3300013102 | Bacteria | 3306 |
| 424 | Ga0157371_10087118 | 3300013102 | Bacteria | 2211 |
| 425 | Ga0157371_10160058 | 3300013102 | Bacteria | 1608 |
| 426 | Ga0157371_10174668 | 3300013102 | Bacteria | 1536 |
| 427 | Ga0157370_10000611 | 3300013104 | Bacteria | 44454 |
| 428 | Ga0157370_10056321 | 3300013104 | Bacteria | 3742 |
| 429 | Ga0157370_10069540 | 3300013104 | Bacteria | 3325 |
| 430 | Ga0157370_10069936 | 3300013104 | Bacteria | 3315 |
| 431 | Ga0157370_10237542 | 3300013104 | Bacteria | 1686 |
| 432 | Ga0157369_10004697 | 3300013105 | Bacteria | 16061 |
| 433 | Ga0157369_10034579 | 3300013105 | Bacteria | 5545 |
| 434 | Ga0157369_10362366 | 3300013105 | Bacteria | 1505 |
| 435 | Ga0157374_10001017 | 3300013296 | Bacteria | 24339 |
| 436 | Ga0157374_10127707 | 3300013296 | Bacteria | 2458 |
| 437 | Ga0157378_10001127 | 3300013297 | Bacteria | 24339 |
| 438 | Ga0157378_10005257 | 3300013297 | Bacteria | 11373 |
| 439 | Ga0163162_10014044 | 3300013306 | Bacteria | 7827 |
| 440 | Ga0163162_10045213 | 3300013306 | Bacteria | 4411 |
| 441 | Ga0163162_10128767 | 3300013306 | Bacteria | 2639 |
| 442 | Ga0163162_10365752 | 3300013306 | Bacteria | 1575 |
| 443 | Ga0163162_10629872 | 3300013306 | Bacteria | 1197 |
| 444 | Ga0157372_10023486 | 3300013307 | Bacteria | 6685 |
| 445 | Ga0157372_10024302 | 3300013307 | Bacteria | 6580 |
| 446 | Ga0157372_10049722 | 3300013307 | Bacteria | 4663 |
| 447 | Ga0157372_10406939 | 3300013307 | Bacteria | 1585 |
| 448 | Ga0157372_10427514 | 3300013307 | Bacteria | 1544 |
| 449 | Ga0157372_10509123 | 3300013307 | Bacteria | 1404 |
| 450 | Ga0157372_10580103 | 3300013307 | Bacteria | 1307 |
| 451 | Ga0157372_10611976 | 3300013307 | Bacteria | 1270 |
| 452 | Ga0157375_10002160 | 3300013308 | Bacteria | 17001 |
| 453 | Ga0157375_10448862 | 3300013308 | Bacteria | 1455 |
| 454 | Ga0157375_10625967 | 3300013308 | Bacteria | 1234 |
| 455 | Ga0163163_10000882 | 3300014325 | Bacteria | 25516 |
| 456 | Ga0163163_10027458 | 3300014325 | Bacteria | 5453 |
| 457 | Ga0163163_10048402 | 3300014325 | Bacteria | 4180 |
| 458 | Ga0163163_10269882 | 3300014325 | Bacteria | 1753 |
| 459 | Ga0157380_10000030 | 3300014326 | Bacteria | 91258 |
| 460 | Ga0157380_10000365 | 3300014326 | Bacteria | 27217 |
| 461 | Ga0157380_10004840 | 3300014326 | Bacteria | 9382 |
| 462 | Ga0157380_10074108 | 3300014326 | Bacteria | 2762 |
| 463 | Ga0157380_10079645 | 3300014326 | Bacteria | 2676 |
| 464 | Ga0157380_10098239 | 3300014326 | Bacteria | 2432 |
| 465 | Ga0157380_10108341 | 3300014326 | Bacteria | 2329 |
| 466 | Ga0157379_10003869 | 3300014968 | Bacteria | 12761 |
| 467 | Ga0157379_10004680 | 3300014968 | Bacteria | 11746 |
| 468 | Ga0157379_10025399 | 3300014968 | Bacteria | 5263 |
| 469 | Ga0157376_10001892 | 3300014969 | Bacteria | 13979 |
| 470 | Ga0183363_1003 | 3300015690 | Bacteria | 421263 |
| 471 | Ga0206356_10373769 | 3300020070 | Bacteria | 1626 |
| 472 | Ga0206356_10882194 | 3300020070 | Bacteria | 2156 |
| 473 | Ga0206353_10996392 | 3300020082 | Bacteria | 1879 |
| 474 | Ga0206353_12001773 | 3300020082 | Bacteria | 2559 |
| 475 | Ga0213876_10007008 | 3300021384 | Bacteria | 6147 |
| 476 | Ga0213875_10000636 | 3300021388 | Bacteria | 28040 |
| 477 | Ga0209563_100024 | 3300025230 | Bacteria | 601155 |
| 478 | Ga0207427_101779 | 3300025231 | Bacteria | 6987 |
| 479 | Ga0209437_104987 | 3300025233 | Bacteria | 2293 |
| 480 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 481 | Ga0209026_1002697 | 3300025250 | Bacteria | 6409 |
| 482 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 483 | Ga0209148_1000301 | 3300025254 | Bacteria | 71452 |
| 484 | Ga0209148_1001740 | 3300025254 | Bacteria | 9482 |
| 485 | Ga0209129_1000345 | 3300025258 | Bacteria | 39677 |
| 486 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 487 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 488 | Ga0209565_1000010 | 3300025263 | Bacteria | 687724 |
| 489 | Ga0209565_1000029 | 3300025263 | Bacteria | 340335 |
| 490 | Ga0209565_1000052 | 3300025263 | Bacteria | 212056 |
| 491 | Ga0209565_1009556 | 3300025263 | Bacteria | 2454 |
| 492 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 493 | Ga0209455_1000467 | 3300025272 | Bacteria | 30363 |
| 494 | Ga0209455_1004431 | 3300025272 | Bacteria | 4602 |
| 495 | Ga0209673_1002171 | 3300025273 | Bacteria | 14487 |
| 496 | Ga0209673_1002668 | 3300025273 | Bacteria | 11894 |
| 497 | Ga0209676_1005902 | 3300025292 | Bacteria | 6217 |
| 498 | Ga0209025_1000855 | 3300025294 | Bacteria | 48253 |
| 499 | Ga0209564_1000866 | 3300025295 | Bacteria | 40332 |
| 500 | Ga0209564_1012788 | 3300025295 | Bacteria | 3627 |
| 501 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 502 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 503 | Ga0209758_1025935 | 3300025297 | Bacteria | 2556 |
| 504 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 505 | Ga0209050_1000167 | 3300025298 | Bacteria | 151608 |
| 506 | Ga0209050_1007940 | 3300025298 | Bacteria | 5812 |
| 507 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 508 | Ga0209256_1000012 | 3300025299 | Bacteria | 790371 |
| 509 | Ga0209051_1000297 | 3300025303 | Bacteria | 79062 |
| 510 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 511 | Ga0209257_1002251 | 3300025304 | Bacteria | 19776 |
| 512 | Ga0209257_1002675 | 3300025304 | Bacteria | 17088 |
| 513 | Ga0209257_1002709 | 3300025304 | Bacteria | 16888 |
| 514 | Ga0209257_1024069 | 3300025304 | Bacteria | 2119 |
| 515 | Ga0207697_10000105 | 3300025315 | Bacteria | 38611 |
| 516 | Ga0207697_10042941 | 3300025315 | Bacteria | 1858 |
| 517 | Ga0207656_10031488 | 3300025321 | Bacteria | 2198 |
| 518 | Ga0207656_10115232 | 3300025321 | Bacteria | 1246 |
| 519 | Ga0207713_1027124 | 3300025735 | Bacteria | 2608 |
| 520 | Ga0207682_10000970 | 3300025893 | Bacteria | 13250 |
| 521 | Ga0207710_10010965 | 3300025900 | Bacteria | 3818 |
| 522 | Ga0207710_10023316 | 3300025900 | Bacteria | 2659 |
| 523 | Ga0207688_10066523 | 3300025901 | Bacteria | 2039 |
| 524 | Ga0207688_10087546 | 3300025901 | Bacteria | 1786 |
| 525 | Ga0207688_10088204 | 3300025901 | Bacteria | 1779 |
| 526 | Ga0207680_10000299 | 3300025903 | Bacteria | 23555 |
| 527 | Ga0207680_10056507 | 3300025903 | Bacteria | 2370 |
| 528 | Ga0207647_10000643 | 3300025904 | Bacteria | 27280 |
| 529 | Ga0207647_10002316 | 3300025904 | Bacteria | 14493 |
| 530 | Ga0207647_10002797 | 3300025904 | Bacteria | 13162 |
| 531 | Ga0207647_10003935 | 3300025904 | Bacteria | 11093 |
| 532 | Ga0207647_10014925 | 3300025904 | Bacteria | 5338 |
| 533 | Ga0207647_10041875 | 3300025904 | Bacteria | 2877 |
| 534 | Ga0207647_10091413 | 3300025904 | Bacteria | 1815 |
| 535 | Ga0207645_10002875 | 3300025907 | Bacteria | 13324 |
| 536 | Ga0207645_10015633 | 3300025907 | Bacteria | 5035 |
| 537 | Ga0207645_10093955 | 3300025907 | Bacteria | 1930 |
| 538 | Ga0207645_10174161 | 3300025907 | Bacteria | 1411 |
| 539 | Ga0207705_10000046 | 3300025909 | Bacteria | 177574 |
| 540 | Ga0207705_10000181 | 3300025909 | Bacteria | 66244 |
| 541 | Ga0207705_10000299 | 3300025909 | Bacteria | 46209 |
| 542 | Ga0207705_10002601 | 3300025909 | Bacteria | 13872 |
| 543 | Ga0207705_10006485 | 3300025909 | Bacteria | 8669 |
| 544 | Ga0207705_10026336 | 3300025909 | Bacteria | 4147 |
| 545 | Ga0207705_10034863 | 3300025909 | Bacteria | 3599 |
| 546 | Ga0207705_10036465 | 3300025909 | Bacteria | 3519 |
| 547 | Ga0207705_10083029 | 3300025909 | Bacteria | 2337 |
| 548 | Ga0207705_10188398 | 3300025909 | Bacteria | 1559 |
| 549 | Ga0207705_10204979 | 3300025909 | Bacteria | 1495 |
| 550 | Ga0207654_10000741 | 3300025911 | Bacteria | 18127 |
| 551 | Ga0207707_10053752 | 3300025912 | Bacteria | 3506 |
| 552 | Ga0207707_10172064 | 3300025912 | Bacteria | 1893 |
| 553 | Ga0207707_10274134 | 3300025912 | Bacteria | 1462 |
| 554 | Ga0207707_10282574 | 3300025912 | Bacteria | 1437 |
| 555 | Ga0207695_10000516 | 3300025913 | Bacteria | 81914 |
| 556 | Ga0207695_10007459 | 3300025913 | Bacteria | 13900 |
| 557 | Ga0207695_10012484 | 3300025913 | Bacteria | 10195 |
| 558 | Ga0207695_10022835 | 3300025913 | Bacteria | 7087 |
| 559 | Ga0207695_10141239 | 3300025913 | Bacteria | 2356 |
| 560 | Ga0207695_10247953 | 3300025913 | Bacteria | 1681 |
| 561 | Ga0207671_10019676 | 3300025914 | Bacteria | 5157 |
| 562 | Ga0207671_10020388 | 3300025914 | Bacteria | 5045 |
| 563 | Ga0207671_10031862 | 3300025914 | Bacteria | 3925 |
| 564 | Ga0207660_10002059 | 3300025917 | Bacteria | 13360 |
| 565 | Ga0207660_10016210 | 3300025917 | Bacteria | 4930 |
| 566 | Ga0207660_10030179 | 3300025917 | Bacteria | 3725 |
| 567 | Ga0207660_10201067 | 3300025917 | Bacteria | 1556 |
| 568 | Ga0207660_10292345 | 3300025917 | Bacteria | 1296 |
| 569 | Ga0207657_10001108 | 3300025919 | Bacteria | 28597 |
| 570 | Ga0207657_10002117 | 3300025919 | Bacteria | 21474 |
| 571 | Ga0207657_10003558 | 3300025919 | Bacteria | 16624 |
| 572 | Ga0207657_10004994 | 3300025919 | Bacteria | 13945 |
| 573 | Ga0207657_10005570 | 3300025919 | Bacteria | 13151 |
| 574 | Ga0207657_10007755 | 3300025919 | Bacteria | 10963 |
| 575 | Ga0207657_10038901 | 3300025919 | Bacteria | 4229 |
| 576 | Ga0207657_10046247 | 3300025919 | Bacteria | 3813 |
| 577 | Ga0207657_10049022 | 3300025919 | Bacteria | 3684 |
| 578 | Ga0207657_10109844 | 3300025919 | Bacteria | 2278 |
| 579 | Ga0207657_10126224 | 3300025919 | Bacteria | 2101 |
| 580 | Ga0207657_10167370 | 3300025919 | Bacteria | 1782 |
| 581 | Ga0207649_10020563 | 3300025920 | Bacteria | 3786 |
| 582 | Ga0207649_10034748 | 3300025920 | Bacteria | 3023 |
| 583 | Ga0207649_10061294 | 3300025920 | Bacteria | 2367 |
| 584 | Ga0207649_10120262 | 3300025920 | Bacteria | 1770 |
| 585 | Ga0207652_10082118 | 3300025921 | Bacteria | 2820 |
| 586 | Ga0207652_10093551 | 3300025921 | Bacteria | 2645 |
| 587 | Ga0207652_10126857 | 3300025921 | Bacteria | 2273 |
| 588 | Ga0207652_10130312 | 3300025921 | Bacteria | 2243 |
| 589 | Ga0207652_10150879 | 3300025921 | Bacteria | 2081 |
| 590 | Ga0207652_10171552 | 3300025921 | Bacteria | 1947 |
| 591 | Ga0207652_10398027 | 3300025921 | Bacteria | 1243 |
| 592 | Ga0207652_10428955 | 3300025921 | Bacteria | 1192 |
| 593 | Ga0207652_10523714 | 3300025921 | Bacteria | 1066 |
| 594 | Ga0207681_10000003 | 3300025923 | Bacteria | 713245 |
| 595 | Ga0207681_10000010 | 3300025923 | Bacteria | 403379 |
| 596 | Ga0207681_10000049 | 3300025923 | Bacteria | 120296 |
| 597 | Ga0207681_10029445 | 3300025923 | Bacteria | 3567 |
| 598 | Ga0207681_10061664 | 3300025923 | Bacteria | 2579 |
| 599 | Ga0207681_10287104 | 3300025923 | Bacteria | 1297 |
| 600 | Ga0207681_10444687 | 3300025923 | Bacteria | 1054 |
| 601 | Ga0207681_10447058 | 3300025923 | Bacteria | 1051 |
| 602 | Ga0207694_10066128 | 3300025924 | Bacteria | 2820 |
| 603 | Ga0207694_10082193 | 3300025924 | Bacteria | 2532 |
| 604 | Ga0207694_10367958 | 3300025924 | Bacteria | 1192 |
| 605 | Ga0207650_10000012 | 3300025925 | Bacteria | 437889 |
| 606 | Ga0207650_10012956 | 3300025925 | Bacteria | 5765 |
| 607 | Ga0207650_10035436 | 3300025925 | Bacteria | 3624 |
| 608 | Ga0207650_10038261 | 3300025925 | Bacteria | 3502 |
| 609 | Ga0207650_10038930 | 3300025925 | Bacteria | 3474 |
| 610 | Ga0207650_10075913 | 3300025925 | Bacteria | 2538 |
| 611 | Ga0207650_10077064 | 3300025925 | Bacteria | 2520 |
| 612 | Ga0207650_10105107 | 3300025925 | Bacteria | 2179 |
| 613 | Ga0207650_10195318 | 3300025925 | Bacteria | 1619 |
| 614 | Ga0207650_10214693 | 3300025925 | Bacteria | 1546 |
| 615 | Ga0207659_10013860 | 3300025926 | Bacteria | 5181 |
| 616 | Ga0207659_10019949 | 3300025926 | Bacteria | 4423 |
| 617 | Ga0207659_10066375 | 3300025926 | Bacteria | 2618 |
| 618 | Ga0207659_10071154 | 3300025926 | Bacteria | 2539 |
| 619 | Ga0207659_10260604 | 3300025926 | Bacteria | 1410 |
| 620 | Ga0207687_10010131 | 3300025927 | Bacteria | 6163 |
| 621 | Ga0207687_10049796 | 3300025927 | Bacteria | 2914 |
| 622 | Ga0207700_10138279 | 3300025928 | Bacteria | 1998 |
| 623 | Ga0207644_10000007 | 3300025931 | Bacteria | 381778 |
| 624 | Ga0207644_10000032 | 3300025931 | Bacteria | 133759 |
| 625 | Ga0207644_10000052 | 3300025931 | Bacteria | 91473 |
| 626 | Ga0207644_10000069 | 3300025931 | Bacteria | 75201 |
| 627 | Ga0207644_10066824 | 3300025931 | Bacteria | 2619 |
| 628 | Ga0207644_10112012 | 3300025931 | Bacteria | 2065 |
| 629 | Ga0207644_10223483 | 3300025931 | Bacteria | 1493 |
| 630 | Ga0207690_10000020 | 3300025932 | Bacteria | 218439 |
| 631 | Ga0207690_10001383 | 3300025932 | Bacteria | 15243 |
| 632 | Ga0207690_10016682 | 3300025932 | Bacteria | 4473 |
| 633 | Ga0207690_10076960 | 3300025932 | Bacteria | 2318 |
| 634 | Ga0207690_10107485 | 3300025932 | Bacteria | 2004 |
| 635 | Ga0207690_10162215 | 3300025932 | Bacteria | 1667 |
| 636 | Ga0207690_10170013 | 3300025932 | Bacteria | 1632 |
| 637 | Ga0207690_10328257 | 3300025932 | Bacteria | 1204 |
| 638 | Ga0207706_10003116 | 3300025933 | Bacteria | 15944 |
| 639 | Ga0207706_10021858 | 3300025933 | Bacteria | 5742 |
| 640 | Ga0207706_10026051 | 3300025933 | Bacteria | 5236 |
| 641 | Ga0207706_10041512 | 3300025933 | Bacteria | 4078 |
| 642 | Ga0207706_10041713 | 3300025933 | Bacteria | 4068 |
| 643 | Ga0207706_10052489 | 3300025933 | Bacteria | 3599 |
| 644 | Ga0207706_10066126 | 3300025933 | Bacteria | 3182 |
| 645 | Ga0207706_10292387 | 3300025933 | Bacteria | 1420 |
| 646 | Ga0207686_10005035 | 3300025934 | Bacteria | 7110 |
| 647 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 648 | Ga0207709_10000051 | 3300025935 | Bacteria | 227968 |
| 649 | Ga0207709_10017408 | 3300025935 | Bacteria | 4011 |
| 650 | Ga0207670_10145285 | 3300025936 | Bacteria | 1753 |
| 651 | Ga0207669_10000742 | 3300025937 | Bacteria | 14150 |
| 652 | Ga0207669_10001774 | 3300025937 | Bacteria | 9151 |
| 653 | Ga0207669_10028122 | 3300025937 | Bacteria | 3089 |
| 654 | Ga0207669_10057581 | 3300025937 | Bacteria | 2367 |
| 655 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 656 | Ga0207691_10011367 | 3300025940 | Bacteria | 8544 |
| 657 | Ga0207691_10036585 | 3300025940 | Bacteria | 4549 |
| 658 | Ga0207691_10040846 | 3300025940 | Bacteria | 4285 |
| 659 | Ga0207691_10087562 | 3300025940 | Bacteria | 2794 |
| 660 | Ga0207691_10088679 | 3300025940 | Bacteria | 2774 |
| 661 | Ga0207691_10379635 | 3300025940 | Bacteria | 1207 |
| 662 | Ga0207711_10000153 | 3300025941 | Bacteria | 73814 |
| 663 | Ga0207711_10001371 | 3300025941 | Bacteria | 22952 |
| 664 | Ga0207711_10011668 | 3300025941 | Bacteria | 7300 |
| 665 | Ga0207711_10055660 | 3300025941 | Bacteria | 3396 |
| 666 | Ga0207711_10089499 | 3300025941 | Bacteria | 2705 |
| 667 | Ga0207711_10165514 | 3300025941 | Bacteria | 2004 |
| 668 | Ga0207711_10172504 | 3300025941 | Bacteria | 1963 |
| 669 | Ga0207711_10327237 | 3300025941 | Bacteria | 1417 |
| 670 | Ga0207711_10459114 | 3300025941 | Bacteria | 1186 |
| 671 | Ga0207689_10005027 | 3300025942 | Bacteria | 11917 |
| 672 | Ga0207689_10093499 | 3300025942 | Bacteria | 2470 |
| 673 | Ga0207689_10105177 | 3300025942 | Bacteria | 2319 |
| 674 | Ga0207661_10016501 | 3300025944 | Bacteria | 5450 |
| 675 | Ga0207661_10089152 | 3300025944 | Bacteria | 2565 |
| 676 | Ga0207661_10303553 | 3300025944 | Bacteria | 1432 |
| 677 | Ga0207679_10170520 | 3300025945 | Bacteria | 1791 |
| 678 | Ga0207679_10202423 | 3300025945 | Bacteria | 1659 |
| 679 | Ga0207679_10214166 | 3300025945 | Bacteria | 1617 |
| 680 | Ga0207679_10235480 | 3300025945 | Bacteria | 1548 |
| 681 | Ga0207667_10000024 | 3300025949 | Bacteria | 355874 |
| 682 | Ga0207667_10000852 | 3300025949 | Bacteria | 39321 |
| 683 | Ga0207667_10002816 | 3300025949 | Bacteria | 21561 |
| 684 | Ga0207667_10220220 | 3300025949 | Bacteria | 1944 |
| 685 | Ga0207667_10272166 | 3300025949 | Bacteria | 1731 |
| 686 | Ga0207651_10000006 | 3300025960 | Bacteria | 227893 |
| 687 | Ga0207651_10050762 | 3300025960 | Bacteria | 2819 |
| 688 | Ga0207651_10073534 | 3300025960 | Bacteria | 2431 |
| 689 | Ga0207651_10131110 | 3300025960 | Bacteria | 1919 |
| 690 | Ga0207651_10223588 | 3300025960 | Bacteria | 1523 |
| 691 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 692 | Ga0207712_10002585 | 3300025961 | Bacteria | 11625 |
| 693 | Ga0207712_10010885 | 3300025961 | Bacteria | 5789 |
| 694 | Ga0207712_10030000 | 3300025961 | Bacteria | 3654 |
| 695 | Ga0207712_10237933 | 3300025961 | Bacteria | 1465 |
| 696 | Ga0207712_10322510 | 3300025961 | Bacteria | 1275 |
| 697 | Ga0207668_10000006 | 3300025972 | Bacteria | 191468 |
| 698 | Ga0207668_10000034 | 3300025972 | Bacteria | 119274 |
| 699 | Ga0207668_10000321 | 3300025972 | Bacteria | 31112 |
| 700 | Ga0207668_10002255 | 3300025972 | Bacteria | 11242 |
| 701 | Ga0207668_10006614 | 3300025972 | Bacteria | 6855 |
| 702 | Ga0207668_10008868 | 3300025972 | Bacteria | 6014 |
| 703 | Ga0207668_10010065 | 3300025972 | Bacteria | 5695 |
| 704 | Ga0207668_10022336 | 3300025972 | Bacteria | 4049 |
| 705 | Ga0207668_10070992 | 3300025972 | Bacteria | 2486 |
| 706 | Ga0207668_10075528 | 3300025972 | Bacteria | 2423 |
| 707 | Ga0207640_10000109 | 3300025981 | Bacteria | 62407 |
| 708 | Ga0207640_10006284 | 3300025981 | Bacteria | 6515 |
| 709 | Ga0207640_10009825 | 3300025981 | Bacteria | 5367 |
| 710 | Ga0207640_10012181 | 3300025981 | Bacteria | 4892 |
| 711 | Ga0207640_10013565 | 3300025981 | Bacteria | 4676 |
| 712 | Ga0207640_10020357 | 3300025981 | Bacteria | 3938 |
| 713 | Ga0207640_10028939 | 3300025981 | Bacteria | 3394 |
| 714 | Ga0207640_10118678 | 3300025981 | Bacteria | 1890 |
| 715 | Ga0207640_10124510 | 3300025981 | Bacteria | 1853 |
| 716 | Ga0207658_10000026 | 3300025986 | Bacteria | 178292 |
| 717 | Ga0207658_10000069 | 3300025986 | Bacteria | 113687 |
| 718 | Ga0207658_10003813 | 3300025986 | Bacteria | 10610 |
| 719 | Ga0207658_10004121 | 3300025986 | Bacteria | 10137 |
| 720 | Ga0207658_10016310 | 3300025986 | Bacteria | 5109 |
| 721 | Ga0207658_10020099 | 3300025986 | Bacteria | 4623 |
| 722 | Ga0207658_10020601 | 3300025986 | Bacteria | 4566 |
| 723 | Ga0207658_10034220 | 3300025986 | Bacteria | 3629 |
| 724 | Ga0207658_10102527 | 3300025986 | Bacteria | 2244 |
| 725 | Ga0207658_10162940 | 3300025986 | Bacteria | 1829 |
| 726 | Ga0207677_10000156 | 3300026023 | Bacteria | 54081 |
| 727 | Ga0207677_10012718 | 3300026023 | Bacteria | 4852 |
| 728 | Ga0207703_10001033 | 3300026035 | Bacteria | 26717 |
| 729 | Ga0207703_10002370 | 3300026035 | Bacteria | 16383 |
| 730 | Ga0207703_10003077 | 3300026035 | Bacteria | 14107 |
| 731 | Ga0207703_10004091 | 3300026035 | Bacteria | 12030 |
| 732 | Ga0207703_10004901 | 3300026035 | Bacteria | 10880 |
| 733 | Ga0207703_10087222 | 3300026035 | Bacteria | 2616 |
| 734 | Ga0207639_10001528 | 3300026041 | Bacteria | 15547 |
| 735 | Ga0207639_10004179 | 3300026041 | Bacteria | 9724 |
| 736 | Ga0207639_10004479 | 3300026041 | Bacteria | 9429 |
| 737 | Ga0207639_10032831 | 3300026041 | Bacteria | 3825 |
| 738 | Ga0207639_10050815 | 3300026041 | Bacteria | 3150 |
| 739 | Ga0207639_10060713 | 3300026041 | Bacteria | 2917 |
| 740 | Ga0207639_10091673 | 3300026041 | Bacteria | 2433 |
| 741 | Ga0207639_10093055 | 3300026041 | Bacteria | 2417 |
| 742 | Ga0207639_10192547 | 3300026041 | Bacteria | 1743 |
| 743 | Ga0207678_10000080 | 3300026067 | Bacteria | 78553 |
| 744 | Ga0207678_10000680 | 3300026067 | Bacteria | 31116 |
| 745 | Ga0207678_10003120 | 3300026067 | Bacteria | 15000 |
| 746 | Ga0207678_10003478 | 3300026067 | Bacteria | 14176 |
| 747 | Ga0207678_10004958 | 3300026067 | Bacteria | 11947 |
| 748 | Ga0207678_10023620 | 3300026067 | Bacteria | 5376 |
| 749 | Ga0207678_10059541 | 3300026067 | Bacteria | 3286 |
| 750 | Ga0207678_10119066 | 3300026067 | Bacteria | 2253 |
| 751 | Ga0207678_10228415 | 3300026067 | Bacteria | 1593 |
| 752 | Ga0207702_10001603 | 3300026078 | Bacteria | 22370 |
| 753 | Ga0207702_10003537 | 3300026078 | Bacteria | 14222 |
| 754 | Ga0207702_10005016 | 3300026078 | Bacteria | 11632 |
| 755 | Ga0207702_10009720 | 3300026078 | Bacteria | 8078 |
| 756 | Ga0207702_10021712 | 3300026078 | Bacteria | 5315 |
| 757 | Ga0207702_10154436 | 3300026078 | Bacteria | 2091 |
| 758 | Ga0207702_10285661 | 3300026078 | Bacteria | 1561 |
| 759 | Ga0207702_10536686 | 3300026078 | Bacteria | 1143 |
| 760 | Ga0207641_10000031 | 3300026088 | Bacteria | 224320 |
| 761 | Ga0207641_10000205 | 3300026088 | Bacteria | 78692 |
| 762 | Ga0207641_10000617 | 3300026088 | Bacteria | 38890 |
| 763 | Ga0207641_10001438 | 3300026088 | Bacteria | 23396 |
| 764 | Ga0207641_10003069 | 3300026088 | Bacteria | 15060 |
| 765 | Ga0207641_10004589 | 3300026088 | Bacteria | 11931 |
| 766 | Ga0207641_10006151 | 3300026088 | Bacteria | 10157 |
| 767 | Ga0207641_10012621 | 3300026088 | Bacteria | 6928 |
| 768 | Ga0207641_10018768 | 3300026088 | Bacteria | 5671 |
| 769 | Ga0207641_10037164 | 3300026088 | Bacteria | 4066 |
| 770 | Ga0207641_10090902 | 3300026088 | Bacteria | 2670 |
| 771 | Ga0207641_10099749 | 3300026088 | Bacteria | 2556 |
| 772 | Ga0207648_10000363 | 3300026089 | Bacteria | 50049 |
| 773 | Ga0207648_10004614 | 3300026089 | Bacteria | 14126 |
| 774 | Ga0207648_10073095 | 3300026089 | Bacteria | 2988 |
| 775 | Ga0207676_10000009 | 3300026095 | Bacteria | 545256 |
| 776 | Ga0207676_10001710 | 3300026095 | Bacteria | 16181 |
| 777 | Ga0207676_10001834 | 3300026095 | Bacteria | 15561 |
| 778 | Ga0207676_10004450 | 3300026095 | Bacteria | 9910 |
| 779 | Ga0207676_10006981 | 3300026095 | Bacteria | 8003 |
| 780 | Ga0207676_10012120 | 3300026095 | Bacteria | 6171 |
| 781 | Ga0207676_10060246 | 3300026095 | Bacteria | 3002 |
| 782 | Ga0207676_10061808 | 3300026095 | Bacteria | 2967 |
| 783 | Ga0207674_10000284 | 3300026116 | Bacteria | 64099 |
| 784 | Ga0207674_10002418 | 3300026116 | Bacteria | 23581 |
| 785 | Ga0207674_10004022 | 3300026116 | Bacteria | 17851 |
| 786 | Ga0207674_10004819 | 3300026116 | Bacteria | 16164 |
| 787 | Ga0207674_10012727 | 3300026116 | Bacteria | 9402 |
| 788 | Ga0207674_10016332 | 3300026116 | Bacteria | 8132 |
| 789 | Ga0207674_10019804 | 3300026116 | Bacteria | 7282 |
| 790 | Ga0207674_10028832 | 3300026116 | Bacteria | 5852 |
| 791 | Ga0207674_10031068 | 3300026116 | Bacteria | 5612 |
| 792 | Ga0207674_10065001 | 3300026116 | Bacteria | 3679 |
| 793 | Ga0207674_10172960 | 3300026116 | Bacteria | 2113 |
| 794 | Ga0207675_100000053 | 3300026118 | Bacteria | 82907 |
| 795 | Ga0207675_100000255 | 3300026118 | Bacteria | 50880 |
| 796 | Ga0207675_100001380 | 3300026118 | Bacteria | 24344 |
| 797 | Ga0207675_100071737 | 3300026118 | Bacteria | 3238 |
| 798 | Ga0207675_100376066 | 3300026118 | Bacteria | 1396 |
| 799 | Ga0207683_10002674 | 3300026121 | Bacteria | 15579 |
| 800 | Ga0207683_10003233 | 3300026121 | Bacteria | 14216 |
| 801 | Ga0207698_10000964 | 3300026142 | Bacteria | 16725 |
| 802 | Ga0207698_10002279 | 3300026142 | Bacteria | 11359 |
| 803 | Ga0207698_10003975 | 3300026142 | Bacteria | 8963 |
| 804 | Ga0207698_10026953 | 3300026142 | Bacteria | 4072 |
| 805 | Ga0207698_10507191 | 3300026142 | Bacteria | 1175 |
| 806 | Ga0209813_10000014 | 3300027866 | Bacteria | 87712 |
| 807 | Ga0209974_10021647 | 3300027876 | Bacteria | 2130 |
| 808 | Ga0209974_10029267 | 3300027876 | Bacteria | 1824 |
| 809 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 810 | Ga0268266_10000626 | 3300028379 | Bacteria | 48011 |
| 811 | Ga0268266_10008582 | 3300028379 | Bacteria | 9076 |
| 812 | Ga0268266_10010736 | 3300028379 | Bacteria | 7981 |
| 813 | Ga0268266_10012663 | 3300028379 | Bacteria | 7290 |
| 814 | Ga0268266_10016041 | 3300028379 | Bacteria | 6406 |
| 815 | Ga0268266_10017080 | 3300028379 | Bacteria | 6197 |
| 816 | Ga0268266_10143703 | 3300028379 | Bacteria | 2143 |
| 817 | Ga0268266_10273355 | 3300028379 | Bacteria | 1569 |
| 818 | Ga0268266_10300108 | 3300028379 | Bacteria | 1498 |
| 819 | Ga0268266_10377681 | 3300028379 | Bacteria | 1336 |
| 820 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 821 | Ga0268265_10000048 | 3300028380 | Bacteria | 178523 |
| 822 | Ga0268265_10000972 | 3300028380 | Bacteria | 26208 |
| 823 | Ga0268265_10001068 | 3300028380 | Bacteria | 24459 |
| 824 | Ga0268265_10001877 | 3300028380 | Bacteria | 16711 |
| 825 | Ga0268265_10005131 | 3300028380 | Bacteria | 8967 |
| 826 | Ga0268265_10008778 | 3300028380 | Bacteria | 6828 |
| 827 | Ga0268265_10010546 | 3300028380 | Bacteria | 6239 |
| 828 | Ga0268265_10025582 | 3300028380 | Bacteria | 4192 |
| 829 | Ga0268265_10130476 | 3300028380 | Bacteria | 2087 |
| 830 | Ga0268265_10149800 | 3300028380 | Bacteria | 1966 |
| 831 | Ga0268265_10251546 | 3300028380 | Bacteria | 1565 |
| 832 | Ga0268264_10000076 | 3300028381 | Bacteria | 255518 |
| 833 | Ga0268264_10000106 | 3300028381 | Bacteria | 210031 |
| 834 | Ga0268264_10000217 | 3300028381 | Bacteria | 113674 |
| 835 | Ga0268264_10000439 | 3300028381 | Bacteria | 57339 |
| 836 | Ga0268264_10000645 | 3300028381 | Bacteria | 41090 |
| 837 | Ga0268264_10003344 | 3300028381 | Bacteria | 13863 |
| 838 | Ga0268264_10046997 | 3300028381 | Bacteria | 3587 |
| 839 | Ga0268264_10131719 | 3300028381 | Bacteria | 2218 |
| 840 | Ga0268264_10172584 | 3300028381 | Bacteria | 1957 |
| 841 | Ga0307517_10001703 | 3300028786 | Bacteria | 36321 |
| 842 | Ga0307515_10288239 | 3300028794 | Bacteria | 1341 |
| 843 | Ga0307513_10021142 | 3300031456 | Bacteria | 7688 |
| 844 | Ga0307513_10078148 | 3300031456 | Bacteria | 3424 |
| 845 | Ga0307513_10343196 | 3300031456 | Bacteria | 1243 |
| 846 | Ga0307509_10225888 | 3300031507 | Bacteria | 1680 |
| 847 | Ga0307408_100021735 | 3300031548 | Bacteria | 4346 |
| 848 | Ga0307408_100029774 | 3300031548 | Bacteria | 3786 |
| 849 | Ga0307408_100038304 | 3300031548 | Bacteria | 3382 |
| 850 | Ga0307408_100045920 | 3300031548 | Bacteria | 3122 |
| 851 | Ga0307408_100053685 | 3300031548 | Bacteria | 2911 |
| 852 | Ga0307408_100125754 | 3300031548 | Bacteria | 1993 |
| 853 | Ga0307408_100414950 | 3300031548 | Bacteria | 1159 |
| 854 | Ga0307405_10014730 | 3300031731 | Bacteria | 4214 |
| 855 | Ga0307405_10067652 | 3300031731 | Bacteria | 2283 |
| 856 | Ga0307405_10096911 | 3300031731 | Bacteria | 1968 |
| 857 | Ga0307405_10104681 | 3300031731 | Bacteria | 1904 |
| 858 | Ga0307405_10122976 | 3300031731 | Bacteria | 1779 |
| 859 | Ga0307405_10201270 | 3300031731 | Bacteria | 1446 |
| 860 | Ga0307405_10219015 | 3300031731 | Bacteria | 1395 |
| 861 | Ga0307413_10008683 | 3300031824 | Bacteria | 4813 |
| 862 | Ga0307413_10081449 | 3300031824 | Bacteria | 2075 |
| 863 | Ga0307413_10108764 | 3300031824 | Bacteria | 1851 |
| 864 | Ga0307413_10111929 | 3300031824 | Bacteria | 1829 |
| 865 | Ga0307413_10115938 | 3300031824 | Bacteria | 1803 |
| 866 | Ga0307413_10138495 | 3300031824 | Bacteria | 1678 |
| 867 | Ga0307410_10001691 | 3300031852 | Bacteria | 10153 |
| 868 | Ga0307410_10015931 | 3300031852 | Bacteria | 4469 |
| 869 | Ga0307410_10024939 | 3300031852 | Bacteria | 3743 |
| 870 | Ga0307410_10057510 | 3300031852 | Bacteria | 2648 |
| 871 | Ga0307410_10064707 | 3300031852 | Bacteria | 2513 |
| 872 | Ga0307410_10071379 | 3300031852 | Bacteria | 2408 |
| 873 | Ga0307410_10081235 | 3300031852 | Bacteria | 2277 |
| 874 | Ga0307410_10082071 | 3300031852 | Bacteria | 2267 |
| 875 | Ga0307410_10104263 | 3300031852 | Bacteria | 2038 |
| 876 | Ga0307410_10252591 | 3300031852 | Bacteria | 1371 |
| 877 | Ga0307406_10010818 | 3300031901 | Bacteria | 5156 |
| 878 | Ga0307406_10014221 | 3300031901 | Bacteria | 4574 |
| 879 | Ga0307406_10030679 | 3300031901 | Bacteria | 3266 |
| 880 | Ga0307406_10253402 | 3300031901 | Bacteria | 1327 |
| 881 | Ga0307407_10043436 | 3300031903 | Bacteria | 2527 |
| 882 | Ga0307407_10052426 | 3300031903 | Bacteria | 2343 |
| 883 | Ga0307407_10076751 | 3300031903 | Bacteria | 2007 |
| 884 | Ga0307407_10300882 | 3300031903 | Bacteria | 1118 |
| 885 | Ga0307412_10001006 | 3300031911 | Bacteria | 16124 |
| 886 | Ga0307412_10010753 | 3300031911 | Bacteria | 5279 |
| 887 | Ga0307412_10015861 | 3300031911 | Bacteria | 4475 |
| 888 | Ga0307412_10026558 | 3300031911 | Bacteria | 3600 |
| 889 | Ga0307412_10090404 | 3300031911 | Bacteria | 2140 |
| 890 | Ga0307412_10131208 | 3300031911 | Bacteria | 1820 |
| 891 | Ga0307412_10258661 | 3300031911 | Bacteria | 1356 |
| 892 | Ga0307409_100003480 | 3300031995 | Bacteria | 8560 |
| 893 | Ga0307409_100008340 | 3300031995 | Bacteria | 6282 |
| 894 | Ga0307409_100014339 | 3300031995 | Bacteria | 5150 |
| 895 | Ga0307409_100019207 | 3300031995 | Bacteria | 4621 |
| 896 | Ga0307409_100051476 | 3300031995 | Bacteria | 3152 |
| 897 | Ga0307409_100090909 | 3300031995 | Bacteria | 2500 |
| 898 | Ga0307409_100162794 | 3300031995 | Bacteria | 1953 |
| 899 | Ga0307409_100167198 | 3300031995 | Bacteria | 1931 |
| 900 | Ga0307409_100176297 | 3300031995 | Bacteria | 1887 |
| 901 | Ga0307409_100178903 | 3300031995 | Bacteria | 1875 |
| 902 | Ga0307409_100196260 | 3300031995 | Bacteria | 1802 |
| 903 | Ga0307409_100197829 | 3300031995 | Bacteria | 1795 |
| 904 | Ga0307409_100597173 | 3300031995 | Bacteria | 1090 |
| 905 | Ga0307416_100008527 | 3300032002 | Bacteria | 6624 |
| 906 | Ga0307416_100009876 | 3300032002 | Bacteria | 6276 |
| 907 | Ga0307416_100032224 | 3300032002 | Bacteria | 3957 |
| 908 | Ga0307416_100041334 | 3300032002 | Bacteria | 3590 |
| 909 | Ga0307416_100041956 | 3300032002 | Bacteria | 3568 |
| 910 | Ga0307416_100120714 | 3300032002 | Bacteria | 2335 |
| 911 | Ga0307416_100206387 | 3300032002 | Bacteria | 1869 |
| 912 | Ga0307416_100256220 | 3300032002 | Bacteria | 1707 |
| 913 | Ga0307416_100263142 | 3300032002 | Bacteria | 1687 |
| 914 | Ga0307416_100377439 | 3300032002 | Bacteria | 1446 |
| 915 | Ga0307416_100490352 | 3300032002 | Bacteria | 1291 |
| 916 | Ga0307416_100756164 | 3300032002 | Bacteria | 1065 |
| 917 | Ga0307414_10000463 | 3300032004 | Bacteria | 21300 |
| 918 | Ga0307414_10013269 | 3300032004 | Bacteria | 4902 |
| 919 | Ga0307414_10018046 | 3300032004 | Bacteria | 4332 |
| 920 | Ga0307414_10022267 | 3300032004 | Bacteria | 3993 |
| 921 | Ga0307414_10032046 | 3300032004 | Bacteria | 3456 |
| 922 | Ga0307414_10038232 | 3300032004 | Bacteria | 3221 |
| 923 | Ga0307414_10040883 | 3300032004 | Bacteria | 3135 |
| 924 | Ga0307414_10050706 | 3300032004 | Bacteria | 2876 |
| 925 | Ga0307414_10080498 | 3300032004 | Bacteria | 2382 |
| 926 | Ga0307414_10089233 | 3300032004 | Bacteria | 2284 |
| 927 | Ga0307414_10095902 | 3300032004 | Bacteria | 2218 |
| 928 | Ga0307414_10100857 | 3300032004 | Bacteria | 2172 |
| 929 | Ga0307414_10364778 | 3300032004 | Bacteria | 1244 |
| 930 | Ga0307414_10584610 | 3300032004 | Bacteria | 999 |
| 931 | Ga0307411_10004366 | 3300032005 | Bacteria | 6762 |
| 932 | Ga0307411_10007971 | 3300032005 | Bacteria | 5448 |
| 933 | Ga0307411_10011224 | 3300032005 | Bacteria | 4822 |
| 934 | Ga0307411_10013119 | 3300032005 | Bacteria | 4556 |
| 935 | Ga0307411_10028624 | 3300032005 | Bacteria | 3391 |
| 936 | Ga0307411_10125648 | 3300032005 | Bacteria | 1865 |
| 937 | Ga0307411_10180873 | 3300032005 | Bacteria | 1600 |
| 938 | Ga0307411_10234088 | 3300032005 | Bacteria | 1434 |
| 939 | Ga0307411_10239316 | 3300032005 | Bacteria | 1420 |
| 940 | Ga0307411_10283227 | 3300032005 | Bacteria | 1320 |
| 941 | Ga0307415_100015317 | 3300032126 | Bacteria | 4536 |
| 942 | Ga0307415_100029178 | 3300032126 | Bacteria | 3522 |
| 943 | Ga0307415_100112216 | 3300032126 | Bacteria | 2025 |
| 944 | Ga0307415_100129515 | 3300032126 | Bacteria | 1907 |
| 945 | Ga0307415_100162034 | 3300032126 | Bacteria | 1735 |
| 946 | Ga0307415_100163138 | 3300032126 | Bacteria | 1729 |
| 947 | Ga0307415_100403440 | 3300032126 | Bacteria | 1168 |
| 948 | Ga0307415_100469859 | 3300032126 | Bacteria | 1092 |
| 949 | Ga0307510_10000248 | 3300033180 | Bacteria | 48764 |
| 950 | Ga0307510_10040635 | 3300033180 | Bacteria | 5103 |
| 951 | Ga0307510_10182106 | 3300033180 | Bacteria | 1662 |
| 952 | Ga0373927_0071656 | 3300035695 | Bacteria | 2243 |
| 953 | Ga0395899_0004754 | 3300037312 | Bacteria | 10587 |
| 954 | Ga0395899_0077243 | 3300037312 | Bacteria | 2429 |
| 955 | Ga0395899_0130846 | 3300037312 | Bacteria | 1792 |
| 956 | Ga0395900_0006155 | 3300037418 | Bacteria | 12526 |
| 957 | Ga0395900_0010551 | 3300037418 | Bacteria | 9450 |
| 958 | Ga0395900_0018554 | 3300037418 | Bacteria | 7094 |
| 959 | Ga0395900_0053239 | 3300037418 | Bacteria | 4165 |
| 960 | Ga0395900_0090942 | 3300037418 | Bacteria | 3136 |
| 961 | Ga0395900_0120339 | 3300037418 | Bacteria | 2694 |
| 962 | Ga0395900_0187899 | 3300037418 | Bacteria | 2097 |
| 963 | Ga0395900_0279352 | 3300037418 | Bacteria | 1662 |
| 964 | Ga0395900_0358415 | 3300037418 | Bacteria | 1430 |
| 965 | Ga0395898_0032517 | 3300037466 | Bacteria | 5207 |
| 966 | Ga0395898_0223001 | 3300037466 | Bacteria | 1798 |
| 967 | Ga0395898_0292281 | 3300037466 | Bacteria | 1554 |
| 968 | Ga0395898_0363665 | 3300037466 | Bacteria | 1380 |
| 969 | Ga0395898_0697633 | 3300037466 | Bacteria | 957 |
| 970 | Ga0395905_0000232 | 3300037471 | Bacteria | 84233 |
| 971 | Ga0395905_0028518 | 3300037471 | Bacteria | 5262 |
| 972 | Ga0395905_0041496 | 3300037471 | Bacteria | 4318 |
| 973 | Ga0395905_0048257 | 3300037471 | Bacteria | 3990 |
| 974 | Ga0395905_0066004 | 3300037471 | Bacteria | 3388 |
| 975 | Ga0395905_0153646 | 3300037471 | Bacteria | 2165 |
| 976 | Ga0395905_0310815 | 3300037471 | Bacteria | 1464 |
| 977 | Ga0395905_0412896 | 3300037471 | Bacteria | 1245 |
| 978 | Ga0436364_0551790 | 3300037853 | Bacteria | 2086 |
| 979 | Ga0436364_0786820 | 3300037853 | Bacteria | 5502 |
| 980 | Ga0436364_0816160 | 3300037853 | Bacteria | 20704 |
| 981 | Ga0395901_0024797 | 3300038443 | Bacteria | 6156 |
| 982 | Ga0395901_0056296 | 3300038443 | Bacteria | 4090 |
| 983 | Ga0395901_0250660 | 3300038443 | Bacteria | 1844 |
| 984 | Ga0395901_0521418 | 3300038443 | Bacteria | 1207 |
| 985 | Ga0237819_00556 | 3300038705 | Bacteria | 12543 |
| 986 | Ga0436365_1650189 | 3300039437 | Bacteria | 5299 |
| 987 | Ga0439436_0053380 | 3300041404 | Bacteria | 1138 |
| 988 | Ga0439461_0000081 | 3300041410 | Bacteria | 12554 |
| 989 | Ga0439466_0032477 | 3300041411 | Bacteria | 1779 |
| 990 | Ga0439465_0001389 | 3300041413 | Bacteria | 7815 |
| 991 | Ga0439465_0028487 | 3300041413 | Bacteria | 1771 |
| 992 | Ga0451807_2106806 | 3300041486 | Bacteria | 1728 |
| 993 | Ga0439431_0000134 | 3300041997 | Bacteria | 13258 |
| 994 | Ga0439431_0029888 | 3300041997 | Bacteria | 1347 |
| 995 | Ga0439442_003063 | 3300042002 | Bacteria | 3306 |
| 996 | Ga0439445_0000905 | 3300042004 | Bacteria | 6298 |
| 997 | Ga0439432_000152 | 3300042006 | Bacteria | 23430 |
| 998 | Ga0439432_016068 | 3300042006 | Bacteria | 2522 |
| 999 | Ga0439449_0008461 | 3300042007 | Bacteria | 3911 |
| 1000 | Ga0439449_0021174 | 3300042007 | Bacteria | 2435 |
| 1001 | Ga0439452_014099 | 3300042010 | Bacteria | 2227 |
| 1002 | Ga0439452_025818 | 3300042010 | Bacteria | 1487 |
| 1003 | Ga0439455_0000107 | 3300042012 | Bacteria | 8291 |
| 1004 | Ga0439462_0000151 | 3300042015 | Bacteria | 11324 |
| 1005 | Ga0439462_0004098 | 3300042015 | Bacteria | 3538 |
| 1006 | Ga0450919_004896 | 3300042121 | Bacteria | 1622 |
| 1007 | Ga0450920_009964 | 3300042122 | Bacteria | 1757 |
| 1008 | Ga0450891_004362 | 3300042129 | Bacteria | 1328 |
| 1009 | Ga0450889_000118 | 3300042144 | Bacteria | 7702 |
| 1010 | Ga0439446_0038448 | 3300042156 | Bacteria | 1403 |
| 1011 | Ga0439458_0000371 | 3300042157 | Bacteria | 11321 |
| 1012 | Ga0439458_0004674 | 3300042157 | Bacteria | 3125 |
| 1013 | Ga0439434_0000213 | 3300042435 | Bacteria | 16069 |
| 1014 | Ga0451577_0339336 | 3300042876 | Bacteria | 1363 |
| 1015 | Ga0466966_0316951 | 3300044684 | Bacteria | 937 |
| 1016 | Ga0466961_0067645 | 3300044693 | Bacteria | 2269 |
| 1017 | Ga0466963_0004135 | 3300044694 | Bacteria | 8393 |
| 1018 | Ga0466963_0212209 | 3300044694 | Bacteria | 1355 |
| 1019 | Ga0466963_0337181 | 3300044694 | Bacteria | 1061 |
| 1020 | Ga0466964_0016202 | 3300044706 | Bacteria | 2842 |
| 1021 | Ga0466971_0003306 | 3300044719 | Bacteria | 6887 |
| 1022 | Ga0466971_0074812 | 3300044719 | Bacteria | 1540 |
| 1023 | Ga0466968_0054218 | 3300044735 | Bacteria | 1718 |
| 1024 | Ga0466957_0021802 | 3300044842 | Bacteria | 3776 |
| 1025 | Ga0466960_0044375 | 3300044901 | Bacteria | 2119 |
| 1026 | Ga0466959_0292751 | 3300045049 | Bacteria | 1116 |
| 1027 | Ga0466959_0304717 | 3300045049 | Bacteria | 1091 |
| 1028 | Ga0466958_0069813 | 3300045836 | Bacteria | 2149 |
| 1029 | Ga0466958_0191725 | 3300045836 | Bacteria | 1299 |
| 1030 | Ga0466967_0012308 | 3300045976 | Bacteria | 6536 |
| 1031 | Ga0466967_0019763 | 3300045976 | Bacteria | 5425 |
| 1032 | Ga0466967_0478654 | 3300045976 | Bacteria | 1220 |
| 1033 | Ga0495627_006112 | 3300046453 | Bacteria | 4752 |
| 1034 | Ga0495638_0001117 | 3300046460 | Bacteria | 26096 |
| 1035 | Ga0495638_0007198 | 3300046460 | Bacteria | 8006 |
| 1036 | Ga0495638_0024614 | 3300046460 | Bacteria | 3923 |
| 1037 | Ga0495638_0054138 | 3300046460 | Bacteria | 2495 |
| 1038 | Ga0495650_0027007 | 3300046471 | Bacteria | 2659 |
| 1039 | Ga0495584_0081542 | 3300046491 | Bacteria | 1628 |
| 1040 | Ga0495585_0000933 | 3300046492 | Bacteria | 24663 |
| 1041 | Ga0495607_0008896 | 3300046501 | Bacteria | 6839 |
| 1042 | Ga0495583_0000358 | 3300046506 | Bacteria | 71745 |
| 1043 | Ga0495583_0006282 | 3300046506 | Bacteria | 7809 |
| 1044 | Ga0495583_0006422 | 3300046506 | Bacteria | 7693 |
| 1045 | Ga0495583_0012582 | 3300046506 | Bacteria | 4778 |
| 1046 | Ga0495583_0014543 | 3300046506 | Bacteria | 4337 |
| 1047 | Ga0495583_0024689 | 3300046506 | Bacteria | 3015 |
| 1048 | Ga0495606_0000457 | 3300046507 | Bacteria | 67044 |
| 1049 | Ga0495606_0033751 | 3300046507 | Bacteria | 3524 |
| 1050 | Ga0495616_0029958 | 3300046513 | Bacteria | 2866 |
| 1051 | Ga0495631_0006313 | 3300046518 | Bacteria | 6133 |
| 1052 | Ga0495637_0009055 | 3300046520 | Bacteria | 4864 |
| 1053 | Ga0495643_0003269 | 3300046522 | Bacteria | 11994 |
| 1054 | Ga0495643_0126952 | 3300046522 | Bacteria | 1283 |
| 1055 | Ga0495643_0139080 | 3300046522 | Bacteria | 1212 |
| 1056 | Ga0495648_0001493 | 3300046524 | Bacteria | 22886 |
| 1057 | Ga0495648_0033863 | 3300046524 | Bacteria | 3332 |
| 1058 | Ga0495648_0036481 | 3300046524 | Bacteria | 3171 |
| 1059 | Ga0495648_0060079 | 3300046524 | Bacteria | 2264 |
| 1060 | Ga0495648_0140727 | 3300046524 | Bacteria | 1270 |
| 1061 | Ga0495663_0000435 | 3300046525 | Bacteria | 15274 |
| 1062 | Ga0495663_0039188 | 3300046525 | Bacteria | 1435 |
| 1063 | Ga0495654_0000338 | 3300046530 | Bacteria | 40946 |
| 1064 | Ga0495597_0031047 | 3300046542 | Bacteria | 2433 |
| 1065 | Ga0495597_0039105 | 3300046542 | Bacteria | 2125 |
| 1066 | Ga0495622_0004163 | 3300046557 | Bacteria | 6749 |
| 1067 | Ga0495622_0004720 | 3300046557 | Bacteria | 6315 |
| 1068 | Ga0495633_0000690 | 3300046558 | Bacteria | 30854 |
| 1069 | Ga0495633_0011005 | 3300046558 | Bacteria | 4909 |
| 1070 | Ga0495633_0157489 | 3300046558 | Bacteria | 1048 |
| 1071 | Ga0495668_0000059 | 3300046616 | Bacteria | 194951 |
| 1072 | Ga0495668_0002301 | 3300046616 | Bacteria | 16028 |
| 1073 | Ga0495668_0005543 | 3300046616 | Bacteria | 8505 |
| 1074 | Ga0495668_0013937 | 3300046616 | Bacteria | 4726 |
| 1075 | Ga0495668_0064687 | 3300046616 | Bacteria | 2013 |
| 1076 | Ga0495668_0113197 | 3300046616 | Bacteria | 1484 |
| 1077 | Ga0495668_0124350 | 3300046616 | Bacteria | 1411 |
| 1078 | Ga0495611_0070043 | 3300046648 | Bacteria | 1603 |
| 1079 | Ga0495625_0000094 | 3300046660 | Bacteria | 144517 |
| 1080 | Ga0495625_0004059 | 3300046660 | Bacteria | 13990 |
| 1081 | Ga0495625_0005946 | 3300046660 | Bacteria | 10979 |
| 1082 | Ga0495625_0012086 | 3300046660 | Bacteria | 7005 |
| 1083 | Ga0495625_0194363 | 3300046660 | Bacteria | 1342 |
| 1084 | Ga0495625_0207866 | 3300046660 | Bacteria | 1288 |
| 1085 | Ga0495623_0215794 | 3300046679 | Bacteria | 1096 |
| 1086 | Ga0495669_0000058 | 3300046684 | Bacteria | 76033 |
| 1087 | Ga0495669_0003419 | 3300046684 | Bacteria | 6538 |
| 1088 | Ga0495669_0017312 | 3300046684 | Bacteria | 3092 |
| 1089 | Ga0495669_0019801 | 3300046684 | Bacteria | 2906 |
| 1090 | Ga0495669_0033342 | 3300046684 | Bacteria | 2266 |
| 1091 | Ga0495670_0000016 | 3300046691 | Bacteria | 128045 |
| 1092 | Ga0495670_0054654 | 3300046691 | Bacteria | 2001 |
| 1093 | Ga0495671_0010759 | 3300046692 | Bacteria | 5058 |
| 1094 | Ga0495671_0082351 | 3300046692 | Bacteria | 1577 |
| 1095 | Ga0495649_0054082 | 3300046694 | Bacteria | 2172 |
| 1096 | Ga0495660_0033946 | 3300046810 | Bacteria | 2858 |
| 1097 | Ga0495660_0087453 | 3300046810 | Bacteria | 1625 |
| 1098 | Ga0495683_0006073 | 3300047323 | Bacteria | 6626 |
| 1099 | Ga0495687_000083 | 3300047443 | Bacteria | 145688 |
| 1100 | Ga0495687_000152 | 3300047443 | Bacteria | 105602 |
| 1101 | Ga0495677_0006604 | 3300047445 | Bacteria | 4378 |
| 1102 | Ga0495677_0015249 | 3300047445 | Bacteria | 2793 |
| 1103 | Ga0495681_0003027 | 3300047470 | Bacteria | 11814 |
| 1104 | Ga0495681_0022129 | 3300047470 | Bacteria | 3410 |
| 1105 | Ga0495681_0026507 | 3300047470 | Bacteria | 3014 |
| 1106 | Ga0495686_0000100 | 3300047472 | Bacteria | 180492 |
| 1107 | Ga0495686_0000209 | 3300047472 | Bacteria | 108972 |
| 1108 | Ga0495686_0000300 | 3300047472 | Bacteria | 85146 |
| 1109 | Ga0495686_0008787 | 3300047472 | Bacteria | 7362 |
| 1110 | Ga0495686_0031244 | 3300047472 | Bacteria | 3454 |
| 1111 | Ga0495686_0048709 | 3300047472 | Bacteria | 2670 |
| 1112 | Ga0495686_0115656 | 3300047472 | Bacteria | 1604 |
| 1113 | Ga0496100_0052989 | 3300048903 | Bacteria | 2640 |
| 1114 | Ga0496100_0408691 | 3300048903 | Bacteria | 1035 |
| 1115 | Ga0496102_0000321 | 3300048905 | Bacteria | 60110 |
| 1116 | Ga0496102_0000372 | 3300048905 | Bacteria | 53776 |
| 1117 | Ga0496102_0013635 | 3300048905 | Bacteria | 7045 |
| 1118 | Ga0496102_0737498 | 3300048905 | Bacteria | 908 |
| 1119 | Ga0496103_0000021 | 3300048906 | Bacteria | 229062 |
| 1120 | Ga0496103_0000199 | 3300048906 | Bacteria | 60032 |
| 1121 | Ga0496103_0020370 | 3300048906 | Bacteria | 3983 |
| 1122 | Ga0496104_0000128 | 3300048907 | Bacteria | 70094 |
| 1123 | Ga0496104_0200548 | 3300048907 | Bacteria | 1907 |
| 1124 | Ga0496105_0000064 | 3300048908 | Bacteria | 83935 |
| 1125 | Ga0496107_0060793 | 3300048910 | Bacteria | 2734 |
| 1126 | Ga0496107_0112532 | 3300048910 | Bacteria | 2001 |
| 1127 | Ga0496107_0209131 | 3300048910 | Bacteria | 1451 |
| 1128 | Ga0496108_0000270 | 3300048911 | Bacteria | 44669 |
| 1129 | Ga0496108_0003272 | 3300048911 | Bacteria | 13018 |
| 1130 | Ga0496108_0013648 | 3300048911 | Bacteria | 6632 |
| 1131 | Ga0496108_0238511 | 3300048911 | Bacteria | 1582 |
| 1132 | Ga0496108_0316635 | 3300048911 | Bacteria | 1360 |
| 1133 | Ga0496109_0012198 | 3300048912 | Bacteria | 7413 |
| 1134 | Ga0496109_0017884 | 3300048912 | Bacteria | 6220 |
| 1135 | Ga0496110_0008670 | 3300048913 | Bacteria | 8189 |
| 1136 | Ga0496110_0018618 | 3300048913 | Bacteria | 5825 |
| 1137 | Ga0496110_0209858 | 3300048913 | Bacteria | 1770 |
| 1138 | Ga0496111_0007263 | 3300048914 | Bacteria | 7249 |
| 1139 | Ga0496111_0073251 | 3300048914 | Bacteria | 2494 |
| 1140 | Ga0496112_0011063 | 3300048915 | Bacteria | 8223 |
| 1141 | Ga0496112_0018560 | 3300048915 | Bacteria | 6552 |
| 1142 | Ga0496112_0024945 | 3300048915 | Bacteria | 5736 |
| 1143 | Ga0496113_0000044 | 3300048916 | Bacteria | 51909 |
| 1144 | Ga0496113_0001779 | 3300048916 | Bacteria | 12227 |
| 1145 | Ga0496113_0010090 | 3300048916 | Bacteria | 6229 |
| 1146 | Ga0496113_0039617 | 3300048916 | Bacteria | 3469 |
| 1147 | Ga0496113_0223916 | 3300048916 | Bacteria | 1499 |
| 1148 | Ga0496114_0188465 | 3300048917 | Bacteria | 1804 |
| 1149 | Ga0496115_0004300 | 3300048918 | Bacteria | 10314 |
| 1150 | Ga0496116_0000648 | 3300048919 | Bacteria | 45494 |
| 1151 | Ga0496116_0060403 | 3300048919 | Bacteria | 2459 |
| 1152 | Ga0496116_0189969 | 3300048919 | Bacteria | 1088 |
| 1153 | Ga0496117_0000584 | 3300048920 | Bacteria | 60140 |
| 1154 | Ga0496117_0001310 | 3300048920 | Bacteria | 36602 |
| 1155 | Ga0496117_0009809 | 3300048920 | Bacteria | 8825 |
| 1156 | Ga0496117_0035784 | 3300048920 | Bacteria | 3723 |
| 1157 | Ga0496118_0000588 | 3300048921 | Bacteria | 60153 |
| 1158 | Ga0496118_0003241 | 3300048921 | Bacteria | 20752 |
| 1159 | Ga0496118_0063764 | 3300048921 | Bacteria | 2709 |
| 1160 | Ga0496118_0069773 | 3300048921 | Bacteria | 2543 |
| 1161 | Ga0496118_0095905 | 3300048921 | Bacteria | 2023 |
| 1162 | Ga0496119_0000077 | 3300048922 | Bacteria | 143108 |
| 1163 | Ga0496119_0024187 | 3300048922 | Bacteria | 4279 |
| 1164 | Ga0496119_0041571 | 3300048922 | Bacteria | 2925 |
| 1165 | Ga0496120_0001955 | 3300048923 | Bacteria | 22562 |
| 1166 | Ga0496120_0016721 | 3300048923 | Bacteria | 4785 |
| 1167 | Ga0496120_0207791 | 3300048923 | Bacteria | 943 |
| 1168 | Ga0496121_0000163 | 3300048924 | Bacteria | 145648 |
| 1169 | Ga0496121_0001865 | 3300048924 | Bacteria | 33822 |
| 1170 | Ga0496121_0002849 | 3300048924 | Bacteria | 25522 |
| 1171 | Ga0496121_0005208 | 3300048924 | Bacteria | 16854 |
| 1172 | Ga0496121_0010109 | 3300048924 | Bacteria | 10699 |
| 1173 | Ga0496121_0043634 | 3300048924 | Bacteria | 3880 |
| 1174 | Ga0496121_0091189 | 3300048924 | Bacteria | 2380 |
| 1175 | Ga0496121_0182928 | 3300048924 | Bacteria | 1510 |
| 1176 | Ga0496122_0001166 | 3300048925 | Bacteria | 44916 |
| 1177 | Ga0496122_0001683 | 3300048925 | Bacteria | 34269 |
| 1178 | Ga0496122_0004055 | 3300048925 | Bacteria | 18593 |
| 1179 | Ga0496122_0009279 | 3300048925 | Bacteria | 10403 |
| 1180 | Ga0496122_0029763 | 3300048925 | Bacteria | 4594 |
| 1181 | Ga0496123_0000542 | 3300048926 | Bacteria | 64858 |
| 1182 | Ga0496123_0001103 | 3300048926 | Bacteria | 40498 |
| 1183 | Ga0496123_0011457 | 3300048926 | Bacteria | 7681 |
| 1184 | Ga0496123_0018448 | 3300048926 | Bacteria | 5552 |
| 1185 | Ga0496123_0018488 | 3300048926 | Bacteria | 5542 |
| 1186 | Ga0496123_0022752 | 3300048926 | Bacteria | 4819 |
| 1187 | Ga0496123_0039900 | 3300048926 | Bacteria | 3279 |
| 1188 | Ga0496123_0061608 | 3300048926 | Bacteria | 2409 |
| 1189 | Ga0496123_0070592 | 3300048926 | Bacteria | 2185 |
| 1190 | Ga0496123_0102011 | 3300048926 | Bacteria | 1667 |
| 1191 | Ga0496123_0113327 | 3300048926 | Bacteria | 1544 |
| 1192 | Ga0496124_0000354 | 3300048927 | Bacteria | 83817 |
| 1193 | Ga0496124_0000387 | 3300048927 | Bacteria | 80517 |
| 1194 | Ga0496124_0001269 | 3300048927 | Bacteria | 38422 |
| 1195 | Ga0496124_0008572 | 3300048927 | Bacteria | 10668 |
| 1196 | Ga0496124_0009752 | 3300048927 | Bacteria | 9828 |
| 1197 | Ga0496124_0027461 | 3300048927 | Bacteria | 5108 |
| 1198 | Ga0496124_0031798 | 3300048927 | Bacteria | 4667 |
| 1199 | Ga0496124_0033453 | 3300048927 | Bacteria | 4522 |
| 1200 | Ga0496124_0109432 | 3300048927 | Bacteria | 2227 |
| 1201 | Ga0496125_0000687 | 3300048928 | Bacteria | 56251 |
| 1202 | Ga0496125_0001135 | 3300048928 | Bacteria | 40511 |
| 1203 | Ga0496125_0010521 | 3300048928 | Bacteria | 9354 |
| 1204 | Ga0496125_0014132 | 3300048928 | Bacteria | 7790 |
| 1205 | Ga0496125_0023090 | 3300048928 | Bacteria | 5753 |
| 1206 | Ga0496125_0039372 | 3300048928 | Bacteria | 4072 |
| 1207 | Ga0496125_0151987 | 3300048928 | Bacteria | 1588 |
| 1208 | Ga0496125_0155808 | 3300048928 | Bacteria | 1561 |
| 1209 | Ga0496126_0000175 | 3300048929 | Bacteria | 146389 |
| 1210 | Ga0496126_0006303 | 3300048929 | Bacteria | 13249 |
| 1211 | Ga0496126_0024925 | 3300048929 | Bacteria | 5767 |
| 1212 | Ga0496126_0037074 | 3300048929 | Bacteria | 4553 |
| 1213 | Ga0496126_0174180 | 3300048929 | Bacteria | 1831 |
| 1214 | Ga0496126_0183686 | 3300048929 | Bacteria | 1775 |
| 1215 | Ga0496126_0184844 | 3300048929 | Bacteria | 1768 |
| 1216 | Ga0501290_001241 | 3300049513 | Bacteria | 3558 |
| 1217 | Ga0501292_000012 | 3300049515 | Bacteria | 69398 |
| 1218 | Ga0501033_0153155 | 3300049570 | Bacteria | 1662 |
| 1219 | Ga0501034_0014162 | 3300049571 | Bacteria | 8220 |
| 1220 | Ga0501043_0027180 | 3300049579 | Bacteria | 4492 |
| 1221 | Ga0501046_0246584 | 3300049580 | Bacteria | 1316 |
| 1222 | Ga0501047_0002016 | 3300049581 | Bacteria | 19482 |
| 1223 | Ga0501047_0138887 | 3300049581 | Bacteria | 2309 |
| 1224 | Ga0501067_0013236 | 3300049583 | Bacteria | 4567 |
| 1225 | Ga0501068_0061284 | 3300049584 | Bacteria | 2286 |
| 1226 | Ga0501209_042906 | 3300049656 | Bacteria | 1204 |
| 1227 | Ga0501223_000111 | 3300049663 | Bacteria | 23444 |
| 1228 | Ga0501223_002079 | 3300049663 | Bacteria | 4494 |
| 1229 | Ga0501224_000024 | 3300049664 | Bacteria | 61321 |
| 1230 | Ga0501224_000250 | 3300049664 | Bacteria | 6135 |
| 1231 | Ga0501257_011461 | 3300049686 | Bacteria | 2024 |
| 1232 | Ga0501259_015058 | 3300049688 | Bacteria | 1317 |
| 1233 | Ga0501225_0000004 | 3300049705 | Bacteria | 140738 |
| 1234 | Ga0501225_0000017 | 3300049705 | Bacteria | 61517 |
| 1235 | Ga0501225_0008251 | 3300049705 | Bacteria | 2996 |
| 1236 | Ga0501241_003853 | 3300049758 | Bacteria | 2828 |
| 1237 | Ga0501279_000012 | 3300049775 | Bacteria | 80359 |
| 1238 | Ga0501280_000052 | 3300049776 | Bacteria | 33642 |
| 1239 | Ga0501282_000586 | 3300049778 | Bacteria | 4250 |
| 1240 | Ga0501283_006592 | 3300049779 | Bacteria | 1630 |
| 1241 | Ga0501044_0064208 | 3300049823 | Bacteria | 3749 |
| 1242 | Ga0501044_0123466 | 3300049823 | Bacteria | 2588 |
| 1243 | Ga0501226_000072 | 3300049853 | Bacteria | 31259 |
| 1244 | nmdc:mga03683_39951_c1 | 3300050489 | Bacteria | 1922 |
| 1245 | nmdc:mga00v17_54411_c1 | 3300050491 | Bacteria | 2441 |
| 1246 | nmdc:mga0k408_59255_c1 | 3300050493 | Bacteria | 2224 |
| 1247 | nmdc:mga0k408_85431_c1 | 3300050493 | Bacteria | 1852 |
| 1248 | nmdc:mga06z11_47_c1 | 3300050494 | Bacteria | 51206 |
| 1249 | nmdc:mga04h51_182_c1 | 3300050495 | Bacteria | 17567 |
| 1250 | nmdc:mga05p37_458637_c1 | 3300050507 | Bacteria | 1473 |
| 1251 | nmdc:mga08y16_44274_c1 | 3300050511 | Bacteria | 4663 |
| 1252 | nmdc:mga0n895_301325_c1 | 3300050512 | Bacteria | 1625 |
| 1253 | Ga0500610_0000029 | 3300053079 | Bacteria | 52531 |
| 1254 | Ga0500643_000096 | 3300053087 | Bacteria | 92125 |
| 1255 | Ga0500643_000611 | 3300053087 | Bacteria | 24350 |
| 1256 | Ga0500643_001187 | 3300053087 | Bacteria | 15537 |
| 1257 | Ga0500643_001703 | 3300053087 | Bacteria | 12216 |
| 1258 | Ga0500643_002575 | 3300053087 | Bacteria | 9232 |
| 1259 | Ga0500643_003036 | 3300053087 | Bacteria | 8284 |
| 1260 | Ga0500583_0045830 | 3300053092 | Bacteria | 2010 |
| 1261 | Ga0500651_0009427 | 3300053093 | Bacteria | 5800 |
| 1262 | Ga0500641_0008635 | 3300053096 | Bacteria | 3642 |
| 1263 | Ga0500641_0042853 | 3300053096 | Bacteria | 1835 |
| 1264 | Ga0500555_003364 | 3300053103 | Bacteria | 4560 |
| 1265 | Ga0500556_0000053 | 3300053104 | Bacteria | 117389 |
| 1266 | Ga0500556_0006126 | 3300053104 | Bacteria | 3411 |
| 1267 | Ga0500592_013655 | 3300053116 | Bacteria | 1302 |
| 1268 | Ga0500594_0005984 | 3300053118 | Bacteria | 2715 |
| 1269 | Ga0500595_001869 | 3300053119 | Bacteria | 10863 |
| 1270 | Ga0500614_003766 | 3300053123 | Bacteria | 3248 |
| 1271 | Ga0500617_066071 | 3300053124 | Bacteria | 1593 |
| 1272 | Ga0500618_014164 | 3300053125 | Bacteria | 2044 |
| 1273 | Ga0500618_017070 | 3300053125 | Bacteria | 1809 |
| 1274 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 1275 | Ga0500642_0000238 | 3300053130 | Bacteria | 21313 |
| 1276 | Ga0500655_000089 | 3300053133 | Bacteria | 24204 |
| 1277 | Ga0500658_0000147 | 3300053134 | Bacteria | 33394 |
| 1278 | Ga0500658_0007420 | 3300053134 | Bacteria | 4053 |
| 1279 | Ga0500658_0013523 | 3300053134 | Bacteria | 3016 |
| 1280 | Ga0500559_0000456 | 3300053136 | Bacteria | 29143 |
| 1281 | Ga0500559_0021181 | 3300053136 | Bacteria | 2753 |
| 1282 | Ga0500559_0042912 | 3300053136 | Bacteria | 1975 |
| 1283 | Ga0500559_0098424 | 3300053136 | Bacteria | 1346 |
| 1284 | Ga0500573_0000039 | 3300053140 | Bacteria | 105413 |
| 1285 | Ga0500585_080656 | 3300053144 | Bacteria | 1176 |
| 1286 | Ga0500590_001156 | 3300053148 | Bacteria | 10422 |
| 1287 | Ga0500604_0038234 | 3300053151 | Bacteria | 1439 |
| 1288 | Ga0500622_0102362 | 3300053156 | Bacteria | 1408 |
| 1289 | Ga0500622_0109698 | 3300053156 | Bacteria | 1350 |
| 1290 | Ga0500624_000005 | 3300053157 | Bacteria | 187122 |
| 1291 | Ga0500624_000026 | 3300053157 | Bacteria | 109681 |
| 1292 | Ga0500627_0000074 | 3300053158 | Bacteria | 40189 |
| 1293 | Ga0500627_0000248 | 3300053158 | Bacteria | 15424 |
| 1294 | Ga0500627_0167636 | 3300053158 | Bacteria | 990 |
| 1295 | Ga0500639_121099 | 3300053163 | Bacteria | 1256 |
| 1296 | Ga0500636_0002055 | 3300053177 | Bacteria | 11101 |
| 1297 | Ga0500636_0004034 | 3300053177 | Bacteria | 8284 |
| 1298 | Ga0500570_002530 | 3300053724 | Bacteria | 9109 |
| 1299 | Ga0500645_000019 | 3300053730 | Bacteria | 135445 |
| 1300 | Ga0500645_003141 | 3300053730 | Bacteria | 6872 |
| 1301 | Ga0500645_008281 | 3300053730 | Bacteria | 3559 |
| 1302 | Ga0500645_013673 | 3300053730 | Bacteria | 2601 |
| 1303 | Ga0466962_0002921 | 3300061719 | Bacteria | 8146 |
| 1304 | Ga0466962_0112577 | 3300061719 | Bacteria | 1311 |
| 1305 | 2512645141 | 2512564014 | Bacteria | 4639632 |
| 1306 | 2545677296 | 2545555834 | Bacteria | 8130841 |
| 1307 | 2585264219 | 2582581305 | Bacteria | 4895574 |
| 1308 | 2600203225 | 2599185354 | Bacteria | 4398675 |
| 1309 | 2600226997 | 2599185359 | Bacteria | 4772316 |
| 1310 | 2643728270 | 2643221541 | Bacteria | 5498788 |
| 1311 | 2644040523 | 2643221605 | Bacteria | 4772303 |
| 1312 | 2644042781 | 2643221606 | Bacteria | 5588032 |
| 1313 | 2644127456 | 2643221622 | Bacteria | 4212502 |
| 1314 | 2644395788 | 2643221671 | Bacteria | 5496681 |
| 1315 | 2738711044 | 2738541275 | Bacteria | 4830863 |
| 1316 | 2738746478 | 2738541281 | Bacteria | 5112672 |
| 1317 | 2738849469 | 2738541301 | Bacteria | 4834102 |
| 1318 | 2738865198 | 2738541304 | Bacteria | 4833665 |
| 1319 | 2739297716 | 2738543022 | Bacteria | 4835059 |
| 1320 | 2739355708 | 2738543032 | Bacteria | 5115625 |
| 1321 | 2739359394 | 2738543033 | Bacteria | 4833336 |
| 1322 | 2778125838 | 2775507255 | Bacteria | 3945731 |
| 1323 | 2809063354 | 2808606401 | Bacteria | 4586670 |
| 1324 | 2809079210 | 2808606404 | Bacteria | 4652788 |
| 1325 | 2809083416 | 2808606405 | Bacteria | 4586632 |
| 1326 | 2830076101 | 2830075706 | Bacteria | 3855215 |
| 1327 | 2842701625 | 2842698319 | Bacteria | 5190321 |
| 1328 | 2879163527 | 2879163058 | Bacteria | 4223965 |
| 1329 | 2880520624 | 2880518877 | Bacteria | 5012590 |
| 1330 | 2885432234 | 2885429604 | Bacteria | 3642894 |
| 1331 | 2895885859 | 2895880812 | Bacteria | 11255272 |
| 1332 | 2902333399 | 2902330777 | Bacteria | 6395352 |
| 1333 | 2919139474 | 2919138771 | Bacteria | 5281312 |
| 1334 | 2928029405 | 2928027323 | Bacteria | 4382488 |
| 1335 | 2928103657 | 2928100450 | Bacteria | 4837635 |
| 1336 | 2928529571 | 2928526807 | Bacteria | 4760224 |
| 1337 | 2928961330 | 2928959182 | Bacteria | 4725774 |
| 1338 | 2928970942 | 2928968154 | Bacteria | 4633371 |
| 1339 | 2984556602 | 2984555340 | Bacteria | 4247089 |
| 1340 | 2984565225 | 2984564862 | Bacteria | 4339992 |
| 1341 | 2990267955 | 2990265787 | Bacteria | 3943888 |
| 1342 | 2993356301 | 2993356040 | Bacteria | 4247105 |
| 1343 | 2993697027 | 2993693658 | Bacteria | 4040749 |
| 1344 | 3003667601 | 3003665799 | Bacteria | 7279786 |
| 1345 | 641640733 | 641522639 | Bacteria | 7737025 |
| 1346 | 643599467 | 643348564 | Bacteria | 8839022 |
| 1347 | 8057105113 | 8057101203 | Bacteria | 5034064 |
| 1348 | Ga0163162_10275917 | |||
| 1349 | SwRhRL2b_contig_2018180 | |||
| 1350 | JGI24736J21556_1000218 | |||
| 1351 | JGI24741J21665_1000920 | |||
| 1352 | JGI24741J21665_1001053 | |||
| 1353 | JGI24741J21665_1006080 | |||
| 1354 | JGI24752J21851_1000572 | |||
| 1355 | JGI24752J21851_1002495 | |||
| 1356 | JGI24740J21852_10001935 | |||
| 1357 | JGI24740J21852_10038182 | |||
| 1358 | JGI24739J22299_10033524 | |||
| 1359 | JGI24739J22299_10054056 | |||
| 1360 | JGI24737J22298_10012515 | |||
| 1361 | JGI24737J22298_10013082 | |||
| 1362 | JGI24737J22298_10026054 | |||
| 1363 | JGI24735J21928_10001399 | |||
| 1364 | JGI24735J21928_10003192 | |||
| 1365 | JGI24735J21928_10012661 | |||
| 1366 | JGI24735J21928_10017883 | |||
| 1367 | JGI24735J21928_10025640 | |||
| 1368 | JGI24738J21930_10001121 | |||
| 1369 | JGI24738J21930_10015417 | |||
| 1370 | JGI24749J21850_1000242 | |||
| 1371 | JGI24751J29686_10000195 | |||
| 1372 | JGI25150J39212_1000189 | |||
| 1373 | JGI25165J46597_1000023 | |||
| 1374 | JGI25153J46596_10000045 | |||
| 1375 | JGI25153J46596_10000125 | |||
| 1376 | rootL2_10207868 | |||
| 1377 | Ga0055525_1000119 | |||
| 1378 | Ga0055542_1000142 | |||
| 1379 | Ga0055542_1006997 | |||
| 1380 | Ga0055529_1000167 | |||
| 1381 | Ga0055526_1008886 | |||
| 1382 | Ga0055537_1000787 | |||
| 1383 | Ga0055537_1002802 | |||
| 1384 | Ga0055537_1011990 | |||
| 1385 | Ga0055524_1000221 | |||
| 1386 | Ga0055524_1000387 | |||
| 1387 | Ga0055536_1038756 | |||
| 1388 | Ga0055530_10000269 | |||
| 1389 | Ga0055530_10011428 | |||
| 1390 | Ga0055530_10020041 | |||
| 1391 | Ga0055540_1004110 | |||
| 1392 | Ga0055531_10000318 | |||
| 1393 | Ga0055531_10011173 | |||
| 1394 | Ga0055543_1009876 | |||
| 1395 | Ga0065165_1001532 | |||
| 1396 | Ga0065165_1002366 | |||
| 1397 | Ga0065165_1004263 | |||
| 1398 | Ga0065165_1037780 | |||
| 1399 | Ga0065165_1038879 | |||
| 1400 | Ga0065704_10073584 | |||
| 1401 | Ga0065704_10096430 | |||
| 1402 | Ga0065715_10213345 | |||
| 1403 | Ga0065707_10082561 | |||
| 1404 | Ga0065707_10133594 | |||
| 1405 | Ga0070658_10000143 | |||
| 1406 | Ga0070658_10009867 | |||
| 1407 | Ga0070658_10010686 | |||
| 1408 | Ga0070658_10015184 | |||
| 1409 | Ga0070658_10036159 | |||
| 1410 | Ga0070658_10114371 | |||
| 1411 | Ga0070658_10117779 | |||
| 1412 | Ga0070658_10135797 | |||
| 1413 | Ga0070676_10000104 | |||
| 1414 | Ga0070676_10017471 | |||
| 1415 | Ga0070676_10067142 | |||
| 1416 | Ga0070676_10082353 | |||
| 1417 | Ga0070683_100018140 | |||
| 1418 | Ga0070683_100025921 | |||
| 1419 | Ga0070670_100000033 | |||
| 1420 | Ga0070670_100001972 | |||
| 1421 | Ga0070670_100013480 | |||
| 1422 | Ga0070670_100022250 | |||
| 1423 | Ga0070670_100035125 | |||
| 1424 | Ga0070670_100048591 | |||
| 1425 | Ga0070670_100386006 | |||
| 1426 | Ga0070670_100532687 | |||
| 1427 | Ga0068869_100002907 | |||
| 1428 | Ga0068869_100016838 | |||
| 1429 | Ga0068869_100066878 | |||
| 1430 | Ga0068869_100148069 | |||
| 1431 | Ga0068869_100164656 | |||
| 1432 | Ga0070666_10000286 | |||
| 1433 | Ga0070666_10074837 | |||
| 1434 | Ga0070666_10173768 | |||
| 1435 | Ga0070680_100003296 | |||
| 1436 | Ga0070680_100038230 | |||
| 1437 | Ga0070680_100047487 | |||
| 1438 | Ga0070680_100147180 | |||
| 1439 | Ga0070682_100033480 | |||
| 1440 | Ga0070682_100049566 | |||
| 1441 | Ga0068868_100000032 | |||
| 1442 | Ga0068868_100000073 | |||
| 1443 | Ga0068868_100033767 | |||
| 1444 | Ga0070660_100000200 | |||
| 1445 | Ga0070660_100002030 | |||
| 1446 | Ga0070660_100011462 | |||
| 1447 | Ga0070660_100015446 | |||
| 1448 | Ga0070660_100044942 | |||
| 1449 | Ga0070660_100064600 | |||
| 1450 | Ga0070660_100069844 | |||
| 1451 | Ga0070660_100115988 | |||
| 1452 | Ga0070660_100151670 | |||
| 1453 | Ga0070660_100224655 | |||
| 1454 | Ga0070689_100241634 | |||
| 1455 | Ga0070689_100269916 | |||
| 1456 | Ga0070691_10001770 | |||
| 1457 | Ga0070661_100021883 | |||
| 1458 | Ga0070661_100029595 | |||
| 1459 | Ga0070661_100102198 | |||
| 1460 | Ga0070661_100187233 | |||
| 1461 | Ga0070668_100000003 | |||
| 1462 | Ga0070668_100000011 | |||
| 1463 | Ga0070668_100005153 | |||
| 1464 | Ga0070668_100016688 | |||
| 1465 | Ga0070668_100017250 | |||
| 1466 | Ga0070668_100022525 | |||
| 1467 | Ga0070668_100027223 | |||
| 1468 | Ga0070668_100029946 | |||
| 1469 | Ga0070668_100044453 | |||
| 1470 | Ga0070668_100064361 | |||
| 1471 | Ga0070668_100130510 | |||
| 1472 | Ga0070669_100000004 | |||
| 1473 | Ga0070669_100000005 | |||
| 1474 | Ga0070669_100000080 | |||
| 1475 | Ga0070669_100006816 | |||
| 1476 | Ga0070669_100029782 | |||
| 1477 | Ga0070669_100033355 | |||
| 1478 | Ga0070669_100058340 | |||
| 1479 | Ga0070669_100067227 | |||
| 1480 | Ga0070669_100143822 | |||
| 1481 | Ga0070669_100501224 | |||
| 1482 | Ga0070675_100015090 | |||
| 1483 | Ga0070675_100027624 | |||
| 1484 | Ga0070675_100028394 | |||
| 1485 | Ga0070675_100152732 | |||
| 1486 | Ga0070671_100000004 | |||
| 1487 | Ga0070671_100000061 | |||
| 1488 | Ga0070671_100000707 | |||
| 1489 | Ga0070671_100002229 | |||
| 1490 | Ga0070671_100014989 | |||
| 1491 | Ga0070671_100016884 | |||
| 1492 | Ga0070671_100041223 | |||
| 1493 | Ga0070671_100114964 | |||
| 1494 | Ga0070674_100003200 | |||
| 1495 | Ga0070674_100003367 | |||
| 1496 | Ga0070674_100051126 | |||
| 1497 | Ga0070673_100000047 | |||
| 1498 | Ga0070673_100006160 | |||
| 1499 | Ga0070673_100018722 | |||
| 1500 | Ga0070673_100035764 | |||
| 1501 | Ga0070673_100178991 | |||
| 1502 | Ga0070673_100436710 | |||
| 1503 | Ga0070659_100000005 | |||
| 1504 | Ga0070659_100004006 | |||
| 1505 | Ga0070659_100007944 | |||
| 1506 | Ga0070659_100019152 | |||
| 1507 | Ga0070659_100027682 | |||
| 1508 | Ga0070659_100068801 | |||
| 1509 | Ga0070659_100115301 | |||
| 1510 | Ga0070659_100117057 | |||
| 1511 | Ga0070659_100120593 | |||
| 1512 | Ga0070659_100125475 | |||
| 1513 | Ga0070667_100000035 | |||
| 1514 | Ga0070667_100000089 | |||
| 1515 | Ga0070667_100005092 | |||
| 1516 | Ga0070667_100012916 | |||
| 1517 | Ga0070667_100014340 | |||
| 1518 | Ga0070667_100022265 | |||
| 1519 | Ga0070667_100023510 | |||
| 1520 | Ga0070667_100029928 | |||
| 1521 | Ga0070667_100039833 | |||
| 1522 | Ga0070667_100079713 | |||
| 1523 | Ga0070705_100003446 | |||
| 1524 | Ga0070694_100034881 | |||
| 1525 | Ga0070663_100005176 | |||
| 1526 | Ga0070663_100017609 | |||
| 1527 | Ga0070663_100122022 | |||
| 1528 | Ga0070663_100249401 | |||
| 1529 | Ga0070678_100000636 | |||
| 1530 | Ga0070678_100052058 | |||
| 1531 | Ga0070662_100115782 | |||
| 1532 | Ga0070681_10030827 | |||
| 1533 | Ga0070681_10053958 | |||
| 1534 | Ga0070681_10076524 | |||
| 1535 | Ga0070681_10280189 | |||
| 1536 | Ga0068867_100000119 | |||
| 1537 | Ga0068867_100078814 | |||
| 1538 | Ga0070679_100120739 | |||
| 1539 | Ga0070679_100125251 | |||
| 1540 | Ga0070679_100196527 | |||
| 1541 | Ga0070679_100404038 | |||
| 1542 | Ga0070684_100001970 | |||
| 1543 | Ga0068853_100000181 | |||
| 1544 | Ga0068853_100009279 | |||
| 1545 | Ga0068853_100013443 | |||
| 1546 | Ga0068853_100023982 | |||
| 1547 | Ga0068853_100030853 | |||
| 1548 | Ga0068853_100033970 | |||
| 1549 | Ga0068853_100076818 | |||
| 1550 | Ga0068853_100091868 | |||
| 1551 | Ga0068853_100247384 | |||
| 1552 | Ga0070672_100024461 | |||
| 1553 | Ga0070686_100000884 | |||
| 1554 | Ga0070695_100015510 | |||
| 1555 | Ga0070696_100000325 | |||
| 1556 | Ga0070696_100025395 | |||
| 1557 | Ga0070693_100054683 | |||
| 1558 | Ga0070665_100000067 | |||
| 1559 | Ga0070665_100000148 | |||
| 1560 | Ga0070665_100008797 | |||
| 1561 | Ga0070665_100010552 | |||
| 1562 | Ga0070665_100039812 | |||
| 1563 | Ga0070665_100039844 | |||
| 1564 | Ga0070665_100041106 | |||
| 1565 | Ga0070665_100071179 | |||
| 1566 | Ga0070665_100074754 | |||
| 1567 | Ga0070665_100103312 | |||
| 1568 | Ga0070665_100353004 | |||
| 1569 | Ga0068855_100000207 | |||
| 1570 | Ga0068855_100000468 | |||
| 1571 | Ga0068855_100128226 | |||
| 1572 | Ga0068855_100150706 | |||
| 1573 | Ga0068855_100199379 | |||
| 1574 | Ga0068855_100218568 | |||
| 1575 | Ga0068855_100283884 | |||
| 1576 | Ga0068855_100305039 | |||
| 1577 | Ga0068855_100336688 | |||
| 1578 | Ga0068855_100634770 | |||
| 1579 | Ga0070664_100005465 | |||
| 1580 | Ga0070664_100011359 | |||
| 1581 | Ga0070664_100011682 | |||
| 1582 | Ga0070664_100071906 | |||
| 1583 | Ga0070664_100074109 | |||
| 1584 | Ga0070664_100101369 | |||
| 1585 | Ga0070664_100180736 | |||
| 1586 | Ga0070664_100279813 | |||
| 1587 | Ga0068857_100016562 | |||
| 1588 | Ga0068857_100052526 | |||
| 1589 | Ga0068857_100102730 | |||
| 1590 | Ga0068857_100216769 | |||
| 1591 | Ga0068857_100239755 | |||
| 1592 | Ga0068854_100000874 | |||
| 1593 | Ga0068854_100001419 | |||
| 1594 | Ga0068854_100002336 | |||
| 1595 | Ga0068854_100010980 | |||
| 1596 | Ga0068854_100016007 | |||
| 1597 | Ga0068854_100053156 | |||
| 1598 | Ga0068854_100087547 | |||
| 1599 | Ga0068854_100143193 | |||
| 1600 | Ga0068854_100385002 | |||
| 1601 | Ga0068856_100004000 | |||
| 1602 | Ga0068856_100022632 | |||
| 1603 | Ga0068856_100165255 | |||
| 1604 | Ga0068856_100206084 | |||
| 1605 | Ga0068856_100262852 | |||
| 1606 | Ga0068852_100005304 | |||
| 1607 | Ga0068852_100005418 | |||
| 1608 | Ga0068852_100094326 | |||
| 1609 | Ga0068852_100154739 | |||
| 1610 | Ga0068852_100729260 | |||
| 1611 | Ga0068859_100000104 | |||
| 1612 | Ga0068859_100000286 | |||
| 1613 | Ga0068859_100002190 | |||
| 1614 | Ga0068859_100002837 | |||
| 1615 | Ga0068859_100009889 | |||
| 1616 | Ga0068859_100013205 | |||
| 1617 | Ga0068859_100019147 | |||
| 1618 | Ga0068859_100024626 | |||
| 1619 | Ga0068859_100064186 | |||
| 1620 | Ga0068859_100076580 | |||
| 1621 | Ga0068859_100120161 | |||
| 1622 | Ga0068864_100000042 | |||
| 1623 | Ga0068864_100000118 | |||
| 1624 | Ga0068864_100002169 | |||
| 1625 | Ga0068864_100003096 | |||
| 1626 | Ga0068864_100003259 | |||
| 1627 | Ga0068864_100008581 | |||
| 1628 | Ga0068864_100017649 | |||
| 1629 | Ga0068864_100018007 | |||
| 1630 | Ga0068864_100141363 | |||
| 1631 | Ga0068866_10063726 | |||
| 1632 | Ga0068866_10156508 | |||
| 1633 | Ga0068861_100000109 | |||
| 1634 | Ga0068861_100007704 | |||
| 1635 | Ga0068861_100105187 | |||
| 1636 | Ga0068861_100167586 | |||
| 1637 | Ga0068861_100298103 | |||
| 1638 | Ga0068851_10020234 | |||
| 1639 | Ga0068863_100000152 | |||
| 1640 | Ga0068863_100000186 | |||
| 1641 | Ga0068863_100001950 | |||
| 1642 | Ga0068863_100003849 | |||
| 1643 | Ga0068863_100004680 | |||
| 1644 | Ga0068863_100015933 | |||
| 1645 | Ga0068863_100019579 | |||
| 1646 | Ga0068863_100020111 | |||
| 1647 | Ga0068863_100040042 | |||
| 1648 | Ga0068863_100066623 | |||
| 1649 | Ga0068863_100066670 | |||
| 1650 | Ga0068858_100000274 | |||
| 1651 | Ga0068858_100000561 | |||
| 1652 | Ga0068858_100000723 | |||
| 1653 | Ga0068858_100012034 | |||
| 1654 | Ga0068858_100014401 | |||
| 1655 | Ga0068858_100025676 | |||
| 1656 | Ga0068860_100000106 | |||
| 1657 | Ga0068860_100000148 | |||
| 1658 | Ga0068860_100003623 | |||
| 1659 | Ga0068860_100004806 | |||
| 1660 | Ga0068860_100007728 | |||
| 1661 | Ga0068860_100009573 | |||
| 1662 | Ga0068860_100072001 | |||
| 1663 | Ga0068862_100000005 | |||
| 1664 | Ga0068862_100000014 | |||
| 1665 | Ga0068862_100000714 | |||
| 1666 | Ga0068862_100001201 | |||
| 1667 | Ga0068862_100002361 | |||
| 1668 | Ga0068862_100002421 | |||
| 1669 | Ga0068862_100014819 | |||
| 1670 | Ga0068862_100026085 | |||
| 1671 | Ga0068862_100028111 | |||
| 1672 | Ga0068862_100090943 | |||
| 1673 | Ga0068862_100139938 | |||
| 1674 | Ga0081539_10046059 | |||
| 1675 | Ga0075363_100037474 | |||
| 1676 | Ga0075364_10196977 | |||
| 1677 | Ga0075367_10012146 | |||
| 1678 | Ga0075366_10063278 | |||
| 1679 | Ga0075366_10100927 | |||
| 1680 | Ga0097621_100051110 | |||
| 1681 | Ga0097621_100082125 | |||
| 1682 | Ga0097621_100273498 | |||
| 1683 | Ga0075370_10050943 | |||
| 1684 | Ga0075370_10054405 | |||
| 1685 | Ga0068871_100012676 | |||
| 1686 | Ga0068871_100051342 | |||
| 1687 | Ga0068871_100500398 | |||
| 1688 | Ga0075428_100442091 | |||
| 1689 | Ga0075434_100166593 | |||
| 1690 | Ga0068865_100000005 | |||
| 1691 | Ga0068865_100171660 | |||
| 1692 | Ga0097620_100000104 | |||
| 1693 | Ga0097620_100000286 | |||
| 1694 | Ga0097620_100002190 | |||
| 1695 | Ga0097620_100002837 | |||
| 1696 | Ga0097620_100009888 | |||
| 1697 | Ga0097620_100013205 | |||
| 1698 | Ga0097620_100019145 | |||
| 1699 | Ga0097620_100024626 | |||
| 1700 | Ga0097620_100064190 | |||
| 1701 | Ga0097620_100076580 | |||
| 1702 | Ga0097620_100120158 | |||
| 1703 | Ga0105251_10033964 | |||
| 1704 | Ga0105250_10026890 | |||
| 1705 | Ga0105240_10001296 | |||
| 1706 | Ga0105240_10127643 | |||
| 1707 | Ga0105240_10251832 | |||
| 1708 | Ga0105240_10262200 | |||
| 1709 | Ga0105240_10273647 | |||
| 1710 | Ga0111539_10096650 | |||
| 1711 | Ga0105245_10000281 | |||
| 1712 | Ga0105245_10001668 | |||
| 1713 | Ga0105245_10030282 | |||
| 1714 | Ga0105247_10000465 | |||
| 1715 | Ga0105247_10000830 | |||
| 1716 | Ga0114129_10380427 | |||
| 1717 | Ga0105243_10000411 | |||
| 1718 | Ga0105243_10003479 | |||
| 1719 | Ga0105243_10013311 | |||
| 1720 | Ga0105243_10102179 | |||
| 1721 | Ga0105241_10003317 | |||
| 1722 | Ga0105241_10164866 | |||
| 1723 | Ga0105241_10209566 | |||
| 1724 | Ga0105241_10213212 | |||
| 1725 | Ga0105242_10001969 | |||
| 1726 | Ga0105242_10063280 | |||
| 1727 | Ga0105248_10000171 | |||
| 1728 | Ga0105248_10000295 | |||
| 1729 | Ga0105248_10000626 | |||
| 1730 | Ga0105248_10013669 | |||
| 1731 | Ga0105248_10045875 | |||
| 1732 | Ga0105248_10058317 | |||
| 1733 | Ga0105248_10105335 | |||
| 1734 | Ga0105248_10502025 | |||
| 1735 | Ga0105248_10547821 | |||
| 1736 | Ga0105237_10004686 | |||
| 1737 | Ga0105237_10022015 | |||
| 1738 | Ga0105237_10036941 | |||
| 1739 | Ga0105237_10066353 | |||
| 1740 | Ga0105237_10068401 | |||
| 1741 | Ga0105238_10002027 | |||
| 1742 | Ga0105238_10096439 | |||
| 1743 | Ga0105238_10098405 | |||
| 1744 | Ga0105238_10134776 | |||
| 1745 | Ga0105238_10505608 | |||
| 1746 | Ga0105238_10520312 | |||
| 1747 | Ga0105249_10000002 | |||
| 1748 | Ga0105249_10003111 | |||
| 1749 | Ga0105249_10006352 | |||
| 1750 | Ga0105249_10009826 | |||
| 1751 | Ga0105249_10033704 | |||
| 1752 | Ga0105249_10051833 | |||
| 1753 | Ga0105249_10077586 | |||
| 1754 | Ga0105249_10116167 | |||
| 1755 | Ga0105148_100047 | |||
| 1756 | Ga0105239_10000266 | |||
| 1757 | Ga0105239_10085122 | |||
| 1758 | Ga0105239_10110126 | |||
| 1759 | Ga0105246_10002967 | |||
| 1760 | Ga0105246_10039643 | |||
| 1761 | Ga0157326_1000559 | |||
| 1762 | Ga0157373_10009957 | |||
| 1763 | Ga0157373_10010481 | |||
| 1764 | Ga0157373_10013343 | |||
| 1765 | Ga0157373_10022838 | |||
| 1766 | Ga0157373_10092834 | |||
| 1767 | Ga0157373_10162908 | |||
| 1768 | Ga0157373_10165562 | |||
| 1769 | Ga0157371_10000062 | |||
| 1770 | Ga0157371_10040988 | |||
| 1771 | Ga0157371_10087118 | |||
| 1772 | Ga0157371_10160058 | |||
| 1773 | Ga0157371_10174668 | |||
| 1774 | Ga0157370_10000611 | |||
| 1775 | Ga0157370_10056321 | |||
| 1776 | Ga0157370_10069540 | |||
| 1777 | Ga0157370_10069936 | |||
| 1778 | Ga0157370_10237542 | |||
| 1779 | Ga0157369_10004697 | |||
| 1780 | Ga0157369_10034579 | |||
| 1781 | Ga0157369_10362366 | |||
| 1782 | Ga0157374_10001017 | |||
| 1783 | Ga0157374_10127707 | |||
| 1784 | Ga0157378_10001127 | |||
| 1785 | Ga0157378_10005257 | |||
| 1786 | Ga0163162_10014044 | |||
| 1787 | Ga0163162_10045213 | |||
| 1788 | Ga0163162_10128767 | |||
| 1789 | Ga0163162_10365752 | |||
| 1790 | Ga0163162_10629872 | |||
| 1791 | Ga0157372_10023486 | |||
| 1792 | Ga0157372_10024302 | |||
| 1793 | Ga0157372_10049722 | |||
| 1794 | Ga0157372_10406939 | |||
| 1795 | Ga0157372_10427514 | |||
| 1796 | Ga0157372_10509123 | |||
| 1797 | Ga0157372_10580103 | |||
| 1798 | Ga0157372_10611976 | |||
| 1799 | Ga0157375_10002160 | |||
| 1800 | Ga0157375_10448862 | |||
| 1801 | Ga0157375_10625967 | |||
| 1802 | Ga0163163_10000882 | |||
| 1803 | Ga0163163_10027458 | |||
| 1804 | Ga0163163_10048402 | |||
| 1805 | Ga0163163_10269882 | |||
| 1806 | Ga0157380_10000030 | |||
| 1807 | Ga0157380_10000365 | |||
| 1808 | Ga0157380_10004840 | |||
| 1809 | Ga0157380_10074108 | |||
| 1810 | Ga0157380_10079645 | |||
| 1811 | Ga0157380_10098239 | |||
| 1812 | Ga0157380_10108341 | |||
| 1813 | Ga0157379_10003869 | |||
| 1814 | Ga0157379_10004680 | |||
| 1815 | Ga0157379_10025399 | |||
| 1816 | Ga0157376_10001892 | |||
| 1817 | Ga0183363_1003 | |||
| 1818 | Ga0206356_10373769 | |||
| 1819 | Ga0206356_10882194 | |||
| 1820 | Ga0206353_10996392 | |||
| 1821 | Ga0206353_12001773 | |||
| 1822 | Ga0213876_10007008 | |||
| 1823 | Ga0213875_10000636 | |||
| 1824 | Ga0209563_100024 | |||
| 1825 | Ga0207427_101779 | |||
| 1826 | Ga0209437_104987 | |||
| 1827 | Ga0207425_1000005 | |||
| 1828 | Ga0209026_1002697 | |||
| 1829 | Ga0209148_1000008 | |||
| 1830 | Ga0209148_1000301 | |||
| 1831 | Ga0209148_1001740 | |||
| 1832 | Ga0209129_1000345 | |||
| 1833 | Ga0209233_1000003 | |||
| 1834 | Ga0209233_1000044 | |||
| 1835 | Ga0209565_1000010 | |||
| 1836 | Ga0209565_1000029 | |||
| 1837 | Ga0209565_1000052 | |||
| 1838 | Ga0209565_1009556 | |||
| 1839 | Ga0209455_1000002 | |||
| 1840 | Ga0209455_1000467 | |||
| 1841 | Ga0209455_1004431 | |||
| 1842 | Ga0209673_1002171 | |||
| 1843 | Ga0209673_1002668 | |||
| 1844 | Ga0209676_1005902 | |||
| 1845 | Ga0209025_1000855 | |||
| 1846 | Ga0209564_1000866 | |||
| 1847 | Ga0209564_1012788 | |||
| 1848 | Ga0209758_1000002 | |||
| 1849 | Ga0209758_1000007 | |||
| 1850 | Ga0209758_1025935 | |||
| 1851 | Ga0209050_1000001 | |||
| 1852 | Ga0209050_1000167 | |||
| 1853 | Ga0209050_1007940 | |||
| 1854 | Ga0209256_1000008 | |||
| 1855 | Ga0209256_1000012 | |||
| 1856 | Ga0209051_1000297 | |||
| 1857 | Ga0209257_1000028 | |||
| 1858 | Ga0209257_1002251 | |||
| 1859 | Ga0209257_1002675 | |||
| 1860 | Ga0209257_1002709 | |||
| 1861 | Ga0209257_1024069 | |||
| 1862 | Ga0207697_10000105 | |||
| 1863 | Ga0207697_10042941 | |||
| 1864 | Ga0207656_10031488 | |||
| 1865 | Ga0207656_10115232 | |||
| 1866 | Ga0207713_1027124 | |||
| 1867 | Ga0207682_10000970 | |||
| 1868 | Ga0207710_10010965 | |||
| 1869 | Ga0207710_10023316 | |||
| 1870 | Ga0207688_10066523 | |||
| 1871 | Ga0207688_10087546 | |||
| 1872 | Ga0207688_10088204 | |||
| 1873 | Ga0207680_10000299 | |||
| 1874 | Ga0207680_10056507 | |||
| 1875 | Ga0207647_10000643 | |||
| 1876 | Ga0207647_10002316 | |||
| 1877 | Ga0207647_10002797 | |||
| 1878 | Ga0207647_10003935 | |||
| 1879 | Ga0207647_10014925 | |||
| 1880 | Ga0207647_10041875 | |||
| 1881 | Ga0207647_10091413 | |||
| 1882 | Ga0207645_10002875 | |||
| 1883 | Ga0207645_10015633 | |||
| 1884 | Ga0207645_10093955 | |||
| 1885 | Ga0207645_10174161 | |||
| 1886 | Ga0207705_10000046 | |||
| 1887 | Ga0207705_10000181 | |||
| 1888 | Ga0207705_10000299 | |||
| 1889 | Ga0207705_10002601 | |||
| 1890 | Ga0207705_10006485 | |||
| 1891 | Ga0207705_10026336 | |||
| 1892 | Ga0207705_10034863 | |||
| 1893 | Ga0207705_10036465 | |||
| 1894 | Ga0207705_10083029 | |||
| 1895 | Ga0207705_10188398 | |||
| 1896 | Ga0207705_10204979 | |||
| 1897 | Ga0207654_10000741 | |||
| 1898 | Ga0207707_10053752 | |||
| 1899 | Ga0207707_10172064 | |||
| 1900 | Ga0207707_10274134 | |||
| 1901 | Ga0207707_10282574 | |||
| 1902 | Ga0207695_10000516 | |||
| 1903 | Ga0207695_10007459 | |||
| 1904 | Ga0207695_10012484 | |||
| 1905 | Ga0207695_10022835 | |||
| 1906 | Ga0207695_10141239 | |||
| 1907 | Ga0207695_10247953 | |||
| 1908 | Ga0207671_10019676 | |||
| 1909 | Ga0207671_10020388 | |||
| 1910 | Ga0207671_10031862 | |||
| 1911 | Ga0207660_10002059 | |||
| 1912 | Ga0207660_10016210 | |||
| 1913 | Ga0207660_10030179 | |||
| 1914 | Ga0207660_10201067 | |||
| 1915 | Ga0207660_10292345 | |||
| 1916 | Ga0207657_10001108 | |||
| 1917 | Ga0207657_10002117 | |||
| 1918 | Ga0207657_10003558 | |||
| 1919 | Ga0207657_10004994 | |||
| 1920 | Ga0207657_10005570 | |||
| 1921 | Ga0207657_10007755 | |||
| 1922 | Ga0207657_10038901 | |||
| 1923 | Ga0207657_10046247 | |||
| 1924 | Ga0207657_10049022 | |||
| 1925 | Ga0207657_10109844 | |||
| 1926 | Ga0207657_10126224 | |||
| 1927 | Ga0207657_10167370 | |||
| 1928 | Ga0207649_10020563 | |||
| 1929 | Ga0207649_10034748 | |||
| 1930 | Ga0207649_10061294 | |||
| 1931 | Ga0207649_10120262 | |||
| 1932 | Ga0207652_10082118 | |||
| 1933 | Ga0207652_10093551 | |||
| 1934 | Ga0207652_10126857 | |||
| 1935 | Ga0207652_10130312 | |||
| 1936 | Ga0207652_10150879 | |||
| 1937 | Ga0207652_10171552 | |||
| 1938 | Ga0207652_10398027 | |||
| 1939 | Ga0207652_10428955 | |||
| 1940 | Ga0207652_10523714 | |||
| 1941 | Ga0207681_10000003 | |||
| 1942 | Ga0207681_10000010 | |||
| 1943 | Ga0207681_10000049 | |||
| 1944 | Ga0207681_10029445 | |||
| 1945 | Ga0207681_10061664 | |||
| 1946 | Ga0207681_10287104 | |||
| 1947 | Ga0207681_10444687 | |||
| 1948 | Ga0207681_10447058 | |||
| 1949 | Ga0207694_10066128 | |||
| 1950 | Ga0207694_10082193 | |||
| 1951 | Ga0207694_10367958 | |||
| 1952 | Ga0207650_10000012 | |||
| 1953 | Ga0207650_10012956 | |||
| 1954 | Ga0207650_10035436 | |||
| 1955 | Ga0207650_10038261 | |||
| 1956 | Ga0207650_10038930 | |||
| 1957 | Ga0207650_10075913 | |||
| 1958 | Ga0207650_10077064 | |||
| 1959 | Ga0207650_10105107 | |||
| 1960 | Ga0207650_10195318 | |||
| 1961 | Ga0207650_10214693 | |||
| 1962 | Ga0207659_10013860 | |||
| 1963 | Ga0207659_10019949 | |||
| 1964 | Ga0207659_10066375 | |||
| 1965 | Ga0207659_10071154 | |||
| 1966 | Ga0207659_10260604 | |||
| 1967 | Ga0207687_10010131 | |||
| 1968 | Ga0207687_10049796 | |||
| 1969 | Ga0207700_10138279 | |||
| 1970 | Ga0207644_10000007 | |||
| 1971 | Ga0207644_10000032 | |||
| 1972 | Ga0207644_10000052 | |||
| 1973 | Ga0207644_10000069 | |||
| 1974 | Ga0207644_10066824 | |||
| 1975 | Ga0207644_10112012 | |||
| 1976 | Ga0207644_10223483 | |||
| 1977 | Ga0207690_10000020 | |||
| 1978 | Ga0207690_10001383 | |||
| 1979 | Ga0207690_10016682 | |||
| 1980 | Ga0207690_10076960 | |||
| 1981 | Ga0207690_10107485 | |||
| 1982 | Ga0207690_10162215 | |||
| 1983 | Ga0207690_10170013 | |||
| 1984 | Ga0207690_10328257 | |||
| 1985 | Ga0207706_10003116 | |||
| 1986 | Ga0207706_10021858 | |||
| 1987 | Ga0207706_10026051 | |||
| 1988 | Ga0207706_10041512 | |||
| 1989 | Ga0207706_10041713 | |||
| 1990 | Ga0207706_10052489 | |||
| 1991 | Ga0207706_10066126 | |||
| 1992 | Ga0207706_10292387 | |||
| 1993 | Ga0207686_10005035 | |||
| 1994 | Ga0207709_10000005 | |||
| 1995 | Ga0207709_10000051 | |||
| 1996 | Ga0207709_10017408 | |||
| 1997 | Ga0207670_10145285 | |||
| 1998 | Ga0207669_10000742 | |||
| 1999 | Ga0207669_10001774 | |||
| 2000 | Ga0207669_10028122 | |||
| 2001 | Ga0207669_10057581 | |||
| 2002 | Ga0207704_10000001 | |||
| 2003 | Ga0207691_10011367 | |||
| 2004 | Ga0207691_10036585 | |||
| 2005 | Ga0207691_10040846 | |||
| 2006 | Ga0207691_10087562 | |||
| 2007 | Ga0207691_10088679 | |||
| 2008 | Ga0207691_10379635 | |||
| 2009 | Ga0207711_10000153 | |||
| 2010 | Ga0207711_10001371 | |||
| 2011 | Ga0207711_10011668 | |||
| 2012 | Ga0207711_10055660 | |||
| 2013 | Ga0207711_10089499 | |||
| 2014 | Ga0207711_10165514 | |||
| 2015 | Ga0207711_10172504 | |||
| 2016 | Ga0207711_10327237 | |||
| 2017 | Ga0207711_10459114 | |||
| 2018 | Ga0207689_10005027 | |||
| 2019 | Ga0207689_10093499 | |||
| 2020 | Ga0207689_10105177 | |||
| 2021 | Ga0207661_10016501 | |||
| 2022 | Ga0207661_10089152 | |||
| 2023 | Ga0207661_10303553 | |||
| 2024 | Ga0207679_10170520 | |||
| 2025 | Ga0207679_10202423 | |||
| 2026 | Ga0207679_10214166 | |||
| 2027 | Ga0207679_10235480 | |||
| 2028 | Ga0207667_10000024 | |||
| 2029 | Ga0207667_10000852 | |||
| 2030 | Ga0207667_10002816 | |||
| 2031 | Ga0207667_10220220 | |||
| 2032 | Ga0207667_10272166 | |||
| 2033 | Ga0207651_10000006 | |||
| 2034 | Ga0207651_10050762 | |||
| 2035 | Ga0207651_10073534 | |||
| 2036 | Ga0207651_10131110 | |||
| 2037 | Ga0207651_10223588 | |||
| 2038 | Ga0207712_10000002 | |||
| 2039 | Ga0207712_10002585 | |||
| 2040 | Ga0207712_10010885 | |||
| 2041 | Ga0207712_10030000 | |||
| 2042 | Ga0207712_10237933 | |||
| 2043 | Ga0207712_10322510 | |||
| 2044 | Ga0207668_10000006 | |||
| 2045 | Ga0207668_10000034 | |||
| 2046 | Ga0207668_10000321 | |||
| 2047 | Ga0207668_10002255 | |||
| 2048 | Ga0207668_10006614 | |||
| 2049 | Ga0207668_10008868 | |||
| 2050 | Ga0207668_10010065 | |||
| 2051 | Ga0207668_10022336 | |||
| 2052 | Ga0207668_10070992 | |||
| 2053 | Ga0207668_10075528 | |||
| 2054 | Ga0207640_10000109 | |||
| 2055 | Ga0207640_10006284 | |||
| 2056 | Ga0207640_10009825 | |||
| 2057 | Ga0207640_10012181 | |||
| 2058 | Ga0207640_10013565 | |||
| 2059 | Ga0207640_10020357 | |||
| 2060 | Ga0207640_10028939 | |||
| 2061 | Ga0207640_10118678 | |||
| 2062 | Ga0207640_10124510 | |||
| 2063 | Ga0207658_10000026 | |||
| 2064 | Ga0207658_10000069 | |||
| 2065 | Ga0207658_10003813 | |||
| 2066 | Ga0207658_10004121 | |||
| 2067 | Ga0207658_10016310 | |||
| 2068 | Ga0207658_10020099 | |||
| 2069 | Ga0207658_10020601 | |||
| 2070 | Ga0207658_10034220 | |||
| 2071 | Ga0207658_10102527 | |||
| 2072 | Ga0207658_10162940 | |||
| 2073 | Ga0207677_10000156 | |||
| 2074 | Ga0207677_10012718 | |||
| 2075 | Ga0207703_10001033 | |||
| 2076 | Ga0207703_10002370 | |||
| 2077 | Ga0207703_10003077 | |||
| 2078 | Ga0207703_10004091 | |||
| 2079 | Ga0207703_10004901 | |||
| 2080 | Ga0207703_10087222 | |||
| 2081 | Ga0207639_10001528 | |||
| 2082 | Ga0207639_10004179 | |||
| 2083 | Ga0207639_10004479 | |||
| 2084 | Ga0207639_10032831 | |||
| 2085 | Ga0207639_10050815 | |||
| 2086 | Ga0207639_10060713 | |||
| 2087 | Ga0207639_10091673 | |||
| 2088 | Ga0207639_10093055 | |||
| 2089 | Ga0207639_10192547 | |||
| 2090 | Ga0207678_10000080 | |||
| 2091 | Ga0207678_10000680 | |||
| 2092 | Ga0207678_10003120 | |||
| 2093 | Ga0207678_10003478 | |||
| 2094 | Ga0207678_10004958 | |||
| 2095 | Ga0207678_10023620 | |||
| 2096 | Ga0207678_10059541 | |||
| 2097 | Ga0207678_10119066 | |||
| 2098 | Ga0207678_10228415 | |||
| 2099 | Ga0207702_10001603 | |||
| 2100 | Ga0207702_10003537 | |||
| 2101 | Ga0207702_10005016 | |||
| 2102 | Ga0207702_10009720 | |||
| 2103 | Ga0207702_10021712 | |||
| 2104 | Ga0207702_10154436 | |||
| 2105 | Ga0207702_10285661 | |||
| 2106 | Ga0207702_10536686 | |||
| 2107 | Ga0207641_10000031 | |||
| 2108 | Ga0207641_10000205 | |||
| 2109 | Ga0207641_10000617 | |||
| 2110 | Ga0207641_10001438 | |||
| 2111 | Ga0207641_10003069 | |||
| 2112 | Ga0207641_10004589 | |||
| 2113 | Ga0207641_10006151 | |||
| 2114 | Ga0207641_10012621 | |||
| 2115 | Ga0207641_10018768 | |||
| 2116 | Ga0207641_10037164 | |||
| 2117 | Ga0207641_10090902 | |||
| 2118 | Ga0207641_10099749 | |||
| 2119 | Ga0207648_10000363 | |||
| 2120 | Ga0207648_10004614 | |||
| 2121 | Ga0207648_10073095 | |||
| 2122 | Ga0207676_10000009 | |||
| 2123 | Ga0207676_10001710 | |||
| 2124 | Ga0207676_10001834 | |||
| 2125 | Ga0207676_10004450 | |||
| 2126 | Ga0207676_10006981 | |||
| 2127 | Ga0207676_10012120 | |||
| 2128 | Ga0207676_10060246 | |||
| 2129 | Ga0207676_10061808 | |||
| 2130 | Ga0207674_10000284 | |||
| 2131 | Ga0207674_10002418 | |||
| 2132 | Ga0207674_10004022 | |||
| 2133 | Ga0207674_10004819 | |||
| 2134 | Ga0207674_10012727 | |||
| 2135 | Ga0207674_10016332 | |||
| 2136 | Ga0207674_10019804 | |||
| 2137 | Ga0207674_10028832 | |||
| 2138 | Ga0207674_10031068 | |||
| 2139 | Ga0207674_10065001 | |||
| 2140 | Ga0207674_10172960 | |||
| 2141 | Ga0207675_100000053 | |||
| 2142 | Ga0207675_100000255 | |||
| 2143 | Ga0207675_100001380 | |||
| 2144 | Ga0207675_100071737 | |||
| 2145 | Ga0207675_100376066 | |||
| 2146 | Ga0207683_10002674 | |||
| 2147 | Ga0207683_10003233 | |||
| 2148 | Ga0207698_10000964 | |||
| 2149 | Ga0207698_10002279 | |||
| 2150 | Ga0207698_10003975 | |||
| 2151 | Ga0207698_10026953 | |||
| 2152 | Ga0207698_10507191 | |||
| 2153 | Ga0209813_10000014 | |||
| 2154 | Ga0209974_10021647 | |||
| 2155 | Ga0209974_10029267 | |||
| 2156 | Ga0268266_10000002 | |||
| 2157 | Ga0268266_10000626 | |||
| 2158 | Ga0268266_10008582 | |||
| 2159 | Ga0268266_10010736 | |||
| 2160 | Ga0268266_10012663 | |||
| 2161 | Ga0268266_10016041 | |||
| 2162 | Ga0268266_10017080 | |||
| 2163 | Ga0268266_10143703 | |||
| 2164 | Ga0268266_10273355 | |||
| 2165 | Ga0268266_10300108 | |||
| 2166 | Ga0268266_10377681 | |||
| 2167 | Ga0268265_10000001 | |||
| 2168 | Ga0268265_10000048 | |||
| 2169 | Ga0268265_10000972 | |||
| 2170 | Ga0268265_10001068 | |||
| 2171 | Ga0268265_10001877 | |||
| 2172 | Ga0268265_10005131 | |||
| 2173 | Ga0268265_10008778 | |||
| 2174 | Ga0268265_10010546 | |||
| 2175 | Ga0268265_10025582 | |||
| 2176 | Ga0268265_10130476 | |||
| 2177 | Ga0268265_10149800 | |||
| 2178 | Ga0268265_10251546 | |||
| 2179 | Ga0268264_10000076 | |||
| 2180 | Ga0268264_10000106 | |||
| 2181 | Ga0268264_10000217 | |||
| 2182 | Ga0268264_10000439 | |||
| 2183 | Ga0268264_10000645 | |||
| 2184 | Ga0268264_10003344 | |||
| 2185 | Ga0268264_10046997 | |||
| 2186 | Ga0268264_10131719 | |||
| 2187 | Ga0268264_10172584 | |||
| 2188 | Ga0307517_10001703 | |||
| 2189 | Ga0307515_10288239 | |||
| 2190 | Ga0307513_10021142 | |||
| 2191 | Ga0307513_10078148 | |||
| 2192 | Ga0307513_10343196 | |||
| 2193 | Ga0307509_10225888 | |||
| 2194 | Ga0307408_100021735 | |||
| 2195 | Ga0307408_100029774 | |||
| 2196 | Ga0307408_100038304 | |||
| 2197 | Ga0307408_100045920 | |||
| 2198 | Ga0307408_100053685 | |||
| 2199 | Ga0307408_100125754 | |||
| 2200 | Ga0307408_100414950 | |||
| 2201 | Ga0307405_10014730 | |||
| 2202 | Ga0307405_10067652 | |||
| 2203 | Ga0307405_10096911 | |||
| 2204 | Ga0307405_10104681 | |||
| 2205 | Ga0307405_10122976 | |||
| 2206 | Ga0307405_10201270 | |||
| 2207 | Ga0307405_10219015 | |||
| 2208 | Ga0307413_10008683 | |||
| 2209 | Ga0307413_10081449 | |||
| 2210 | Ga0307413_10108764 | |||
| 2211 | Ga0307413_10111929 | |||
| 2212 | Ga0307413_10115938 | |||
| 2213 | Ga0307413_10138495 | |||
| 2214 | Ga0307410_10001691 | |||
| 2215 | Ga0307410_10015931 | |||
| 2216 | Ga0307410_10024939 | |||
| 2217 | Ga0307410_10057510 | |||
| 2218 | Ga0307410_10064707 | |||
| 2219 | Ga0307410_10071379 | |||
| 2220 | Ga0307410_10081235 | |||
| 2221 | Ga0307410_10082071 | |||
| 2222 | Ga0307410_10104263 | |||
| 2223 | Ga0307410_10252591 | |||
| 2224 | Ga0307406_10010818 | |||
| 2225 | Ga0307406_10014221 | |||
| 2226 | Ga0307406_10030679 | |||
| 2227 | Ga0307406_10253402 | |||
| 2228 | Ga0307407_10043436 | |||
| 2229 | Ga0307407_10052426 | |||
| 2230 | Ga0307407_10076751 | |||
| 2231 | Ga0307407_10300882 | |||
| 2232 | Ga0307412_10001006 | |||
| 2233 | Ga0307412_10010753 | |||
| 2234 | Ga0307412_10015861 | |||
| 2235 | Ga0307412_10026558 | |||
| 2236 | Ga0307412_10090404 | |||
| 2237 | Ga0307412_10131208 | |||
| 2238 | Ga0307412_10258661 | |||
| 2239 | Ga0307409_100003480 | |||
| 2240 | Ga0307409_100008340 | |||
| 2241 | Ga0307409_100014339 | |||
| 2242 | Ga0307409_100019207 | |||
| 2243 | Ga0307409_100051476 | |||
| 2244 | Ga0307409_100090909 | |||
| 2245 | Ga0307409_100162794 | |||
| 2246 | Ga0307409_100167198 | |||
| 2247 | Ga0307409_100176297 | |||
| 2248 | Ga0307409_100178903 | |||
| 2249 | Ga0307409_100196260 | |||
| 2250 | Ga0307409_100197829 | |||
| 2251 | Ga0307409_100597173 | |||
| 2252 | Ga0307416_100008527 | |||
| 2253 | Ga0307416_100009876 | |||
| 2254 | Ga0307416_100032224 | |||
| 2255 | Ga0307416_100041334 | |||
| 2256 | Ga0307416_100041956 | |||
| 2257 | Ga0307416_100120714 | |||
| 2258 | Ga0307416_100206387 | |||
| 2259 | Ga0307416_100256220 | |||
| 2260 | Ga0307416_100263142 | |||
| 2261 | Ga0307416_100377439 | |||
| 2262 | Ga0307416_100490352 | |||
| 2263 | Ga0307416_100756164 | |||
| 2264 | Ga0307414_10000463 | |||
| 2265 | Ga0307414_10013269 | |||
| 2266 | Ga0307414_10018046 | |||
| 2267 | Ga0307414_10022267 | |||
| 2268 | Ga0307414_10032046 | |||
| 2269 | Ga0307414_10038232 | |||
| 2270 | Ga0307414_10040883 | |||
| 2271 | Ga0307414_10050706 | |||
| 2272 | Ga0307414_10080498 | |||
| 2273 | Ga0307414_10089233 | |||
| 2274 | Ga0307414_10095902 | |||
| 2275 | Ga0307414_10100857 | |||
| 2276 | Ga0307414_10364778 | |||
| 2277 | Ga0307414_10584610 | |||
| 2278 | Ga0307411_10004366 | |||
| 2279 | Ga0307411_10007971 | |||
| 2280 | Ga0307411_10011224 | |||
| 2281 | Ga0307411_10013119 | |||
| 2282 | Ga0307411_10028624 | |||
| 2283 | Ga0307411_10125648 | |||
| 2284 | Ga0307411_10180873 | |||
| 2285 | Ga0307411_10234088 | |||
| 2286 | Ga0307411_10239316 | |||
| 2287 | Ga0307411_10283227 | |||
| 2288 | Ga0307415_100015317 | |||
| 2289 | Ga0307415_100029178 | |||
| 2290 | Ga0307415_100112216 | |||
| 2291 | Ga0307415_100129515 | |||
| 2292 | Ga0307415_100162034 | |||
| 2293 | Ga0307415_100163138 | |||
| 2294 | Ga0307415_100403440 | |||
| 2295 | Ga0307415_100469859 | |||
| 2296 | Ga0307510_10000248 | |||
| 2297 | Ga0307510_10040635 | |||
| 2298 | Ga0307510_10182106 | |||
| 2299 | Ga0373927_0071656 | |||
| 2300 | Ga0395899_0004754 | |||
| 2301 | Ga0395899_0077243 | |||
| 2302 | Ga0395899_0130846 | |||
| 2303 | Ga0395900_0006155 | |||
| 2304 | Ga0395900_0010551 | |||
| 2305 | Ga0395900_0018554 | |||
| 2306 | Ga0395900_0053239 | |||
| 2307 | Ga0395900_0090942 | |||
| 2308 | Ga0395900_0120339 | |||
| 2309 | Ga0395900_0187899 | |||
| 2310 | Ga0395900_0279352 | |||
| 2311 | Ga0395900_0358415 | |||
| 2312 | Ga0395898_0032517 | |||
| 2313 | Ga0395898_0223001 | |||
| 2314 | Ga0395898_0292281 | |||
| 2315 | Ga0395898_0363665 | |||
| 2316 | Ga0395898_0697633 | |||
| 2317 | Ga0395905_0000232 | |||
| 2318 | Ga0395905_0028518 | |||
| 2319 | Ga0395905_0041496 | |||
| 2320 | Ga0395905_0048257 | |||
| 2321 | Ga0395905_0066004 | |||
| 2322 | Ga0395905_0153646 | |||
| 2323 | Ga0395905_0310815 | |||
| 2324 | Ga0395905_0412896 | |||
| 2325 | Ga0436364_0551790 | |||
| 2326 | Ga0436364_0786820 | |||
| 2327 | Ga0436364_0816160 | |||
| 2328 | Ga0395901_0024797 | |||
| 2329 | Ga0395901_0056296 | |||
| 2330 | Ga0395901_0250660 | |||
| 2331 | Ga0395901_0521418 | |||
| 2332 | Ga0237819_00556 | |||
| 2333 | Ga0436365_1650189 | |||
| 2334 | Ga0439436_0053380 | |||
| 2335 | Ga0439461_0000081 | |||
| 2336 | Ga0439466_0032477 | |||
| 2337 | Ga0439465_0001389 | |||
| 2338 | Ga0439465_0028487 | |||
| 2339 | Ga0451807_2106806 | |||
| 2340 | Ga0439431_0000134 | |||
| 2341 | Ga0439431_0029888 | |||
| 2342 | Ga0439442_003063 | |||
| 2343 | Ga0439445_0000905 | |||
| 2344 | Ga0439432_000152 | |||
| 2345 | Ga0439432_016068 | |||
| 2346 | Ga0439449_0008461 | |||
| 2347 | Ga0439449_0021174 | |||
| 2348 | Ga0439452_014099 | |||
| 2349 | Ga0439452_025818 | |||
| 2350 | Ga0439455_0000107 | |||
| 2351 | Ga0439462_0000151 | |||
| 2352 | Ga0439462_0004098 | |||
| 2353 | Ga0450919_004896 | |||
| 2354 | Ga0450920_009964 | |||
| 2355 | Ga0450891_004362 | |||
| 2356 | Ga0450889_000118 | |||
| 2357 | Ga0439446_0038448 | |||
| 2358 | Ga0439458_0000371 | |||
| 2359 | Ga0439458_0004674 | |||
| 2360 | Ga0439434_0000213 | |||
| 2361 | Ga0451577_0339336 | |||
| 2362 | Ga0466966_0316951 | |||
| 2363 | Ga0466961_0067645 | |||
| 2364 | Ga0466963_0004135 | |||
| 2365 | Ga0466963_0212209 | |||
| 2366 | Ga0466963_0337181 | |||
| 2367 | Ga0466964_0016202 | |||
| 2368 | Ga0466971_0003306 | |||
| 2369 | Ga0466971_0074812 | |||
| 2370 | Ga0466968_0054218 | |||
| 2371 | Ga0466957_0021802 | |||
| 2372 | Ga0466960_0044375 | |||
| 2373 | Ga0466959_0292751 | |||
| 2374 | Ga0466959_0304717 | |||
| 2375 | Ga0466958_0069813 | |||
| 2376 | Ga0466958_0191725 | |||
| 2377 | Ga0466967_0012308 | |||
| 2378 | Ga0466967_0019763 | |||
| 2379 | Ga0466967_0478654 | |||
| 2380 | Ga0495627_006112 | |||
| 2381 | Ga0495638_0001117 | |||
| 2382 | Ga0495638_0007198 | |||
| 2383 | Ga0495638_0024614 | |||
| 2384 | Ga0495638_0054138 | |||
| 2385 | Ga0495650_0027007 | |||
| 2386 | Ga0495584_0081542 | |||
| 2387 | Ga0495585_0000933 | |||
| 2388 | Ga0495607_0008896 | |||
| 2389 | Ga0495583_0000358 | |||
| 2390 | Ga0495583_0006282 | |||
| 2391 | Ga0495583_0006422 | |||
| 2392 | Ga0495583_0012582 | |||
| 2393 | Ga0495583_0014543 | |||
| 2394 | Ga0495583_0024689 | |||
| 2395 | Ga0495606_0000457 | |||
| 2396 | Ga0495606_0033751 | |||
| 2397 | Ga0495616_0029958 | |||
| 2398 | Ga0495631_0006313 | |||
| 2399 | Ga0495637_0009055 | |||
| 2400 | Ga0495643_0003269 | |||
| 2401 | Ga0495643_0126952 | |||
| 2402 | Ga0495643_0139080 | |||
| 2403 | Ga0495648_0001493 | |||
| 2404 | Ga0495648_0033863 | |||
| 2405 | Ga0495648_0036481 | |||
| 2406 | Ga0495648_0060079 | |||
| 2407 | Ga0495648_0140727 | |||
| 2408 | Ga0495663_0000435 | |||
| 2409 | Ga0495663_0039188 | |||
| 2410 | Ga0495654_0000338 | |||
| 2411 | Ga0495597_0031047 | |||
| 2412 | Ga0495597_0039105 | |||
| 2413 | Ga0495622_0004163 | |||
| 2414 | Ga0495622_0004720 | |||
| 2415 | Ga0495633_0000690 | |||
| 2416 | Ga0495633_0011005 | |||
| 2417 | Ga0495633_0157489 | |||
| 2418 | Ga0495668_0000059 | |||
| 2419 | Ga0495668_0002301 | |||
| 2420 | Ga0495668_0005543 | |||
| 2421 | Ga0495668_0013937 | |||
| 2422 | Ga0495668_0064687 | |||
| 2423 | Ga0495668_0113197 | |||
| 2424 | Ga0495668_0124350 | |||
| 2425 | Ga0495611_0070043 | |||
| 2426 | Ga0495625_0000094 | |||
| 2427 | Ga0495625_0004059 | |||
| 2428 | Ga0495625_0005946 | |||
| 2429 | Ga0495625_0012086 | |||
| 2430 | Ga0495625_0194363 | |||
| 2431 | Ga0495625_0207866 | |||
| 2432 | Ga0495623_0215794 | |||
| 2433 | Ga0495669_0000058 | |||
| 2434 | Ga0495669_0003419 | |||
| 2435 | Ga0495669_0017312 | |||
| 2436 | Ga0495669_0019801 | |||
| 2437 | Ga0495669_0033342 | |||
| 2438 | Ga0495670_0000016 | |||
| 2439 | Ga0495670_0054654 | |||
| 2440 | Ga0495671_0010759 | |||
| 2441 | Ga0495671_0082351 | |||
| 2442 | Ga0495649_0054082 | |||
| 2443 | Ga0495660_0033946 | |||
| 2444 | Ga0495660_0087453 | |||
| 2445 | Ga0495683_0006073 | |||
| 2446 | Ga0495687_000083 | |||
| 2447 | Ga0495687_000152 | |||
| 2448 | Ga0495677_0006604 | |||
| 2449 | Ga0495677_0015249 | |||
| 2450 | Ga0495681_0003027 | |||
| 2451 | Ga0495681_0022129 | |||
| 2452 | Ga0495681_0026507 | |||
| 2453 | Ga0495686_0000100 | |||
| 2454 | Ga0495686_0000209 | |||
| 2455 | Ga0495686_0000300 | |||
| 2456 | Ga0495686_0008787 | |||
| 2457 | Ga0495686_0031244 | |||
| 2458 | Ga0495686_0048709 | |||
| 2459 | Ga0495686_0115656 | |||
| 2460 | Ga0496100_0052989 | |||
| 2461 | Ga0496100_0408691 | |||
| 2462 | Ga0496102_0000321 | |||
| 2463 | Ga0496102_0000372 | |||
| 2464 | Ga0496102_0013635 | |||
| 2465 | Ga0496102_0737498 | |||
| 2466 | Ga0496103_0000021 | |||
| 2467 | Ga0496103_0000199 | |||
| 2468 | Ga0496103_0020370 | |||
| 2469 | Ga0496104_0000128 | |||
| 2470 | Ga0496104_0200548 | |||
| 2471 | Ga0496105_0000064 | |||
| 2472 | Ga0496107_0060793 | |||
| 2473 | Ga0496107_0112532 | |||
| 2474 | Ga0496107_0209131 | |||
| 2475 | Ga0496108_0000270 | |||
| 2476 | Ga0496108_0003272 | |||
| 2477 | Ga0496108_0013648 | |||
| 2478 | Ga0496108_0238511 | |||
| 2479 | Ga0496108_0316635 | |||
| 2480 | Ga0496109_0012198 | |||
| 2481 | Ga0496109_0017884 | |||
| 2482 | Ga0496110_0008670 | |||
| 2483 | Ga0496110_0018618 | |||
| 2484 | Ga0496110_0209858 | |||
| 2485 | Ga0496111_0007263 | |||
| 2486 | Ga0496111_0073251 | |||
| 2487 | Ga0496112_0011063 | |||
| 2488 | Ga0496112_0018560 | |||
| 2489 | Ga0496112_0024945 | |||
| 2490 | Ga0496113_0000044 | |||
| 2491 | Ga0496113_0001779 | |||
| 2492 | Ga0496113_0010090 | |||
| 2493 | Ga0496113_0039617 | |||
| 2494 | Ga0496113_0223916 | |||
| 2495 | Ga0496114_0188465 | |||
| 2496 | Ga0496115_0004300 | |||
| 2497 | Ga0496116_0000648 | |||
| 2498 | Ga0496116_0060403 | |||
| 2499 | Ga0496116_0189969 | |||
| 2500 | Ga0496117_0000584 | |||
| 2501 | Ga0496117_0001310 | |||
| 2502 | Ga0496117_0009809 | |||
| 2503 | Ga0496117_0035784 | |||
| 2504 | Ga0496118_0000588 | |||
| 2505 | Ga0496118_0003241 | |||
| 2506 | Ga0496118_0063764 | |||
| 2507 | Ga0496118_0069773 | |||
| 2508 | Ga0496118_0095905 | |||
| 2509 | Ga0496119_0000077 | |||
| 2510 | Ga0496119_0024187 | |||
| 2511 | Ga0496119_0041571 | |||
| 2512 | Ga0496120_0001955 | |||
| 2513 | Ga0496120_0016721 | |||
| 2514 | Ga0496120_0207791 | |||
| 2515 | Ga0496121_0000163 | |||
| 2516 | Ga0496121_0001865 | |||
| 2517 | Ga0496121_0002849 | |||
| 2518 | Ga0496121_0005208 | |||
| 2519 | Ga0496121_0010109 | |||
| 2520 | Ga0496121_0043634 | |||
| 2521 | Ga0496121_0091189 | |||
| 2522 | Ga0496121_0182928 | |||
| 2523 | Ga0496122_0001166 | |||
| 2524 | Ga0496122_0001683 | |||
| 2525 | Ga0496122_0004055 | |||
| 2526 | Ga0496122_0009279 | |||
| 2527 | Ga0496122_0029763 | |||
| 2528 | Ga0496123_0000542 | |||
| 2529 | Ga0496123_0001103 | |||
| 2530 | Ga0496123_0011457 | |||
| 2531 | Ga0496123_0018448 | |||
| 2532 | Ga0496123_0018488 | |||
| 2533 | Ga0496123_0022752 | |||
| 2534 | Ga0496123_0039900 | |||
| 2535 | Ga0496123_0061608 | |||
| 2536 | Ga0496123_0070592 | |||
| 2537 | Ga0496123_0102011 | |||
| 2538 | Ga0496123_0113327 | |||
| 2539 | Ga0496124_0000354 | |||
| 2540 | Ga0496124_0000387 | |||
| 2541 | Ga0496124_0001269 | |||
| 2542 | Ga0496124_0008572 | |||
| 2543 | Ga0496124_0009752 | |||
| 2544 | Ga0496124_0027461 | |||
| 2545 | Ga0496124_0031798 | |||
| 2546 | Ga0496124_0033453 | |||
| 2547 | Ga0496124_0109432 | |||
| 2548 | Ga0496125_0000687 | |||
| 2549 | Ga0496125_0001135 | |||
| 2550 | Ga0496125_0010521 | |||
| 2551 | Ga0496125_0014132 | |||
| 2552 | Ga0496125_0023090 | |||
| 2553 | Ga0496125_0039372 | |||
| 2554 | Ga0496125_0151987 | |||
| 2555 | Ga0496125_0155808 | |||
| 2556 | Ga0496126_0000175 | |||
| 2557 | Ga0496126_0006303 | |||
| 2558 | Ga0496126_0024925 | |||
| 2559 | Ga0496126_0037074 | |||
| 2560 | Ga0496126_0174180 | |||
| 2561 | Ga0496126_0183686 | |||
| 2562 | Ga0496126_0184844 | |||
| 2563 | Ga0501290_001241 | |||
| 2564 | Ga0501292_000012 | |||
| 2565 | Ga0501033_0153155 | |||
| 2566 | Ga0501034_0014162 | |||
| 2567 | Ga0501043_0027180 | |||
| 2568 | Ga0501046_0246584 | |||
| 2569 | Ga0501047_0002016 | |||
| 2570 | Ga0501047_0138887 | |||
| 2571 | Ga0501067_0013236 | |||
| 2572 | Ga0501068_0061284 | |||
| 2573 | Ga0501209_042906 | |||
| 2574 | Ga0501223_000111 | |||
| 2575 | Ga0501223_002079 | |||
| 2576 | Ga0501224_000024 | |||
| 2577 | Ga0501224_000250 | |||
| 2578 | Ga0501257_011461 | |||
| 2579 | Ga0501259_015058 | |||
| 2580 | Ga0501225_0000004 | |||
| 2581 | Ga0501225_0000017 | |||
| 2582 | Ga0501225_0008251 | |||
| 2583 | Ga0501241_003853 | |||
| 2584 | Ga0501279_000012 | |||
| 2585 | Ga0501280_000052 | |||
| 2586 | Ga0501282_000586 | |||
| 2587 | Ga0501283_006592 | |||
| 2588 | Ga0501044_0064208 | |||
| 2589 | Ga0501044_0123466 | |||
| 2590 | Ga0501226_000072 | |||
| 2591 | nmdc:mga03683_39951_c1 | |||
| 2592 | nmdc:mga00v17_54411_c1 | |||
| 2593 | nmdc:mga0k408_59255_c1 | |||
| 2594 | nmdc:mga0k408_85431_c1 | |||
| 2595 | nmdc:mga06z11_47_c1 | |||
| 2596 | nmdc:mga04h51_182_c1 | |||
| 2597 | nmdc:mga05p37_458637_c1 | |||
| 2598 | nmdc:mga08y16_44274_c1 | |||
| 2599 | nmdc:mga0n895_301325_c1 | |||
| 2600 | Ga0500610_0000029 | |||
| 2601 | Ga0500643_000096 | |||
| 2602 | Ga0500643_000611 | |||
| 2603 | Ga0500643_001187 | |||
| 2604 | Ga0500643_001703 | |||
| 2605 | Ga0500643_002575 | |||
| 2606 | Ga0500643_003036 | |||
| 2607 | Ga0500583_0045830 | |||
| 2608 | Ga0500651_0009427 | |||
| 2609 | Ga0500641_0008635 | |||
| 2610 | Ga0500641_0042853 | |||
| 2611 | Ga0500555_003364 | |||
| 2612 | Ga0500556_0000053 | |||
| 2613 | Ga0500556_0006126 | |||
| 2614 | Ga0500592_013655 | |||
| 2615 | Ga0500594_0005984 | |||
| 2616 | Ga0500595_001869 | |||
| 2617 | Ga0500614_003766 | |||
| 2618 | Ga0500617_066071 | |||
| 2619 | Ga0500618_014164 | |||
| 2620 | Ga0500618_017070 | |||
| 2621 | Ga0500642_0000001 | |||
| 2622 | Ga0500642_0000238 | |||
| 2623 | Ga0500655_000089 | |||
| 2624 | Ga0500658_0000147 | |||
| 2625 | Ga0500658_0007420 | |||
| 2626 | Ga0500658_0013523 | |||
| 2627 | Ga0500559_0000456 | |||
| 2628 | Ga0500559_0021181 | |||
| 2629 | Ga0500559_0042912 | |||
| 2630 | Ga0500559_0098424 | |||
| 2631 | Ga0500573_0000039 | |||
| 2632 | Ga0500585_080656 | |||
| 2633 | Ga0500590_001156 | |||
| 2634 | Ga0500604_0038234 | |||
| 2635 | Ga0500622_0102362 | |||
| 2636 | Ga0500622_0109698 | |||
| 2637 | Ga0500624_000005 | |||
| 2638 | Ga0500624_000026 | |||
| 2639 | Ga0500627_0000074 | |||
| 2640 | Ga0500627_0000248 | |||
| 2641 | Ga0500627_0167636 | |||
| 2642 | Ga0500639_121099 | |||
| 2643 | Ga0500636_0002055 | |||
| 2644 | Ga0500636_0004034 | |||
| 2645 | Ga0500570_002530 | |||
| 2646 | Ga0500645_000019 | |||
| 2647 | Ga0500645_003141 | |||
| 2648 | Ga0500645_008281 | |||
| 2649 | Ga0500645_013673 | |||
| 2650 | Ga0466962_0002921 | |||
| 2651 | Ga0466962_0112577 | |||
| 2652 | 2512645141 | |||
| 2653 | 2545677296 | |||
| 2654 | 2585264219 | |||
| 2655 | 2600203225 | |||
| 2656 | 2600226997 | |||
| 2657 | 2643728270 | |||
| 2658 | 2644040523 | |||
| 2659 | 2644042781 | |||
| 2660 | 2644127456 | |||
| 2661 | 2644395788 | |||
| 2662 | 2738711044 | |||
| 2663 | 2738746478 | |||
| 2664 | 2738849469 | |||
| 2665 | 2738865198 | |||
| 2666 | 2739297716 | |||
| 2667 | 2739355708 | |||
| 2668 | 2739359394 | |||
| 2669 | 2778125838 | |||
| 2670 | 2809063354 | |||
| 2671 | 2809079210 | |||
| 2672 | 2809083416 | |||
| 2673 | 2830076101 | |||
| 2674 | 2842701625 | |||
| 2675 | 2879163527 | |||
| 2676 | 2880520624 | |||
| 2677 | 2885432234 | |||
| 2678 | 2895885859 | |||
| 2679 | 2902333399 | |||
| 2680 | 2919139474 | |||
| 2681 | 2928029405 | |||
| 2682 | 2928103657 | |||
| 2683 | 2928529571 | |||
| 2684 | 2928961330 | |||
| 2685 | 2928970942 | |||
| 2686 | 2984556602 | |||
| 2687 | 2984565225 | |||
| 2688 | 2990267955 | |||
| 2689 | 2993356301 | |||
| 2690 | 2993697027 | |||
| 2691 | 3003667601 | |||
| 2692 | 641640733 | |||
| 2693 | 643599467 | |||
| 2694 | 8057105113 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4htg-assembly1.cif.gz_A | porphobilinogen deaminase from arabidopsis thaliana | 0.9493 | 5 | 293 |
| 1ah5-assembly1.cif.gz_A | reduced form selenomethionine-labelled hydroxymethylbilane synthase determined by mad | 0.9386 | 8 | 302 |
| 1pda-assembly1.cif.gz_A | structure of porphobilinogen deaminase reveals a flexible multidomain polymerase with a single catalytic site | 0.937 | 5 | 296 |
| 2ypn-assembly1.cif.gz_A | hydroxymethylbilane synthase | 0.9358 | 5 | 294 |
| 5h6o-assembly1.cif.gz_A | porphobilinogen deaminase from vibrio cholerae | 0.9356 | 7 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4htgA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9605 | 104 | 198 | 3.40.190.10 |
| 1ah5A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9581 | 104 | 198 | 3.40.190.10 |
| 4htgA03 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain | 0.9334 | 220 | 293 | 3.30.160.40 |
| 5h6oA03 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain | 0.9241 | 220 | 295 | 3.30.160.40 |
| af_C6TEP8_269_355_3.30.160.40 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain | 0.9193 | 220 | 300 | 3.30.160.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350KUL8-F1-model_v4 | deleted | 0.981 | 125 | 306 |
|
| AF-A0A377TL07-F1-model_v4 | Hydroxymethylbilane synthase (EC 2.5.1.61) | 0.9717 | 101 | 232 |
GO:0004418
GO:0005737 GO:0006782 |
| AF-A0A849FDB6-F1-model_v4 | Hydroxymethylbilane synthase (EC 2.5.1.61) | 0.9704 | 91 | 300 |
GO:0004418
GO:0005737 GO:0006782 |
| AF-A0A377LQF5-F1-model_v4 | Hydroxymethylbilane synthase (EC 2.5.1.61) | 0.9695 | 101 | 294 |
GO:0004418
GO:0005737 GO:0006782 |
| AF-A0A3B0RAH1-F1-model_v4 | hydroxymethylbilane synthase (EC 2.5.1.61) | 0.9656 | 6 | 249 |
GO:0004418
GO:0005737 GO:0006783 |